WO2023002415A2 - Methods and compositions for anti-cd117 antibody drug conjugate (adc) treatment - Google Patents
Methods and compositions for anti-cd117 antibody drug conjugate (adc) treatment Download PDFInfo
- Publication number
- WO2023002415A2 WO2023002415A2 PCT/IB2022/056720 IB2022056720W WO2023002415A2 WO 2023002415 A2 WO2023002415 A2 WO 2023002415A2 IB 2022056720 W IB2022056720 W IB 2022056720W WO 2023002415 A2 WO2023002415 A2 WO 2023002415A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- therapeutic
- human subject
- sample
- receptor occupancy
- Prior art date
Links
- 238000000034 method Methods 0.000 title claims abstract description 199
- 239000000611 antibody drug conjugate Substances 0.000 title claims abstract description 133
- 229940049595 antibody-drug conjugate Drugs 0.000 title claims abstract description 133
- 239000000203 mixture Substances 0.000 title description 45
- 238000011282 treatment Methods 0.000 title description 16
- 230000001225 therapeutic effect Effects 0.000 claims description 219
- 230000027455 binding Effects 0.000 claims description 181
- 210000004027 cell Anatomy 0.000 claims description 170
- 239000012634 fragment Substances 0.000 claims description 164
- 239000000427 antigen Substances 0.000 claims description 160
- 108091007433 antigens Proteins 0.000 claims description 160
- 102000036639 antigens Human genes 0.000 claims description 160
- 125000005647 linker group Chemical group 0.000 claims description 153
- 108020003175 receptors Proteins 0.000 claims description 133
- 238000003556 assay Methods 0.000 claims description 130
- -1 cyano, hydroxy, mercapto Chemical class 0.000 claims description 96
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 80
- 125000001424 substituent group Chemical group 0.000 claims description 73
- 125000000217 alkyl group Chemical group 0.000 claims description 72
- 239000003795 chemical substances by application Substances 0.000 claims description 62
- 210000003958 hematopoietic stem cell Anatomy 0.000 claims description 58
- 231100000729 Amatoxin Toxicity 0.000 claims description 49
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 49
- 239000000126 substance Substances 0.000 claims description 41
- WVHGJJRMKGDTEC-WCIJHFMNSA-N 2-[(1R,4S,8R,10S,13S,16S,27R,34S)-34-[(2S)-butan-2-yl]-8,22-dihydroxy-13-[(2R,3S)-3-hydroxybutan-2-yl]-2,5,11,14,27,30,33,36,39-nonaoxo-27lambda4-thia-3,6,12,15,25,29,32,35,38-nonazapentacyclo[14.12.11.06,10.018,26.019,24]nonatriaconta-18(26),19(24),20,22-tetraen-4-yl]acetamide Chemical compound CC[C@H](C)[C@@H]1NC(=O)CNC(=O)[C@@H]2Cc3c([nH]c4cc(O)ccc34)[S@](=O)C[C@H](NC(=O)CNC1=O)C(=O)N[C@@H](CC(N)=O)C(=O)N1C[C@H](O)C[C@H]1C(=O)N[C@@H]([C@@H](C)[C@H](C)O)C(=O)N2 WVHGJJRMKGDTEC-WCIJHFMNSA-N 0.000 claims description 40
- 108010004729 Phycoerythrin Proteins 0.000 claims description 39
- 108010014709 amatoxin Proteins 0.000 claims description 39
- 206010028980 Neoplasm Diseases 0.000 claims description 34
- 125000001072 heteroaryl group Chemical group 0.000 claims description 32
- 230000002860 competitive effect Effects 0.000 claims description 30
- 125000000592 heterocycloalkyl group Chemical group 0.000 claims description 29
- 201000011510 cancer Diseases 0.000 claims description 28
- 210000004369 blood Anatomy 0.000 claims description 26
- 239000008280 blood Substances 0.000 claims description 26
- 125000003118 aryl group Chemical group 0.000 claims description 25
- 229910052717 sulfur Inorganic materials 0.000 claims description 23
- 230000003750 conditioning effect Effects 0.000 claims description 22
- 210000000130 stem cell Anatomy 0.000 claims description 22
- 150000003839 salts Chemical class 0.000 claims description 21
- 125000005842 heteroatom Chemical group 0.000 claims description 20
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 20
- 208000035475 disorder Diseases 0.000 claims description 19
- OAKJQQAXSVQMHS-UHFFFAOYSA-N Hydrazine Chemical compound NN OAKJQQAXSVQMHS-UHFFFAOYSA-N 0.000 claims description 18
- 208000031261 Acute myeloid leukaemia Diseases 0.000 claims description 17
- 125000000304 alkynyl group Chemical group 0.000 claims description 17
- 238000000684 flow cytometry Methods 0.000 claims description 16
- 125000002887 hydroxy group Chemical group [H]O* 0.000 claims description 16
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 claims description 15
- 125000004450 alkenylene group Chemical group 0.000 claims description 15
- 125000000732 arylene group Chemical group 0.000 claims description 15
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 claims description 15
- 125000000753 cycloalkyl group Chemical group 0.000 claims description 15
- 125000006588 heterocycloalkylene group Chemical group 0.000 claims description 15
- 125000003396 thiol group Chemical group [H]S* 0.000 claims description 15
- 125000003342 alkenyl group Chemical group 0.000 claims description 14
- 125000004419 alkynylene group Chemical group 0.000 claims description 14
- 238000005859 coupling reaction Methods 0.000 claims description 14
- 125000004474 heteroalkylene group Chemical group 0.000 claims description 14
- 125000005549 heteroarylene group Chemical group 0.000 claims description 14
- 125000003161 (C1-C6) alkylene group Chemical group 0.000 claims description 13
- 125000002993 cycloalkylene group Chemical group 0.000 claims description 13
- 208000032839 leukemia Diseases 0.000 claims description 13
- 229910052760 oxygen Inorganic materials 0.000 claims description 13
- 208000023275 Autoimmune disease Diseases 0.000 claims description 11
- 125000000475 sulfinyl group Chemical group [*:2]S([*:1])=O 0.000 claims description 11
- 125000002252 acyl group Chemical group 0.000 claims description 10
- 230000002489 hematologic effect Effects 0.000 claims description 10
- 108010004469 allophycocyanin Proteins 0.000 claims description 9
- 229910052757 nitrogen Inorganic materials 0.000 claims description 9
- 125000002877 alkyl aryl group Chemical group 0.000 claims description 8
- 210000001185 bone marrow Anatomy 0.000 claims description 8
- FTJHKZQHQDKPFJ-UHFFFAOYSA-N (carbamoylamino)carbamic acid Chemical compound NC(=O)NNC(O)=O FTJHKZQHQDKPFJ-UHFFFAOYSA-N 0.000 claims description 7
- 101100454807 Caenorhabditis elegans lgg-1 gene Proteins 0.000 claims description 7
- 125000004442 acylamino group Chemical group 0.000 claims description 7
- 125000004423 acyloxy group Chemical group 0.000 claims description 7
- 125000003545 alkoxy group Chemical group 0.000 claims description 7
- 125000004453 alkoxycarbonyl group Chemical group 0.000 claims description 7
- 125000005213 alkyl heteroaryl group Chemical group 0.000 claims description 7
- 125000003917 carbamoyl group Chemical group [H]N([H])C(*)=O 0.000 claims description 7
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 claims description 7
- 230000000779 depleting effect Effects 0.000 claims description 7
- 230000002708 enhancing effect Effects 0.000 claims description 7
- 229910052736 halogen Inorganic materials 0.000 claims description 7
- 150000002367 halogens Chemical class 0.000 claims description 7
- 125000000449 nitro group Chemical group [O-][N+](*)=O 0.000 claims description 7
- 125000000472 sulfonyl group Chemical group *S(*)(=O)=O 0.000 claims description 7
- 125000004953 trihalomethyl group Chemical group 0.000 claims description 7
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 claims description 6
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 claims description 6
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 claims description 6
- 230000000735 allogeneic effect Effects 0.000 claims description 6
- 230000008901 benefit Effects 0.000 claims description 6
- 239000007850 fluorescent dye Substances 0.000 claims description 6
- 201000003793 Myelodysplastic syndrome Diseases 0.000 claims description 5
- 102000004190 Enzymes Human genes 0.000 claims description 4
- 108090000790 Enzymes Proteins 0.000 claims description 4
- 239000012099 Alexa Fluor family Substances 0.000 claims description 3
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 claims description 3
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 claims description 3
- 210000003969 blast cell Anatomy 0.000 claims description 3
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 claims description 3
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 claims description 3
- 210000003995 blood forming stem cell Anatomy 0.000 claims 3
- 101001105486 Homo sapiens Proteasome subunit alpha type-7 Proteins 0.000 claims 1
- 102100021201 Proteasome subunit alpha type-7 Human genes 0.000 claims 1
- 238000012292 receptor occupancy assay Methods 0.000 abstract description 14
- 102000005962 receptors Human genes 0.000 description 106
- 239000000523 sample Substances 0.000 description 79
- 231100000599 cytotoxic agent Toxicity 0.000 description 53
- 239000002619 cytotoxin Substances 0.000 description 50
- 125000000325 methylidene group Chemical group [H]C([H])=* 0.000 description 50
- 239000003814 drug Substances 0.000 description 43
- 150000001875 compounds Chemical class 0.000 description 39
- 101710112752 Cytotoxin Proteins 0.000 description 38
- 229940079593 drug Drugs 0.000 description 34
- 235000001014 amino acid Nutrition 0.000 description 33
- 230000021615 conjugation Effects 0.000 description 32
- 201000010099 disease Diseases 0.000 description 30
- 239000000562 conjugate Substances 0.000 description 29
- 150000001413 amino acids Chemical class 0.000 description 20
- 125000004432 carbon atom Chemical group C* 0.000 description 18
- 238000006243 chemical reaction Methods 0.000 description 18
- 238000002560 therapeutic procedure Methods 0.000 description 18
- 230000015572 biosynthetic process Effects 0.000 description 17
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 description 15
- 230000035772 mutation Effects 0.000 description 15
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 14
- 239000003153 chemical reaction reagent Substances 0.000 description 13
- 150000003573 thiols Chemical class 0.000 description 13
- 150000001412 amines Chemical class 0.000 description 12
- 229940045799 anthracyclines and related substance Drugs 0.000 description 12
- 108090000623 proteins and genes Proteins 0.000 description 12
- 108010016626 Dipeptides Proteins 0.000 description 11
- 210000001772 blood platelet Anatomy 0.000 description 11
- 238000005755 formation reaction Methods 0.000 description 11
- 102000039446 nucleic acids Human genes 0.000 description 11
- 108020004707 nucleic acids Proteins 0.000 description 11
- 150000007523 nucleic acids Chemical class 0.000 description 11
- 230000000269 nucleophilic effect Effects 0.000 description 11
- QWPXBEHQFHACTK-KZVYIGENSA-N (10e,12e)-86-chloro-12,14,4-trihydroxy-85,14-dimethoxy-33,2,7,10-tetramethyl-15,16-dihydro-14h-7-aza-1(6,4)-oxazina-3(2,3)-oxirana-8(1,3)-benzenacyclotetradecaphane-10,12-dien-6-one Chemical compound CN1C(=O)CC(O)C2(C)OC2C(C)C(OC(=O)N2)CC2(O)C(OC)\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 QWPXBEHQFHACTK-KZVYIGENSA-N 0.000 description 10
- 125000006716 (C1-C6) heteroalkyl group Chemical group 0.000 description 10
- 125000000882 C2-C6 alkenyl group Chemical group 0.000 description 10
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 10
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 10
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 10
- 230000001472 cytotoxic effect Effects 0.000 description 10
- 108060003951 Immunoglobulin Proteins 0.000 description 9
- 231100000433 cytotoxic Toxicity 0.000 description 9
- 230000006870 function Effects 0.000 description 9
- 102000018358 immunoglobulin Human genes 0.000 description 9
- 102000004196 processed proteins & peptides Human genes 0.000 description 9
- 235000018102 proteins Nutrition 0.000 description 9
- 102000004169 proteins and genes Human genes 0.000 description 9
- 239000012453 solvate Substances 0.000 description 9
- 238000004458 analytical method Methods 0.000 description 8
- 229910052799 carbon Inorganic materials 0.000 description 8
- 238000001514 detection method Methods 0.000 description 8
- 125000000524 functional group Chemical group 0.000 description 8
- DJQYYYCQOZMCRC-UHFFFAOYSA-N 2-aminopropane-1,3-dithiol Chemical group SCC(N)CS DJQYYYCQOZMCRC-UHFFFAOYSA-N 0.000 description 7
- 125000003601 C2-C6 alkynyl group Chemical group 0.000 description 7
- 108020004414 DNA Proteins 0.000 description 7
- 102000029749 Microtubule Human genes 0.000 description 7
- 108091022875 Microtubule Proteins 0.000 description 7
- 230000029936 alkylation Effects 0.000 description 7
- 238000005804 alkylation reaction Methods 0.000 description 7
- 125000003710 aryl alkyl group Chemical group 0.000 description 7
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 7
- 238000003776 cleavage reaction Methods 0.000 description 7
- 229940127089 cytotoxic agent Drugs 0.000 description 7
- 210000003743 erythrocyte Anatomy 0.000 description 7
- 125000002485 formyl group Chemical class [H]C(*)=O 0.000 description 7
- 125000000623 heterocyclic group Chemical group 0.000 description 7
- 229940127121 immunoconjugate Drugs 0.000 description 7
- 235000018977 lysine Nutrition 0.000 description 7
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 7
- 210000004688 microtubule Anatomy 0.000 description 7
- YUOCYTRGANSSRY-UHFFFAOYSA-N pyrrolo[2,3-i][1,2]benzodiazepine Chemical compound C1=CN=NC2=C3C=CN=C3C=CC2=C1 YUOCYTRGANSSRY-UHFFFAOYSA-N 0.000 description 7
- 230000007017 scission Effects 0.000 description 7
- 229940124597 therapeutic agent Drugs 0.000 description 7
- 210000001519 tissue Anatomy 0.000 description 7
- VRDGQQTWSGDXCU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-iodoacetate Chemical compound ICC(=O)ON1C(=O)CCC1=O VRDGQQTWSGDXCU-UHFFFAOYSA-N 0.000 description 6
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 6
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 6
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 6
- 239000004472 Lysine Substances 0.000 description 6
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 6
- QWPXBEHQFHACTK-UHFFFAOYSA-N Maytansinol Natural products CN1C(=O)CC(O)C2(C)OC2C(C)C(OC(=O)N2)CC2(O)C(OC)C=CC=C(C)CC2=CC(OC)=C(Cl)C1=C2 QWPXBEHQFHACTK-UHFFFAOYSA-N 0.000 description 6
- 206010035226 Plasma cell myeloma Diseases 0.000 description 6
- RWRDLPDLKQPQOW-UHFFFAOYSA-N Pyrrolidine Chemical group C1CCNC1 RWRDLPDLKQPQOW-UHFFFAOYSA-N 0.000 description 6
- 210000001744 T-lymphocyte Anatomy 0.000 description 6
- 125000003277 amino group Chemical group 0.000 description 6
- 108010044540 auristatin Proteins 0.000 description 6
- 210000000601 blood cell Anatomy 0.000 description 6
- 239000000306 component Substances 0.000 description 6
- 125000000392 cycloalkenyl group Chemical group 0.000 description 6
- 235000018417 cysteine Nutrition 0.000 description 6
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Chemical group SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 6
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 6
- 239000002254 cytotoxic agent Substances 0.000 description 6
- 230000002950 deficient Effects 0.000 description 6
- 229960004679 doxorubicin Drugs 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 6
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Chemical group C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 6
- 230000003834 intracellular effect Effects 0.000 description 6
- 230000000670 limiting effect Effects 0.000 description 6
- 238000004519 manufacturing process Methods 0.000 description 6
- 230000004048 modification Effects 0.000 description 6
- 238000012986 modification Methods 0.000 description 6
- 210000001616 monocyte Anatomy 0.000 description 6
- 201000006417 multiple sclerosis Diseases 0.000 description 6
- 230000007170 pathology Effects 0.000 description 6
- 238000002360 preparation method Methods 0.000 description 6
- 208000007056 sickle cell anemia Diseases 0.000 description 6
- 239000002904 solvent Substances 0.000 description 6
- 238000006467 substitution reaction Methods 0.000 description 6
- 238000003786 synthesis reaction Methods 0.000 description 6
- 239000013598 vector Substances 0.000 description 6
- AGGWFDNPHKLBBV-YUMQZZPRSA-N (2s)-2-[[(2s)-2-amino-3-methylbutanoyl]amino]-5-(carbamoylamino)pentanoic acid Chemical compound CC(C)[C@H](N)C(=O)N[C@H](C(O)=O)CCCNC(N)=O AGGWFDNPHKLBBV-YUMQZZPRSA-N 0.000 description 5
- 125000004400 (C1-C12) alkyl group Chemical group 0.000 description 5
- 239000004698 Polyethylene Substances 0.000 description 5
- 239000011230 binding agent Substances 0.000 description 5
- 229930195731 calicheamicin Natural products 0.000 description 5
- 150000001721 carbon Chemical group 0.000 description 5
- 230000001419 dependent effect Effects 0.000 description 5
- 239000012636 effector Substances 0.000 description 5
- 150000002148 esters Chemical class 0.000 description 5
- 125000001188 haloalkyl group Chemical group 0.000 description 5
- 229910052739 hydrogen Inorganic materials 0.000 description 5
- 230000007062 hydrolysis Effects 0.000 description 5
- 238000006460 hydrolysis reaction Methods 0.000 description 5
- 239000003112 inhibitor Substances 0.000 description 5
- 229910052698 phosphorus Inorganic materials 0.000 description 5
- 229920001184 polypeptide Polymers 0.000 description 5
- 150000003254 radicals Chemical class 0.000 description 5
- 230000002829 reductive effect Effects 0.000 description 5
- 238000003860 storage Methods 0.000 description 5
- 125000003107 substituted aryl group Chemical group 0.000 description 5
- 125000004434 sulfur atom Chemical group 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- 208000011580 syndromic disease Diseases 0.000 description 5
- ALBODLTZUXKBGZ-JUUVMNCLSA-N (2s)-2-amino-3-phenylpropanoic acid;(2s)-2,6-diaminohexanoic acid Chemical compound NCCCC[C@H](N)C(O)=O.OC(=O)[C@@H](N)CC1=CC=CC=C1 ALBODLTZUXKBGZ-JUUVMNCLSA-N 0.000 description 4
- 125000005913 (C3-C6) cycloalkyl group Chemical group 0.000 description 4
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 4
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 206010053138 Congenital aplastic anaemia Diseases 0.000 description 4
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 4
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 4
- 229930126263 Maytansine Natural products 0.000 description 4
- 201000011442 Metachromatic leukodystrophy Diseases 0.000 description 4
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 4
- 108091005804 Peptidases Proteins 0.000 description 4
- GLUUGHFHXGJENI-UHFFFAOYSA-N Piperazine Chemical group C1CNCCN1 GLUUGHFHXGJENI-UHFFFAOYSA-N 0.000 description 4
- KAESVJOAVNADME-UHFFFAOYSA-N Pyrrole Chemical group C=1C=CNC=1 KAESVJOAVNADME-UHFFFAOYSA-N 0.000 description 4
- YTPLMLYBLZKORZ-UHFFFAOYSA-N Thiophene Chemical group C=1C=CSC=1 YTPLMLYBLZKORZ-UHFFFAOYSA-N 0.000 description 4
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 4
- CHKFLBOLYREYDO-SHYZEUOFSA-N [[(2s,4r,5r)-5-(4-amino-2-oxopyrimidin-1-yl)-4-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)C[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 CHKFLBOLYREYDO-SHYZEUOFSA-N 0.000 description 4
- 150000001450 anions Chemical class 0.000 description 4
- 125000004429 atom Chemical group 0.000 description 4
- 230000001363 autoimmune Effects 0.000 description 4
- 210000003719 b-lymphocyte Anatomy 0.000 description 4
- 210000003651 basophil Anatomy 0.000 description 4
- 230000009286 beneficial effect Effects 0.000 description 4
- 239000011203 carbon fibre reinforced carbon Substances 0.000 description 4
- 229960002173 citrulline Drugs 0.000 description 4
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 4
- 210000004443 dendritic cell Anatomy 0.000 description 4
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 4
- 210000003979 eosinophil Anatomy 0.000 description 4
- 210000003714 granulocyte Anatomy 0.000 description 4
- 125000004404 heteroalkyl group Chemical group 0.000 description 4
- 125000004446 heteroarylalkyl group Chemical group 0.000 description 4
- 239000001257 hydrogen Substances 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- 210000003292 kidney cell Anatomy 0.000 description 4
- 210000004698 lymphocyte Anatomy 0.000 description 4
- 210000002540 macrophage Anatomy 0.000 description 4
- WKPWGQKGSOKKOO-RSFHAFMBSA-N maytansine Chemical compound CO[C@@H]([C@@]1(O)C[C@](OC(=O)N1)([C@H]([C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(C)=O)CC(=O)N1C)C)[H])\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 WKPWGQKGSOKKOO-RSFHAFMBSA-N 0.000 description 4
- 210000003593 megakaryocyte Anatomy 0.000 description 4
- 125000002950 monocyclic group Chemical group 0.000 description 4
- 210000000822 natural killer cell Anatomy 0.000 description 4
- 210000000440 neutrophil Anatomy 0.000 description 4
- 230000036963 noncompetitive effect Effects 0.000 description 4
- 210000002997 osteoclast Anatomy 0.000 description 4
- 125000004430 oxygen atom Chemical group O* 0.000 description 4
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 238000003127 radioimmunoassay Methods 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 206010039073 rheumatoid arthritis Diseases 0.000 description 4
- 238000009738 saturating Methods 0.000 description 4
- 125000005346 substituted cycloalkyl group Chemical group 0.000 description 4
- 230000002459 sustained effect Effects 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- AXKGIPZJYUNAIW-UHFFFAOYSA-N (4-aminophenyl)methanol Chemical compound NC1=CC=C(CO)C=C1 AXKGIPZJYUNAIW-UHFFFAOYSA-N 0.000 description 3
- 125000001494 2-propynyl group Chemical group [H]C#CC([H])([H])* 0.000 description 3
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 3
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 3
- 239000012114 Alexa Fluor 647 Substances 0.000 description 3
- 208000032467 Aplastic anaemia Diseases 0.000 description 3
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 3
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical group [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 3
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 3
- 206010009900 Colitis ulcerative Diseases 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- YLQBMQCUIZJEEH-UHFFFAOYSA-N Furan Chemical group C=1C=COC=1 YLQBMQCUIZJEEH-UHFFFAOYSA-N 0.000 description 3
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 3
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 3
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 3
- SIKJAQJRHWYJAI-UHFFFAOYSA-N Indole Chemical group C1=CC=C2NC=CC2=C1 SIKJAQJRHWYJAI-UHFFFAOYSA-N 0.000 description 3
- 208000003456 Juvenile Arthritis Diseases 0.000 description 3
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 description 3
- 208000031671 Large B-Cell Diffuse Lymphoma Diseases 0.000 description 3
- 206010025323 Lymphomas Diseases 0.000 description 3
- 208000034578 Multiple myelomas Diseases 0.000 description 3
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 3
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 3
- 206010039710 Scleroderma Diseases 0.000 description 3
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 3
- 201000006704 Ulcerative Colitis Diseases 0.000 description 3
- JKHXYJKMNSSFFL-IUCAKERBSA-N Val-Lys Chemical compound CC(C)[C@H](N)C(=O)N[C@H](C(O)=O)CCCCN JKHXYJKMNSSFFL-IUCAKERBSA-N 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- 150000001345 alkine derivatives Chemical class 0.000 description 3
- 125000002947 alkylene group Chemical group 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 150000001540 azides Chemical class 0.000 description 3
- 125000000852 azido group Chemical group *N=[N+]=[N-] 0.000 description 3
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 229910052801 chlorine Inorganic materials 0.000 description 3
- 238000012875 competitive assay Methods 0.000 description 3
- 239000013078 crystal Substances 0.000 description 3
- 230000006378 damage Effects 0.000 description 3
- 150000001993 dienes Chemical class 0.000 description 3
- 206010012818 diffuse large B-cell lymphoma Diseases 0.000 description 3
- 239000012039 electrophile Substances 0.000 description 3
- 230000007071 enzymatic hydrolysis Effects 0.000 description 3
- 238000006047 enzymatic hydrolysis reaction Methods 0.000 description 3
- 229940088598 enzyme Drugs 0.000 description 3
- 229910052731 fluorine Inorganic materials 0.000 description 3
- 230000003394 haemopoietic effect Effects 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 238000011068 loading method Methods 0.000 description 3
- 238000013507 mapping Methods 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- ANZJBCHSOXCCRQ-FKUXLPTCSA-N mertansine Chemical compound CO[C@@H]([C@@]1(O)C[C@H](OC(=O)N1)[C@@H](C)[C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(=O)CCS)CC(=O)N1C)\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 ANZJBCHSOXCCRQ-FKUXLPTCSA-N 0.000 description 3
- 210000000274 microglia Anatomy 0.000 description 3
- 201000000050 myeloid neoplasm Diseases 0.000 description 3
- 239000013642 negative control Substances 0.000 description 3
- 239000012038 nucleophile Substances 0.000 description 3
- 230000003287 optical effect Effects 0.000 description 3
- 210000005259 peripheral blood Anatomy 0.000 description 3
- 239000011886 peripheral blood Substances 0.000 description 3
- 238000000159 protein binding assay Methods 0.000 description 3
- 125000000714 pyrimidinyl group Chemical group 0.000 description 3
- 238000010188 recombinant method Methods 0.000 description 3
- 208000002491 severe combined immunodeficiency Diseases 0.000 description 3
- 125000005017 substituted alkenyl group Chemical group 0.000 description 3
- 125000000547 substituted alkyl group Chemical group 0.000 description 3
- 125000004426 substituted alkynyl group Chemical group 0.000 description 3
- 150000003568 thioethers Chemical class 0.000 description 3
- 238000002054 transplantation Methods 0.000 description 3
- 108010073969 valyllysine Proteins 0.000 description 3
- 238000003260 vortexing Methods 0.000 description 3
- FLCQLSRLQIPNLM-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-acetylsulfanylacetate Chemical compound CC(=O)SCC(=O)ON1C(=O)CCC1=O FLCQLSRLQIPNLM-UHFFFAOYSA-N 0.000 description 2
- JSHOVKSMJRQOGY-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-(pyridin-2-yldisulfanyl)butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCSSC1=CC=CC=N1 JSHOVKSMJRQOGY-UHFFFAOYSA-N 0.000 description 2
- GKSPIZSKQWTXQG-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[1-(pyridin-2-yldisulfanyl)ethyl]benzoate Chemical compound C=1C=C(C(=O)ON2C(CCC2=O)=O)C=CC=1C(C)SSC1=CC=CC=N1 GKSPIZSKQWTXQG-UHFFFAOYSA-N 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical group OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- VEGGTWZUZGZKHY-GJZGRUSLSA-N (2s)-2-[[(2s)-2-amino-3-methylbutanoyl]amino]-5-(carbamoylamino)-n-[4-(hydroxymethyl)phenyl]pentanamide Chemical compound NC(=O)NCCC[C@H](NC(=O)[C@@H](N)C(C)C)C(=O)NC1=CC=C(CO)C=C1 VEGGTWZUZGZKHY-GJZGRUSLSA-N 0.000 description 2
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 2
- 125000004178 (C1-C4) alkyl group Chemical group 0.000 description 2
- DIYPCWKHSODVAP-UHFFFAOYSA-N 1-[3-(2,5-dioxopyrrol-1-yl)benzoyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1=CC=CC(N2C(C=CC2=O)=O)=C1 DIYPCWKHSODVAP-UHFFFAOYSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- BOHCOUQZNDPURZ-ICNZIKDASA-N 2-[(1R,4S,8R,10S,13S,16S,27R,34S)-34-[(2S)-butan-2-yl]-13-[(2R,3R)-3,4-dihydroxybutan-2-yl]-8-hydroxy-2,5,11,14,27,30,33,36,39-nonaoxo-27lambda4-thia-3,6,12,15,25,29,32,35,38-nonazapentacyclo[14.12.11.06,10.018,26.019,24]nonatriaconta-18(26),19,21,23-tetraen-4-yl]acetamide Chemical compound CC[C@H](C)[C@@H]1NC(=O)CNC(=O)[C@@H]2Cc3c([nH]c4ccccc34)[S@](=O)C[C@H](NC(=O)CNC1=O)C(=O)N[C@@H](CC(N)=O)C(=O)N1C[C@H](O)C[C@H]1C(=O)N[C@@H]([C@@H](C)[C@@H](O)CO)C(=O)N2 BOHCOUQZNDPURZ-ICNZIKDASA-N 0.000 description 2
- 102100033051 40S ribosomal protein S19 Human genes 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- UJOBWOGCFQCDNV-UHFFFAOYSA-N 9H-carbazole Chemical compound C1=CC=C2C3=CC=CC=C3NC2=C1 UJOBWOGCFQCDNV-UHFFFAOYSA-N 0.000 description 2
- 208000030507 AIDS Diseases 0.000 description 2
- 206010000830 Acute leukaemia Diseases 0.000 description 2
- 235000001674 Agaricus brunnescens Nutrition 0.000 description 2
- QCZXQEYEVLCQHL-UHFFFAOYSA-N Amanin Natural products O=C1NC(CC(O)=O)C(=O)N2CC(O)CC2C(=O)NC(C(C)C(O)CO)C(=O)NC(C2)C(=O)NCC(=O)NC(C(C)CC)C(=O)NCC(=O)NC1CS(=O)C1=C2C2=CC=CC=C2N1 QCZXQEYEVLCQHL-UHFFFAOYSA-N 0.000 description 2
- 241000948470 Amanita phalloides Species 0.000 description 2
- 208000003343 Antiphospholipid Syndrome Diseases 0.000 description 2
- 208000000659 Autoimmune lymphoproliferative syndrome Diseases 0.000 description 2
- 208000028564 B-cell non-Hodgkin lymphoma Diseases 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 208000033932 Blackfan-Diamond anemia Diseases 0.000 description 2
- 108010006654 Bleomycin Proteins 0.000 description 2
- 208000019838 Blood disease Diseases 0.000 description 2
- 206010006187 Breast cancer Diseases 0.000 description 2
- LDZJNMJIPNOYGA-UHFFFAOYSA-N C1=C(OC(C)=O)C(OC)=CC=C1C1=C2C3=CC(OC)=C(OC(C)=O)C=C3C=CN2C2=C1C(C=C(OC)C(OC(C)=O)=C1)=C1OC2=O Chemical compound C1=C(OC(C)=O)C(OC)=CC=C1C1=C2C3=CC(OC)=C(OC(C)=O)C=C3C=CN2C2=C1C(C=C(OC)C(OC(C)=O)=C1)=C1OC2=O LDZJNMJIPNOYGA-UHFFFAOYSA-N 0.000 description 2
- 239000004215 Carbon black (E152) Substances 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 241000699802 Cricetulus griseus Species 0.000 description 2
- 208000011231 Crohn disease Diseases 0.000 description 2
- 201000004449 Diamond-Blackfan anemia Diseases 0.000 description 2
- 238000006117 Diels-Alder cycloaddition reaction Methods 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- 230000010777 Disulfide Reduction Effects 0.000 description 2
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 2
- QUSNBJAOOMFDIB-UHFFFAOYSA-N Ethylamine Chemical compound CCN QUSNBJAOOMFDIB-UHFFFAOYSA-N 0.000 description 2
- 201000004939 Fanconi anemia Diseases 0.000 description 2
- 208000001640 Fibromyalgia Diseases 0.000 description 2
- 208000015872 Gaucher disease Diseases 0.000 description 2
- 208000007465 Giant cell arteritis Diseases 0.000 description 2
- HQRHFUYMGCHHJS-LURJTMIESA-N Gly-Gly-Arg Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CCCN=C(N)N HQRHFUYMGCHHJS-LURJTMIESA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102100039619 Granulocyte colony-stimulating factor Human genes 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- 208000035895 Guillain-Barré syndrome Diseases 0.000 description 2
- 208000035186 Hemolytic Autoimmune Anemia Diseases 0.000 description 2
- 238000006736 Huisgen cycloaddition reaction Methods 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 2
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical group SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- RHGKLRLOHDJJDR-BYPYZUCNSA-N L-citrulline Chemical compound NC(=O)NCCC[C@H]([NH3+])C([O-])=O RHGKLRLOHDJJDR-BYPYZUCNSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical group C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- 208000035809 Lymphohistiocytosis Diseases 0.000 description 2
- 206010049567 Miller Fisher syndrome Diseases 0.000 description 2
- 208000003250 Mixed connective tissue disease Diseases 0.000 description 2
- YNAVUWVOSKDBBP-UHFFFAOYSA-N Morpholine Chemical group C1COCCN1 YNAVUWVOSKDBBP-UHFFFAOYSA-N 0.000 description 2
- 208000002678 Mucopolysaccharidoses Diseases 0.000 description 2
- 206010056886 Mucopolysaccharidosis I Diseases 0.000 description 2
- RHGKLRLOHDJJDR-UHFFFAOYSA-N Ndelta-carbamoyl-DL-ornithine Natural products OC(=O)C(N)CCCNC(N)=O RHGKLRLOHDJJDR-UHFFFAOYSA-N 0.000 description 2
- 206010029260 Neuroblastoma Diseases 0.000 description 2
- 208000005225 Opsoclonus-Myoclonus Syndrome Diseases 0.000 description 2
- 206010031243 Osteogenesis imperfecta Diseases 0.000 description 2
- 229930012538 Paclitaxel Natural products 0.000 description 2
- 206010034277 Pemphigoid Diseases 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical group C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 108010014608 Proto-Oncogene Proteins c-kit Proteins 0.000 description 2
- 102000016971 Proto-Oncogene Proteins c-kit Human genes 0.000 description 2
- WTKZEGDFNFYCGP-UHFFFAOYSA-N Pyrazole Chemical group C=1C=NNC=1 WTKZEGDFNFYCGP-UHFFFAOYSA-N 0.000 description 2
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical group C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 2
- 229940122277 RNA polymerase inhibitor Drugs 0.000 description 2
- 108010084592 Saporins Proteins 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 201000004283 Shwachman-Diamond syndrome Diseases 0.000 description 2
- 208000010346 Sphingolipidoses Diseases 0.000 description 2
- 201000001307 Sphingolipidosis Diseases 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 2
- 201000009594 Systemic Scleroderma Diseases 0.000 description 2
- 206010042953 Systemic sclerosis Diseases 0.000 description 2
- WYURNTSHIVDZCO-UHFFFAOYSA-N Tetrahydrofuran Chemical group C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 2
- 206010043391 Thalassaemia beta Diseases 0.000 description 2
- 208000002903 Thalassemia Diseases 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Chemical group CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Chemical group 0.000 description 2
- DTQVDTLACAAQTR-UHFFFAOYSA-M Trifluoroacetate Chemical compound [O-]C(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-M 0.000 description 2
- 102000007537 Type II DNA Topoisomerases Human genes 0.000 description 2
- 108010046308 Type II DNA Topoisomerases Proteins 0.000 description 2
- HSRXSKHRSXRCFC-WDSKDSINSA-N Val-Ala Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C)C(O)=O HSRXSKHRSXRCFC-WDSKDSINSA-N 0.000 description 2
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 2
- 229940122803 Vinca alkaloid Drugs 0.000 description 2
- 208000006110 Wiskott-Aldrich syndrome Diseases 0.000 description 2
- 239000000370 acceptor Substances 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 208000002552 acute disseminated encephalomyelitis Diseases 0.000 description 2
- 230000002776 aggregation Effects 0.000 description 2
- 238000004220 aggregation Methods 0.000 description 2
- QCZXQEYEVLCQHL-MIBTZWEZSA-N amanin Chemical compound O=C1N[C@@H](CC(O)=O)C(=O)N2C[C@H](O)C[C@H]2C(=O)N[C@@H]([C@@H](C)[C@@H](O)CO)C(=O)N[C@@H](C2)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@H]1CS(=O)C1=C2C2=CC=CC=C2N1 QCZXQEYEVLCQHL-MIBTZWEZSA-N 0.000 description 2
- 108010004258 amaninamide Proteins 0.000 description 2
- BOHCOUQZNDPURZ-UHFFFAOYSA-N amaninamide Natural products O=C1NC(CC(N)=O)C(=O)N2CC(O)CC2C(=O)NC(C(C)C(O)CO)C(=O)NC(C2)C(=O)NCC(=O)NC(C(C)CC)C(=O)NCC(=O)NC1CS(=O)C1=C2C2=CC=CC=C2N1 BOHCOUQZNDPURZ-UHFFFAOYSA-N 0.000 description 2
- QQLVIKWYAVVKKF-XYDKGUIVSA-N amanullin Chemical compound O=C1N[C@@H](CC(N)=O)C(=O)N2C[C@H](O)C[C@H]2C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C2)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@H]1CS(=O)C1=C2C2=CC=C(O)C=C2N1 QQLVIKWYAVVKKF-XYDKGUIVSA-N 0.000 description 2
- HFENEIQMWRYNGK-XYDKGUIVSA-N amanullinic acid Chemical compound O=C1N[C@@H](CC(O)=O)C(=O)N2C[C@H](O)C[C@H]2C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C2)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@H]1CS(=O)C1=C2C2=CC=C(O)C=C2N1 HFENEIQMWRYNGK-XYDKGUIVSA-N 0.000 description 2
- 230000009435 amidation Effects 0.000 description 2
- 238000007112 amidation reaction Methods 0.000 description 2
- 150000001408 amides Chemical class 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 229940125644 antibody drug Drugs 0.000 description 2
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 2
- 210000000612 antigen-presenting cell Anatomy 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- 208000027625 autoimmune inner ear disease Diseases 0.000 description 2
- 208000036556 autosomal recessive T cell-negative B cell-negative NK cell-negative due to adenosine deaminase deficiency severe combined immunodeficiency Diseases 0.000 description 2
- HONIICLYMWZJFZ-UHFFFAOYSA-N azetidine Chemical compound C1CNC1 HONIICLYMWZJFZ-UHFFFAOYSA-N 0.000 description 2
- 125000004069 aziridinyl group Chemical group 0.000 description 2
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 2
- WGQKYBSKWIADBV-UHFFFAOYSA-N benzylamine Chemical compound NCC1=CC=CC=C1 WGQKYBSKWIADBV-UHFFFAOYSA-N 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 125000002619 bicyclic group Chemical group 0.000 description 2
- 238000004820 blood count Methods 0.000 description 2
- 238000010322 bone marrow transplantation Methods 0.000 description 2
- AOJDZKCUAATBGE-UHFFFAOYSA-N bromomethane Chemical compound Br[CH2] AOJDZKCUAATBGE-UHFFFAOYSA-N 0.000 description 2
- HQABUPZFAYXKJW-UHFFFAOYSA-N butan-1-amine Chemical compound CCCCN HQABUPZFAYXKJW-UHFFFAOYSA-N 0.000 description 2
- 125000000837 carbohydrate group Chemical group 0.000 description 2
- CREMABGTGYGIQB-UHFFFAOYSA-N carbon carbon Chemical compound C.C CREMABGTGYGIQB-UHFFFAOYSA-N 0.000 description 2
- 150000001728 carbonyl compounds Chemical class 0.000 description 2
- 150000001768 cations Chemical class 0.000 description 2
- 230000030833 cell death Effects 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- NQGMIPUYCWIEAW-OVCLIPMQSA-N chembl1834105 Chemical compound O/N=C/C1=C(SC)C(OC)=CC(C=2N=CC=CC=2)=N1 NQGMIPUYCWIEAW-OVCLIPMQSA-N 0.000 description 2
- 238000007385 chemical modification Methods 0.000 description 2
- 239000003638 chemical reducing agent Substances 0.000 description 2
- 208000019069 chronic childhood arthritis Diseases 0.000 description 2
- 210000003040 circulating cell Anatomy 0.000 description 2
- 235000013477 citrulline Nutrition 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 230000004154 complement system Effects 0.000 description 2
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 2
- 238000009833 condensation Methods 0.000 description 2
- 230000005494 condensation Effects 0.000 description 2
- 238000006352 cycloaddition reaction Methods 0.000 description 2
- 230000003013 cytotoxicity Effects 0.000 description 2
- 231100000135 cytotoxicity Toxicity 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 230000007812 deficiency Effects 0.000 description 2
- 238000001212 derivatisation Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- NOPFSRXAKWQILS-UHFFFAOYSA-N docosan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCCCCCO NOPFSRXAKWQILS-UHFFFAOYSA-N 0.000 description 2
- VQNATVDKACXKTF-XELLLNAOSA-N duocarmycin Chemical compound COC1=C(OC)C(OC)=C2NC(C(=O)N3C4=CC(=O)C5=C([C@@]64C[C@@H]6C3)C=C(N5)C(=O)OC)=CC2=C1 VQNATVDKACXKTF-XELLLNAOSA-N 0.000 description 2
- 238000007345 electrophilic aromatic substitution reaction Methods 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 229960001904 epirubicin Drugs 0.000 description 2
- 229930013356 epothilone Natural products 0.000 description 2
- HESCAJZNRMSMJG-KKQRBIROSA-N epothilone A Chemical class C/C([C@@H]1C[C@@H]2O[C@@H]2CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)O1)O)C)=C\C1=CSC(C)=N1 HESCAJZNRMSMJG-KKQRBIROSA-N 0.000 description 2
- 230000032050 esterification Effects 0.000 description 2
- 238000005886 esterification reaction Methods 0.000 description 2
- LIQODXNTTZAGID-OCBXBXKTSA-N etoposide phosphate Chemical compound COC1=C(OP(O)(O)=O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 LIQODXNTTZAGID-OCBXBXKTSA-N 0.000 description 2
- 238000000855 fermentation Methods 0.000 description 2
- 230000004151 fermentation Effects 0.000 description 2
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- 125000004407 fluoroaryl group Chemical group 0.000 description 2
- CHPZKNULDCNCBW-UHFFFAOYSA-N gallium nitrate Chemical compound [Ga+3].[O-][N+]([O-])=O.[O-][N+]([O-])=O.[O-][N+]([O-])=O CHPZKNULDCNCBW-UHFFFAOYSA-N 0.000 description 2
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 208000007345 glycogen storage disease Diseases 0.000 description 2
- 108010062266 glycyl-glycyl-argininal Proteins 0.000 description 2
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Chemical compound NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 2
- 125000003106 haloaryl group Chemical group 0.000 description 2
- 125000005216 haloheteroaryl group Chemical group 0.000 description 2
- 201000005787 hematologic cancer Diseases 0.000 description 2
- 208000014951 hematologic disease Diseases 0.000 description 2
- 238000011134 hematopoietic stem cell transplantation Methods 0.000 description 2
- 208000018706 hematopoietic system disease Diseases 0.000 description 2
- 208000034737 hemoglobinopathy Diseases 0.000 description 2
- 230000011132 hemopoiesis Effects 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 210000003630 histaminocyte Anatomy 0.000 description 2
- HYFHYPWGAURHIV-UHFFFAOYSA-N homoharringtonine Natural products C1=C2CCN3CCCC43C=C(OC)C(OC(=O)C(O)(CCCC(C)(C)O)CC(=O)OC)C4C2=CC2=C1OCO2 HYFHYPWGAURHIV-UHFFFAOYSA-N 0.000 description 2
- 150000004677 hydrates Chemical class 0.000 description 2
- 229930195733 hydrocarbon Natural products 0.000 description 2
- 229960000908 idarubicin Drugs 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 238000009830 intercalation Methods 0.000 description 2
- 230000002687 intercalation Effects 0.000 description 2
- 229910052740 iodine Inorganic materials 0.000 description 2
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 2
- 229960004768 irinotecan Drugs 0.000 description 2
- 125000000904 isoindolyl group Chemical group C=1(NC=C2C=CC=CC12)* 0.000 description 2
- AWJUIBRHMBBTKR-UHFFFAOYSA-N isoquinoline Chemical compound C1=NC=CC2=CC=CC=C21 AWJUIBRHMBBTKR-UHFFFAOYSA-N 0.000 description 2
- 125000000842 isoxazolyl group Chemical group 0.000 description 2
- 201000002215 juvenile rheumatoid arthritis Diseases 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 210000005229 liver cell Anatomy 0.000 description 2
- 206010025135 lupus erythematosus Diseases 0.000 description 2
- 230000036210 malignancy Effects 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 238000004949 mass spectrometry Methods 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 210000005074 megakaryoblast Anatomy 0.000 description 2
- 208000030159 metabolic disease Diseases 0.000 description 2
- 230000002503 metabolic effect Effects 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- 150000004682 monohydrates Chemical class 0.000 description 2
- 206010028093 mucopolysaccharidosis Diseases 0.000 description 2
- 208000029766 myalgic encephalomeyelitis/chronic fatigue syndrome Diseases 0.000 description 2
- 229930014626 natural product Natural products 0.000 description 2
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 2
- 238000007339 nucleophilic aromatic substitution reaction Methods 0.000 description 2
- 229960002230 omacetaxine mepesuccinate Drugs 0.000 description 2
- HYFHYPWGAURHIV-JFIAXGOJSA-N omacetaxine mepesuccinate Chemical compound C1=C2CCN3CCC[C@]43C=C(OC)[C@@H](OC(=O)[C@@](O)(CCCC(C)(C)O)CC(=O)OC)[C@H]4C2=CC2=C1OCO2 HYFHYPWGAURHIV-JFIAXGOJSA-N 0.000 description 2
- 150000002891 organic anions Chemical class 0.000 description 2
- 125000002524 organometallic group Chemical group 0.000 description 2
- 208000002865 osteopetrosis Diseases 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 230000003647 oxidation Effects 0.000 description 2
- 238000007254 oxidation reaction Methods 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 2
- 238000006303 photolysis reaction Methods 0.000 description 2
- 230000015843 photosynthesis, light reaction Effects 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- CTYHFRWAIRSHQT-YRDOMICZSA-N proamanullin Chemical compound O=C1N[C@@H](CC(N)=O)C(=O)N2CCC[C@H]2C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C2)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@H]1CS(=O)C1=C2C2=CC=C(O)C=C2N1 CTYHFRWAIRSHQT-YRDOMICZSA-N 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 210000004765 promyelocyte Anatomy 0.000 description 2
- 235000019419 proteases Nutrition 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 125000003373 pyrazinyl group Chemical group 0.000 description 2
- 125000002943 quinolinyl group Chemical group N1=C(C=CC2=CC=CC=C12)* 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 210000001995 reticulocyte Anatomy 0.000 description 2
- MOCVYVBNJQIVOV-TVQRCGJNSA-N rohitukine Chemical compound O[C@@H]1CN(C)CC[C@@H]1C1=C(O)C=C(O)C2=C1OC(C)=CC2=O MOCVYVBNJQIVOV-TVQRCGJNSA-N 0.000 description 2
- CGFVUVWMYIHGHS-UHFFFAOYSA-N saintopin Chemical compound C1=C(O)C=C2C=C(C(=O)C=3C(=C(O)C=C(C=3)O)C3=O)C3=C(O)C2=C1O CGFVUVWMYIHGHS-UHFFFAOYSA-N 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- VUFNRPJNRFOTGK-UHFFFAOYSA-M sodium;1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 VUFNRPJNRFOTGK-UHFFFAOYSA-M 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 229950006050 spiromustine Drugs 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 238000010189 synthetic method Methods 0.000 description 2
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 2
- 206010043207 temporal arteritis Diseases 0.000 description 2
- 125000003507 tetrahydrothiofenyl group Chemical group 0.000 description 2
- ATGUDZODTABURZ-UHFFFAOYSA-N thiolan-2-ylideneazanium;chloride Chemical compound Cl.N=C1CCCS1 ATGUDZODTABURZ-UHFFFAOYSA-N 0.000 description 2
- TVPNFKRGOFJQOO-UHFFFAOYSA-N topsentin b1 Chemical compound C1=CC=C2C(C3=CN=C(N3)C(=O)C=3C4=CC=C(C=C4NC=3)O)=CNC2=C1 TVPNFKRGOFJQOO-UHFFFAOYSA-N 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 231100000765 toxin Toxicity 0.000 description 2
- 108700012359 toxins Proteins 0.000 description 2
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 2
- 150000003852 triazoles Chemical group 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 2
- 229960002066 vinorelbine Drugs 0.000 description 2
- AIFRHYZBTHREPW-UHFFFAOYSA-N β-carboline Chemical compound N1=CC=C2C3=CC=CC=C3NC2=C1 AIFRHYZBTHREPW-UHFFFAOYSA-N 0.000 description 2
- AADVCYNFEREWOS-UHFFFAOYSA-N (+)-DDM Natural products C=CC=CC(C)C(OC(N)=O)C(C)C(O)C(C)CC(C)=CC(C)C(O)C(C)C=CC(O)CC1OC(=O)C(C)C(O)C1C AADVCYNFEREWOS-UHFFFAOYSA-N 0.000 description 1
- OPFTUNCRGUEPRZ-UHFFFAOYSA-N (+)-beta-Elemen Natural products CC(=C)C1CCC(C)(C=C)C(C(C)=C)C1 OPFTUNCRGUEPRZ-UHFFFAOYSA-N 0.000 description 1
- BMKDZUISNHGIBY-ZETCQYMHSA-N (+)-dexrazoxane Chemical compound C([C@H](C)N1CC(=O)NC(=O)C1)N1CC(=O)NC(=O)C1 BMKDZUISNHGIBY-ZETCQYMHSA-N 0.000 description 1
- OPFTUNCRGUEPRZ-QLFBSQMISA-N (-)-beta-elemene Chemical compound CC(=C)[C@@H]1CC[C@@](C)(C=C)[C@H](C(C)=C)C1 OPFTUNCRGUEPRZ-QLFBSQMISA-N 0.000 description 1
- HZSBSRAVNBUZRA-RQDPQJJXSA-J (1r,2r)-cyclohexane-1,2-diamine;tetrachloroplatinum(2+) Chemical compound Cl[Pt+2](Cl)(Cl)Cl.N[C@@H]1CCCC[C@H]1N HZSBSRAVNBUZRA-RQDPQJJXSA-J 0.000 description 1
- GCPUVEMWOWMALU-HZMBPMFUSA-N (1s,3s)-1-hydroxy-8-methoxy-3-methyl-1,2,3,4-tetrahydrobenzo[a]anthracene-7,12-dione Chemical compound C1[C@H](C)C[C@H](O)C2=C1C=CC1=C2C(=O)C(C=CC=C2OC)=C2C1=O GCPUVEMWOWMALU-HZMBPMFUSA-N 0.000 description 1
- UFIVODCEJLHUTQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-(1-phenylethyldisulfanyl)-2h-pyridine-1-carboxylate Chemical compound C=1C=CC=CC=1C(C)SSC1C=CC=CN1C(=O)ON1C(=O)CCC1=O UFIVODCEJLHUTQ-UHFFFAOYSA-N 0.000 description 1
- VQZYZXLBKBUOHE-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(pyridin-2-yldisulfanyl)butanoate Chemical compound C=1C=CC=NC=1SSC(C)CC(=O)ON1C(=O)CCC1=O VQZYZXLBKBUOHE-UHFFFAOYSA-N 0.000 description 1
- JWDFQMWEFLOOED-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(pyridin-2-yldisulfanyl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSC1=CC=CC=N1 JWDFQMWEFLOOED-UHFFFAOYSA-N 0.000 description 1
- MXABZXILAJGOTL-AUYMZICSSA-N (2S)-N-[(2S)-1-[(2S)-1-[(2S,3S)-1-[(2S)-1-[2-[(2S)-1,3-dihydroxy-1-[(E)-1-hydroxy-1-[(2S,3S)-1-hydroxy-3-methyl-1-[[(2Z,6S,9S,12R)-5,8,11-trihydroxy-9-(2-methylpropyl)-6-propan-2-yl-1-thia-4,7,10-triazacyclotrideca-2,4,7,10-tetraen-12-yl]imino]pentan-2-yl]iminobut-2-en-2-yl]iminopropan-2-yl]imino-2-hydroxyethyl]imino-1,5-dihydroxy-5-iminopentan-2-yl]imino-1-hydroxy-3-methylpentan-2-yl]imino-1-hydroxy-3-methylbutan-2-yl]imino-1-hydroxy-3-phenylpropan-2-yl]-2-[[(2S)-2-[[(2S)-2-[[(Z)-2-[[(2S)-2-[[(Z)-2-[[(2S)-2-[[[(2S)-1-[(Z)-2-[[(2S)-2-(dimethylamino)-1-hydroxypropylidene]amino]but-2-enoyl]pyrrolidin-2-yl]-hydroxymethylidene]amino]-1-hydroxypropylidene]amino]-1-hydroxybut-2-enylidene]amino]-1-hydroxy-3-phenylpropylidene]amino]-1-hydroxybut-2-enylidene]amino]-1-hydroxy-3-methylbutylidene]amino]-1-hydroxypropylidene]amino]pentanediimidic acid Chemical compound CC[C@H](C)[C@H](\N=C(/O)[C@@H](\N=C(/O)[C@H](Cc1ccccc1)\N=C(/O)[C@H](CCC(O)=N)\N=C(/O)[C@H](C)\N=C(/O)[C@@H](\N=C(/O)\C(=C\C)\N=C(/O)[C@H](Cc1ccccc1)\N=C(/O)\C(=C\C)\N=C(/O)[C@H](C)\N=C(/O)[C@@H]1CCCN1C(=O)\C(=C\C)\N=C(/O)[C@H](C)N(C)C)C(C)C)C(C)C)C(\O)=N\[C@@H](CCC(O)=N)C(\O)=N\C\C(O)=N\[C@@H](CO)C(\O)=N\C(=C\C)\C(\O)=N\[C@@H]([C@@H](C)CC)C(\O)=N\[C@H]1CS\C=C/N=C(O)\[C@@H](\N=C(O)/[C@H](CC(C)C)\N=C1\O)C(C)C MXABZXILAJGOTL-AUYMZICSSA-N 0.000 description 1
- BUSGWUFLNHIBPT-XYBORKQMSA-N (2e,4e,6e)-7-[(1r,5r,6s)-3-[[(2e,4e)-5-cyclohexylpenta-2,4-dienoyl]amino]-5-hydroxy-2-oxo-7-oxabicyclo[4.1.0]hept-3-en-5-yl]hepta-2,4,6-trienoic acid Chemical compound C([C@]([C@H]1O[C@H]1C1=O)(O)/C=C/C=C/C=C/C(=O)O)=C1NC(=O)\C=C\C=C\C1CCCCC1 BUSGWUFLNHIBPT-XYBORKQMSA-N 0.000 description 1
- LCADVYTXPLBAGB-AUQKUMLUSA-N (2e,4e,6z,8e,10e,14e)-13-hydroxy-n-(1-hydroxypropan-2-yl)-2,10,12,14,16-pentamethyl-18-phenyloctadeca-2,4,6,8,10,14-hexaenamide Chemical compound OCC(C)NC(=O)C(\C)=C\C=C\C=C/C=C/C(/C)=C/C(C)C(O)C(\C)=C\C(C)CCC1=CC=CC=C1 LCADVYTXPLBAGB-AUQKUMLUSA-N 0.000 description 1
- RCGXNDQKCXNWLO-WLEIXIPESA-N (2r)-n-[(2s)-5-amino-1-[[(2r,3r)-1-[[(3s,6z,9s,12r,15r,18r,19s)-9-benzyl-15-[(2r)-butan-2-yl]-6-ethylidene-19-methyl-2,5,8,11,14,17-hexaoxo-3,12-di(propan-2-yl)-1-oxa-4,7,10,13,16-pentazacyclononadec-18-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-1-oxopent Chemical compound N([C@@H](CCCN)C(=O)N[C@H]([C@H](C)CC)C(=O)N[C@H]1C(N[C@@H](C(=O)N[C@@H](C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)NC(/C(=O)N[C@H](C(=O)O[C@H]1C)C(C)C)=C\C)C(C)C)[C@H](C)CC)=O)C(=O)[C@H]1CCCN1C(=O)[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](NC(=O)CCCC(C)C)C(C)C)[C@@H](C)O)C(C)C)C(C)C RCGXNDQKCXNWLO-WLEIXIPESA-N 0.000 description 1
- NOENHWMKHNSHGX-IZOOSHNJSA-N (2s)-1-[(2s)-2-[[(2s)-2-[[(2r)-2-[[(2r)-2-[[(2s)-2-[[(2r)-2-[[(2s)-2-[[(2r)-2-acetamido-3-naphthalen-2-ylpropanoyl]amino]-3-(4-chlorophenyl)propanoyl]amino]-3-pyridin-3-ylpropanoyl]amino]-3-hydroxypropanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-6-(ca Chemical compound C([C@H](C(=O)N[C@H](CCCCNC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCNC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@H](C)C(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](CC=1C=NC=CC=1)NC(=O)[C@H](CC=1C=CC(Cl)=CC=1)NC(=O)[C@@H](CC=1C=C2C=CC=CC2=CC=1)NC(C)=O)C1=CC=C(O)C=C1 NOENHWMKHNSHGX-IZOOSHNJSA-N 0.000 description 1
- ZZKNRXZVGOYGJT-VKHMYHEASA-N (2s)-2-[(2-phosphonoacetyl)amino]butanedioic acid Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)CP(O)(O)=O ZZKNRXZVGOYGJT-VKHMYHEASA-N 0.000 description 1
- XDZGQQRZJDKPTG-HBNQUELISA-N (2s)-2-[(3s,6s)-6-[2-[(1r,2r,4as,8as)-1-hydroxy-2,4a,5,5,8a-pentamethyl-2,3,4,6,7,8-hexahydronaphthalen-1-yl]ethyl]-6-methyldioxan-3-yl]propanoic acid Chemical compound O1O[C@H]([C@H](C)C(O)=O)CC[C@@]1(C)CC[C@]1(O)[C@@]2(C)CCCC(C)(C)[C@]2(C)CC[C@H]1C XDZGQQRZJDKPTG-HBNQUELISA-N 0.000 description 1
- MFRNYXJJRJQHNW-DEMKXPNLSA-N (2s)-2-[[(2r,3r)-3-methoxy-3-[(2s)-1-[(3r,4s,5s)-3-methoxy-5-methyl-4-[methyl-[(2s)-3-methyl-2-[[(2s)-3-methyl-2-(methylamino)butanoyl]amino]butanoyl]amino]heptanoyl]pyrrolidin-2-yl]-2-methylpropanoyl]amino]-3-phenylpropanoic acid Chemical group CN[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 MFRNYXJJRJQHNW-DEMKXPNLSA-N 0.000 description 1
- ZUQBAQVRAURMCL-DOMZBBRYSA-N (2s)-2-[[4-[2-[(6r)-2-amino-4-oxo-5,6,7,8-tetrahydro-1h-pyrido[2,3-d]pyrimidin-6-yl]ethyl]benzoyl]amino]pentanedioic acid Chemical compound C([C@@H]1CC=2C(=O)N=C(NC=2NC1)N)CC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 ZUQBAQVRAURMCL-DOMZBBRYSA-N 0.000 description 1
- JRBXPUUAYKCCLQ-QMMMGPOBSA-N (2s)-2-amino-2-[3-hydroxy-4-(hydroxymethyl)phenyl]acetic acid Chemical compound OC(=O)[C@@H](N)C1=CC=C(CO)C(O)=C1 JRBXPUUAYKCCLQ-QMMMGPOBSA-N 0.000 description 1
- NNWYWNRCBPYLML-GWCFXTLKSA-N (2s)-2-amino-n-[(2s)-1-[4-(hydroxymethyl)anilino]-1-oxopropan-2-yl]-3-methylbutanamide Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)NC1=CC=C(CO)C=C1 NNWYWNRCBPYLML-GWCFXTLKSA-N 0.000 description 1
- HJNZCKLMRAOTMA-BRBGIFQRSA-N (2s)-n-[(2s)-1-[[(2s)-1-[[(2s)-1-[[(2s)-1-[[(2r)-1-[[(2s)-1-[[(2s)-5-(diaminomethylideneamino)-1-[(2s)-2-(ethylcarbamoyl)pyrrolidin-1-yl]-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(2-methyl-1h-indol-3-yl)-1-oxopropan-2-yl]amino]-3-(4-hydr Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=C(C)NC2=CC=CC=C12 HJNZCKLMRAOTMA-BRBGIFQRSA-N 0.000 description 1
- HWMMBHOXHRVLCU-QOUANJGESA-N (2s,4s,5s)-4-[(1e,3e,5e)-7-[(2r,6r)-6-[(2r,3s,4ar,12bs)-2,3,4a,8,12b-pentahydroxy-3-methyl-1,7,12-trioxo-2,4-dihydrobenzo[a]anthracen-9-yl]-2-methyloxan-3-yl]oxy-7-oxohepta-1,3,5-trienyl]-2,5-dimethyl-1,3-dioxolane-2-carboxylic acid Chemical compound C[C@@H]1O[C@](C)(C(O)=O)O[C@H]1\C=C\C=C\C=C\C(=O)OC1[C@@H](C)O[C@@H](C=2C(=C3C(=O)C4=C([C@]5(C(=O)[C@H](O)[C@@](C)(O)C[C@@]5(O)C=C4)O)C(=O)C3=CC=2)O)CC1 HWMMBHOXHRVLCU-QOUANJGESA-N 0.000 description 1
- RDIMTXDFGHNINN-UHFFFAOYSA-N (3R,9R,10R)-1-heptadecen-4,6-diyne-3,9,10-triol Natural products CCCCCCCC(O)C(O)CC#CC#CC(O)C=C RDIMTXDFGHNINN-UHFFFAOYSA-N 0.000 description 1
- FELGMEQIXOGIFQ-CYBMUJFWSA-N (3r)-9-methyl-3-[(2-methylimidazol-1-yl)methyl]-2,3-dihydro-1h-carbazol-4-one Chemical compound CC1=NC=CN1C[C@@H]1C(=O)C(C=2C(=CC=CC=2)N2C)=C2CC1 FELGMEQIXOGIFQ-CYBMUJFWSA-N 0.000 description 1
- TVIRNGFXQVMMGB-OFWIHYRESA-N (3s,6r,10r,13e,16s)-16-[(2r,3r,4s)-4-chloro-3-hydroxy-4-phenylbutan-2-yl]-10-[(3-chloro-4-methoxyphenyl)methyl]-6-methyl-3-(2-methylpropyl)-1,4-dioxa-8,11-diazacyclohexadec-13-ene-2,5,9,12-tetrone Chemical compound C1=C(Cl)C(OC)=CC=C1C[C@@H]1C(=O)NC[C@@H](C)C(=O)O[C@@H](CC(C)C)C(=O)O[C@H]([C@H](C)[C@@H](O)[C@@H](Cl)C=2C=CC=CC=2)C/C=C/C(=O)N1 TVIRNGFXQVMMGB-OFWIHYRESA-N 0.000 description 1
- FRCJDPPXHQGEKS-BCHFMIIMSA-N (4S,5R)-N-[4-[(2,3-dihydroxybenzoyl)amino]butyl]-N-[3-[(2,3-dihydroxybenzoyl)amino]propyl]-2-(2-hydroxyphenyl)-5-methyl-4,5-dihydro-1,3-oxazole-4-carboxamide Chemical compound C[C@H]1OC(=N[C@@H]1C(=O)N(CCCCNC(=O)c1cccc(O)c1O)CCCNC(=O)c1cccc(O)c1O)c1ccccc1O FRCJDPPXHQGEKS-BCHFMIIMSA-N 0.000 description 1
- GTEXXGIEZVKSLH-YPMHNXCESA-N (4as,12br)-8,10-dihydroxy-2,5,5,9-tetramethyl-3,4,4a,12b-tetrahydronaphtho[2,3-c]isochromene-7,12-dione Chemical compound O=C1C2=CC(O)=C(C)C(O)=C2C(=O)C2=C1[C@@H]1C=C(C)CC[C@@H]1C(C)(C)O2 GTEXXGIEZVKSLH-YPMHNXCESA-N 0.000 description 1
- DEQANNDTNATYII-OULOTJBUSA-N (4r,7s,10s,13r,16s,19r)-10-(4-aminobutyl)-19-[[(2r)-2-amino-3-phenylpropanoyl]amino]-16-benzyl-n-[(2r,3r)-1,3-dihydroxybutan-2-yl]-7-[(1r)-1-hydroxyethyl]-13-(1h-indol-3-ylmethyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentazacycloicosane-4-carboxa Chemical compound C([C@@H](N)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](CC=2C3=CC=CC=C3NC=2)NC(=O)[C@H](CC=2C=CC=CC=2)NC1=O)C(=O)N[C@H](CO)[C@H](O)C)C1=CC=CC=C1 DEQANNDTNATYII-OULOTJBUSA-N 0.000 description 1
- PUDHBTGHUJUUFI-SCTWWAJVSA-N (4r,7s,10s,13r,16s,19r)-10-(4-aminobutyl)-n-[(2s,3r)-1-amino-3-hydroxy-1-oxobutan-2-yl]-19-[[(2r)-2-amino-3-naphthalen-2-ylpropanoyl]amino]-16-[(4-hydroxyphenyl)methyl]-13-(1h-indol-3-ylmethyl)-6,9,12,15,18-pentaoxo-7-propan-2-yl-1,2-dithia-5,8,11,14,17-p Chemical compound C([C@H]1C(=O)N[C@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(N[C@@H](CSSC[C@@H](C(=O)N1)NC(=O)[C@H](N)CC=1C=C2C=CC=CC2=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(N)=O)=O)C(C)C)C1=CC=C(O)C=C1 PUDHBTGHUJUUFI-SCTWWAJVSA-N 0.000 description 1
- HLAKJNQXUARACO-ZDUSSCGKSA-N (5'r)-5'-hydroxy-2',5',7'-trimethylspiro[cyclopropane-1,6'-indene]-4'-one Chemical compound O=C([C@@]1(O)C)C2=CC(C)=CC2=C(C)C21CC2 HLAKJNQXUARACO-ZDUSSCGKSA-N 0.000 description 1
- ANVAOWXLWRTKGA-NTXLUARGSA-N (6'R)-beta,epsilon-carotene Chemical compound CC=1CCCC(C)(C)C=1\C=C\C(\C)=C\C=C\C(\C)=C\C=C\C=C(/C)\C=C\C=C(/C)\C=C\[C@H]1C(C)=CCCC1(C)C ANVAOWXLWRTKGA-NTXLUARGSA-N 0.000 description 1
- WTSKMKRYHATLLL-UHFFFAOYSA-N (6-benzoyloxy-3-cyanopyridin-2-yl) 3-[3-(ethoxymethyl)-5-fluoro-2,6-dioxopyrimidine-1-carbonyl]benzoate Chemical compound O=C1N(COCC)C=C(F)C(=O)N1C(=O)C1=CC=CC(C(=O)OC=2C(=CC=C(OC(=O)C=3C=CC=CC=3)N=2)C#N)=C1 WTSKMKRYHATLLL-UHFFFAOYSA-N 0.000 description 1
- LKBBOPGQDRPCDS-YAOXHJNESA-N (7s,9r,10r)-7-[(2r,4s,5s,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-9-ethyl-4,6,9,10,11-pentahydroxy-8,10-dihydro-7h-tetracene-5,12-dione Chemical compound O([C@H]1C[C@]([C@@H](C2=C(O)C=3C(=O)C4=CC=CC(O)=C4C(=O)C=3C(O)=C21)O)(O)CC)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 LKBBOPGQDRPCDS-YAOXHJNESA-N 0.000 description 1
- GYPCWHHQAVLMKO-XXKQIVDLSA-N (7s,9s)-7-[(2r,4s,5s,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-[(e)-n-[(1-hydroxy-2,2,6,6-tetramethylpiperidin-4-ylidene)amino]-c-methylcarbonimidoyl]-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical group Cl.O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(\C)=N\N=C1CC(C)(C)N(O)C(C)(C)C1)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 GYPCWHHQAVLMKO-XXKQIVDLSA-N 0.000 description 1
- VHZXNQKVFDBFIK-NBBHSKLNSA-N (8r,9s,10r,13s,14s,16r)-16-fluoro-10,13-dimethyl-1,2,3,4,7,8,9,11,12,14,15,16-dodecahydrocyclopenta[a]phenanthren-17-one Chemical compound C1CCC[C@]2(C)[C@H]3CC[C@](C)(C([C@H](F)C4)=O)[C@@H]4[C@@H]3CC=C21 VHZXNQKVFDBFIK-NBBHSKLNSA-N 0.000 description 1
- IEXUMDBQLIVNHZ-YOUGDJEHSA-N (8s,11r,13r,14s,17s)-11-[4-(dimethylamino)phenyl]-17-hydroxy-17-(3-hydroxypropyl)-13-methyl-1,2,6,7,8,11,12,14,15,16-decahydrocyclopenta[a]phenanthren-3-one Chemical compound C1=CC(N(C)C)=CC=C1[C@@H]1C2=C3CCC(=O)C=C3CC[C@H]2[C@H](CC[C@]2(O)CCCO)[C@@]2(C)C1 IEXUMDBQLIVNHZ-YOUGDJEHSA-N 0.000 description 1
- 125000000229 (C1-C4)alkoxy group Chemical group 0.000 description 1
- 125000006710 (C2-C12) alkenyl group Chemical group 0.000 description 1
- 125000006711 (C2-C12) alkynyl group Chemical group 0.000 description 1
- 125000006736 (C6-C20) aryl group Chemical group 0.000 description 1
- LKJPYSCBVHEWIU-KRWDZBQOSA-N (R)-bicalutamide Chemical compound C([C@@](O)(C)C(=O)NC=1C=C(C(C#N)=CC=1)C(F)(F)F)S(=O)(=O)C1=CC=C(F)C=C1 LKJPYSCBVHEWIU-KRWDZBQOSA-N 0.000 description 1
- MHFRGQHAERHWKZ-HHHXNRCGSA-N (R)-edelfosine Chemical compound CCCCCCCCCCCCCCCCCCOC[C@@H](OC)COP([O-])(=O)OCC[N+](C)(C)C MHFRGQHAERHWKZ-HHHXNRCGSA-N 0.000 description 1
- FONKWHRXTPJODV-DNQXCXABSA-N 1,3-bis[2-[(8s)-8-(chloromethyl)-4-hydroxy-1-methyl-7,8-dihydro-3h-pyrrolo[3,2-e]indole-6-carbonyl]-1h-indol-5-yl]urea Chemical compound C1([C@H](CCl)CN2C(=O)C=3NC4=CC=C(C=C4C=3)NC(=O)NC=3C=C4C=C(NC4=CC=3)C(=O)N3C4=CC(O)=C5NC=C(C5=C4[C@H](CCl)C3)C)=C2C=C(O)C2=C1C(C)=CN2 FONKWHRXTPJODV-DNQXCXABSA-N 0.000 description 1
- RAIPHJJURHTUIC-UHFFFAOYSA-N 1,3-thiazol-2-amine Chemical group NC1=NC=CS1 RAIPHJJURHTUIC-UHFFFAOYSA-N 0.000 description 1
- YQYBWJPESSJLTK-HXFLIBJXSA-N 1-(2-chloroethyl)-3-[(2r,3s,4r,6s)-3-hydroxy-2-(hydroxymethyl)-6-methoxyoxan-4-yl]-1-nitrosourea Chemical compound CO[C@@H]1C[C@@H](NC(=O)N(CCCl)N=O)[C@H](O)[C@@H](CO)O1 YQYBWJPESSJLTK-HXFLIBJXSA-N 0.000 description 1
- TUSDEZXZIZRFGC-UHFFFAOYSA-N 1-O-galloyl-3,6-(R)-HHDP-beta-D-glucose Natural products OC1C(O2)COC(=O)C3=CC(O)=C(O)C(O)=C3C3=C(O)C(O)=C(O)C=C3C(=O)OC1C(O)C2OC(=O)C1=CC(O)=C(O)C(O)=C1 TUSDEZXZIZRFGC-UHFFFAOYSA-N 0.000 description 1
- 125000001462 1-pyrrolyl group Chemical group [*]N1C([H])=C([H])C([H])=C1[H] 0.000 description 1
- HAWSQZCWOQZXHI-FQEVSTJZSA-N 10-Hydroxycamptothecin Chemical compound C1=C(O)C=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 HAWSQZCWOQZXHI-FQEVSTJZSA-N 0.000 description 1
- MQLACMBJVPINKE-UHFFFAOYSA-N 10-[(3-hydroxy-4-methoxyphenyl)methylidene]anthracen-9-one Chemical compound C1=C(O)C(OC)=CC=C1C=C1C2=CC=CC=C2C(=O)C2=CC=CC=C21 MQLACMBJVPINKE-UHFFFAOYSA-N 0.000 description 1
- BAXOFTOLAUCFNW-UHFFFAOYSA-N 1H-indazole Chemical group C1=CC=C2C=NNC2=C1 BAXOFTOLAUCFNW-UHFFFAOYSA-N 0.000 description 1
- DEPDDPLQZYCHOH-UHFFFAOYSA-N 1h-imidazol-2-amine Chemical class NC1=NC=CN1 DEPDDPLQZYCHOH-UHFFFAOYSA-N 0.000 description 1
- KEQTWHPMSVAFDA-UHFFFAOYSA-N 2,3-dihydro-1h-pyrazole Chemical group C1NNC=C1 KEQTWHPMSVAFDA-UHFFFAOYSA-N 0.000 description 1
- FFMBYMANYCDCMK-UHFFFAOYSA-N 2,5-dihydro-1h-imidazole Chemical group C1NCN=C1 FFMBYMANYCDCMK-UHFFFAOYSA-N 0.000 description 1
- 150000003923 2,5-pyrrolediones Chemical class 0.000 description 1
- TXQPXJKRNHJWAX-UHFFFAOYSA-N 2-(3-aminopropylamino)ethylsulfanylphosphonic acid;trihydrate Chemical compound O.O.O.NCCCNCCSP(O)(O)=O TXQPXJKRNHJWAX-UHFFFAOYSA-N 0.000 description 1
- PDWUPXJEEYOOTR-UHFFFAOYSA-N 2-[(3-iodophenyl)methyl]guanidine Chemical compound NC(=N)NCC1=CC=CC(I)=C1 PDWUPXJEEYOOTR-UHFFFAOYSA-N 0.000 description 1
- QXLQZLBNPTZMRK-UHFFFAOYSA-N 2-[(dimethylamino)methyl]-1-(2,4-dimethylphenyl)prop-2-en-1-one Chemical compound CN(C)CC(=C)C(=O)C1=CC=C(C)C=C1C QXLQZLBNPTZMRK-UHFFFAOYSA-N 0.000 description 1
- XXVLKDRPHSFIIB-UHFFFAOYSA-N 2-[2-(dimethylamino)ethyl]-5-nitrobenzo[de]isoquinoline-1,3-dione Chemical compound [O-][N+](=O)C1=CC(C(N(CCN(C)C)C2=O)=O)=C3C2=CC=CC3=C1 XXVLKDRPHSFIIB-UHFFFAOYSA-N 0.000 description 1
- MHXVDXXARZCVRK-WCWDXBQESA-N 2-[2-[4-[(e)-3,3,3-trifluoro-1,2-diphenylprop-1-enyl]phenoxy]ethylamino]ethanol Chemical compound C1=CC(OCCNCCO)=CC=C1C(\C=1C=CC=CC=1)=C(C(F)(F)F)/C1=CC=CC=C1 MHXVDXXARZCVRK-WCWDXBQESA-N 0.000 description 1
- VDCRFBBZFHHYGT-IOSLPCCCSA-N 2-amino-9-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-7-prop-2-enyl-3h-purine-6,8-dione Chemical compound O=C1N(CC=C)C=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O VDCRFBBZFHHYGT-IOSLPCCCSA-N 0.000 description 1
- NIXVOFULDIFBLB-QVRNUERCSA-N 2-amino-9-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]purine-6-sulfinamide Chemical compound C12=NC(N)=NC(S(N)=O)=C2N=CN1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NIXVOFULDIFBLB-QVRNUERCSA-N 0.000 description 1
- BMUXBWLKTHLRQC-UHFFFAOYSA-N 2-azanylethanoic acid Chemical compound NCC(O)=O.NCC(O)=O.NCC(O)=O BMUXBWLKTHLRQC-UHFFFAOYSA-N 0.000 description 1
- UPHOPMSGKZNELG-UHFFFAOYSA-N 2-hydroxynaphthalene-1-carboxylic acid Chemical compound C1=CC=C2C(C(=O)O)=C(O)C=CC2=C1 UPHOPMSGKZNELG-UHFFFAOYSA-N 0.000 description 1
- 125000004493 2-methylbut-1-yl group Chemical group CC(C*)CC 0.000 description 1
- KRTGJZMJJVEKRX-UHFFFAOYSA-N 2-phenylethan-1-yl Chemical group [CH2]CC1=CC=CC=C1 KRTGJZMJJVEKRX-UHFFFAOYSA-N 0.000 description 1
- 125000004105 2-pyridyl group Chemical group N1=C([*])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- RSEBUVRVKCANEP-UHFFFAOYSA-N 2-pyrroline Chemical group C1CC=CN1 RSEBUVRVKCANEP-UHFFFAOYSA-N 0.000 description 1
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 1
- QGJZLNKBHJESQX-UHFFFAOYSA-N 3-Epi-Betulin-Saeure Natural products C1CC(O)C(C)(C)C2CCC3(C)C4(C)CCC5(C(O)=O)CCC(C(=C)C)C5C4CCC3C21C QGJZLNKBHJESQX-UHFFFAOYSA-N 0.000 description 1
- QNKJFXARIMSDBR-UHFFFAOYSA-N 3-[2-[bis(2-chloroethyl)amino]ethyl]-1,3-diazaspiro[4.5]decane-2,4-dione Chemical compound O=C1N(CCN(CCCl)CCCl)C(=O)NC11CCCCC1 QNKJFXARIMSDBR-UHFFFAOYSA-N 0.000 description 1
- WELIVEBWRWAGOM-UHFFFAOYSA-N 3-amino-n-[2-[2-(3-aminopropanoylamino)ethyldisulfanyl]ethyl]propanamide Chemical compound NCCC(=O)NCCSSCCNC(=O)CCN WELIVEBWRWAGOM-UHFFFAOYSA-N 0.000 description 1
- 125000003349 3-pyridyl group Chemical group N1=C([H])C([*])=C([H])C([H])=C1[H] 0.000 description 1
- JVQIKJMSUIMUDI-UHFFFAOYSA-N 3-pyrroline Chemical group C1NCC=C1 JVQIKJMSUIMUDI-UHFFFAOYSA-N 0.000 description 1
- CLOUCVRNYSHRCF-UHFFFAOYSA-N 3beta-Hydroxy-20(29)-Lupen-3,27-oic acid Natural products C1CC(O)C(C)(C)C2CCC3(C)C4(C(O)=O)CCC5(C)CCC(C(=C)C)C5C4CCC3C21C CLOUCVRNYSHRCF-UHFFFAOYSA-N 0.000 description 1
- PDQGEKGUTOTUNV-TZSSRYMLSA-N 4'-deoxy-4'-iododoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](I)[C@H](C)O1 PDQGEKGUTOTUNV-TZSSRYMLSA-N 0.000 description 1
- MCGBIXXDQFWVDW-UHFFFAOYSA-N 4,5-dihydro-1h-pyrazole Chemical group C1CC=NN1 MCGBIXXDQFWVDW-UHFFFAOYSA-N 0.000 description 1
- LIETVYHJBSLSSW-UHFFFAOYSA-N 4,6,9-trihydroxy-8-methyl-3,4-dihydro-2h-anthracen-1-one Chemical compound OC1CCC(=O)C2=C1C=C1C=C(O)C=C(C)C1=C2O LIETVYHJBSLSSW-UHFFFAOYSA-N 0.000 description 1
- CLPFFLWZZBQMAO-UHFFFAOYSA-N 4-(5,6,7,8-tetrahydroimidazo[1,5-a]pyridin-5-yl)benzonitrile Chemical compound C1=CC(C#N)=CC=C1C1N2C=NC=C2CCC1 CLPFFLWZZBQMAO-UHFFFAOYSA-N 0.000 description 1
- AKJHMTWEGVYYSE-AIRMAKDCSA-N 4-HPR Chemical compound C=1C=C(O)C=CC=1NC(=O)/C=C(\C)/C=C/C=C(C)C=CC1=C(C)CCCC1(C)C AKJHMTWEGVYYSE-AIRMAKDCSA-N 0.000 description 1
- HQFSNUYUXXPVKL-UHFFFAOYSA-N 4-[(4-fluorophenyl)methyl]-2-[1-(2-phenylethyl)azepan-4-yl]phthalazin-1-one Chemical compound C1=CC(F)=CC=C1CC(C1=CC=CC=C1C1=O)=NN1C1CCN(CCC=2C=CC=CC=2)CCC1 HQFSNUYUXXPVKL-UHFFFAOYSA-N 0.000 description 1
- OUQPTBCOEKUHBH-LSDHQDQOSA-N 4-[2-[4-[(e)-2-(5,5,8,8-tetramethyl-6,7-dihydronaphthalen-2-yl)prop-1-enyl]phenoxy]ethyl]morpholine Chemical compound C=1C=C(C(CCC2(C)C)(C)C)C2=CC=1C(/C)=C/C(C=C1)=CC=C1OCCN1CCOCC1 OUQPTBCOEKUHBH-LSDHQDQOSA-N 0.000 description 1
- CTSNHMQGVWXIEG-UHFFFAOYSA-N 4-amino-n-(5-chloroquinoxalin-2-yl)benzenesulfonamide Chemical compound C1=CC(N)=CC=C1S(=O)(=O)NC1=CN=C(C(Cl)=CC=C2)C2=N1 CTSNHMQGVWXIEG-UHFFFAOYSA-N 0.000 description 1
- 125000005986 4-piperidonyl group Chemical group 0.000 description 1
- 125000000339 4-pyridyl group Chemical group N1=C([H])C([H])=C([*])C([H])=C1[H] 0.000 description 1
- KDDQRKBRJSGMQE-UHFFFAOYSA-N 4-thiazolyl Chemical group [C]1=CSC=N1 KDDQRKBRJSGMQE-UHFFFAOYSA-N 0.000 description 1
- 125000002471 4H-quinolizinyl group Chemical group C=1(C=CCN2C=CC=CC12)* 0.000 description 1
- 101710169336 5'-deoxyadenosine deaminase Proteins 0.000 description 1
- APNRZHLOPQFNMR-WEIUTZTHSA-N 5-[(e)-5-[(1s)-2,2-dimethyl-6-methylidenecyclohexyl]-3-methylpent-2-enyl]phenazin-1-one Chemical compound C12=CC=CC=C2N=C(C(C=CC=2)=O)C=2N1C\C=C(/C)CC[C@@H]1C(=C)CCCC1(C)C APNRZHLOPQFNMR-WEIUTZTHSA-N 0.000 description 1
- XAUDJQYHKZQPEU-KVQBGUIXSA-N 5-aza-2'-deoxycytidine Chemical compound O=C1N=C(N)N=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 XAUDJQYHKZQPEU-KVQBGUIXSA-N 0.000 description 1
- PXBZKHOQHTVCSQ-QZTJIDSGSA-N 5-nitro-2-[(2r)-1-[2-[[(2r)-2-(5-nitro-1,3-dioxobenzo[de]isoquinolin-2-yl)propyl]amino]ethylamino]propan-2-yl]benzo[de]isoquinoline-1,3-dione Chemical compound [O-][N+](=O)C1=CC(C(N([C@@H](CNCCNC[C@@H](C)N2C(C=3C=C(C=C4C=CC=C(C=34)C2=O)[N+]([O-])=O)=O)C)C2=O)=O)=C3C2=CC=CC3=C1 PXBZKHOQHTVCSQ-QZTJIDSGSA-N 0.000 description 1
- 125000004938 5-pyridyl group Chemical group N1=CC=CC(=C1)* 0.000 description 1
- CWDWFSXUQODZGW-UHFFFAOYSA-N 5-thiazolyl Chemical group [C]1=CN=CS1 CWDWFSXUQODZGW-UHFFFAOYSA-N 0.000 description 1
- ATCGGEJZONJOCL-UHFFFAOYSA-N 6-(2,5-dichlorophenyl)-1,3,5-triazine-2,4-diamine Chemical compound NC1=NC(N)=NC(C=2C(=CC=C(Cl)C=2)Cl)=N1 ATCGGEJZONJOCL-UHFFFAOYSA-N 0.000 description 1
- VJXSSYDSOJBUAV-UHFFFAOYSA-N 6-(2,5-dimethoxy-benzyl)-5-methyl-pyrido[2,3-d]pyrimidine-2,4-diamine Chemical compound COC1=CC=C(OC)C(CC=2C(=C3C(N)=NC(N)=NC3=NC=2)C)=C1 VJXSSYDSOJBUAV-UHFFFAOYSA-N 0.000 description 1
- WOJKKJKETHYEAC-UHFFFAOYSA-N 6-Maleimidocaproic acid Chemical compound OC(=O)CCCCCN1C(=O)C=CC1=O WOJKKJKETHYEAC-UHFFFAOYSA-N 0.000 description 1
- LRHPCRBOMKRVOA-UHFFFAOYSA-N 6-[2-(2-hydroxyethylamino)ethyl]indeno[1,2-c]isoquinoline-5,11-dione Chemical compound C12=CC=CC=C2C(=O)N(CCNCCO)C2=C1C(=O)C1=CC=CC=C12 LRHPCRBOMKRVOA-UHFFFAOYSA-N 0.000 description 1
- LJIRBXZDQGQUOO-KVTDHHQDSA-N 6-amino-3-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-1,4-dihydro-1,3,5-triazin-2-one Chemical compound C1NC(N)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 LJIRBXZDQGQUOO-KVTDHHQDSA-N 0.000 description 1
- 125000004939 6-pyridyl group Chemical group N1=CC=CC=C1* 0.000 description 1
- FJHBVJOVLFPMQE-QFIPXVFZSA-N 7-Ethyl-10-Hydroxy-Camptothecin Chemical compound C1=C(O)C=C2C(CC)=C(CN3C(C4=C([C@@](C(=O)OC4)(O)CC)C=C33)=O)C3=NC2=C1 FJHBVJOVLFPMQE-QFIPXVFZSA-N 0.000 description 1
- GOYNNCPGHOBFCK-UHFFFAOYSA-N 7-[4-(dimethylamino)-5-[(2,9-dimethyl-3-oxo-4,4a,5a,6,7,9,9a,10a-octahydrodipyrano[4,2-a:4',3'-e][1,4]dioxin-7-yl)oxy]-6-methyloxan-2-yl]oxy-9-ethyl-4,6,9,10,11-pentahydroxy-8,10-dihydro-7h-tetracene-5,12-dione Chemical compound O=C1C2=C(O)C=CC=C2C(=O)C2=C1C(O)=C1C(OC3OC(C)C(OC4OC(C)C5OC6OC(C)C(=O)CC6OC5C4)C(C3)N(C)C)CC(CC)(O)C(O)C1=C2O GOYNNCPGHOBFCK-UHFFFAOYSA-N 0.000 description 1
- GOJJWDOZNKBUSR-UHFFFAOYSA-N 7-sulfamoyloxyheptyl sulfamate Chemical compound NS(=O)(=O)OCCCCCCCOS(N)(=O)=O GOJJWDOZNKBUSR-UHFFFAOYSA-N 0.000 description 1
- JPASRFGVACYSJG-UHFFFAOYSA-N 8,10-dihydroimidazo[4,5-a]acridin-9-one Chemical class N1=C2C=CC3=NC=NC3=C2C=C2C1=CCC(=O)C2 JPASRFGVACYSJG-UHFFFAOYSA-N 0.000 description 1
- ZGXJTSGNIOSYLO-UHFFFAOYSA-N 88755TAZ87 Chemical compound NCC(=O)CCC(O)=O ZGXJTSGNIOSYLO-UHFFFAOYSA-N 0.000 description 1
- MSNVESLISHTIRS-UHFFFAOYSA-N 9h-pyrrolo[2,1-c][1,4]benzodiazepine Chemical class N1=C2C=CC=CC2=CN2CC=CC2=C1 MSNVESLISHTIRS-UHFFFAOYSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 241000186361 Actinobacteria <class> Species 0.000 description 1
- 208000026872 Addison Disease Diseases 0.000 description 1
- 208000036832 Adenocarcinoma of ovary Diseases 0.000 description 1
- 102100036664 Adenosine deaminase Human genes 0.000 description 1
- 208000008190 Agammaglobulinemia Diseases 0.000 description 1
- QXRNAOYBCYVZCD-BQBZGAKWSA-N Ala-Lys Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CCCCN QXRNAOYBCYVZCD-BQBZGAKWSA-N 0.000 description 1
- OMNVYXHOSHNURL-WPRPVWTQSA-N Ala-Phe Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 OMNVYXHOSHNURL-WPRPVWTQSA-N 0.000 description 1
- LIWMQSWFLXEGMA-WDSKDSINSA-N Ala-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](C)N LIWMQSWFLXEGMA-WDSKDSINSA-N 0.000 description 1
- 206010001767 Alopecia universalis Diseases 0.000 description 1
- 108010027164 Amanitins Proteins 0.000 description 1
- 206010001935 American trypanosomiasis Diseases 0.000 description 1
- ITPDYQOUSLNIHG-UHFFFAOYSA-N Amiodarone hydrochloride Chemical compound [Cl-].CCCCC=1OC2=CC=CC=C2C=1C(=O)C1=CC(I)=C(OCC[NH+](CC)CC)C(I)=C1 ITPDYQOUSLNIHG-UHFFFAOYSA-N 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- BOJKULTULYSRAS-OTESTREVSA-N Andrographolide Chemical compound C([C@H]1[C@]2(C)CC[C@@H](O)[C@]([C@H]2CCC1=C)(CO)C)\C=C1/[C@H](O)COC1=O BOJKULTULYSRAS-OTESTREVSA-N 0.000 description 1
- NQGMIPUYCWIEAW-UHFFFAOYSA-N Antibiotic SF 2738 Natural products COc1cc(nc(C=NO)c1SC)-c1ccccn1 NQGMIPUYCWIEAW-UHFFFAOYSA-N 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- BFYIZQONLCFLEV-DAELLWKTSA-N Aromasine Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC(=C)C2=C1 BFYIZQONLCFLEV-DAELLWKTSA-N 0.000 description 1
- 206010003827 Autoimmune hepatitis Diseases 0.000 description 1
- 206010003840 Autonomic nervous system imbalance Diseases 0.000 description 1
- YOZSEGPJAXTSFZ-ZETCQYMHSA-N Azatyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=N1 YOZSEGPJAXTSFZ-ZETCQYMHSA-N 0.000 description 1
- 208000009137 Behcet syndrome Diseases 0.000 description 1
- DIZWSDNSTNAYHK-XGWVBXMLSA-N Betulinic acid Natural products CC(=C)[C@@H]1C[C@H]([C@H]2CC[C@]3(C)[C@H](CC[C@@H]4[C@@]5(C)CC[C@H](O)C(C)(C)[C@@H]5CC[C@@]34C)[C@@H]12)C(=O)O DIZWSDNSTNAYHK-XGWVBXMLSA-N 0.000 description 1
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 1
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- CIUUIPMOFZIWIZ-UHFFFAOYSA-N Bropirimine Chemical compound NC1=NC(O)=C(Br)C(C=2C=CC=CC=2)=N1 CIUUIPMOFZIWIZ-UHFFFAOYSA-N 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 125000001313 C5-C10 heteroaryl group Chemical group 0.000 description 1
- HAWSQZCWOQZXHI-UHFFFAOYSA-N CPT-OH Natural products C1=C(O)C=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 HAWSQZCWOQZXHI-UHFFFAOYSA-N 0.000 description 1
- 201000002829 CREST Syndrome Diseases 0.000 description 1
- BHPQYMZQTOCNFJ-UHFFFAOYSA-N Calcium cation Chemical compound [Ca+2] BHPQYMZQTOCNFJ-UHFFFAOYSA-N 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 208000031229 Cardiomyopathies Diseases 0.000 description 1
- 102000005403 Casein Kinases Human genes 0.000 description 1
- 108010031425 Casein Kinases Proteins 0.000 description 1
- JDVVGAQPNNXQDW-WCMLQCRESA-N Castanospermine Natural products O[C@H]1[C@@H](O)[C@H]2[C@@H](O)CCN2C[C@H]1O JDVVGAQPNNXQDW-WCMLQCRESA-N 0.000 description 1
- JDVVGAQPNNXQDW-TVNFTVLESA-N Castinospermine Chemical compound C1[C@H](O)[C@@H](O)[C@H](O)[C@H]2[C@@H](O)CCN21 JDVVGAQPNNXQDW-TVNFTVLESA-N 0.000 description 1
- 208000024699 Chagas disease Diseases 0.000 description 1
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- 241000282552 Chlorocebus aethiops Species 0.000 description 1
- 208000030939 Chronic inflammatory demyelinating polyneuropathy Diseases 0.000 description 1
- 208000031879 Chédiak-Higashi syndrome Diseases 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 1
- 208000015943 Coeliac disease Diseases 0.000 description 1
- 208000011038 Cold agglutinin disease Diseases 0.000 description 1
- 206010009868 Cold type haemolytic anaemia Diseases 0.000 description 1
- 206010056979 Colitis microscopic Diseases 0.000 description 1
- HVXBOLULGPECHP-WAYWQWQTSA-N Combretastatin A4 Chemical compound C1=C(O)C(OC)=CC=C1\C=C/C1=CC(OC)=C(OC)C(OC)=C1 HVXBOLULGPECHP-WAYWQWQTSA-N 0.000 description 1
- DFDTZECTHJFPHE-UHFFFAOYSA-N Crambescidin 816 Natural products C1CC=CC(CC)OC11NC(N23)=NC4(OC(C)CCC4)C(C(=O)OCCCCCCCCCCCCCCCC(=O)N(CCCN)CC(O)CCN)C3(O)CCC2C1 DFDTZECTHJFPHE-UHFFFAOYSA-N 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 208000019707 Cryoglobulinemic vasculitis Diseases 0.000 description 1
- LUEYTMPPCOCKBX-KWYHTCOPSA-N Curacin A Chemical compound C=CC[C@H](OC)CC\C(C)=C\C=C\CC\C=C/[C@@H]1CSC([C@H]2[C@H](C2)C)=N1 LUEYTMPPCOCKBX-KWYHTCOPSA-N 0.000 description 1
- LUEYTMPPCOCKBX-UHFFFAOYSA-N Curacin A Natural products C=CCC(OC)CCC(C)=CC=CCCC=CC1CSC(C2C(C2)C)=N1 LUEYTMPPCOCKBX-UHFFFAOYSA-N 0.000 description 1
- XZMCDFZZKTWFGF-UHFFFAOYSA-N Cyanamide Chemical compound NC#N XZMCDFZZKTWFGF-UHFFFAOYSA-N 0.000 description 1
- PQNNIEWMPIULRS-UHFFFAOYSA-N Cytostatin Natural products CC=CC=CC=CC(O)C(C)C(OP(O)(O)=O)CCC(C)C1OC(=O)C=CC1C PQNNIEWMPIULRS-UHFFFAOYSA-N 0.000 description 1
- 150000008574 D-amino acids Chemical class 0.000 description 1
- AEMOLEFTQBMNLQ-AQKNRBDQSA-N D-glucopyranuronic acid Chemical compound OC1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O AEMOLEFTQBMNLQ-AQKNRBDQSA-N 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- 206010012468 Dermatitis herpetiformis Diseases 0.000 description 1
- GJKXGJCSJWBJEZ-XRSSZCMZSA-N Deslorelin Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CNC2=CC=CC=C12 GJKXGJCSJWBJEZ-XRSSZCMZSA-N 0.000 description 1
- YZCKVEUIGOORGS-OUBTZVSYSA-N Deuterium Chemical group [2H] YZCKVEUIGOORGS-OUBTZVSYSA-N 0.000 description 1
- XBPCUCUWBYBCDP-UHFFFAOYSA-N Dicyclohexylamine Chemical compound C1CCCCC1NC1CCCCC1 XBPCUCUWBYBCDP-UHFFFAOYSA-N 0.000 description 1
- KYHUYMLIVQFXRI-SJPGYWQQSA-N Didemnin B Chemical compound CN([C@H](CC(C)C)C(=O)N[C@@H]1C(=O)N[C@@H]([C@H](CC(=O)O[C@H](C(=O)[C@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N2CCC[C@H]2C(=O)N(C)[C@@H](CC=2C=CC(OC)=CC=2)C(=O)O[C@@H]1C)C(C)C)O)[C@@H](C)CC)C(=O)[C@@H]1CCCN1C(=O)[C@H](C)O KYHUYMLIVQFXRI-SJPGYWQQSA-N 0.000 description 1
- HWMMBHOXHRVLCU-UHFFFAOYSA-N Dioxamycin Natural products CC1OC(C)(C(O)=O)OC1C=CC=CC=CC(=O)OC1C(C)OC(C=2C(=C3C(=O)C4=C(C5(C(=O)C(O)C(C)(O)CC5(O)C=C4)O)C(=O)C3=CC=2)O)CC1 HWMMBHOXHRVLCU-UHFFFAOYSA-N 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- AADVCYNFEREWOS-OBRABYBLSA-N Discodermolide Chemical compound C=C\C=C/[C@H](C)[C@H](OC(N)=O)[C@@H](C)[C@H](O)[C@@H](C)C\C(C)=C/[C@H](C)[C@@H](O)[C@@H](C)\C=C/[C@@H](O)C[C@@H]1OC(=O)[C@H](C)[C@@H](O)[C@H]1C AADVCYNFEREWOS-OBRABYBLSA-N 0.000 description 1
- MWWSFMDVAYGXBV-RUELKSSGSA-N Doxorubicin hydrochloride Chemical compound Cl.O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 MWWSFMDVAYGXBV-RUELKSSGSA-N 0.000 description 1
- ZQZFYGIXNQKOAV-OCEACIFDSA-N Droloxifene Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=C(O)C=CC=1)\C1=CC=C(OCCN(C)C)C=C1 ZQZFYGIXNQKOAV-OCEACIFDSA-N 0.000 description 1
- CYQFCXCEBYINGO-DLBZAZTESA-N Dronabinol Natural products C1=C(C)CC[C@H]2C(C)(C)OC3=CC(CCCCC)=CC(O)=C3[C@H]21 CYQFCXCEBYINGO-DLBZAZTESA-N 0.000 description 1
- VQNATVDKACXKTF-UHFFFAOYSA-N Duocarmycin SA Natural products COC1=C(OC)C(OC)=C2NC(C(=O)N3C4=CC(=O)C5=C(C64CC6C3)C=C(N5)C(=O)OC)=CC2=C1 VQNATVDKACXKTF-UHFFFAOYSA-N 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- DYEFUKCXAQOFHX-UHFFFAOYSA-N Ebselen Chemical compound [se]1C2=CC=CC=C2C(=O)N1C1=CC=CC=C1 DYEFUKCXAQOFHX-UHFFFAOYSA-N 0.000 description 1
- 201000009273 Endometriosis Diseases 0.000 description 1
- QXRSDHAAWVKZLJ-OXZHEXMSSA-N Epothilone B Natural products O=C1[C@H](C)[C@H](O)[C@@H](C)CCC[C@@]2(C)O[C@H]2C[C@@H](/C(=C\c2nc(C)sc2)/C)OC(=O)C[C@H](O)C1(C)C QXRSDHAAWVKZLJ-OXZHEXMSSA-N 0.000 description 1
- VAPSMQAHNAZRKC-PQWRYPMOSA-N Epristeride Chemical compound C1C=C2C=C(C(O)=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)NC(C)(C)C)[C@@]1(C)CC2 VAPSMQAHNAZRKC-PQWRYPMOSA-N 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- VGGSQFUCUMXWEO-UHFFFAOYSA-N Ethene Chemical compound C=C VGGSQFUCUMXWEO-UHFFFAOYSA-N 0.000 description 1
- 239000005977 Ethylene Substances 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 239000001263 FEMA 3042 Substances 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 102100024785 Fibroblast growth factor 2 Human genes 0.000 description 1
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 1
- 108010029961 Filgrastim Proteins 0.000 description 1
- 206010056740 Genital discharge Diseases 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 208000024869 Goodpasture syndrome Diseases 0.000 description 1
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 1
- 208000003807 Graves Disease Diseases 0.000 description 1
- 208000015023 Graves' disease Diseases 0.000 description 1
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 1
- 101000582950 Homo sapiens Platelet factor 4 Proteins 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 1
- 206010020983 Hypogammaglobulinaemia Diseases 0.000 description 1
- MPBVHIBUJCELCL-UHFFFAOYSA-N Ibandronate Chemical compound CCCCCN(C)CCC(O)(P(O)(O)=O)P(O)(O)=O MPBVHIBUJCELCL-UHFFFAOYSA-N 0.000 description 1
- 201000009794 Idiopathic Pulmonary Fibrosis Diseases 0.000 description 1
- JJKOTMDDZAJTGQ-DQSJHHFOSA-N Idoxifene Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN2CCCC2)=CC=1)/C1=CC=C(I)C=C1 JJKOTMDDZAJTGQ-DQSJHHFOSA-N 0.000 description 1
- 102000009490 IgG Receptors Human genes 0.000 description 1
- 108010073807 IgG Receptors Proteins 0.000 description 1
- WRYCSMQKUKOKBP-UHFFFAOYSA-N Imidazolidine Chemical group C1CNCN1 WRYCSMQKUKOKBP-UHFFFAOYSA-N 0.000 description 1
- 101000668058 Infectious salmon anemia virus (isolate Atlantic salmon/Norway/810/9/99) RNA-directed RNA polymerase catalytic subunit Proteins 0.000 description 1
- 108700022013 Insecta cecropin B Proteins 0.000 description 1
- 208000005615 Interstitial Cystitis Diseases 0.000 description 1
- 208000000209 Isaacs syndrome Diseases 0.000 description 1
- 208000011200 Kawasaki disease Diseases 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- KJQFBVYMGADDTQ-CVSPRKDYSA-N L-buthionine-(S,R)-sulfoximine Chemical compound CCCCS(=N)(=O)CC[C@H](N)C(O)=O KJQFBVYMGADDTQ-CVSPRKDYSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- 108010043135 L-methionine gamma-lyase Proteins 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-L L-tartrate(2-) Chemical compound [O-]C(=O)[C@H](O)[C@@H](O)C([O-])=O FEWJPZIEWOKRBE-JCYAYHJZSA-L 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- ZHTRILQJTPJGNK-FYBAATNNSA-N Leinamycin Chemical compound N([C@@H](C=1SC=C(N=1)\C=C/C=C/C(=O)[C@H](O)/C=C(C)/CC1)C)C(=O)C[C@@]21S(=O)SC(=O)[C@]2(C)O ZHTRILQJTPJGNK-FYBAATNNSA-N 0.000 description 1
- ZHTRILQJTPJGNK-UHFFFAOYSA-N Leinamycin Natural products C1CC(C)=CC(O)C(=O)C=CC=CC(N=2)=CSC=2C(C)NC(=O)CC21S(=O)SC(=O)C2(C)O ZHTRILQJTPJGNK-UHFFFAOYSA-N 0.000 description 1
- 108010062867 Lenograstim Proteins 0.000 description 1
- 229920001491 Lentinan Polymers 0.000 description 1
- 241001157060 Lepiota brunneoincarnata Species 0.000 description 1
- LMVRPBWWHMVLPC-KBPJCXPTSA-N Leptolstatin Natural products CC(CC=CC(=CC(C)C(=O)C(C)C(O)C(C)CC(=CCO)C)C)C=C(C)/C=C/C1CC=CC(=O)O1 LMVRPBWWHMVLPC-KBPJCXPTSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 208000016604 Lyme disease Diseases 0.000 description 1
- 102000043136 MAP kinase family Human genes 0.000 description 1
- 108091054455 MAP kinase family Proteins 0.000 description 1
- JLVVSXFLKOJNIY-UHFFFAOYSA-N Magnesium ion Chemical compound [Mg+2] JLVVSXFLKOJNIY-UHFFFAOYSA-N 0.000 description 1
- 206010064281 Malignant atrophic papulosis Diseases 0.000 description 1
- 241001441512 Maytenus serrata Species 0.000 description 1
- 208000027530 Meniere disease Diseases 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- HRHKSTOGXBBQCB-UHFFFAOYSA-N Mitomycin E Natural products O=C1C(N)=C(C)C(=O)C2=C1C(COC(N)=O)C1(OC)C3N(C)C3CN12 HRHKSTOGXBBQCB-UHFFFAOYSA-N 0.000 description 1
- 102100030173 Muellerian-inhibiting factor Human genes 0.000 description 1
- HFPXYDFQVINJBV-UHFFFAOYSA-N Mycaperoxide B Natural products O1OC(C(C)C(O)=O)CCC1(C)CCC1(O)C2(C)CCCC(C)(C)C2CCC1C HFPXYDFQVINJBV-UHFFFAOYSA-N 0.000 description 1
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 1
- WUKZPHOXUVCQOR-UHFFFAOYSA-N N-(1-azabicyclo[2.2.2]octan-3-yl)-6-chloro-4-methyl-3-oxo-1,4-benzoxazine-8-carboxamide Chemical compound C1N(CC2)CCC2C1NC(=O)C1=CC(Cl)=CC2=C1OCC(=O)N2C WUKZPHOXUVCQOR-UHFFFAOYSA-N 0.000 description 1
- QJMCKEPOKRERLN-UHFFFAOYSA-N N-3,4-tridhydroxybenzamide Chemical compound ONC(=O)C1=CC=C(O)C(O)=C1 QJMCKEPOKRERLN-UHFFFAOYSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 229910002651 NO3 Inorganic materials 0.000 description 1
- 108010021717 Nafarelin Proteins 0.000 description 1
- GTEXXGIEZVKSLH-UHFFFAOYSA-N Naphterpin Natural products O=C1C2=CC(O)=C(C)C(O)=C2C(=O)C2=C1C1C=C(C)CCC1C(C)(C)O2 GTEXXGIEZVKSLH-UHFFFAOYSA-N 0.000 description 1
- 206010072359 Neuromyotonia Diseases 0.000 description 1
- BUSGWUFLNHIBPT-UHFFFAOYSA-N Nisamycin Natural products O=C1C2OC2C(C=CC=CC=CC(=O)O)(O)C=C1NC(=O)C=CC=CC1CCCCC1 BUSGWUFLNHIBPT-UHFFFAOYSA-N 0.000 description 1
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 1
- 108010016076 Octreotide Proteins 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- VTAZRSXSBIHBMH-UHFFFAOYSA-N Ophiocordin Natural products OC1=CC(C(=O)O)=CC(O)=C1C(=O)C1=C(O)C=CC=C1C(=O)NC1C(OC(=O)C=2C=CC(O)=CC=2)CCCNC1 VTAZRSXSBIHBMH-UHFFFAOYSA-N 0.000 description 1
- 208000003435 Optic Neuritis Diseases 0.000 description 1
- 206010061328 Ovarian epithelial cancer Diseases 0.000 description 1
- LKBBOPGQDRPCDS-UHFFFAOYSA-N Oxaunomycin Natural products C12=C(O)C=3C(=O)C4=C(O)C=CC=C4C(=O)C=3C(O)=C2C(O)C(CC)(O)CC1OC1CC(N)C(O)C(C)O1 LKBBOPGQDRPCDS-UHFFFAOYSA-N 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- VYOQBYCIIJYKJA-UHFFFAOYSA-N Palauamine Natural products C1N2C(=O)C3=CC=CN3C3N=C(N)NC32C2C1C(CN)C(Cl)C12NC(N)=NC1O VYOQBYCIIJYKJA-UHFFFAOYSA-N 0.000 description 1
- FRCJDPPXHQGEKS-UHFFFAOYSA-N Parabactin Natural products CC1OC(=NC1C(=O)N(CCCCNC(=O)c1cccc(O)c1O)CCCNC(=O)c1cccc(O)c1O)c1ccccc1O FRCJDPPXHQGEKS-UHFFFAOYSA-N 0.000 description 1
- 201000011152 Pemphigus Diseases 0.000 description 1
- LRBQNJMCXXYXIU-PPKXGCFTSA-N Penta-digallate-beta-D-glucose Natural products OC1=C(O)C(O)=CC(C(=O)OC=2C(=C(O)C=C(C=2)C(=O)OC[C@@H]2[C@H]([C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)O2)OC(=O)C=2C=C(OC(=O)C=3C=C(O)C(O)=C(O)C=3)C(O)=C(O)C=2)O)=C1 LRBQNJMCXXYXIU-PPKXGCFTSA-N 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 208000031845 Pernicious anaemia Diseases 0.000 description 1
- OZILORBBPKKGRI-RYUDHWBXSA-N Phe-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 OZILORBBPKKGRI-RYUDHWBXSA-N 0.000 description 1
- PCNDJXKNXGMECE-UHFFFAOYSA-N Phenazine Natural products C1=CC=CC2=NC3=CC=CC=C3N=C21 PCNDJXKNXGMECE-UHFFFAOYSA-N 0.000 description 1
- APNRZHLOPQFNMR-UHFFFAOYSA-N Phenazinomycin Natural products C12=CC=CC=C2N=C(C(C=CC=2)=O)C=2N1CC=C(C)CCC1C(=C)CCCC1(C)C APNRZHLOPQFNMR-UHFFFAOYSA-N 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical group OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 1
- ABLZXFCXXLZCGV-UHFFFAOYSA-N Phosphorous acid Chemical group OP(O)=O ABLZXFCXXLZCGV-UHFFFAOYSA-N 0.000 description 1
- KMSKQZKKOZQFFG-HSUXVGOQSA-N Pirarubicin Chemical compound O([C@H]1[C@@H](N)C[C@@H](O[C@H]1C)O[C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1CCCCO1 KMSKQZKKOZQFFG-HSUXVGOQSA-N 0.000 description 1
- 102100030304 Platelet factor 4 Human genes 0.000 description 1
- 206010065159 Polychondritis Diseases 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 208000007048 Polymyalgia Rheumatica Diseases 0.000 description 1
- NPYPAHLBTDXSSS-UHFFFAOYSA-N Potassium ion Chemical compound [K+] NPYPAHLBTDXSSS-UHFFFAOYSA-N 0.000 description 1
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- PICZCWCKOLHDOJ-UHFFFAOYSA-N Pseudoaxinellin Natural products N1C(=O)C2CCCN2C(=O)C(CC(N)=O)NC(=O)C(C(C)C)NC(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C(C(C)C)NC(=O)C1CC1=CC=CC=C1 PICZCWCKOLHDOJ-UHFFFAOYSA-N 0.000 description 1
- 108700033844 Pseudomonas aeruginosa toxA Proteins 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 1
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 1
- KYQCOXFCLRTKLS-UHFFFAOYSA-N Pyrazine Natural products C1=CN=CC=N1 KYQCOXFCLRTKLS-UHFFFAOYSA-N 0.000 description 1
- 102000009572 RNA Polymerase II Human genes 0.000 description 1
- 108010009460 RNA Polymerase II Proteins 0.000 description 1
- 241000700157 Rattus norvegicus Species 0.000 description 1
- 208000003782 Raynaud disease Diseases 0.000 description 1
- 208000012322 Raynaud phenomenon Diseases 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 208000033464 Reiter syndrome Diseases 0.000 description 1
- OWPCHSCAPHNHAV-UHFFFAOYSA-N Rhizoxin Natural products C1C(O)C2(C)OC2C=CC(C)C(OC(=O)C2)CC2CC2OC2C(=O)OC1C(C)C(OC)C(C)=CC=CC(C)=CC1=COC(C)=N1 OWPCHSCAPHNHAV-UHFFFAOYSA-N 0.000 description 1
- 101710158076 Ribosome-inactivating protein Proteins 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- GCPUVEMWOWMALU-UHFFFAOYSA-N Rubiginone B1 Natural products C1C(C)CC(O)C2=C1C=CC1=C2C(=O)C(C=CC=C2OC)=C2C1=O GCPUVEMWOWMALU-UHFFFAOYSA-N 0.000 description 1
- 108010005173 SERPIN-B5 Proteins 0.000 description 1
- OTKJDMGTUTTYMP-ROUUACIJSA-N Safingol ( L-threo-sphinganine) Chemical compound CCCCCCCCCCCCCCC[C@H](O)[C@@H](N)CO OTKJDMGTUTTYMP-ROUUACIJSA-N 0.000 description 1
- YADVRLOQIWILGX-MIWLTHJTSA-N Sarcophytol A Chemical compound CC(C)C/1=C/C=C(C)/CC\C=C(C)\CC\C=C(C)\C[C@@H]\1O YADVRLOQIWILGX-MIWLTHJTSA-N 0.000 description 1
- 102100030333 Serpin B5 Human genes 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- OCOKWVBYZHBHLU-UHFFFAOYSA-N Sobuzoxane Chemical compound C1C(=O)N(COC(=O)OCC(C)C)C(=O)CN1CCN1CC(=O)N(COC(=O)OCC(C)C)C(=O)C1 OCOKWVBYZHBHLU-UHFFFAOYSA-N 0.000 description 1
- FKNQFGJONOIPTF-UHFFFAOYSA-N Sodium cation Chemical compound [Na+] FKNQFGJONOIPTF-UHFFFAOYSA-N 0.000 description 1
- 206010072148 Stiff-Person syndrome Diseases 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- CYQFCXCEBYINGO-UHFFFAOYSA-N THC Natural products C1=C(C)CCC2C(C)(C)OC3=CC(CCCCC)=CC(O)=C3C21 CYQFCXCEBYINGO-UHFFFAOYSA-N 0.000 description 1
- 208000001106 Takayasu Arteritis Diseases 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 1
- FZWLAAWBMGSTSO-UHFFFAOYSA-N Thiazole Chemical group C1=CSC=N1 FZWLAAWBMGSTSO-UHFFFAOYSA-N 0.000 description 1
- UPGGKUQISSWRJJ-XLTUSUNSSA-N Thiocoraline Chemical compound O=C([C@H]1CSSC[C@@H](N(C(=O)CNC2=O)C)C(=O)N(C)[C@@H](C(SC[C@@H](C(=O)NCC(=O)N1C)NC(=O)C=1C(=CC3=CC=CC=C3N=1)O)=O)CSC)N(C)[C@H](CSC)C(=O)SC[C@@H]2NC(=O)C1=NC2=CC=CC=C2C=C1O UPGGKUQISSWRJJ-XLTUSUNSSA-N 0.000 description 1
- 206010043561 Thrombocytopenic purpura Diseases 0.000 description 1
- IVTVGDXNLFLDRM-HNNXBMFYSA-N Tomudex Chemical compound C=1C=C2NC(C)=NC(=O)C2=CC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)S1 IVTVGDXNLFLDRM-HNNXBMFYSA-N 0.000 description 1
- VGQOVCHZGQWAOI-UHFFFAOYSA-N UNPD55612 Natural products N1C(O)C2CC(C=CC(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-UHFFFAOYSA-N 0.000 description 1
- 206010046851 Uveitis Diseases 0.000 description 1
- 244000000188 Vaccinium ovalifolium Species 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 206010047115 Vasculitis Diseases 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 206010047642 Vitiligo Diseases 0.000 description 1
- 208000003827 Vulvar Vestibulitis Diseases 0.000 description 1
- 208000003728 Vulvodynia Diseases 0.000 description 1
- 206010069055 Vulvovaginal pain Diseases 0.000 description 1
- ZZWKZQDOSJAGGF-VRSYWUPDSA-N [(1s,2e,7s,10e,12r,13r,15s)-12-hydroxy-7-methyl-9-oxo-8-oxabicyclo[11.3.0]hexadeca-2,10-dien-15-yl] 2-(dimethylamino)acetate Chemical compound O[C@@H]1\C=C\C(=O)O[C@@H](C)CCC\C=C\[C@@H]2C[C@H](OC(=O)CN(C)C)C[C@H]21 ZZWKZQDOSJAGGF-VRSYWUPDSA-N 0.000 description 1
- NBLHOLNNKJBEDC-XOGQCRKLSA-N [(2r,3s,4s,5r,6r)-2-[(2r,3s,4s,5s,6s)-2-[(1r,2s)-2-[[6-amino-2-[(1s)-3-amino-1-[[(2s)-2,3-diamino-3-oxopropyl]amino]-3-oxopropyl]-5-methylpyrimidine-4-carbonyl]amino]-3-[[(2r,3s,4s)-5-[[(2s,3r)-1-[2-[4-[4-[4-(diaminomethylideneamino)butylcarbamoyl]-1,3-th Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCCCN=C(N)N)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1NC=NC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C NBLHOLNNKJBEDC-XOGQCRKLSA-N 0.000 description 1
- IFJUINDAXYAPTO-UUBSBJJBSA-N [(8r,9s,13s,14s,17s)-17-[2-[4-[4-[bis(2-chloroethyl)amino]phenyl]butanoyloxy]acetyl]oxy-13-methyl-6,7,8,9,11,12,14,15,16,17-decahydrocyclopenta[a]phenanthren-3-yl] benzoate Chemical compound C([C@@H]1[C@@H](C2=CC=3)CC[C@]4([C@H]1CC[C@@H]4OC(=O)COC(=O)CCCC=1C=CC(=CC=1)N(CCCl)CCCl)C)CC2=CC=3OC(=O)C1=CC=CC=C1 IFJUINDAXYAPTO-UUBSBJJBSA-N 0.000 description 1
- XSMVECZRZBFTIZ-UHFFFAOYSA-M [2-(aminomethyl)cyclobutyl]methanamine;2-oxidopropanoate;platinum(4+) Chemical compound [Pt+4].CC([O-])C([O-])=O.NCC1CCC1CN XSMVECZRZBFTIZ-UHFFFAOYSA-M 0.000 description 1
- QPWBZVAOCWJTFK-UHFFFAOYSA-L [2-(azanidylmethyl)-3-hydroxy-2-(hydroxymethyl)propyl]azanide;cyclobutane-1,1-dicarboxylate;platinum(4+) Chemical compound [Pt+4].[NH-]CC(C[NH-])(CO)CO.[O-]C(=O)C1(C([O-])=O)CCC1 QPWBZVAOCWJTFK-UHFFFAOYSA-L 0.000 description 1
- ODEDPKNSRBCSDO-UHFFFAOYSA-N [2-(hexadecylsulfanylmethyl)-3-methoxypropyl] 2-(trimethylazaniumyl)ethyl phosphate Chemical compound CCCCCCCCCCCCCCCCSCC(COC)COP([O-])(=O)OCC[N+](C)(C)C ODEDPKNSRBCSDO-UHFFFAOYSA-N 0.000 description 1
- IEDXPSOJFSVCKU-HOKPPMCLSA-N [4-[[(2S)-5-(carbamoylamino)-2-[[(2S)-2-[6-(2,5-dioxopyrrolidin-1-yl)hexanoylamino]-3-methylbutanoyl]amino]pentanoyl]amino]phenyl]methyl N-[(2S)-1-[[(2S)-1-[[(3R,4S,5S)-1-[(2S)-2-[(1R,2R)-3-[[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-methylamino]-3-methyl-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]-N-methylcarbamate Chemical group CC[C@H](C)[C@@H]([C@@H](CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)c1ccccc1)OC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)OCc1ccc(NC(=O)[C@H](CCCNC(N)=O)NC(=O)[C@@H](NC(=O)CCCCCN2C(=O)CCC2=O)C(C)C)cc1)C(C)C IEDXPSOJFSVCKU-HOKPPMCLSA-N 0.000 description 1
- GZOSMCIZMLWJML-VJLLXTKPSA-N abiraterone Chemical compound C([C@H]1[C@H]2[C@@H]([C@]3(CC[C@H](O)CC3=CC2)C)CC[C@@]11C)C=C1C1=CC=CN=C1 GZOSMCIZMLWJML-VJLLXTKPSA-N 0.000 description 1
- 229960000853 abiraterone Drugs 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 150000001241 acetals Chemical class 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 125000000641 acridinyl group Chemical group C1(=CC=CC2=NC3=CC=CC=C3C=C12)* 0.000 description 1
- 125000003647 acryloyl group Chemical group O=C([*])C([H])=C([H])[H] 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- HLAKJNQXUARACO-UHFFFAOYSA-N acylfulvene Natural products CC1(O)C(=O)C2=CC(C)=CC2=C(C)C21CC2 HLAKJNQXUARACO-UHFFFAOYSA-N 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- DPGOLRILOKERAV-AAWJQDODSA-N adecypenol Chemical compound OC1C(CO)=CCC1(O)N1C(N=CNC[C@H]2O)C2N=C1 DPGOLRILOKERAV-AAWJQDODSA-N 0.000 description 1
- WJSAFKJWCOMTLH-UHFFFAOYSA-N adecypenol Natural products OC1C(O)C(CO)=CC1N1C(NC=NCC2O)=C2N=C1 WJSAFKJWCOMTLH-UHFFFAOYSA-N 0.000 description 1
- 229950004955 adozelesin Drugs 0.000 description 1
- BYRVKDUQDLJUBX-JJCDCTGGSA-N adozelesin Chemical compound C1=CC=C2OC(C(=O)NC=3C=C4C=C(NC4=CC=3)C(=O)N3C[C@H]4C[C@]44C5=C(C(C=C43)=O)NC=C5C)=CC2=C1 BYRVKDUQDLJUBX-JJCDCTGGSA-N 0.000 description 1
- 229940009456 adriamycin Drugs 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 108010011559 alanylphenylalanine Proteins 0.000 description 1
- 125000003158 alcohol group Chemical group 0.000 description 1
- 229960005310 aldesleukin Drugs 0.000 description 1
- 108700025316 aldesleukin Proteins 0.000 description 1
- 230000002152 alkylating effect Effects 0.000 description 1
- 208000032775 alopecia universalis congenita Diseases 0.000 description 1
- 229960000473 altretamine Drugs 0.000 description 1
- 229950010817 alvocidib Drugs 0.000 description 1
- BIIVYFLTOXDAOV-YVEFUNNKSA-N alvocidib Chemical compound O[C@@H]1CN(C)CC[C@@H]1C1=C(O)C=C(O)C2=C1OC(C=1C(=CC=CC=1)Cl)=CC2=O BIIVYFLTOXDAOV-YVEFUNNKSA-N 0.000 description 1
- 229950010949 ambamustine Drugs 0.000 description 1
- 229960001097 amifostine Drugs 0.000 description 1
- 229960002749 aminolevulinic acid Drugs 0.000 description 1
- 150000005005 aminopyrimidines Chemical class 0.000 description 1
- 210000004381 amniotic fluid Anatomy 0.000 description 1
- 229960002550 amrubicin Drugs 0.000 description 1
- VJZITPJGSQKZMX-XDPRQOKASA-N amrubicin Chemical compound O([C@H]1C[C@](CC2=C(O)C=3C(=O)C4=CC=CC=C4C(=O)C=3C(O)=C21)(N)C(=O)C)[C@H]1C[C@H](O)[C@H](O)CO1 VJZITPJGSQKZMX-XDPRQOKASA-N 0.000 description 1
- 229960001220 amsacrine Drugs 0.000 description 1
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 1
- 229960001694 anagrelide Drugs 0.000 description 1
- OTBXOEAOVRKTNQ-UHFFFAOYSA-N anagrelide Chemical compound N1=C2NC(=O)CN2CC2=C(Cl)C(Cl)=CC=C21 OTBXOEAOVRKTNQ-UHFFFAOYSA-N 0.000 description 1
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 1
- 229960002932 anastrozole Drugs 0.000 description 1
- ASLUCFFROXVMFL-UHFFFAOYSA-N andrographolide Natural products CC1(CO)C(O)CCC2(C)C(CC=C3/C(O)OCC3=O)C(=C)CCC12 ASLUCFFROXVMFL-UHFFFAOYSA-N 0.000 description 1
- 239000004037 angiogenesis inhibitor Substances 0.000 description 1
- 229940121369 angiogenesis inhibitor Drugs 0.000 description 1
- 150000008064 anhydrides Chemical class 0.000 description 1
- SMWDFEZZVXVKRB-UHFFFAOYSA-N anhydrous quinoline Natural products N1=CC=CC2=CC=CC=C21 SMWDFEZZVXVKRB-UHFFFAOYSA-N 0.000 description 1
- 150000001449 anionic compounds Chemical class 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 108010070670 antarelix Proteins 0.000 description 1
- 125000002178 anthracenyl group Chemical group C1(=CC=CC2=CC3=CC=CC=C3C=C12)* 0.000 description 1
- VGQOVCHZGQWAOI-HYUHUPJXSA-N anthramycin Chemical compound N1[C@@H](O)[C@@H]2CC(\C=C\C(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-HYUHUPJXSA-N 0.000 description 1
- 230000002280 anti-androgenic effect Effects 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 229940046836 anti-estrogen Drugs 0.000 description 1
- 230000001833 anti-estrogenic effect Effects 0.000 description 1
- 230000000843 anti-fungal effect Effects 0.000 description 1
- 230000003302 anti-idiotype Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 239000000051 antiandrogen Substances 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000003080 antimitotic agent Substances 0.000 description 1
- 239000003972 antineoplastic antibiotic Substances 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 229940045985 antineoplastic platinum compound Drugs 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- IOASYARYEYRREA-LQAJYKIKSA-N aphidicolin glycinate Chemical compound C1[C@]23[C@]4(C)CC[C@H](O)[C@](C)(CO)[C@H]4CC[C@@H]3C[C@@H]1[C@@](COC(=O)CN)(O)CC2 IOASYARYEYRREA-LQAJYKIKSA-N 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 150000005840 aryl radicals Chemical class 0.000 description 1
- 238000002820 assay format Methods 0.000 description 1
- TWHSQQYCDVSBRK-UHFFFAOYSA-N asulacrine Chemical compound C12=CC=CC(C)=C2N=C2C(C(=O)NC)=CC=CC2=C1NC1=CC=C(NS(C)(=O)=O)C=C1OC TWHSQQYCDVSBRK-UHFFFAOYSA-N 0.000 description 1
- 229950011088 asulacrine Drugs 0.000 description 1
- PEPMWUSGRKINHX-TXTPUJOMSA-N atamestane Chemical compound C1C[C@@H]2[C@@]3(C)C(C)=CC(=O)C=C3CC[C@H]2[C@@H]2CCC(=O)[C@]21C PEPMWUSGRKINHX-TXTPUJOMSA-N 0.000 description 1
- 229950004810 atamestane Drugs 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 229950006933 atrimustine Drugs 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 201000000448 autoimmune hemolytic anemia Diseases 0.000 description 1
- 208000006424 autoimmune oophoritis Diseases 0.000 description 1
- 108010093161 axinastatin 1 Proteins 0.000 description 1
- PICZCWCKOLHDOJ-GHTSNYPWSA-N axinastatin 1 Chemical compound C([C@H]1C(=O)N[C@H](C(=O)N[C@H](C(=O)N2CCC[C@H]2C(=O)N[C@H](C(N[C@@H](CC(N)=O)C(=O)N2CCC[C@H]2C(=O)N1)=O)C(C)C)C(C)C)C(C)C)C1=CC=CC=C1 PICZCWCKOLHDOJ-GHTSNYPWSA-N 0.000 description 1
- 108010093000 axinastatin 2 Proteins 0.000 description 1
- OXNAATCTZCSVKR-AVGVIDKOSA-N axinastatin 2 Chemical compound C([C@H]1C(=O)N[C@H](C(=O)N[C@H](C(N2CCC[C@H]2C(=O)N[C@@H](C(=O)N[C@@H](CC(N)=O)C(=O)N2CCC[C@H]2C(=O)N1)C(C)C)=O)CC(C)C)C(C)C)C1=CC=CC=C1 OXNAATCTZCSVKR-AVGVIDKOSA-N 0.000 description 1
- UZCPCRPHNVHKKP-UHFFFAOYSA-N axinastatin 2 Natural products CC(C)CC1NC(=O)C2CCCN2C(=O)C(NC(=O)C(CC(=O)N)NC(=O)C3CCCN3C(=O)C(Cc4ccccc4)NC(=O)C(NC1=O)C(C)C)C(C)C UZCPCRPHNVHKKP-UHFFFAOYSA-N 0.000 description 1
- 108010092978 axinastatin 3 Proteins 0.000 description 1
- ANLDPEXRVVIABH-WUUSPZRJSA-N axinastatin 3 Chemical compound C([C@H]1C(=O)N[C@H](C(N[C@@H](CC(C)C)C(=O)N2CCC[C@H]2C(=O)N[C@@H](C(=O)N[C@@H](CC(N)=O)C(=O)N2CCC[C@H]2C(=O)N1)C(C)C)=O)[C@@H](C)CC)C1=CC=CC=C1 ANLDPEXRVVIABH-WUUSPZRJSA-N 0.000 description 1
- RTGMQVUKARGBNM-UHFFFAOYSA-N axinastatin 3 Natural products CCC(C)C1NC(=O)C(CC(C)C)NC(=O)C2CCCN2C(=O)C(NC(=O)C(CC(=O)N)NC(=O)C3CCCN3C(=O)C(Cc4ccccc4)NC1=O)C(C)C RTGMQVUKARGBNM-UHFFFAOYSA-N 0.000 description 1
- OPWOOOGFNULJAQ-UHFFFAOYSA-L azane;cyclopentanamine;2-hydroxybutanedioate;platinum(2+) Chemical compound N.[Pt+2].NC1CCCC1.[O-]C(=O)C(O)CC([O-])=O OPWOOOGFNULJAQ-UHFFFAOYSA-L 0.000 description 1
- GRHLMSBCOPRFNA-UHFFFAOYSA-M azanide 2-oxidoacetate platinum(4+) Chemical compound N[Pt]1(N)OCC(=O)O1 GRHLMSBCOPRFNA-UHFFFAOYSA-M 0.000 description 1
- 229950005951 azasetron Drugs 0.000 description 1
- MIXLRUYCYZPSOQ-HXPMCKFVSA-N azatoxin Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=C(C4=CC=CC=C4N3)C[C@@H]3N2C(OC3)=O)=C1 MIXLRUYCYZPSOQ-HXPMCKFVSA-N 0.000 description 1
- 150000004200 baccatin III derivatives Chemical class 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- XYUFCXJZFZPEJD-PGRDOPGGSA-N balanol Chemical compound OC(=O)C1=CC=CC(O)=C1C(=O)C1=C(O)C=C(C(=O)O[C@H]2[C@H](CNCCC2)NC(=O)C=2C=CC(O)=CC=2)C=C1O XYUFCXJZFZPEJD-PGRDOPGGSA-N 0.000 description 1
- XFILPEOLDIKJHX-QYZOEREBSA-N batimastat Chemical compound C([C@@H](C(=O)NC)NC(=O)[C@H](CC(C)C)[C@H](CSC=1SC=CC=1)C(=O)NO)C1=CC=CC=C1 XFILPEOLDIKJHX-QYZOEREBSA-N 0.000 description 1
- 229950001858 batimastat Drugs 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 125000003785 benzimidazolyl group Chemical group N1=C(NC2=C1C=CC=C2)* 0.000 description 1
- 125000004603 benzisoxazolyl group Chemical group O1N=C(C2=C1C=CC=C2)* 0.000 description 1
- 125000000499 benzofuranyl group Chemical group O1C(=CC2=C1C=CC=C2)* 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid group Chemical group C(C1=CC=CC=C1)(=O)O WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- 125000003354 benzotriazolyl group Chemical group N1N=NC2=C1C=CC=C2* 0.000 description 1
- 125000003236 benzoyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C(*)=O 0.000 description 1
- 125000000051 benzyloxy group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])O* 0.000 description 1
- QGJZLNKBHJESQX-FZFNOLFKSA-N betulinic acid Chemical compound C1C[C@H](O)C(C)(C)[C@@H]2CC[C@@]3(C)[C@]4(C)CC[C@@]5(C(O)=O)CC[C@@H](C(=C)C)[C@@H]5[C@H]4CC[C@@H]3[C@]21C QGJZLNKBHJESQX-FZFNOLFKSA-N 0.000 description 1
- 229960000997 bicalutamide Drugs 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 235000010290 biphenyl Nutrition 0.000 description 1
- 239000004305 biphenyl Substances 0.000 description 1
- 229950008548 bisantrene Drugs 0.000 description 1
- 229950002370 bisnafide Drugs 0.000 description 1
- NPSOIFAWYAHWOH-UHFFFAOYSA-N bistratene A Natural products O1C(CC(=O)C=CC)CCC(O2)(O)CC(C)C2CCCNC(=O)C(C)C2OC(CCC(C)C=C(C)C(C)O)CCCCC(C)C1CC(=O)NC2 NPSOIFAWYAHWOH-UHFFFAOYSA-N 0.000 description 1
- 229950006844 bizelesin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- NBLHOLNNKJBEDC-UHFFFAOYSA-N bleomycin B2 Natural products N=1C(C=2SC=C(N=2)C(=O)NCCCCN=C(N)N)=CSC=1CCNC(=O)C(C(O)C)NC(=O)C(C)C(O)C(C)NC(=O)C(C(OC1C(C(O)C(O)C(CO)O1)OC1C(C(OC(N)=O)C(O)C(CO)O1)O)C=1NC=NC=1)NC(=O)C1=NC(C(CC(N)=O)NCC(N)C(N)=O)=NC(N)=C1C NBLHOLNNKJBEDC-UHFFFAOYSA-N 0.000 description 1
- 239000012503 blood component Substances 0.000 description 1
- 201000008275 breast carcinoma Diseases 0.000 description 1
- 229910052794 bromium Inorganic materials 0.000 description 1
- 229950009494 bropirimine Drugs 0.000 description 1
- 229950002361 budotitane Drugs 0.000 description 1
- 208000000594 bullous pemphigoid Diseases 0.000 description 1
- LWQQLNNNIPYSNX-UROSTWAQSA-N calcipotriol Chemical compound C1([C@H](O)/C=C/[C@@H](C)[C@@H]2[C@]3(CCCC(/[C@@H]3CC2)=C\C=C\2C([C@@H](O)C[C@H](O)C/2)=C)C)CC1 LWQQLNNNIPYSNX-UROSTWAQSA-N 0.000 description 1
- 229960002882 calcipotriol Drugs 0.000 description 1
- 229910001424 calcium ion Inorganic materials 0.000 description 1
- LSUTUUOITDQYNO-UHFFFAOYSA-N calphostin C Chemical compound C=12C3=C4C(CC(C)OC(=O)C=5C=CC=CC=5)=C(OC)C(O)=C(C(C=C5OC)=O)C4=C5C=1C(OC)=CC(=O)C2=C(O)C(OC)=C3CC(C)OC(=O)OC1=CC=C(O)C=C1 LSUTUUOITDQYNO-UHFFFAOYSA-N 0.000 description 1
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical class C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- 125000000609 carbazolyl group Chemical group C1(=CC=CC=2C3=CC=CC=C3NC12)* 0.000 description 1
- 125000004452 carbocyclyl group Chemical group 0.000 description 1
- 125000005587 carbonate group Chemical group 0.000 description 1
- 150000004649 carbonic acid derivatives Chemical class 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- WNRZHQBJSXRYJK-UHFFFAOYSA-N carboxyamidotriazole Chemical compound NC1=C(C(=O)N)N=NN1CC(C=C1Cl)=CC(Cl)=C1C(=O)C1=CC=C(Cl)C=C1 WNRZHQBJSXRYJK-UHFFFAOYSA-N 0.000 description 1
- 150000007942 carboxylates Chemical class 0.000 description 1
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- BBZDXMBRAFTCAA-AREMUKBSSA-N carzelesin Chemical compound C1=2NC=C(C)C=2C([C@H](CCl)CN2C(=O)C=3NC4=CC=C(C=C4C=3)NC(=O)C3=CC4=CC=C(C=C4O3)N(CC)CC)=C2C=C1OC(=O)NC1=CC=CC=C1 BBZDXMBRAFTCAA-AREMUKBSSA-N 0.000 description 1
- 229950007509 carzelesin Drugs 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000002458 cell surface marker Substances 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- SBNPWPIBESPSIF-MHWMIDJBSA-N cetrorelix Chemical compound C([C@@H](C(=O)N[C@H](CCCNC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)N[C@H](C)C(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](CC=1C=NC=CC=1)NC(=O)[C@@H](CC=1C=CC(Cl)=CC=1)NC(=O)[C@@H](CC=1C=C2C=CC=CC2=CC=1)NC(C)=O)C1=CC=C(O)C=C1 SBNPWPIBESPSIF-MHWMIDJBSA-N 0.000 description 1
- 108700008462 cetrorelix Proteins 0.000 description 1
- 229960003230 cetrorelix Drugs 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- UKTAZPQNNNJVKR-KJGYPYNMSA-N chembl2368925 Chemical compound C1=CC=C2C(C(O[C@@H]3C[C@@H]4C[C@H]5C[C@@H](N4CC5=O)C3)=O)=CNC2=C1 UKTAZPQNNNJVKR-KJGYPYNMSA-N 0.000 description 1
- DCKFXSZUWVWFEU-JECTWPLRSA-N chembl499423 Chemical compound O1[C@@H](CC)CCCC[C@]11NC(N23)=N[C@]4(O[C@H](C)CCC4)[C@@H](C(=O)OCCCCCCCCCCCCCCCC(=O)N(CCCN)C[C@@H](O)CCN)[C@@]3(O)CC[C@H]2C1 DCKFXSZUWVWFEU-JECTWPLRSA-N 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 150000004035 chlorins Chemical class 0.000 description 1
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 1
- 229960001231 choline Drugs 0.000 description 1
- 210000004252 chorionic villi Anatomy 0.000 description 1
- 125000003016 chromanyl group Chemical group O1C(CCC2=CC=CC=C12)* 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 201000005795 chronic inflammatory demyelinating polyneuritis Diseases 0.000 description 1
- 208000025302 chronic primary adrenal insufficiency Diseases 0.000 description 1
- ARUGKOZUKWAXDS-SEWALLKFSA-N cicaprost Chemical compound C1\C(=C/COCC(O)=O)C[C@@H]2[C@@H](C#C[C@@H](O)[C@@H](C)CC#CCC)[C@H](O)C[C@@H]21 ARUGKOZUKWAXDS-SEWALLKFSA-N 0.000 description 1
- 229950000634 cicaprost Drugs 0.000 description 1
- 125000000259 cinnolinyl group Chemical group N1=NC(=CC2=CC=CC=C12)* 0.000 description 1
- JKNIRLKHOOMGOJ-UHFFFAOYSA-N cladochrome D Natural products COC1=C(CC(C)OC(=O)Oc2ccc(O)cc2)c3c4C(=C(OC)C(=O)c5c(O)cc(OC)c(c45)c6c(OC)cc(O)c(C1=O)c36)CC(C)OC(=O)c7ccc(O)cc7 JKNIRLKHOOMGOJ-UHFFFAOYSA-N 0.000 description 1
- SRJYZPCBWDVSGO-UHFFFAOYSA-N cladochrome E Natural products COC1=CC(O)=C(C(C(OC)=C(CC(C)OC(=O)OC=2C=CC(O)=CC=2)C2=3)=O)C2=C1C1=C(OC)C=C(O)C(C(C=2OC)=O)=C1C=3C=2CC(C)OC(=O)C1=CC=CC=C1 SRJYZPCBWDVSGO-UHFFFAOYSA-N 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- GKIRPKYJQBWNGO-OCEACIFDSA-N clomifene Chemical compound C1=CC(OCCN(CC)CC)=CC=C1C(\C=1C=CC=CC=1)=C(\Cl)C1=CC=CC=C1 GKIRPKYJQBWNGO-OCEACIFDSA-N 0.000 description 1
- 229960003608 clomifene Drugs 0.000 description 1
- VNFPBHJOKIVQEB-UHFFFAOYSA-N clotrimazole Chemical compound ClC1=CC=CC=C1C(N1C=NC=C1)(C=1C=CC=CC=1)C1=CC=CC=C1 VNFPBHJOKIVQEB-UHFFFAOYSA-N 0.000 description 1
- 229960004022 clotrimazole Drugs 0.000 description 1
- 208000008609 collagenous colitis Diseases 0.000 description 1
- 229960005537 combretastatin A-4 Drugs 0.000 description 1
- HVXBOLULGPECHP-UHFFFAOYSA-N combretastatin A4 Natural products C1=C(O)C(OC)=CC=C1C=CC1=CC(OC)=C(OC)C(OC)=C1 HVXBOLULGPECHP-UHFFFAOYSA-N 0.000 description 1
- 150000004814 combretastatins Chemical class 0.000 description 1
- 230000009137 competitive binding Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- GLESHRYLRAOJPS-DHCFDGJBSA-N conagenin Chemical compound C[C@@H](O)[C@H](C)[C@@H](O)C(=O)N[C@@](C)(CO)C(O)=O GLESHRYLRAOJPS-DHCFDGJBSA-N 0.000 description 1
- 230000001143 conditioned effect Effects 0.000 description 1
- 239000013068 control sample Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- SBRXTSOCZITGQG-UHFFFAOYSA-N crisnatol Chemical compound C1=CC=C2C(CNC(CO)(CO)C)=CC3=C(C=CC=C4)C4=CC=C3C2=C1 SBRXTSOCZITGQG-UHFFFAOYSA-N 0.000 description 1
- 229950007258 crisnatol Drugs 0.000 description 1
- 201000003278 cryoglobulinemia Diseases 0.000 description 1
- PSNOPSMXOBPNNV-VVCTWANISA-N cryptophycin 1 Chemical class C1=C(Cl)C(OC)=CC=C1C[C@@H]1C(=O)NC[C@@H](C)C(=O)O[C@@H](CC(C)C)C(=O)O[C@H]([C@H](C)[C@@H]2[C@H](O2)C=2C=CC=CC=2)C/C=C/C(=O)N1 PSNOPSMXOBPNNV-VVCTWANISA-N 0.000 description 1
- 108010090203 cryptophycin 8 Proteins 0.000 description 1
- 238000012926 crystallographic analysis Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 125000001995 cyclobutyl group Chemical group [H]C1([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000000582 cycloheptyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- NZNMSOFKMUBTKW-UHFFFAOYSA-N cyclohexanecarboxylic acid Chemical compound OC(=O)C1CCCCC1 NZNMSOFKMUBTKW-UHFFFAOYSA-N 0.000 description 1
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 125000000640 cyclooctyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 125000001511 cyclopentyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000001559 cyclopropyl group Chemical group [H]C1([H])C([H])([H])C1([H])* 0.000 description 1
- 108010041566 cypemycin Proteins 0.000 description 1
- 229950006614 cytarabine ocfosfate Drugs 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 230000001085 cytostatic effect Effects 0.000 description 1
- 231100000050 cytotoxic potential Toxicity 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- 125000004856 decahydroquinolinyl group Chemical group N1(CCCC2CCCCC12)* 0.000 description 1
- 229960003603 decitabine Drugs 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- CYQFCXCEBYINGO-IAGOWNOFSA-N delta1-THC Chemical compound C1=C(C)CC[C@H]2C(C)(C)OC3=CC(CCCCC)=CC(O)=C3[C@@H]21 CYQFCXCEBYINGO-IAGOWNOFSA-N 0.000 description 1
- 201000001981 dermatomyositis Diseases 0.000 description 1
- 229960005408 deslorelin Drugs 0.000 description 1
- 108700025485 deslorelin Proteins 0.000 description 1
- 229910052805 deuterium Inorganic materials 0.000 description 1
- 229960000605 dexrazoxane Drugs 0.000 description 1
- SGTNSNPWRIOYBX-HHHXNRCGSA-N dexverapamil Chemical compound C1=C(OC)C(OC)=CC=C1CCN(C)CCC[C@@](C#N)(C(C)C)C1=CC=C(OC)C(OC)=C1 SGTNSNPWRIOYBX-HHHXNRCGSA-N 0.000 description 1
- 229950005878 dexverapamil Drugs 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- WVYXNIXAMZOZFK-UHFFFAOYSA-N diaziquone Chemical compound O=C1C(NC(=O)OCC)=C(N2CC2)C(=O)C(NC(=O)OCC)=C1N1CC1 WVYXNIXAMZOZFK-UHFFFAOYSA-N 0.000 description 1
- 229950002389 diaziquone Drugs 0.000 description 1
- 125000000664 diazo group Chemical group [N-]=[N+]=[*] 0.000 description 1
- KYHUYMLIVQFXRI-UHFFFAOYSA-N didemnin B Natural products CC1OC(=O)C(CC=2C=CC(OC)=CC=2)N(C)C(=O)C2CCCN2C(=O)C(CC(C)C)NC(=O)C(C)C(=O)C(C(C)C)OC(=O)CC(O)C(C(C)CC)NC(=O)C1NC(=O)C(CC(C)C)N(C)C(=O)C1CCCN1C(=O)C(C)O KYHUYMLIVQFXRI-UHFFFAOYSA-N 0.000 description 1
- 108010061297 didemnins Proteins 0.000 description 1
- ZBCBWPMODOFKDW-UHFFFAOYSA-N diethanolamine Chemical compound OCCNCCO ZBCBWPMODOFKDW-UHFFFAOYSA-N 0.000 description 1
- HPNMFZURTQLUMO-UHFFFAOYSA-N diethylamine Chemical compound CCNCC HPNMFZURTQLUMO-UHFFFAOYSA-N 0.000 description 1
- 238000002050 diffraction method Methods 0.000 description 1
- 150000004683 dihydrates Chemical class 0.000 description 1
- PZXJOHSZQAEJFE-UHFFFAOYSA-N dihydrobetulinic acid Natural products C1CC(O)C(C)(C)C2CCC3(C)C4(C)CCC5(C(O)=O)CCC(C(C)C)C5C4CCC3C21C PZXJOHSZQAEJFE-UHFFFAOYSA-N 0.000 description 1
- OTKJDMGTUTTYMP-UHFFFAOYSA-N dihydrosphingosine Natural products CCCCCCCCCCCCCCCC(O)C(N)CO OTKJDMGTUTTYMP-UHFFFAOYSA-N 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 229940042396 direct acting antivirals thiosemicarbazones Drugs 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 150000002019 disulfides Chemical class 0.000 description 1
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 229960000735 docosanol Drugs 0.000 description 1
- 229960003413 dolasetron Drugs 0.000 description 1
- 230000007783 downstream signaling Effects 0.000 description 1
- ZWAOHEXOSAUJHY-ZIYNGMLESA-N doxifluridine Chemical compound O[C@@H]1[C@H](O)[C@@H](C)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ZWAOHEXOSAUJHY-ZIYNGMLESA-N 0.000 description 1
- 229950005454 doxifluridine Drugs 0.000 description 1
- 229960002918 doxorubicin hydrochloride Drugs 0.000 description 1
- 229950004203 droloxifene Drugs 0.000 description 1
- 229960004242 dronabinol Drugs 0.000 description 1
- 238000009510 drug design Methods 0.000 description 1
- 229960005501 duocarmycin Drugs 0.000 description 1
- 229930184221 duocarmycin Natural products 0.000 description 1
- 229960005510 duocarmycin SA Drugs 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 208000019479 dysautonomia Diseases 0.000 description 1
- 229950010033 ebselen Drugs 0.000 description 1
- 229950005678 ecomustine Drugs 0.000 description 1
- 229950011461 edelfosine Drugs 0.000 description 1
- 229960001776 edrecolomab Drugs 0.000 description 1
- 230000002500 effect on skin Effects 0.000 description 1
- VLCYCQAOQCDTCN-UHFFFAOYSA-N eflornithine Chemical compound NCCCC(N)(C(F)F)C(O)=O VLCYCQAOQCDTCN-UHFFFAOYSA-N 0.000 description 1
- 229960002759 eflornithine Drugs 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 229940087477 ellence Drugs 0.000 description 1
- 229950005450 emitefur Drugs 0.000 description 1
- JOZGNYDSEBIJDH-UHFFFAOYSA-N eniluracil Chemical compound O=C1NC=C(C#C)C(=O)N1 JOZGNYDSEBIJDH-UHFFFAOYSA-N 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- YJGVMLPVUAXIQN-UHFFFAOYSA-N epipodophyllotoxin Natural products COC1=C(OC)C(OC)=CC(C2C3=CC=4OCOC=4C=C3C(O)C3C2C(OC3)=O)=C1 YJGVMLPVUAXIQN-UHFFFAOYSA-N 0.000 description 1
- HESCAJZNRMSMJG-HGYUPSKWSA-N epothilone A Natural products O=C1[C@H](C)[C@H](O)[C@H](C)CCC[C@H]2O[C@H]2C[C@@H](/C(=C\c2nc(C)sc2)/C)OC(=O)C[C@H](O)C1(C)C HESCAJZNRMSMJG-HGYUPSKWSA-N 0.000 description 1
- 150000003884 epothilone A derivatives Chemical class 0.000 description 1
- QXRSDHAAWVKZLJ-PVYNADRNSA-N epothilone B Chemical compound C/C([C@@H]1C[C@@H]2O[C@]2(C)CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)O1)O)C)=C\C1=CSC(C)=N1 QXRSDHAAWVKZLJ-PVYNADRNSA-N 0.000 description 1
- 229950009537 epristeride Drugs 0.000 description 1
- 230000008029 eradication Effects 0.000 description 1
- HCZKYJDFEPMADG-UHFFFAOYSA-N erythro-nordihydroguaiaretic acid Natural products C=1C=C(O)C(O)=CC=1CC(C)C(C)CC1=CC=C(O)C(O)=C1 HCZKYJDFEPMADG-UHFFFAOYSA-N 0.000 description 1
- 229960001842 estramustine Drugs 0.000 description 1
- FRPJXPJMRWBBIH-RBRWEJTLSA-N estramustine Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 FRPJXPJMRWBBIH-RBRWEJTLSA-N 0.000 description 1
- 239000000328 estrogen antagonist Substances 0.000 description 1
- HYSIJEPDMLSIQJ-UHFFFAOYSA-N ethanolate;1-phenylbutane-1,3-dione;titanium(4+) Chemical compound [Ti+4].CC[O-].CC[O-].CC(=O)[CH-]C(=O)C1=CC=CC=C1.CC(=O)[CH-]C(=O)C1=CC=CC=C1 HYSIJEPDMLSIQJ-UHFFFAOYSA-N 0.000 description 1
- XPGDODOEEWLHOI-GSDHBNRESA-N ethyl (2s)-2-[[(2s)-2-[[(2s)-2-amino-3-(4-fluorophenyl)propanoyl]amino]-3-[3-[bis(2-chloroethyl)amino]phenyl]propanoyl]amino]-4-methylsulfanylbutanoate Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)OCC)NC(=O)[C@@H](N)CC=1C=CC(F)=CC=1)C1=CC=CC(N(CCCl)CCCl)=C1 XPGDODOEEWLHOI-GSDHBNRESA-N 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 229960000752 etoposide phosphate Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000010228 ex vivo assay Methods 0.000 description 1
- 229960000255 exemestane Drugs 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 229950011548 fadrozole Drugs 0.000 description 1
- 229950005096 fazarabine Drugs 0.000 description 1
- NMUSYJAQQFHJEW-ARQDHWQXSA-N fazarabine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-ARQDHWQXSA-N 0.000 description 1
- 229950003662 fenretinide Drugs 0.000 description 1
- 229960004177 filgrastim Drugs 0.000 description 1
- DBEPLOCGEIEOCV-WSBQPABSSA-N finasteride Chemical compound N([C@@H]1CC2)C(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H](C(=O)NC(C)(C)C)[C@@]2(C)CC1 DBEPLOCGEIEOCV-WSBQPABSSA-N 0.000 description 1
- 229960004039 finasteride Drugs 0.000 description 1
- 229950006000 flezelastine Drugs 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 102000034287 fluorescent proteins Human genes 0.000 description 1
- 108091006047 fluorescent proteins Proteins 0.000 description 1
- 229950004217 forfenimex Drugs 0.000 description 1
- OSVMTWJCGUFAOD-KZQROQTASA-N formestane Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CCC2=C1O OSVMTWJCGUFAOD-KZQROQTASA-N 0.000 description 1
- 229960004421 formestane Drugs 0.000 description 1
- 229950010404 fostriecin Drugs 0.000 description 1
- YAKWPXVTIGTRJH-UHFFFAOYSA-N fotemustine Chemical compound CCOP(=O)(OCC)C(C)NC(=O)N(CCCl)N=O YAKWPXVTIGTRJH-UHFFFAOYSA-N 0.000 description 1
- 229960004783 fotemustine Drugs 0.000 description 1
- VZCYOOQTPOCHFL-OWOJBTEDSA-L fumarate(2-) Chemical compound [O-]C(=O)\C=C\C([O-])=O VZCYOOQTPOCHFL-OWOJBTEDSA-L 0.000 description 1
- 125000003838 furazanyl group Chemical group 0.000 description 1
- ZZUFCTLCJUWOSV-UHFFFAOYSA-N furosemide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C(O)=O)=C1NCC1=CC=CO1 ZZUFCTLCJUWOSV-UHFFFAOYSA-N 0.000 description 1
- 125000002541 furyl group Chemical group 0.000 description 1
- 229940044658 gallium nitrate Drugs 0.000 description 1
- 229950004410 galocitabine Drugs 0.000 description 1
- GJNXBNATEDXMAK-PFLSVRRQSA-N ganirelix Chemical compound C([C@@H](C(=O)N[C@H](CCCCN=C(NCC)NCC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN=C(NCC)NCC)C(=O)N1[C@@H](CCC1)C(=O)N[C@H](C)C(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](CC=1C=NC=CC=1)NC(=O)[C@@H](CC=1C=CC(Cl)=CC=1)NC(=O)[C@@H](CC=1C=C2C=CC=CC2=CC=1)NC(C)=O)C1=CC=C(O)C=C1 GJNXBNATEDXMAK-PFLSVRRQSA-N 0.000 description 1
- 108700032141 ganirelix Proteins 0.000 description 1
- 229960003794 ganirelix Drugs 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 239000002406 gelatinase inhibitor Substances 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- 229940097042 glucuronate Drugs 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- JFCQEDHGNNZCLN-UHFFFAOYSA-N glutaric acid Chemical compound OC(=O)CCCC(O)=O JFCQEDHGNNZCLN-UHFFFAOYSA-N 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 150000004820 halides Chemical group 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 125000004475 heteroaralkyl group Chemical group 0.000 description 1
- 150000002391 heterocyclic compounds Chemical class 0.000 description 1
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 1
- 208000002557 hidradenitis Diseases 0.000 description 1
- 201000007162 hidradenitis suppurativa Diseases 0.000 description 1
- 125000000717 hydrazino group Chemical group [H]N([*])N([H])[H] 0.000 description 1
- 150000007857 hydrazones Chemical class 0.000 description 1
- BHEPBYXIRTUNPN-UHFFFAOYSA-N hydridophosphorus(.) (triplet) Chemical compound [PH] BHEPBYXIRTUNPN-UHFFFAOYSA-N 0.000 description 1
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-M hydrogensulfate Chemical compound OS([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-M 0.000 description 1
- UWYVPFMHMJIBHE-OWOJBTEDSA-N hydroxymaleic acid group Chemical group O/C(/C(=O)O)=C/C(=O)O UWYVPFMHMJIBHE-OWOJBTEDSA-N 0.000 description 1
- 125000004029 hydroxymethyl group Chemical group [H]OC([H])([H])* 0.000 description 1
- MPGWGYQTRSNGDD-UHFFFAOYSA-N hypericin Chemical compound OC1=CC(O)=C(C2=O)C3=C1C1C(O)=CC(=O)C(C4=O)=C1C1=C3C3=C2C(O)=CC(C)=C3C2=C1C4=C(O)C=C2C MPGWGYQTRSNGDD-UHFFFAOYSA-N 0.000 description 1
- PHOKTTKFQUYZPI-UHFFFAOYSA-N hypericin Natural products Cc1cc(O)c2c3C(=O)C(=Cc4c(O)c5c(O)cc(O)c6c7C(=O)C(=Cc8c(C)c1c2c(c78)c(c34)c56)O)O PHOKTTKFQUYZPI-UHFFFAOYSA-N 0.000 description 1
- 229940005608 hypericin Drugs 0.000 description 1
- 229960005236 ibandronic acid Drugs 0.000 description 1
- 229940099279 idamycin Drugs 0.000 description 1
- 229950002248 idoxifene Drugs 0.000 description 1
- TZBDEVBNMSLVKT-UHFFFAOYSA-N idramantone Chemical compound C1C(C2)CC3CC1(O)CC2C3=O TZBDEVBNMSLVKT-UHFFFAOYSA-N 0.000 description 1
- 229950009926 idramantone Drugs 0.000 description 1
- 229950006905 ilmofosine Drugs 0.000 description 1
- NITYDPDXAAFEIT-DYVFJYSZSA-N ilomastat Chemical compound C1=CC=C2C(C[C@@H](C(=O)NC)NC(=O)[C@H](CC(C)C)CC(=O)NO)=CNC2=C1 NITYDPDXAAFEIT-DYVFJYSZSA-N 0.000 description 1
- 229960003696 ilomastat Drugs 0.000 description 1
- 125000002632 imidazolidinyl group Chemical group 0.000 description 1
- MTNDZQHUAFNZQY-UHFFFAOYSA-N imidazoline Chemical group C1CN=CN1 MTNDZQHUAFNZQY-UHFFFAOYSA-N 0.000 description 1
- 125000002636 imidazolinyl group Chemical group 0.000 description 1
- 125000002883 imidazolyl group Chemical group 0.000 description 1
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 1
- 229960002751 imiquimod Drugs 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 229960001438 immunostimulant agent Drugs 0.000 description 1
- 239000003022 immunostimulating agent Substances 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- PZOUSPYUWWUPPK-UHFFFAOYSA-N indole Chemical group CC1=CC=CC2=C1C=CN2 PZOUSPYUWWUPPK-UHFFFAOYSA-N 0.000 description 1
- RKJUIXBNRJVNHR-UHFFFAOYSA-N indolenine Chemical group C1=CC=C2CC=NC2=C1 RKJUIXBNRJVNHR-UHFFFAOYSA-N 0.000 description 1
- 125000004926 indolenyl group Chemical group 0.000 description 1
- 125000003406 indolizinyl group Chemical group C=1(C=CN2C=CC=CC12)* 0.000 description 1
- 125000001041 indolyl group Chemical group 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 229910001412 inorganic anion Inorganic materials 0.000 description 1
- 239000000138 intercalating agent Substances 0.000 description 1
- 230000016507 interphase Effects 0.000 description 1
- 208000036971 interstitial lung disease 2 Diseases 0.000 description 1
- 229960003795 iobenguane (123i) Drugs 0.000 description 1
- 229950000855 iroplact Drugs 0.000 description 1
- 229950010984 irsogladine Drugs 0.000 description 1
- 125000004936 isatinoyl group Chemical group N1(C(=O)C(=O)C2=CC=CC=C12)C(=O)* 0.000 description 1
- 125000003384 isochromanyl group Chemical group C1(OCCC2=CC=CC=C12)* 0.000 description 1
- GWVMLCQWXVFZCN-UHFFFAOYSA-N isoindoline Chemical group C1=CC=C2CNCC2=C1 GWVMLCQWXVFZCN-UHFFFAOYSA-N 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 125000002183 isoquinolinyl group Chemical group C1(=NC=CC2=CC=CC=C12)* 0.000 description 1
- ZLTPDFXIESTBQG-UHFFFAOYSA-N isothiazole Chemical group C=1C=NSC=1 ZLTPDFXIESTBQG-UHFFFAOYSA-N 0.000 description 1
- 230000000155 isotopic effect Effects 0.000 description 1
- GQWYWHOHRVVHAP-DHKPLNAMSA-N jaspamide Chemical compound C1([C@@H]2NC(=O)[C@@H](CC=3C4=CC=CC=C4NC=3Br)N(C)C(=O)[C@H](C)NC(=O)[C@@H](C)C/C(C)=C/[C@H](C)C[C@@H](OC(=O)C2)C)=CC=C(O)C=C1 GQWYWHOHRVVHAP-DHKPLNAMSA-N 0.000 description 1
- 108010052440 jasplakinolide Proteins 0.000 description 1
- GQWYWHOHRVVHAP-UHFFFAOYSA-N jasplakinolide Natural products C1C(=O)OC(C)CC(C)C=C(C)CC(C)C(=O)NC(C)C(=O)N(C)C(CC=2C3=CC=CC=C3NC=2Br)C(=O)NC1C1=CC=C(O)C=C1 GQWYWHOHRVVHAP-UHFFFAOYSA-N 0.000 description 1
- 108010091711 kahalalide F Proteins 0.000 description 1
- 125000000468 ketone group Chemical group 0.000 description 1
- 229940043355 kinase inhibitor Drugs 0.000 description 1
- 238000012004 kinetic exclusion assay Methods 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 108010021336 lanreotide Proteins 0.000 description 1
- 229960002437 lanreotide Drugs 0.000 description 1
- 229960002618 lenograstim Drugs 0.000 description 1
- 229940115286 lentinan Drugs 0.000 description 1
- 229960003881 letrozole Drugs 0.000 description 1
- HPJKCIUCZWXJDR-UHFFFAOYSA-N letrozole Chemical compound C1=CC(C#N)=CC=C1C(N1N=CN=C1)C1=CC=C(C#N)C=C1 HPJKCIUCZWXJDR-UHFFFAOYSA-N 0.000 description 1
- 201000011486 lichen planus Diseases 0.000 description 1
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 1
- RBBBWKUBQVARPL-SWQMWMPHSA-N lissoclinamide 7 Chemical compound C([C@H]1C(=O)N2CCC[C@H]2C2=N[C@@H]([C@H](O2)C)C(=O)N[C@@H](C=2SC[C@H](N=2)C(=O)N[C@H](CC=2C=CC=CC=2)C=2SC[C@H](N=2)C(=O)N1)C(C)C)C1=CC=CC=C1 RBBBWKUBQVARPL-SWQMWMPHSA-N 0.000 description 1
- 108010020270 lissoclinamide 7 Proteins 0.000 description 1
- RBBBWKUBQVARPL-UHFFFAOYSA-N lissoclinamide 7 Natural products N1C(=O)C(N=2)CSC=2C(CC=2C=CC=CC=2)NC(=O)C(N=2)CSC=2C(C(C)C)NC(=O)C(C(O2)C)N=C2C2CCCN2C(=O)C1CC1=CC=CC=C1 RBBBWKUBQVARPL-UHFFFAOYSA-N 0.000 description 1
- 229950008991 lobaplatin Drugs 0.000 description 1
- 229950000909 lometrexol Drugs 0.000 description 1
- 229960003538 lonidamine Drugs 0.000 description 1
- WDRYRZXSPDWGEB-UHFFFAOYSA-N lonidamine Chemical compound C12=CC=CC=C2C(C(=O)O)=NN1CC1=CC=C(Cl)C=C1Cl WDRYRZXSPDWGEB-UHFFFAOYSA-N 0.000 description 1
- YROQEQPFUCPDCP-UHFFFAOYSA-N losoxantrone Chemical compound OCCNCCN1N=C2C3=CC=CC(O)=C3C(=O)C3=C2C1=CC=C3NCCNCCO YROQEQPFUCPDCP-UHFFFAOYSA-N 0.000 description 1
- 229950008745 losoxantrone Drugs 0.000 description 1
- 229950005634 loxoribine Drugs 0.000 description 1
- 201000005296 lung carcinoma Diseases 0.000 description 1
- 210000005265 lung cell Anatomy 0.000 description 1
- 229950002654 lurtotecan Drugs 0.000 description 1
- RVFGKBWWUQOIOU-NDEPHWFRSA-N lurtotecan Chemical compound O=C([C@]1(O)CC)OCC(C(N2CC3=4)=O)=C1C=C2C3=NC1=CC=2OCCOC=2C=C1C=4CN1CCN(C)CC1 RVFGKBWWUQOIOU-NDEPHWFRSA-N 0.000 description 1
- 208000004341 lymphocytic colitis Diseases 0.000 description 1
- 230000002132 lysosomal effect Effects 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 239000003120 macrolide antibiotic agent Substances 0.000 description 1
- 229940041033 macrolides Drugs 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 229910001425 magnesium ion Inorganic materials 0.000 description 1
- 229940049920 malate Drugs 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-L malate(2-) Chemical compound [O-]C(=O)C(O)CC([O-])=O BJEPYKJPYRNKOW-UHFFFAOYSA-L 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 229960003951 masoprocol Drugs 0.000 description 1
- HCZKYJDFEPMADG-TXEJJXNPSA-N masoprocol Chemical compound C([C@H](C)[C@H](C)CC=1C=C(O)C(O)=CC=1)C1=CC=C(O)C(O)=C1 HCZKYJDFEPMADG-TXEJJXNPSA-N 0.000 description 1
- 239000003771 matrix metalloproteinase inhibitor Substances 0.000 description 1
- 229940121386 matrix metalloproteinase inhibitor Drugs 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 229960003194 meglumine Drugs 0.000 description 1
- LWYJUZBXGAFFLP-OCNCTQISSA-N menogaril Chemical compound O1[C@@]2(C)[C@H](O)[C@@H](N(C)C)[C@H](O)[C@@H]1OC1=C3C(=O)C(C=C4C[C@@](C)(O)C[C@H](C4=C4O)OC)=C4C(=O)C3=C(O)C=C12 LWYJUZBXGAFFLP-OCNCTQISSA-N 0.000 description 1
- 229950002676 menogaril Drugs 0.000 description 1
- 108700025096 meterelin Proteins 0.000 description 1
- HRHKSTOGXBBQCB-VFWICMBZSA-N methylmitomycin Chemical compound O=C1C(N)=C(C)C(=O)C2=C1[C@@H](COC(N)=O)[C@@]1(OC)[C@H]3N(C)[C@H]3CN12 HRHKSTOGXBBQCB-VFWICMBZSA-N 0.000 description 1
- TTWJBBZEZQICBI-UHFFFAOYSA-N metoclopramide Chemical compound CCN(CC)CCNC(=O)C1=CC(Cl)=C(N)C=C1OC TTWJBBZEZQICBI-UHFFFAOYSA-N 0.000 description 1
- 229960004503 metoclopramide Drugs 0.000 description 1
- 230000002025 microglial effect Effects 0.000 description 1
- 230000008880 microtubule cytoskeleton organization Effects 0.000 description 1
- BMGQWWVMWDBQGC-IIFHNQTCSA-N midostaurin Chemical class CN([C@H]1[C@H]([C@]2(C)O[C@@H](N3C4=CC=CC=C4C4=C5C(=O)NCC5=C5C6=CC=CC=C6N2C5=C43)C1)OC)C(=O)C1=CC=CC=C1 BMGQWWVMWDBQGC-IIFHNQTCSA-N 0.000 description 1
- 229960003775 miltefosine Drugs 0.000 description 1
- PQLXHQMOHUQAKB-UHFFFAOYSA-N miltefosine Chemical compound CCCCCCCCCCCCCCCCOP([O-])(=O)OCC[N+](C)(C)C PQLXHQMOHUQAKB-UHFFFAOYSA-N 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 229950008541 mirimostim Drugs 0.000 description 1
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 1
- 229960003539 mitoguazone Drugs 0.000 description 1
- MXWHMTNPTTVWDM-NXOFHUPFSA-N mitoguazone Chemical compound NC(N)=N\N=C(/C)\C=N\N=C(N)N MXWHMTNPTTVWDM-NXOFHUPFSA-N 0.000 description 1
- 229950010913 mitolactol Drugs 0.000 description 1
- VFKZTMPDYBFSTM-GUCUJZIJSA-N mitolactol Chemical compound BrC[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-GUCUJZIJSA-N 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 229950001745 mitonafide Drugs 0.000 description 1
- 230000000394 mitotic effect Effects 0.000 description 1
- 210000000479 mitotic spindle apparatus Anatomy 0.000 description 1
- 229960001156 mitoxantrone Drugs 0.000 description 1
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 229950008012 mofarotene Drugs 0.000 description 1
- 229960003063 molgramostim Drugs 0.000 description 1
- 108010032806 molgramostim Proteins 0.000 description 1
- 230000001002 morphogenetic effect Effects 0.000 description 1
- 125000002757 morpholinyl group Chemical group 0.000 description 1
- AARXZCZYLAFQQU-UHFFFAOYSA-N motexafin gadolinium Chemical compound [Gd].CC(O)=O.CC(O)=O.C1=C([N-]2)C(CC)=C(CC)C2=CC(C(=C2C)CCCO)=NC2=CN=C2C=C(OCCOCCOCCOC)C(OCCOCCOCCOC)=CC2=NC=C2C(C)=C(CCCO)C1=N2 AARXZCZYLAFQQU-UHFFFAOYSA-N 0.000 description 1
- WIQKYZYFTAEWBF-UHFFFAOYSA-L motexafin lutetium hydrate Chemical compound O.[Lu+3].CC([O-])=O.CC([O-])=O.C1=C([N-]2)C(CC)=C(CC)C2=CC(C(=C2C)CCCO)=NC2=CN=C2C=C(OCCOCCOCCOC)C(OCCOCCOCCOC)=CC2=NC=C2C(C)=C(CCCO)C1=N2 WIQKYZYFTAEWBF-UHFFFAOYSA-L 0.000 description 1
- 208000001725 mucocutaneous lymph node syndrome Diseases 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- NJSMWLQOCQIOPE-OCHFTUDZSA-N n-[(e)-[10-[(e)-(4,5-dihydro-1h-imidazol-2-ylhydrazinylidene)methyl]anthracen-9-yl]methylideneamino]-4,5-dihydro-1h-imidazol-2-amine Chemical compound N1CCN=C1N\N=C\C(C1=CC=CC=C11)=C(C=CC=C2)C2=C1\C=N\NC1=NCCN1 NJSMWLQOCQIOPE-OCHFTUDZSA-N 0.000 description 1
- TVYPSLDUBVTDIS-FUOMVGGVSA-N n-[1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-methyloxolan-2-yl]-5-fluoro-2-oxopyrimidin-4-yl]-3,4,5-trimethoxybenzamide Chemical compound COC1=C(OC)C(OC)=CC(C(=O)NC=2C(=CN(C(=O)N=2)[C@H]2[C@@H]([C@H](O)[C@@H](C)O2)O)F)=C1 TVYPSLDUBVTDIS-FUOMVGGVSA-N 0.000 description 1
- ARKYUICTMUZVEW-UHFFFAOYSA-N n-[5-[[5-[(3-amino-3-iminopropyl)carbamoyl]-1-methylpyrrol-3-yl]carbamoyl]-1-methylpyrrol-3-yl]-4-[[4-[bis(2-chloroethyl)amino]benzoyl]amino]-1-methylpyrrole-2-carboxamide Chemical compound C1=C(C(=O)NCCC(N)=N)N(C)C=C1NC(=O)C1=CC(NC(=O)C=2N(C=C(NC(=O)C=3C=CC(=CC=3)N(CCCl)CCCl)C=2)C)=CN1C ARKYUICTMUZVEW-UHFFFAOYSA-N 0.000 description 1
- OWIUPIRUAQMTTK-UHFFFAOYSA-M n-aminocarbamate Chemical compound NNC([O-])=O OWIUPIRUAQMTTK-UHFFFAOYSA-M 0.000 description 1
- GTWJETSWSUWSEJ-UHFFFAOYSA-N n-benzylaniline Chemical compound C=1C=CC=CC=1CNC1=CC=CC=C1 GTWJETSWSUWSEJ-UHFFFAOYSA-N 0.000 description 1
- UMJJGDUYVQCBMC-UHFFFAOYSA-N n-ethyl-n'-[3-[3-(ethylamino)propylamino]propyl]propane-1,3-diamine Chemical compound CCNCCCNCCCNCCCNCC UMJJGDUYVQCBMC-UHFFFAOYSA-N 0.000 description 1
- SQDFHQJTAWCFIB-UHFFFAOYSA-N n-methylidenehydroxylamine Chemical group ON=C SQDFHQJTAWCFIB-UHFFFAOYSA-N 0.000 description 1
- RWHUEXWOYVBUCI-ITQXDASVSA-N nafarelin Chemical compound C([C@@H](C(=O)N[C@H](CC=1C=C2C=CC=CC2=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(=O)NCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 RWHUEXWOYVBUCI-ITQXDASVSA-N 0.000 description 1
- 229960002333 nafarelin Drugs 0.000 description 1
- JZGDNMXSOCDEFQ-UHFFFAOYSA-N napavin Chemical compound C1C(CC)(O)CC(C2)CN1CCC(C1=CC=CC=C1N1)=C1C2(C(=O)OC)C(C(=C1)OC)=CC2=C1N(C)C1C2(C23)CCN3CC=CC2(CC)C(O)C1(O)C(=O)NCCNC1=CC=C(N=[N+]=[N-])C=C1[N+]([O-])=O JZGDNMXSOCDEFQ-UHFFFAOYSA-N 0.000 description 1
- PSZYNBSKGUBXEH-UHFFFAOYSA-M naphthalene-1-sulfonate Chemical compound C1=CC=C2C(S(=O)(=O)[O-])=CC=CC2=C1 PSZYNBSKGUBXEH-UHFFFAOYSA-M 0.000 description 1
- 125000001624 naphthyl group Chemical group 0.000 description 1
- 125000004923 naphthylmethyl group Chemical group C1(=CC=CC2=CC=CC=C12)C* 0.000 description 1
- 125000004593 naphthyridinyl group Chemical group N1=C(C=CC2=CC=CN=C12)* 0.000 description 1
- 229950010676 nartograstim Drugs 0.000 description 1
- 108010032539 nartograstim Proteins 0.000 description 1
- 229950007221 nedaplatin Drugs 0.000 description 1
- CTMCWCONSULRHO-UHQPFXKFSA-N nemorubicin Chemical compound C1CO[C@H](OC)CN1[C@@H]1[C@H](O)[C@H](C)O[C@@H](O[C@@H]2C3=C(O)C=4C(=O)C5=C(OC)C=CC=C5C(=O)C=4C(O)=C3C[C@](O)(C2)C(=O)CO)C1 CTMCWCONSULRHO-UHQPFXKFSA-N 0.000 description 1
- 229950010159 nemorubicin Drugs 0.000 description 1
- MQYXUWHLBZFQQO-UHFFFAOYSA-N nepehinol Natural products C1CC(O)C(C)(C)C2CCC3(C)C4(C)CCC5(C)CCC(C(=C)C)C5C4CCC3C21C MQYXUWHLBZFQQO-UHFFFAOYSA-N 0.000 description 1
- 229950010733 neridronic acid Drugs 0.000 description 1
- PUUSSSIBPPTKTP-UHFFFAOYSA-N neridronic acid Chemical compound NCCCCCC(O)(P(O)(O)=O)P(O)(O)=O PUUSSSIBPPTKTP-UHFFFAOYSA-N 0.000 description 1
- 201000001119 neuropathy Diseases 0.000 description 1
- 230000007823 neuropathy Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- XWXYUMMDTVBTOU-UHFFFAOYSA-N nilutamide Chemical compound O=C1C(C)(C)NC(=O)N1C1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 XWXYUMMDTVBTOU-UHFFFAOYSA-N 0.000 description 1
- 229960002653 nilutamide Drugs 0.000 description 1
- 150000002825 nitriles Chemical class 0.000 description 1
- 150000007855 nitrilimines Chemical group 0.000 description 1
- 125000004433 nitrogen atom Chemical group N* 0.000 description 1
- GQPLMRYTRLFLPF-UHFFFAOYSA-N nitrous oxide Inorganic materials [O-][N+]#N GQPLMRYTRLFLPF-UHFFFAOYSA-N 0.000 description 1
- 125000006574 non-aromatic ring group Chemical group 0.000 description 1
- 238000001668 nucleic acid synthesis Methods 0.000 description 1
- 125000004930 octahydroisoquinolinyl group Chemical group C1(NCCC2CCCC=C12)* 0.000 description 1
- 229960002700 octreotide Drugs 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid group Chemical group C(CCCCCCC\C=C/CCCCCCCC)(=O)O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 150000002482 oligosaccharides Chemical class 0.000 description 1
- 229950011093 onapristone Drugs 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 229960005343 ondansetron Drugs 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 229950008017 ormaplatin Drugs 0.000 description 1
- 150000002905 orthoesters Chemical class 0.000 description 1
- 208000013371 ovarian adenocarcinoma Diseases 0.000 description 1
- 208000011932 ovarian sarcoma Diseases 0.000 description 1
- 201000006588 ovary adenocarcinoma Diseases 0.000 description 1
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 1
- 229960001756 oxaliplatin Drugs 0.000 description 1
- 125000002971 oxazolyl group Chemical group 0.000 description 1
- 150000002923 oximes Chemical class 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229950007318 ozogamicin Drugs 0.000 description 1
- VYOQBYCIIJYKJA-VORKOXQSSA-N palau'amine Chemical compound N([C@@]12[C@@H](Cl)[C@@H]([C@@H]3[C@@H]2[C@]24N=C(N)N[C@H]2N2C=CC=C2C(=O)N4C3)CN)C(N)=N[C@H]1O VYOQBYCIIJYKJA-VORKOXQSSA-N 0.000 description 1
- IPCSVZSSVZVIGE-UHFFFAOYSA-N palmitic acid group Chemical group C(CCCCCCCCCCCCCCC)(=O)O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 1
- ZFYKZAKRJRNXGF-XRZRNGJYSA-N palmitoyl rhizoxin Chemical compound O1C(=O)C2OC2CC(CC(=O)O2)CC2C(C)\C=C\C2OC2(C)C(OC(=O)CCCCCCCCCCCCCCC)CC1C(C)C(OC)C(\C)=C\C=C\C(\C)=C\C1=COC(C)=N1 ZFYKZAKRJRNXGF-XRZRNGJYSA-N 0.000 description 1
- WRUUGTRCQOWXEG-UHFFFAOYSA-N pamidronate Chemical compound NCCC(O)(P(O)(O)=O)P(O)(O)=O WRUUGTRCQOWXEG-UHFFFAOYSA-N 0.000 description 1
- 229960003978 pamidronic acid Drugs 0.000 description 1
- RDIMTXDFGHNINN-IKGGRYGDSA-N panaxytriol Chemical compound CCCCCCC[C@H](O)[C@@H](O)CC#CC#C[C@H](O)C=C RDIMTXDFGHNINN-IKGGRYGDSA-N 0.000 description 1
- ZCKMUKZQXWHXOF-UHFFFAOYSA-N panaxytriol Natural products CCC(C)C(C)C(C)C(C)C(C)C(O)C(O)CC#CC#CC(O)C=C ZCKMUKZQXWHXOF-UHFFFAOYSA-N 0.000 description 1
- 229950003440 panomifene Drugs 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 229950006361 pazelliptine Drugs 0.000 description 1
- LPHSYQSMAGVYNT-UHFFFAOYSA-N pazelliptine Chemical compound N1C2=CC=NC=C2C2=C1C(C)=C1C=CN=C(NCCCN(CC)CC)C1=C2 LPHSYQSMAGVYNT-UHFFFAOYSA-N 0.000 description 1
- 229960001744 pegaspargase Drugs 0.000 description 1
- 108010001564 pegaspargase Proteins 0.000 description 1
- 229950000039 peldesine Drugs 0.000 description 1
- DOHVAKFYAHLCJP-UHFFFAOYSA-N peldesine Chemical compound C1=2NC(N)=NC(=O)C=2NC=C1CC1=CC=CN=C1 DOHVAKFYAHLCJP-UHFFFAOYSA-N 0.000 description 1
- 201000001976 pemphigus vulgaris Diseases 0.000 description 1
- 229960003820 pentosan polysulfate sodium Drugs 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 229940124633 peptidic drug Drugs 0.000 description 1
- WTWWXOGTJWMJHI-UHFFFAOYSA-N perflubron Chemical compound FC(F)(F)C(F)(F)C(F)(F)C(F)(F)C(F)(F)C(F)(F)C(F)(F)C(F)(F)Br WTWWXOGTJWMJHI-UHFFFAOYSA-N 0.000 description 1
- 229960001217 perflubron Drugs 0.000 description 1
- VPAWVRUHMJVRHU-VGDKGRGNSA-N perfosfamide Chemical compound OO[C@@H]1CCO[P@@](=O)(N(CCCl)CCCl)N1 VPAWVRUHMJVRHU-VGDKGRGNSA-N 0.000 description 1
- 229950009351 perfosfamide Drugs 0.000 description 1
- 208000033808 peripheral neuropathy Diseases 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- LCADVYTXPLBAGB-GNCBHIOISA-N phenalamide A1 Natural products CC(CO)NC(=O)C(=CC=CC=C/C=C/C(=C/C(C)C(O)C(=CC(C)CCc1ccccc1)C)/C)C LCADVYTXPLBAGB-GNCBHIOISA-N 0.000 description 1
- 125000004934 phenanthridinyl group Chemical group C1(=CC=CC2=NC=C3C=CC=CC3=C12)* 0.000 description 1
- 125000004625 phenanthrolinyl group Chemical group N1=C(C=CC2=CC=C3C=CC=NC3=C12)* 0.000 description 1
- 125000001791 phenazinyl group Chemical group C1(=CC=CC2=NC3=CC=CC=C3N=C12)* 0.000 description 1
- 125000001484 phenothiazinyl group Chemical group C1(=CC=CC=2SC3=CC=CC=C3NC12)* 0.000 description 1
- 125000001644 phenoxazinyl group Chemical group C1(=CC=CC=2OC3=CC=CC=C3NC12)* 0.000 description 1
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 1
- WLJVXDMOQOGPHL-UHFFFAOYSA-N phenylacetic acid Chemical compound OC(=O)CC1=CC=CC=C1 WLJVXDMOQOGPHL-UHFFFAOYSA-N 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 108010018625 phenylalanylarginine Proteins 0.000 description 1
- ZUOUZKKEUPVFJK-UHFFFAOYSA-N phenylbenzene Natural products C1=CC=CC=C1C1=CC=CC=C1 ZUOUZKKEUPVFJK-UHFFFAOYSA-N 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- XYFCBTPGUUZFHI-UHFFFAOYSA-N phosphine group Chemical group P XYFCBTPGUUZFHI-UHFFFAOYSA-N 0.000 description 1
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 1
- 125000004592 phthalazinyl group Chemical group C1(=NN=CC2=CC=CC=C12)* 0.000 description 1
- 125000004193 piperazinyl group Chemical group 0.000 description 1
- 125000000587 piperidin-1-yl group Chemical group [H]C1([H])N(*)C([H])([H])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 125000003386 piperidinyl group Chemical group 0.000 description 1
- 125000005936 piperidyl group Chemical group 0.000 description 1
- 229960001221 pirarubicin Drugs 0.000 description 1
- 229950001030 piritrexim Drugs 0.000 description 1
- 230000003169 placental effect Effects 0.000 description 1
- 150000003058 platinum compounds Chemical class 0.000 description 1
- 229960003171 plicamycin Drugs 0.000 description 1
- 229950008499 plitidepsin Drugs 0.000 description 1
- 108010049948 plitidepsin Proteins 0.000 description 1
- UUSZLLQJYRSZIS-LXNNNBEUSA-N plitidepsin Chemical compound CN([C@H](CC(C)C)C(=O)N[C@@H]1C(=O)N[C@@H]([C@H](CC(=O)O[C@H](C(=O)[C@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N2CCC[C@H]2C(=O)N(C)[C@@H](CC=2C=CC(OC)=CC=2)C(=O)O[C@@H]1C)C(C)C)O)[C@@H](C)CC)C(=O)[C@@H]1CCCN1C(=O)C(C)=O UUSZLLQJYRSZIS-LXNNNBEUSA-N 0.000 description 1
- YJGVMLPVUAXIQN-XVVDYKMHSA-N podophyllotoxin Chemical compound COC1=C(OC)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@H](O)[C@@H]3[C@@H]2C(OC3)=O)=C1 YJGVMLPVUAXIQN-XVVDYKMHSA-N 0.000 description 1
- 229960001237 podophyllotoxin Drugs 0.000 description 1
- YVCVYCSAAZQOJI-UHFFFAOYSA-N podophyllotoxin Natural products COC1=C(O)C(OC)=CC(C2C3=CC=4OCOC=4C=C3C(O)C3C2C(OC3)=O)=C1 YVCVYCSAAZQOJI-UHFFFAOYSA-N 0.000 description 1
- 201000006292 polyarteritis nodosa Diseases 0.000 description 1
- 208000005987 polymyositis Diseases 0.000 description 1
- 229950004406 porfiromycin Drugs 0.000 description 1
- 229910001414 potassium ion Inorganic materials 0.000 description 1
- 208000018290 primary dysautonomia Diseases 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 239000000651 prodrug Chemical group 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 125000001501 propionyl group Chemical group O=C([*])C([H])([H])C([H])([H])[H] 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 230000009145 protein modification Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- SSKVDVBQSWQEGJ-UHFFFAOYSA-N pseudohypericin Natural products C12=C(O)C=C(O)C(C(C=3C(O)=CC(O)=C4C=33)=O)=C2C3=C2C3=C4C(C)=CC(O)=C3C(=O)C3=C(O)C=C(O)C1=C32 SSKVDVBQSWQEGJ-UHFFFAOYSA-N 0.000 description 1
- 125000001042 pteridinyl group Chemical group N1=C(N=CC2=NC=CN=C12)* 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 239000000784 purine nucleoside phosphorylase inhibitor Substances 0.000 description 1
- 125000000561 purinyl group Chemical group N1=C(N=C2N=CNC2=C1)* 0.000 description 1
- 125000004307 pyrazin-2-yl group Chemical group [H]C1=C([H])N=C(*)C([H])=N1 0.000 description 1
- 125000004944 pyrazin-3-yl group Chemical group [H]C1=C([H])N=C(*)C([H])=N1 0.000 description 1
- 125000003072 pyrazolidinyl group Chemical group 0.000 description 1
- DNXIASIHZYFFRO-UHFFFAOYSA-N pyrazoline Chemical group C1CN=NC1 DNXIASIHZYFFRO-UHFFFAOYSA-N 0.000 description 1
- 125000002755 pyrazolinyl group Chemical group 0.000 description 1
- 125000003226 pyrazolyl group Chemical group 0.000 description 1
- 125000002206 pyridazin-3-yl group Chemical group [H]C1=C([H])C([H])=C(*)N=N1 0.000 description 1
- 125000004940 pyridazin-4-yl group Chemical group N1=NC=C(C=C1)* 0.000 description 1
- 125000004941 pyridazin-5-yl group Chemical group N1=NC=CC(=C1)* 0.000 description 1
- 125000004942 pyridazin-6-yl group Chemical group N1=NC=CC=C1* 0.000 description 1
- PBMFSQRYOILNGV-UHFFFAOYSA-N pyridazine Chemical group C1=CC=NN=C1 PBMFSQRYOILNGV-UHFFFAOYSA-N 0.000 description 1
- 125000002098 pyridazinyl group Chemical group 0.000 description 1
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 description 1
- 125000004076 pyridyl group Chemical group 0.000 description 1
- 125000000246 pyrimidin-2-yl group Chemical group [H]C1=NC(*)=NC([H])=C1[H] 0.000 description 1
- 125000004527 pyrimidin-4-yl group Chemical group N1=CN=C(C=C1)* 0.000 description 1
- 125000004528 pyrimidin-5-yl group Chemical group N1=CN=CC(=C1)* 0.000 description 1
- 125000004943 pyrimidin-6-yl group Chemical group N1=CN=CC=C1* 0.000 description 1
- 125000000719 pyrrolidinyl group Chemical group 0.000 description 1
- 125000000168 pyrrolyl group Chemical group 0.000 description 1
- 125000002294 quinazolinyl group Chemical group N1=C(N=CC2=CC=CC=C12)* 0.000 description 1
- 125000001567 quinoxalinyl group Chemical group N1=C(C=NC2=CC=CC=C12)* 0.000 description 1
- 125000004621 quinuclidinyl group Chemical group N12C(CC(CC1)CC2)* 0.000 description 1
- 229960004432 raltitrexed Drugs 0.000 description 1
- 230000035484 reaction time Effects 0.000 description 1
- 208000002574 reactive arthritis Diseases 0.000 description 1
- 102000027426 receptor tyrosine kinases Human genes 0.000 description 1
- 108091008598 receptor tyrosine kinases Proteins 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 125000006853 reporter group Chemical group 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 201000003068 rheumatic fever Diseases 0.000 description 1
- OWPCHSCAPHNHAV-LMONGJCWSA-N rhizoxin Chemical compound C/C([C@H](OC)[C@@H](C)[C@@H]1C[C@H](O)[C@]2(C)O[C@@H]2/C=C/[C@@H](C)[C@]2([H])OC(=O)C[C@@](C2)(C[C@@H]2O[C@H]2C(=O)O1)[H])=C\C=C\C(\C)=C\C1=COC(C)=N1 OWPCHSCAPHNHAV-LMONGJCWSA-N 0.000 description 1
- 125000006413 ring segment Chemical group 0.000 description 1
- QXKJWHWUDVQATH-UHFFFAOYSA-N rogletimide Chemical compound C=1C=NC=CC=1C1(CC)CCC(=O)NC1=O QXKJWHWUDVQATH-UHFFFAOYSA-N 0.000 description 1
- 229950005230 rogletimide Drugs 0.000 description 1
- HNMATTJJEPZZMM-BPKVFSPJSA-N s-[(2r,3s,4s,6s)-6-[[(2r,3s,4s,5r,6r)-5-[(2s,4s,5s)-5-[acetyl(ethyl)amino]-4-methoxyoxan-2-yl]oxy-6-[[(2s,5z,9r,13e)-13-[2-[[4-[(2e)-2-[1-[4-(4-amino-4-oxobutoxy)phenyl]ethylidene]hydrazinyl]-2-methyl-4-oxobutan-2-yl]disulfanyl]ethylidene]-9-hydroxy-12-(m Chemical compound C1[C@H](OC)[C@@H](N(CC)C(C)=O)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@@](C/3=C/CSSC(C)(C)CC(=O)N\N=C(/C)C=3C=CC(OCCCC(N)=O)=CC=3)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HNMATTJJEPZZMM-BPKVFSPJSA-N 0.000 description 1
- 229950008902 safingol Drugs 0.000 description 1
- YGSDEFSMJLZEOE-UHFFFAOYSA-M salicylate Chemical compound OC1=CC=CC=C1C([O-])=O YGSDEFSMJLZEOE-UHFFFAOYSA-M 0.000 description 1
- 229960001860 salicylate Drugs 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 201000000306 sarcoidosis Diseases 0.000 description 1
- YADVRLOQIWILGX-UHFFFAOYSA-N sarcophytol N Natural products CC(C)C1=CC=C(C)CCC=C(C)CCC=C(C)CC1O YADVRLOQIWILGX-UHFFFAOYSA-N 0.000 description 1
- 229960002530 sargramostim Drugs 0.000 description 1
- 108010038379 sargramostim Proteins 0.000 description 1
- 229930195734 saturated hydrocarbon Natural products 0.000 description 1
- 150000007659 semicarbazones Chemical class 0.000 description 1
- 210000000717 sertoli cell Anatomy 0.000 description 1
- 230000003007 single stranded DNA break Effects 0.000 description 1
- 229950010372 sobuzoxane Drugs 0.000 description 1
- 229910001415 sodium ion Inorganic materials 0.000 description 1
- JLUAVHQVEFDQEO-ZKZAMAJLSA-M sodium;(2r)-4-hydroxy-5-oxo-2-[(4s)-2-phenyl-1,3-dioxolan-4-yl]-2h-furan-3-olate Chemical compound [Na+].O1C(=O)C(O)=C([O-])[C@H]1[C@H]1OC(C=2C=CC=CC=2)OC1 JLUAVHQVEFDQEO-ZKZAMAJLSA-M 0.000 description 1
- QUCDWLYKDRVKMI-UHFFFAOYSA-M sodium;3,4-dimethylbenzenesulfonate Chemical compound [Na+].CC1=CC=C(S([O-])(=O)=O)C=C1C QUCDWLYKDRVKMI-UHFFFAOYSA-M 0.000 description 1
- XBUIKNRVGYFSHL-IAVQPKKASA-M sodium;[(1e,3r,4r,6r,7z,9z,11e)-3,6,13-trihydroxy-3-methyl-1-[(2r)-6-oxo-2,3-dihydropyran-2-yl]trideca-1,7,9,11-tetraen-4-yl] hydrogen phosphate Chemical compound [Na+].OC/C=C/C=C\C=C/[C@H](O)C[C@@H](OP(O)([O-])=O)[C@@](O)(C)\C=C\[C@H]1CC=CC(=O)O1 XBUIKNRVGYFSHL-IAVQPKKASA-M 0.000 description 1
- NSFFYSQTVOCNLX-JKIHJDPOSA-M sodium;[(2r,3s,4s,5r)-5-(4-amino-2-oxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methyl octadecyl phosphate;hydrate Chemical compound O.[Na+].O[C@H]1[C@H](O)[C@@H](COP([O-])(=O)OCCCCCCCCCCCCCCCCCC)O[C@H]1N1C(=O)N=C(N)C=C1 NSFFYSQTVOCNLX-JKIHJDPOSA-M 0.000 description 1
- DXWSCXWALSKXSD-GTQQMNRMSA-M sodium;[(8e,10e,12e)-7-hydroxy-6-methyl-2-(3-methyl-6-oxo-2,3-dihydropyran-2-yl)tetradeca-8,10,12-trien-5-yl] hydrogen phosphate Chemical compound [Na+].C\C=C\C=C\C=C\C(O)C(C)C(OP(O)([O-])=O)CCC(C)C1OC(=O)C=CC1C DXWSCXWALSKXSD-GTQQMNRMSA-M 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 229950004225 sonermin Drugs 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 229950004796 sparfosic acid Drugs 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- YBZRLMLGUBIIDN-NZSGCTDASA-N spicamycin Chemical compound O1[C@@H](C(O)CO)[C@H](NC(=O)CNC(=O)CCCCCCCCCCCCC(C)C)[C@@H](O)[C@@H](O)[C@H]1NC1=NC=NC2=C1N=CN2 YBZRLMLGUBIIDN-NZSGCTDASA-N 0.000 description 1
- YBZRLMLGUBIIDN-UHFFFAOYSA-N spicamycin Natural products O1C(C(O)CO)C(NC(=O)CNC(=O)CCCCCCCCCCCCC(C)C)C(O)C(O)C1NC1=NC=NC2=C1NC=N2 YBZRLMLGUBIIDN-UHFFFAOYSA-N 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- IIACRCGMVDHOTQ-UHFFFAOYSA-M sulfamate Chemical compound NS([O-])(=O)=O IIACRCGMVDHOTQ-UHFFFAOYSA-M 0.000 description 1
- IIACRCGMVDHOTQ-UHFFFAOYSA-N sulfamic acid Chemical group NS(O)(=O)=O IIACRCGMVDHOTQ-UHFFFAOYSA-N 0.000 description 1
- OJXASOYYODXRPT-UHFFFAOYSA-N sulfamoylurea Chemical group NC(=O)NS(N)(=O)=O OJXASOYYODXRPT-UHFFFAOYSA-N 0.000 description 1
- 125000002128 sulfonyl halide group Chemical group 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- VAZAPHZUAVEOMC-UHFFFAOYSA-N tacedinaline Chemical compound C1=CC(NC(=O)C)=CC=C1C(=O)NC1=CC=CC=C1N VAZAPHZUAVEOMC-UHFFFAOYSA-N 0.000 description 1
- 108010021891 tallimustine Proteins 0.000 description 1
- 229950005667 tallimustine Drugs 0.000 description 1
- LRBQNJMCXXYXIU-NRMVVENXSA-N tannic acid Chemical compound OC1=C(O)C(O)=CC(C(=O)OC=2C(=C(O)C=C(C=2)C(=O)OC[C@@H]2[C@H]([C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)O2)OC(=O)C=2C=C(OC(=O)C=3C=C(O)C(O)=C(O)C=3)C(O)=C(O)C=2)O)=C1 LRBQNJMCXXYXIU-NRMVVENXSA-N 0.000 description 1
- 235000015523 tannic acid Nutrition 0.000 description 1
- 229920002258 tannic acid Polymers 0.000 description 1
- 229940033123 tannic acid Drugs 0.000 description 1
- 229940095064 tartrate Drugs 0.000 description 1
- URLYINUFLXOMHP-HTVVRFAVSA-N tcn-p Chemical compound C=12C3=NC=NC=1N(C)N=C(N)C2=CN3[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O URLYINUFLXOMHP-HTVVRFAVSA-N 0.000 description 1
- 229960001674 tegafur Drugs 0.000 description 1
- WFWLQNSHRPWKFK-ZCFIWIBFSA-N tegafur Chemical compound O=C1NC(=O)C(F)=CN1[C@@H]1OCCC1 WFWLQNSHRPWKFK-ZCFIWIBFSA-N 0.000 description 1
- 229960004964 temozolomide Drugs 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 125000003718 tetrahydrofuranyl group Chemical group 0.000 description 1
- 125000003039 tetrahydroisoquinolinyl group Chemical group C1(NCCC2=CC=CC=C12)* 0.000 description 1
- 125000001412 tetrahydropyranyl group Chemical group 0.000 description 1
- 125000005942 tetrahydropyridyl group Chemical group 0.000 description 1
- 125000000147 tetrahydroquinolinyl group Chemical group N1(CCCC2=CC=CC=C12)* 0.000 description 1
- QEMXHQIAXOOASZ-UHFFFAOYSA-N tetramethylammonium Chemical compound C[N+](C)(C)C QEMXHQIAXOOASZ-UHFFFAOYSA-N 0.000 description 1
- 125000005247 tetrazinyl group Chemical group N1=NN=NC(=C1)* 0.000 description 1
- 125000003831 tetrazolyl group Chemical group 0.000 description 1
- ZCTJIMXXSXQXRI-UHFFFAOYSA-N thaliblastine Natural products CN1CCC2=CC(OC)=C(OC)C3=C2C1CC1=C3C=C(OC)C(OC2=C(CC3C4=CC(OC)=C(OC)C=C4CCN3C)C=C(C(=C2)OC)OC)=C1 ZCTJIMXXSXQXRI-UHFFFAOYSA-N 0.000 description 1
- ZCTJIMXXSXQXRI-KYJUHHDHSA-N thalicarpine Chemical compound CN1CCC2=CC(OC)=C(OC)C3=C2[C@@H]1CC1=C3C=C(OC)C(OC2=C(C[C@H]3C4=CC(OC)=C(OC)C=C4CCN3C)C=C(C(=C2)OC)OC)=C1 ZCTJIMXXSXQXRI-KYJUHHDHSA-N 0.000 description 1
- 125000004927 thianaphthalenyl group Chemical group S1C(C=CC2=CC=CC=C12)* 0.000 description 1
- 125000000335 thiazolyl group Chemical group 0.000 description 1
- 125000001544 thienyl group Chemical group 0.000 description 1
- SRVJKTDHMYAMHA-WUXMJOGZSA-N thioacetazone Chemical compound CC(=O)NC1=CC=C(\C=N\NC(N)=S)C=C1 SRVJKTDHMYAMHA-WUXMJOGZSA-N 0.000 description 1
- 108010062880 thiocoraline Proteins 0.000 description 1
- UPGGKUQISSWRJJ-UHFFFAOYSA-N thiocoraline Natural products CN1C(=O)CNC(=O)C(NC(=O)C=2C(=CC3=CC=CC=C3N=2)O)CSC(=O)C(CSC)N(C)C(=O)C(N(C(=O)CNC2=O)C)CSSCC1C(=O)N(C)C(CSC)C(=O)SCC2NC(=O)C1=NC2=CC=CC=C2C=C1O UPGGKUQISSWRJJ-UHFFFAOYSA-N 0.000 description 1
- CNHYKKNIIGEXAY-UHFFFAOYSA-N thiolan-2-imine Chemical compound N=C1CCCS1 CNHYKKNIIGEXAY-UHFFFAOYSA-N 0.000 description 1
- 229930192474 thiophene Chemical group 0.000 description 1
- 150000003584 thiosemicarbazones Chemical class 0.000 description 1
- 206010043778 thyroiditis Diseases 0.000 description 1
- 229950002376 tirapazamine Drugs 0.000 description 1
- QVMPZNRFXAKISM-UHFFFAOYSA-N tirapazamine Chemical compound C1=CC=C2[N+]([O-])=NC(=N)N(O)C2=C1 QVMPZNRFXAKISM-UHFFFAOYSA-N 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-M toluene-4-sulfonate Chemical compound CC1=CC=C(S([O-])(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-M 0.000 description 1
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- ONYVJPZNVCOAFF-UHFFFAOYSA-N topsentin Natural products Oc1ccc2cc([nH]c2c1)C(=O)c3ncc([nH]3)c4c[nH]c5ccccc45 ONYVJPZNVCOAFF-UHFFFAOYSA-N 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 229950003873 triciribine Drugs 0.000 description 1
- 150000004684 trihydrates Chemical class 0.000 description 1
- 229960001099 trimetrexate Drugs 0.000 description 1
- NOYPYLRCIDNJJB-UHFFFAOYSA-N trimetrexate Chemical compound COC1=C(OC)C(OC)=CC(NCC=2C(=C3C(N)=NC(N)=NC3=CC=2)C)=C1 NOYPYLRCIDNJJB-UHFFFAOYSA-N 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 229960000281 trometamol Drugs 0.000 description 1
- XSQUKJJJFZCRTK-UHFFFAOYSA-N urea group Chemical group NC(=O)N XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 235000014393 valine Nutrition 0.000 description 1
- XLQGICHHYYWYIU-UHFFFAOYSA-N veramine Natural products O1C2CC3C4CC=C5CC(O)CCC5(C)C4CC=C3C2(C)C(C)C21CCC(C)CN2 XLQGICHHYYWYIU-UHFFFAOYSA-N 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- KDQAABAKXDWYSZ-PNYVAJAMSA-N vinblastine sulfate Chemical compound OS(O)(=O)=O.C([C@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 KDQAABAKXDWYSZ-PNYVAJAMSA-N 0.000 description 1
- 229960004982 vinblastine sulfate Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- AQTQHPDCURKLKT-JKDPCDLQSA-N vincristine sulfate Chemical compound OS(O)(=O)=O.C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C=O)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 AQTQHPDCURKLKT-JKDPCDLQSA-N 0.000 description 1
- 229960002110 vincristine sulfate Drugs 0.000 description 1
- 229960004355 vindesine Drugs 0.000 description 1
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 1
- 125000000391 vinyl group Chemical group [H]C([*])=C([H])[H] 0.000 description 1
- 229920002554 vinyl polymer Polymers 0.000 description 1
- 229960001771 vorozole Drugs 0.000 description 1
- XLMPPFTZALNBFS-INIZCTEOSA-N vorozole Chemical compound C1([C@@H](C2=CC=C3N=NN(C3=C2)C)N2N=CN=C2)=CC=C(Cl)C=C1 XLMPPFTZALNBFS-INIZCTEOSA-N 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 238000002424 x-ray crystallography Methods 0.000 description 1
- 229950003017 zeniplatin Drugs 0.000 description 1
- 150000003952 β-lactams Chemical class 0.000 description 1
Classifications
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16H—HEALTHCARE INFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR THE HANDLING OR PROCESSING OF MEDICAL OR HEALTHCARE DATA
- G16H20/00—ICT specially adapted for therapies or health-improving plans, e.g. for handling prescriptions, for steering therapy or for monitoring patient compliance
- G16H20/10—ICT specially adapted for therapies or health-improving plans, e.g. for handling prescriptions, for steering therapy or for monitoring patient compliance relating to drugs or medications, e.g. for ensuring correct administration to patients
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
Definitions
- CD117 (also referred to as c-kit or Stem Cell Factor Receptor (SCRF)) is a single transmembrane, receptor tyrosine kinase that binds the ligand Stem Cell Factor (SCF). SCF induces homodimerization of CD117 which activates its tyrosine kinase activity and signals through both the P13-AKT and MAPK pathways (Kindblom et al., Am J. Path. 1998 152(5):1259).
- SCF Stem Cell Factor Receptor
- CD117 was initially discovered as an oncogene and has been studied in the field of oncology (see, for example, Stankov et al. (2014) Curr Pharm Des. 20(17):2849-80). CD117 is highly expressed on hematopoietic stem cells (HSCs).
- HSCs hematopoietic stem cells
- CD117 represents a potential therapeutic target for treating diseases such as cancer, and as a conditioning agent for cell transplantation, e.g., given its expression on HSCs, the nature of treating such diseases presents unique challenges, including adverse effects of the cancer on bone marrow and hematologic function.
- CD117 is highly expressed on hematopoietic stem cells (HSCs) and on acute myeloid leukemia (AML) tumor cells. This expression pattern makes CD117 a potential target for both conditioning and treating patients across a broad range of diseases. There remains, however, a need for a minimium safe and biologically effective (MSBE) dose of a therapeutic anti-CD117 antibody (or antibody drug conjugate (ADC)).
- MSBE minimium safe and biologically effective
- compositions and methods for treating a human subject with an anti-CD117 antibody drug conjugate may be used to determine dosing of the ADC for treatment of a human subject, e.g., treatment for cancer or as a conditioning agent.
- the methods described herein generally rely on receptor occupancy (RO) assays, e.g., flow cytometry RO assays.
- RO assays e.g., flow cytometry RO assays.
- an RO assay is used to determine the percentage of available receptors, i.e., CD117, that are bound as a function of drug (antibody) concentration.
- a method for treating a human subject in need thereof comprising: determining CD117 receptor occupancy of a therapeutic anti-CD117 antibody on CD117 expressing cells from a human subject, said method comprising performing a receptor occupancy (RO) assay on a sample from the human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample; and administering to the human subject an amount of the therapeutic anti- CD117 antibody that is less than 100 times an amount of the therapeutic anti-CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay, wherein the therapeutic anti-CD117 antibody depletes CD117+ cells in the human subject thereby treating the human subject.
- RO receptor occupancy
- Also disclosed herein is a method for treating a human subject in need thereof, comprising: determining CD117 receptor occupancy of a therapeutic anti-CD117 antibody on CD117 expressing cells from a human subject, said method comprising performing a receptor occupancy (RO) assay on a sample from the human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample; and administering to the human subject an amount of the therapeutic anti-CD117 antibody that is less than 50 times an amount of the therapeutic anti-CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay, wherein the therapeutic anti-CD117 antibody depletes CD117+ cells in the human subject thereby treating the human subject.
- RO receptor occupancy
- Also disclosed herein is a method for treating a human subject in need thereof, comprising: determining CD117 receptor occupancy of a therapeutic anti-CD117 antibody on CD117 expressing cells from a human subject, said method comprising performing a receptor occupancy (RO) assay on a sample from the human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample; and administering to the human subject an amount of the therapeutic anti-CD117 antibody that is less than 10 times an amount of the therapeutic anti-CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay, wherein the therapeutic anti-CD117 antibody depletes CD117+ cells in the human subject thereby treating the human subject.
- RO receptor occupancy
- the therapeutic anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
- the therapeutic anti-CD117 antibody, or antigen binding fragment thereof comprises a light chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 104, and a heavy chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 103.
- the therapeutic anti-CD117 antibody comprises a heavy chain having the amino acid sequence as set forth as SEQ ID NO: 138, and a light chain having an amino acid sequence set forth as SEQ ID NO: 144.
- the therapeutic anti-CD117 antibody is an lgG1 isotype.
- the human subject is administered an amount of the therapeutic anti-CD117 antibody that is less than an amount of the therapeutic anti-CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay.
- the human subject is administered an amount of the therapeutic anti-CD117 antibody that is less than an amount of the therapeutic anti-CD117 antibody sufficient to result in about 90% CD117 receptor occupancy as determined by the RO assay.
- the human subject is administered an amount of the therapeutic anti-CD117 antibody that is less than an amount of the therapeutic anti-CD117 antibody sufficient to result in about 80% CD117 receptor occupancy as determined by the RO assay.
- the human subject is administered an amount of the therapeutic anti-CD117 antibody that is less than an amount of the therapeutic anti-CD117 antibody sufficient to result in about 70% CD117 receptor occupancy as determined by the RO assay.
- the human subject is administered an amount of the therapeutic anti-CD117 antibody that is less than an amount of the therapeutic anti-CD117 antibody sufficient to result in about 60% CD117 receptor occupancy as determined by the RO assay.
- the human subject is administered an amount of the therapeutic anti-CD117 antibody that is less than an amount of the therapeutic anti-CD117 antibody sufficient to result in about 50% CD117 receptor occupancy as determined by the RO assay.
- the RO assay comprises contacting the sample with an anti- CD117 antibody, or an antigen binding fragment thereof, that cross-blocks the therapeutic anti-CD117 antibody.
- the therapeutic anti-CD117 antibody that is administered to the human subject as an anti-CD117 antibody drug conjugate (ADC) comprising the therapeutic anti-CD117 antibody conjugated via a linker to an amatoxin.
- ADC anti-CD117 antibody drug conjugate
- the ADC has the structure of formula (III): or a stereoisomer thereof; wherein:
- X is S or S(O); L is a linker;
- Z is a chemical moiety formed by a coupling reaction between a reactive substituent Z' present on L and a reactive substituent present within the anti-CD117 antibody;
- Ab is the anti-CD117 antibody.
- the ADC has the structure of formula (Ilia) (SEQ ID NO:
- the ADC has the structure of formula (IV) (SEQ ID NO:
- the ADC has the structure of formula (IVa) (SEQ ID NO:
- the ADC has the structure of formula (IVb) (SEQ ID NO: 290): a stereoisomer thereof, or a pharmaceutically acceptable salt thereof.
- Also disclosed herein is a method for determining receptor occupancy of a therapeutic anti-CD117 antibody on a CD117 expressing cell from a human subject, said method comprising performing a receptor occupancy (RO) assay on a sample obtained from a human subject, and determining the percent receptor occupancy of the therapeutic anti- CD117 antibody on the CD117 expressing cell from the sample, wherein the therapeutic anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
- RO receptor occupancy
- the RO assay comprises the steps of (a) contacting the sample with an amount of the anti-CD117 therapeutic antibody, (b) contacting the sample with an amount of a second anti-CD117 antibody, or an antigen-binding fragment thereof, that competes with the anti-CD117 therapeutic antibody for binding to CD117 on the CD117 expressing cell, wherein the second anti-CD117 antibody, or an antigen-binding fragment thereof, is labelled with a first detectable agent; (c) detecting the amount of the second antibody bound to the CD117 on the cell surface on the CD117 expressing cell in the sample, and (d) calculating the percentage of CD117 bound by the anti-CD117 therapeutic antibody, thereby determining receptor occupancy of the therapeutic anti-CD117 antibody.
- Also disclosed herein is a method for determining receptor occupancy of a therapeutic anti-CD117 antibody on a CD117 expressing cell from a human subject who has been administered the therapeutic antibody, said method comprising performing a receptor occupancy (RO) assay on a sample from a human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on the CD117 expressing cell from the sample , and wherein therapeutic anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
- RO receptor occupancy
- the RO assay comprises the steps of: (a) obtaining a sample from the human subject administered the therapeutic antibody; (b) contacting the sample with an amount of a second anti-CD117 antibody, or an antigen-binding fragment thereof, that competes with the anti-CD117 therapeutic antibody for binding to a CD117 receptor, wherein the second anti-CD117 antibody, or an antigen binding fragment thereof, is labelled with a first detectable agent; (c) detecting the amount of the second antibody bound to the CD117 receptor on the CD117 expressing cell in the sample, and (d) calculating the percentage of CD117 bound by the anti-CD117 therapeutic antibody, thereby determining receptor occupancy of the therapeutic anti-CD117 antibody
- the step of calculating the percentage of CD117 bound by the anti-CD117 therapeutic antibody further comprises the steps contacting the sample (or an equivalent sample) with an amount of a third anti-CD117 antibody, or an antigen-binding fragment thereof, that does not compete with the anti-CD117 therapeutic antibody for binding to a CD117 receptor, wherein the third anti-CD117 antibody, or an antigen-binding fragment thereof, is labelled with a second detectable agent, and detecting the amount of the third anti-CD117 antibody, or an antigen-binding fragment thereof, bound to the CD117 receptor on the CD117 expressing cell in the sample, thereby determining the total amount of the CD117 receptor on the CD117 expressing cell in the sample.
- the second detectable agent is detected at a different emission wavelength than the first detectable agent.
- the receptor occupancy of the therapeutic anti-CD117 antibody is determined by detecting a signal from the first detectable agent, detecting a signal from the second detectable agent, and comparing the signals in order to determine the percent receptor occupancy.
- the detecting is determined using flow cytometry.
- the second anti-CD117 antibody, or an antigen-binding fragment thereof is an antigen binding fragment of the therapeutic antibody, a competitive anti-CD117 antibody that cross blocks the therapeutic antibody, or an antigen-binding fragment of a competitive anti-CD117 antibody that cross blocks the therapeutic antibody.
- the amount of the second anti-CD117 antibody is a saturating amount of the second anti-CD117 antibody.
- the amount of the third anti-CD117 antibody is a saturating amount of the third anti-CD117 antibody.
- the detectable agent is selected from the group consisting of a fluorescent label, a luminescent label, a bioluminescent label, a magnetic label, a radiolabel, and an enzyme.
- the detectable agent is a fluorescent label selected from the group consisting of phycoerythrin (PE), allophycocyanin (APC), BD Horizon BrilliantTM Violet 421 (BV421), BD Horizon BrilliantTM Violet 510 (BV510), BD Horizon BrilliantTM Violet 785 (BV785), fluorescein (FITC), PerCP-Cy5.5, and Alexa Fluor® 647 (AF647).
- PE phycoerythrin
- API allophycocyanin
- BV421 BD Horizon BrilliantTM Violet 421
- BV510 BD Horizon BrilliantTM Violet 510
- BD Horizon BrilliantTM Violet 785 BV785
- fluorescein FITC
- PerCP-Cy5.5 PerCP-Cy5.5
- Alexa Fluor® 647 AF647
- the PE is phycoerythrin (PE)-Dazzle 594, PE/Cy5, PE/Cy5.5 and PE/Cy7.
- the APC is allophycocyanin-Cy7.
- the third anti-CD117 antibody comprises antibody 104D2 conjugated to BV421.
- the second antibody is the anti-CD117 therapeutic antibody conjugated to phycoerythrin.
- the sample is obtained from the human subject immediately following administration of the anti-CD117 therapeutic antibody to the human subject. In another embodiment, the sample is obtained from the human subject at about 2 hours after administration of the anti-CD117 therapeutic antibody to the human subject. In another embodiment, the sample is obtained from the human subject at about 4 hours after administration of the anti-CD117 therapeutic antibody to the human subject. In another embodiment, the sample is obtained from the human subject at about 8 hours after administration of the anti-CD117 therapeutic antibody to the human subject. In another embodiment, the sample is obtained from the human subject at about 24 hours after administration of the anti-CD117 therapeutic antibody to the human subject. In another embodiment, the sample is obtained from the human subject at about 36 hours after administration of the anti-CD117 therapeutic antibody to the human subject. In another embodiment, the sample is obtained from the human subject at about 48 hours after administration of the anti-CD117 therapeutic antibody to the human subject.
- the sample comprises a CD117+ cell. In one embodiment, the sample comprises a leukemic blast cell, a hematopoietic stem cell (HSC), or a hematopoietic stem and progenitor cell (HSPC).
- HSC hematopoietic stem cell
- HSPC hematopoietic stem and progenitor cell
- the sample is whole blood or bone marrow from the human subject.
- the second anti-CD117 antibody or the antigen binding fragment thereof, binds to the same epitope as the therapeutic antibody.
- the RO assay comprises contacting the sample with a) the anti- CD117 therapeutic antibody, the antigen binding fragment thereof, and b) a second antibody, or an antigen-binding fragment thereof, which is labelled and specifically binds to the therapeutic anti-CD117 antibody, or an antigen binding fragment thereof, and contacting the sample (or an equivalent sample) with a third anti-CD117 antibody, or an antigen-binding fragment thereof, which does not compete with the therapeutic anti-CD117 antibody for binding to human CD117, wherein the second antibody, or antigen-binding fragment thereof, does not cross react with the third anti-CD117 antibody, or an antigen-binding fragment thereof, and wherein the second anti-CD117 antibody, or antigen binding fragment thereof, is labelled with a first detectable agent and the third antibody, or an antigen-binding fragment thereof, is labeled with a second detectable agent.
- the therapeutic anti-CD117 antibody, or antigen binding fragment thereof comprises a light chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 104, and a heavy chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 103.
- the therapeutic anti-CD117 antibody comprises a heavy chain having the amino acid sequence as set forth as SEQ ID NO: 138, and a light chain having an amino acid sequence set forth as SEQ ID NO: 144.
- the therapeutic anti-CD117 antibody is an lgG1 isotype.
- the method disclosed herein further comprises determining a dose of the therapeutic antibody for treating a human subject in need based on the percent receptor occupancy.
- Also provided herein is a method of depleting CD117 expressing cells in a human subject, comprising administering an dose of an anti-CD117 antibody drug conjugate (ADC) comprising an anti-CD117 antibody conjugated to an amatoxin via a linker, to the human subject, wherein the dose is determined using the method of any one of the methods disclosed herein, and wherein the anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
- ADC anti-CD117 antibody drug conjugate
- Another embodiment disclosed herein is a method of treating a human subject in need thereof, comprising administering an dose of an anti-CD117 antibody drug conjugate (ADC) comprising an anti-CD117 antibody conjugated to an amatoxin to the human subject, wherein the dose is determined using the method of any one of the methods disclosed herein, and wherein the anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
- ADC anti-CD117 antibody drug conjugate
- an anti-CD117 antibody drug conjugate comprising an anti- CD117 antibody conjugated to an amatoxin to the human subject, wherein the dose is determined using the method of any one of the methods disclosed herein, and wherein the anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
- ADC anti-CD117 antibody drug conjugate
- the sample is from the same human subject.
- the amount administered to the human subject is less than 1.1 times an amount of the therapeutic anti-CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay.
- the dose resulted in at least about 80% receptor occupancy in the RO assay. In one embodiment, the dose resulted in at least about 85% receptor occupancy in the RO assay. In one embodiment, the dose resulted in at least about 90% receptor occupancy in the RO assay. In one embodiment, the dose resulted in at least about 95% receptor occupancy in the RO assay. In one embodiment, the dose resulted in at least about 99% receptor occupancy in the RO assay.
- Also provided herein is a method of conditioning a human subject in need thereof, the method comprising administering to the human subject an amount of an anti-CD117 ADC sufficient to achieve and/or maintain a receptor occupancy of at least about 80% as determined according to any one of the methods disclosed herein, wherein the anti-CD117 ADC comprises an anti-CD117 antibody conjugated to an amatoxin, and wherein the anti- CD117 antibody comprises a heavy chain variable region comprising CDR1 , CDR2 and CDR3 as set forth in SEQ ID NO: 105, 106, and 107, respectively, and a light chain variable region comprising CDR1 , CDR2 and CDR3 as set forth in SEQ ID NO: 108, 109, and 110, respectively.
- the anti-CD117 ADC comprises an anti-CD117 antibody conjugated to an amatoxin
- the anti- CD117 antibody comprises a heavy chain variable region comprising CDR1 , CDR2 and CDR3 as set forth in SEQ ID NO: 105, 106, and
- the receptor occupancy achieved and/or maintained is at least about 85%. In one embodiment, the receptor occupancy achieved and/or maintained is at least about 90%. In one embodiment, the receptor occupancy achieved and/or maintained is at least about 95%. In one embodiment, the receptor occupancy achieved and/or maintained is at least about 99%. In one embodiment, the receptor occupancy achieved and/or maintained is about 100%.
- the ADC has the structure of formula (III) (SEQ ID NO: 285): or a stereoisomer thereof; wherein: X is S or S(O);
- L is a linker
- Z is a chemical moiety formed by a coupling reaction between a reactive substituent Z' present on L and a reactive substituent present within the anti-CD117 antibody; and Ab is the anti-CD117 antibody.
- the ADC has the structure of formula (Ilia) (SEQ ID NO:
- the ADC has the structure of formula (IV) (SEQ ID NO: 288): a stereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein Ab is the anti- CD117 antibody.
- the ADC has the structure of formula (IVa) (SEQ ID NO: 289): In one embodiment, the ADC has the structure of formula (IVb) (SEQ ID NO: 290): a stereoisomer thereof, or a pharmaceutically acceptable salt thereof.
- the methods disclosed herein further comprise administering a stem cell transplant to the human subject.
- the stem cell transplant comprises HSCs.
- the stem cell transplant consists essentially of HSCs.
- the HSCs are allogeneic.
- the human subject has a disorder that would benefit from CD117+ cell depletion. In one embodiment, the human subject is in need of a cell transplant.
- the human subject has a stem cell disorder.
- the human subject has cancer or an autoimmune disease.
- the cancer is a hematological cancer.
- the hematological cancer is leukemia.
- the leukemia is acute myeloid leukemia.
- the leukemia is acute lymphoblastic leukemia or chronic lymphocytic leukemia.
- the hematological cancer is myelodysplastic syndrome.
- Also provided herein is a method for determining receptor occupancy of a therapeutic anti-CD117 antibody on CD117 expressing cells from a human subject, said method comprising performing a receptor occupancy (RO) assay on a sample from a human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample, wherein the therapeutic anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
- RO receptor occupancy
- Fig. 1 depicts a schematic of an assay for selecting fluorophores for a receptor occupancy assay.
- Figs. 2A and 2B graphically depict the results of an assay to measure the geometric mean fluorescence intensity (gMFI) of various antibodies labeled with a variety of detectable agents in the presence of CD117+ cells (Kasumi-1 cells; Fig. 2A) and a negative control (Kasumi-1 KO cells; Fig. 2B).
- gMFI geometric mean fluorescence intensity
- Fig.3 summarizes the results of an assay to measure the geometric mean fluorescence intensity (gMFI) of various antibodies labeled with a variety of detectable agents in the presence of CD117+ cells (Kasumi-1 cells) and a negative control (Kasumi-1 KO cells).
- gMFI geometric mean fluorescence intensity
- Fig.4 depicts a schematic of a whole blood spike-in assay.
- Figs. 5A and 5B graphically depicts flow cytometry data for a whole blood spike-in assay using a spike of Kasumi-1 cells and the anti-CD117 antibody 104D2-labeled with phycoerythrin (i.e., “104D2-PE”; Fig. 5A)) in comparison to a control sample without a spike of Kasumi-1 cells;(Fig. 5B).
- 104D2-PE phycoerythrin
- Figs. 6A-6C depicts three different antibody cocktails, each having a different CD117 fluorophore (Figs. 6A-6C) for use in whole blood spike-in assays.
- Fig.7 graphically depicts flow cytometry data for a whole blood spike-in assay to measure the geometric mean fluorescence intensity (gMFI) of various antibodies labeled with a variety of detectable agents.
- gMFI geometric mean fluorescence intensity
- Figs. 8A-8D summarizes the results of an assay comparing the dynamic range of Brilliant VioletTM 421 (BV421 ; Figs. 8A and 8D) to phycoerythrin (PE; Figs. 8B and 8D) and Alexa Fluor 647 (AF647; Fig. 8C and 8D).
- Fig.9 depicts the results of a receptor occupancy assay using various fluorophore- labeled antibodies.
- ADCs anti-CD117 antibody drug conjugates
- the term “about” refers to a value that is within 10% above or below the value being described.
- amatoxin refers to a member of the amatoxin family of peptides which are generally produced by Amanita phalloides mushrooms, or a derivative thereof, such as a variant or derivative thereof capable of inhibiting RNA polymerase II activity.
- Amatoxins may be isolated from a variety of mushroom species (e.g., Amanita phalloides, Gaiehna marginata, Lepiota brunneo-incarnata) or may be prepared semi- synthetically or synthetically.
- a member of this family, oc-amanitin is described in Wieland, Int. J. Pept. Protein Res.1983, 22(3):257-276.
- a derivative of an amatoxin may be obtained by chemical modification of a naturally occurring compound ("semi-synthetic"), or may be obtained from an entirely synthetic source. Synthetic routes to various amatoxin derivatives are disclosed in, for example, U.S. Patent No. 9,676,702 and in Perrin et al., J. Am. Chem. Soc. 2018, 140, p. 6513-6517, each of which is incorporated by reference herein in their entirety with respect to synthetic methods for preparing and derivatizing amatoxins.
- Amatoxins useful in conjunction with the compositions and methods described herein include compounds such, as, but not limited to, compounds of Formula (I), a-amanitin, b-amanitin, y- amanitin, e-amanitin, amanin, amaninamide, amanullin, amanullinic acid, and proamanullin.
- compounds of Formula (I) a-amanitin, b-amanitin, y- amanitin, e-amanitin, amanin, amaninamide, amanullin, amanullinic acid, and proamanullin.
- antibody refers to an immunoglobulin molecule that specifically binds to, or is immunologically reactive with, a particular antigen, and includes monoclonal, chimeric antibodies, humanized antibodies, heteroconjugate antibodies (e.g., bi- tri- and quad-specific antibodies, diabodies, triabodies, and tetrabodies), and antigen binding fragments of antibodies, including, for example, Fab', F(ab')2, Fab, Fv, rlgG, and scFv fragments.
- Antibodies described herein are generally isolated or recombinant.
- Isolated when used herein refers to a polypeptide, e.g., an antibody, that has been identified and separated and/or recovered from a cell or cell culture from which it was expressed. Ordinarily, an isolated antibody will be prepared by at least one purification step. Thus, an “isolated antibody,” refers to an antibody which is substantially free of other antibodies having different antigenic specificities. For instance, an isolated antibody that specifically binds to CD117 is substantially free of antibodies that specifically bind antigens other than CD117.
- antibodies comprise heavy and light chains containing antigen binding regions.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region.
- the heavy chain constant region is comprised of three domains, CH1 , CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- the VH, and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- CDR complementarity determining region
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- the amino acid positions that delineate a hypervariable region of an antibody can vary, depending on the context and the various definitions known in the art. Some positions within a variable domain may be viewed as hybrid hypervariable positions in that these positions can be deemed to be within a hypervariable region under one set of criteria while being deemed to be outside a hypervariable region under a different set of criteria. One or more of these positions can also be found in extended hypervariable regions.
- the antibodies described herein may contain modifications in these hybrid hypervariable positions.
- the variable domains of native heavy and light chains each contain four framework regions that primarily adopt a b-sheet configuration, connected by three CDRs, which form loops that connect, and in some cases form part of, the b-sheet structure.
- the CDRs in each chain are held together in close proximity by the framework regions in the order FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 and, with the CDRs from the other antibody chains, contribute to the formation of the target binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, National Institute of Health, Bethesda,
- numbering of immunoglobulin amino acid residues is performed according to the immunoglobulin amino acid residue numbering system of Kabat et al., unless otherwise indicated (although any antibody numbering scheme, including, but not limited to IMGT and Chothia, can be utilized).
- antigen-binding fragment or “antigen binding portion” as used interchangeably herein, refers to one or more fragments of an antibody that retains the ability to specifically bind to the target antigen of the instant antibody from which it is derived.
- the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- antigen-binding fragments include, but are not limited to: (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , CL, and CH1 domains; (ii) a F(ab')2 fragment, a bivalent fragment containing two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and CH1 domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb including V H and V L domains; (vi) a dAb fragment that consists of a V H domain (see, e.g., Ward et al., Nature 341 :544-546, 1989); (vii) a dAb which consists of a V H or a V L domain; (viii) an isolated complementarity determining region (CDR); and (ix) a combination of two or more
- the two domains of the Fv fragment, V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (known as single chain Fv (scFv); see, for example, Bird et al., Science 242:423-426, 1988 and Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883, 1988).
- scFv single chain Fv
- These antibody fragments can be obtained using conventional techniques known to those of skill in the art, and the fragments can be screened for utility in the same manner as intact antibodies.
- Antigen-binding fragments can be produced by recombinant DNA techniques, enzymatic or chemical cleavage of intact immunoglobulins, or, in certain cases, by chemical peptide synthesis procedures known in the art.
- scFv refers to a single chain Fv antibody in which the variable domains of the heavy chain and the light chain from an antibody have been joined to form one chain.
- scFv fragments contain a single polypeptide chain that includes the variable region of an antibody light chain (V L ) (e.g., CDR-L1, CDR-L2, and/or CDR-L3) and the variable region of an antibody heavy chain (V H ) (e.g., CDR-H1 , CDR-H2, and/or CDR- H3) separated by a linker.
- V L variable region of an antibody light chain
- V H variable region of an antibody heavy chain
- the linker that joins the V L and V H regions of a scFv fragment can be a peptide linker composed of proteinogenic amino acids.
- the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
- polyclonal antibody preparations typically include different antibodies directed against different determinants (epitopes)
- each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
- the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- an “intact” or “full length” antibody refers to an antibody having two heavy (H) chain polypeptides and two light (L) chain polypeptides interconnected by disulfide bonds.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region.
- the heavy chain constant region is comprised of three domains, CH1 , CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- VH, and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- conjugate refers to a compound formed by the chemical bonding of a reactive functional group of one molecule, such as an antibody or antigen binding fragment thereof, with an appropriately reactive functional group of another molecule, such as a cytotoxin described herein.
- the foregoing conjugates are also referred to interchangeably herein as a “drug antibody conjugate”, an “antibody drug conjugate” and an “ADC”.
- an ADC is formed by the chemical bonding of a reactive functional group of one molecule, such as an antibody or antigen-binding fragment thereof, with an appropriately reactive functional group of another molecule, such as a cytotoxin described herein.
- Conjugates may include a linker between the two molecules bound to one another, e.g., between an antibody and a cytotoxin.
- linkers that can be used for the formation of a conjugate include peptide-containing linkers, such as those that contain naturally occurring or non-naturally occurring amino acids, such as D-amino acids. Linkers can be prepared using a variety of strategies described herein and known in the art.
- a linker may be cleaved, for example, by enzymatic hydrolysis, photolysis, hydrolysis under acidic conditions, hydrolysis under basic conditions, oxidation, disulfide reduction, nucleophilic cleavage, or organometallic cleavage (see, for example, Leriche et al., Bioorg. Med. Chem., 20:571-582, 2012).
- anti-CD117 antibody or “an antibody that binds to CD117” refers to an antibody that is capable of binding CD117, e.g., human CD117 (hCD117) with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting CD117.
- a therapeutic antibody refers to an antibody that can be used for treating or conditioning a human subject.
- the term is intended to include a naked antibody as well as an antibody that may be conjugated to a cytotoxin, thus forming an antibody drug conjugate (ADC).
- ADC antibody drug conjugate
- a therapeutic antibody is an anti- CD117 antibody, e.g., Ab85, which is conjugated to an amatoxin for conditioning or treating a human subject in need thereof.
- cross competes refers to the ability of an antibody or antibody fragment to interfere with the binding of other antibodies or antibody fragments to a specific antigen in a standard competitive binding assay.
- An antibody or antigen binding fragment that cross competes with another is a “competitive antibody”.
- the ability or extent to which an antibody, antibody fragment or other antigen-binding moieties is able to interfere with the binding of another antibody or antibody fragment to a specific antigen, and, therefore whether it can be said to cross-compete, can be determined using standard competition binding assays.
- One suitable assay involves the use of the Biacore technology (e.g. by using the BIAcore 3000 instrument (Biacore, Uppsala, Sweden)), which can measure the extent of interactions using surface plasmon resonance technology.
- Another assay for measuring cross-competing uses an ELISA-based approach. A high throughput process for "epitope binning" antibodies based upon their cross-competition is described in International Patent Application No. WO 2003/48731.
- “Binds the same epitope as” means the ability of an antibody or antibody fragment to bind to a specific antigen whereby it binds to the same epitope as the exemplified antibody when using the same epitope mapping technique for comparing the antibodies or fragments thereof.
- the epitopes of the exemplified antibody and other antibodies can be determined using epitope mapping techniques.
- Epitope mapping techniques are well known in the art. For example, conformational epitopes are readily identified by determining spatial conformation of amino acids such as by, e.g., hydrogen/deuterium exchange, x-ray crystallography and two-dimensional nuclear magnetic resonance.
- condition refers to processes by which a patient is prepared for receipt of a transplant, e.g., a transplant containing hematopoietic stem cells (HSCs). Such procedures promote the engraftment of a hematopoietic stem cell transplant (for instance, as inferred from a sustained increase in the quantity of viable hematopoietic stem cells within a blood sample isolated from a patient following a conditioning procedure and subsequent hematopoietic stem cell transplantation).
- a patient may be conditioned for hematopoietic stem cell transplant therapy by administration to the patient of an anti-CD117 ADC.
- Administration of an anti-CD117 ADC to a patient in need of hematopoietic stem cell transplant therapy can promote the engraftment of a hematopoietic stem cell graft, for example, by selectively depleting endogenous hematopoietic stem cells, thereby creating a vacancy filled by an exogenous hematopoietic stem cell transplant.
- HSCs hematopoietic stem cells
- granulocytes e.g., promyelocytes, neutrophils, eosinophils, basophils
- erythrocytes e.g., reticulocytes, erythrocytes
- thrombocytes e.g., megakaryoblasts, platelet producing megakaryocytes, platelets
- monocytes e.g., monocytes, macrophages
- dendritic cells e.g., NK cells, B-cells and T-cells
- lymphocytes e.g., NK cells, B-cells and T-cells.
- CD34 + cells are immature cells that express the CD34 cell surface marker.
- patients that are “in need of” a hematopoietic stem cell transplant include patients that exhibit a defect or deficiency in one or more blood cell types, as well as patients having a stem cell disorder, autoimmune disease, cancer, or other pathology described herein.
- Hematopoietic stem cells generally exhibit 1) multi-potency, and can thus differentiate into multiple different blood lineages including, but not limited to, granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing megakaryocytes, platelets), monocytes (e.g., monocytes, macrophages), dendritic cells, microglia, osteoclasts, and lymphocytes (e.g., NK cells, B-cells and T-cells), 2) self-renewal, and can thus give rise to daughter cells that have equivalent potential as the mother cell, and 3) the ability to be reintroduced into a transplant recipient whereupon they home to the hematopoietic stem cell niche and re-establish productive and sustained hematop
- Hematopoietic stem cells can thus be administered to a patient defective or deficient in one or more cell types of the hematopoietic lineage in order to re-constitute the defective or deficient population of cells in vivo.
- the patient may be suffering from cancer, and the deficiency may be caused by administration of a chemotherapeutic agent or other medicament that depletes, either selectively or non-specifically, the cancerous cell population.
- the patient may be suffering from a hemoglobinopathy (e.g., a non-malignant hemoglobinopathy), such as sickle cell anemia, thalassemia, Fanconi anemia, aplastic anemia, and Wiskott-Aldrich syndrome.
- a hemoglobinopathy e.g., a non-malignant hemoglobinopathy
- the subject may be one that is suffering from adenosine deaminase severe combined immunodeficiency (ADA SCID), HIV/AIDS, metachromatic leukodystrophy, Diamond-Blackfan anemia, and Schwachman-Diamond syndrome.
- ADA SCID adenosine deaminase severe combined immunodeficiency
- the subject may have or be affected by an inherited blood disorder (e.g., sickle cell anemia) or an autoimmune disorder.
- the subject may have or be affected by a malignancy, such as neuroblastoma or a hematologic cancer.
- the subject may have a leukemia, lymphoma, or myeloma.
- the subject has acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, or non-Hodgkin’s lymphoma.
- the subject has myelodysplastic syndrome.
- the subject has an autoimmune disease, such as scleroderma, multiple sclerosis, ulcerative colitis, Crohn’s disease, Type 1 diabetes, or another autoimmune pathology described herein.
- the subject is in need of chimeric antigen receptor T-cell (CART) therapy.
- the subject has or is otherwise affected by a metabolic storage disorder.
- the subject may suffer or otherwise be affected by a metabolic disorder selected from the group consisting of glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingolipidoses, metachromatic leukodystrophy, or any other diseases or disorders which may benefit from the treatments and therapies disclosed herein and including, without limitation, severe combined immunodeficiency, Wiscott-Aldrich syndrome, hyper immunoglobulin M (IgM) syndrome, Chediak-Higashi disease, hereditary lymphohistiocytosis, osteopetrosis, osteogenesis imperfecta, storage diseases, thalassemia major, sickle cell disease, systemic sclerosis, systemic lupus erythematosus, multiple sclerosis, juvenile rheumatoid arthritis and those diseases, or disorders described in "Bone Marrow Transplantation for Non-Malignant Disease," ASH Education Book, 1 :319-338 (2000), the disclosure of which is incorporated herein by reference in its entirety as
- a patient “in need of” a hematopoietic stem cell transplant may one that is or is not suffering from one of the foregoing pathologies, but nonetheless exhibits a reduced level (e.g., as compared to that of an otherwise healthy subject) of one or more endogenous cell types within the hematopoietic lineage, such as megakaryocytes, thrombocytes, platelets, erythrocytes, mast cells, myeoblasts, basophils, neutrophils, eosinophils, microglia, granulocytes, monocytes, osteoclasts, antigen-presenting cells, macrophages, dendritic cells, natural killer cells, T-lymphocytes, and B-lymphocytes.
- endogenous cell types within the hematopoietic lineage such as megakaryocytes, thrombocytes, platelets, erythrocytes, mast cells, myeoblasts, basophils, neutrophils, eos
- FACS fluorescence activated cell sorting
- the term “recipient” refers to a patient that receives a transplant, such as a transplant containing a population of hematopoietic stem cells.
- the transplanted cells administered to a recipient may be, e.g., autologous, syngeneic, or allogeneic cells.
- allogeneic when used in reference to a cell transplant or graft broadly means any transplant which is not genetically identical to a patient recipient. More specifically, any transplant from any donor who is not an identical twin to a patient recipient, is referred to as an allogeneic transplant as these transplants are not genetically identical to a patient recipient. Thus, the term “donor" of an allogeneic transplant means any donor who is not an identical twin to a patient recipient.
- sample refers to a specimen (e.g., blood, blood component (e.g., serum or plasma), urine, saliva, amniotic fluid, cerebrospinal fluid, tissue (e.g., placental or dermal), pancreatic fluid, chorionic villus sample, and cells) taken from a subject.
- a specimen e.g., blood, blood component (e.g., serum or plasma), urine, saliva, amniotic fluid, cerebrospinal fluid, tissue (e.g., placental or dermal), pancreatic fluid, chorionic villus sample, and cells
- the terms “subject” and “patient”, used interchangeably herein, refer to an organism, such as a human, that receives treatment for a particular disease or condition as described herein.
- a patient such as a human patient, may receive treatment prior to hematopoietic stem cell transplant therapy in order to promote the engraftment of exogenous hematopoietic stem cells.
- the phrase “substantially cleared from the blood” refers to a point in time following administration of a therapeutic agent to a patient when the concentration of the therapeutic agent in a blood sample isolated from the patient is such that the therapeutic agent is not detectable by conventional means (for instance, such that the therapeutic agent is not detectable above the noise threshold of the device or assay used to detect the therapeutic agent).
- a variety of techniques known in the art can be used to detect antibodies, antibody fragments, and protein ligands, such as ELISA-based detection assays known in the art or described herein. Additional assays that can be used to detect antibodies, or antibody fragments, include immunoprecipitation techniques and immunoblot assays, among others known in the art.
- stem cell disorder broadly refers to any disease, disorder, or condition that may be treated or cured by conditioning a subject's target tissues, and/or by ablating an endogenous stem cell population in a target tissue (e.g., ablating an endogenous hematopoietic stem or progenitor cell population from a subject's bone marrow tissue) and/or by engrafting or transplanting stem cells in a subject's target tissues.
- a target tissue e.g., ablating an endogenous hematopoietic stem or progenitor cell population from a subject's bone marrow tissue
- stem cells in a subject's target tissues e.g., ablating an endogenous hematopoietic stem or progenitor cell population from a subject's bone marrow tissue
- Type I diabetes has been shown to be cured by hematopoietic stem cell transplant and may benefit from conditioning in accordance with the compositions and methods described herein.
- Additional disorders that can be treated using the compositions and methods described herein include, without limitation, sickle cell anemia, thalassemias, Fanconi anemia, aplastic anemia, Wiskott-Aldrich syndrome, ADA SCID, HIV/AIDS, metachromatic leukodystrophy, Diamond-Blackfan anemia, and Schwachman-Diamond syndrome.
- Additional diseases that may be treated using the patient conditioning and/or hematopoietic stem cell transplant methods described herein influde inherited blood disorders (e.g., sickle cell anemia) and autoimmune disorders, such as scleroderma, multiple sclerosis, ulcerative colitis, and Chrohn’s disease.
- Additional diseases that may be treated using the conditioning and/or transplantation methods described herein include a malignancy, such as a neuroblastoma or hematologic cancers, such as leukemia, lymphoma, and myeloma.
- the cancer may be acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, or non-Flodgkin’s lymphoma.
- Additional diseases treatable using the conditioning and/or transplantation methods described herein include myelodysplastic syndrome.
- the subject has or is otherwise affected by a metabolic storage disorder.
- the subject may suffer or otherwise be affected by a metabolic disorder selected from the group consisting of glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingolipidoses, metachromatic leukodystrophy, or any other diseases or disorders which may benefit from the treatments and therapies disclosed herein and including, without limitation, severe combined immunodeficiency, Wiscott-Aldrich syndrome, hyper immunoglobulin M (IgM) syndrome, Chediak-Fligashi disease, hereditary lymphohistiocytosis, osteopetrosis, osteogenesis imperfecta, storage diseases, thalassemia major, sickle cell disease, systemic sclerosis, systemic lupus erythematosus, multiple sclerosis, juvenile rheumatoid arthritis and those diseases, or disorders described in "Bone Marrow Transplantation for Non-Malignant Disease," ASH Education Book, 1 :319-338 (2000), the disclosure of which is incorporated herein by reference in its
- treat refers to reducing the severity and/or frequency of disease symptoms, eliminating disease symptoms and/or the underlying cause of said symptoms, reducing the frequency or likelihood of disease symptoms and/or their underlying cause, and improving or remediating damage caused, directly or indirectly, by disease.
- beneficial or desired clinical results include, but are not limited to, promoting the engraftment of exogenous hematopoietic cells in a patient following antibody conditioning therapy as described herein and subsequent hematopoietic stem cell transplant therapy.
- Additional beneficial results include an increase in the cell count or relative concentration of hematopoietic stem cells in a patient in need of a hematopoietic stem cell transplant following conditioning therapy and subsequent administration of an exogenous hematopoietic stem cell graft to the patient.
- Beneficial results of therapy described herein may also include an increase in the cell count or relative concentration of one or more cells of hematopoietic lineage, such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeoblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting cell, macrophage, dendritic cell, natural killer cell, T- lymphocyte, or B-lymphocyte, following conditioning therapy and subsequent hematopoietic stem cell transplant therapy.
- Additional beneficial results may include the reduction in quantity of a disease-causing cell population, such as a population of cancer cells or autoimmune cells.
- the term “prevent” does not require that the disease state be completely thwarted. Rather, as used herein, the term preventing refers to the ability of the skilled artisan to identify a population that is susceptible to disorders, such that administration of the compounds disclosed herein may occur prior to onset of a disease. The term does not imply that the disease state is completely avoided. As used herein, the term “treatment” encompasses conditioning, unless otherwise indicated.
- variants and “derivative” are used interchangeably and refer to naturally-occurring, synthetic, and semi-synthetic analogues of a compound, peptide, protein, or other substance described herein.
- a variant or derivative of a compound, peptide, protein, or other substance described herein may retain or improve upon the biological activity of the original material.
- the term “coupling reaction” refers to a chemical reaction in which two or more substituents suitable for reaction with one another react so as to form a chemical moiety that joins (e.g., covalently) the molecular fragments bound to each substituent.
- Coupling reactions include those in which a reactive substituent bound to a fragment that is a cytotoxin, such as a cytotoxin known in the art or described herein, reacts with a suitably reactive substituent bound to a fragment that is an antibody, or antigen binding fragment thereof, such as an antibody, antigen-binding fragment thereof, or specific anti-CD117 antibody that binds CD117 known in the art or described herein.
- suitably reactive substituents include a nucleophile/electrophile pair (e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/a, b-unsaturated carbonyl pair, among others), a diene/dienophile pair (e.g., an azide/alkyne pair, among others), and the like.
- a nucleophile/electrophile pair e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/a, b-unsaturated carbonyl pair, among others
- diene/dienophile pair e.g., an azide/alkyne pair, among others
- Coupling reactions include, without limitation, thiol alkylation, hydroxyl alkylation, amine alkylation, amine condensation, amidation, esterification, disulfide formation, cycloaddition (e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others), nucleophilic aromatic substitution, electrophilic aromatic substitution, and other reactive modalities known in the art or described herein.
- cycloaddition e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others
- nucleophilic aromatic substitution e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others
- nucleophilic aromatic substitution e.g., [4+2] Diels-Alder cycloa
- R is hydrogen (“aldehyde”), C1-C12 alkyl, C2-C12 alkenyl, C2-C12 alkynyl, C3-C7 carbocyclyl, C6-C20 aryl, 5-10 membered heteroaryl, or 5-10 membered heterocyclyl, as defined herein.
- Non-limiting examples include formyl, acetyl, propanoyl, benzoyl, and acryloyl.
- C1-C12 alkyl refers to a straight chain or branched, saturated hydrocarbon having from 1 to 12 carbon atoms.
- Representative C1-C12 alkyl groups include, but are not limited to, -methyl, -ethyl, -n-propyl, -n-butyl, -n-pentyl, and -n- hexyl; while branched C1-C12 alkyls include, but are not limited to, -isopropyl, -sec-butyl, - isobutyl, -tert-butyl, -isopentyl, and 2-methylbutyl.
- a C1-C12 alkyl group can be unsubstituted or substituted.
- alkenyl refers to C2-C12 hydrocarbon containing normal, secondary, or tertiary carbon atoms with at least one site of unsaturation, i.e., a carbon- carbon, sp 2 double bond. Examples include, but are not limited to: ethylene or vinyl, -allyl, -1- butenyl, -2-butenyl, -isobutylenyl, -1-pentenyl, -2-pentenyl, -3-methyl-1-butenyl, -2-methyl-2- butenyl, -2,3-dimethyl-2-butenyl, and the like.
- An alkenyl group can be unsubstituted or substituted.
- Alkynyl refers to a C2-C12 hydrocarbon containing normal, secondary, or tertiary carbon atoms with at least one site of unsaturation, i.e., a carbon- carbon, sp triple bond. Examples include, but are not limited to acetylenic and propargyl. An alkynyl group can be unsubstituted or substituted.
- Aryl refers to a C6-C20 carbocyclic aromatic group. Examples of aryl groups include, but are not limited to, phenyl, naphthyl and anthracenyl. An aryl group can be unsubstituted or substituted.
- Arylalkyl refers to an acyclic alkyl radical in which one of the hydrogen atoms bonded to a carbon atom, typically a terminal or sp 3 carbon atom, is replaced with an aryl radical.
- Typical arylalkyl groups include, but are not limited to, benzyl, 2-phenylethan-1-yl, 2-phenylethen-1-yl, naphthylmethyl, 2-naphthylethan-1-yl, 2- naphthylethen-1-yl, naphthobenzyl, 2-naphthophenylethan-1-yl and the like.
- the arylalkyl group comprises 6 to 20 carbon atoms, e.g.
- the alkyl moiety including alkanyl, alkenyl or alkynyl groups
- the arylalkyl group is 1 to 6 carbon atoms and the aryl moiety is 5 to 14 carbon atoms.
- An alkaryl group can be unsubstituted or substituted.
- Cycloalkyl refers to a saturated carbocyclic radical, which may be mono- or bicyclic. Cycloalkyl groups include a ring having 3 to 7 carbon atoms as a monocycle or 7 to 12 carbon atoms as a bicycle. Examples of monocyclic cycloalkyl groups include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl. A cycloalkyl group can be unsubstituted or substituted.
- Cycloalkenyl refers to an unsaturated carbocyclic radical, which may be mono- or bicyclic. Cycloalkenyl groups include a ring having 3 to 6 carbon atoms as a monocycle or 7 to 12 carbon atoms as a bicycle. Examples of monocyclic cycloalkenyl groups include 1-cyclopent-1-enyl, 1-cyclopent-2-enyl, 1-cyclopent-3-enyl, 1 -cyclohex-1 - enyl, 1-cyclohex-2-enyl, and 1-cyclohex-3-enyl. A cycloalkenyl group can be unsubstituted or substituted.
- Heteroaralkyl refers to an acyclic alkyl radical in which one of the hydrogen atoms bonded to a carbon atom, typically a terminal or sp3 carbon atom, is replaced with a heteroaryl radical.
- Typical heteroaryl alkyl groups include, but are not limited to, 2-benzimidazolylmethyl, 2-furylethyl, and the like.
- the heteroarylalkyl group comprises 6 to 20 carbon atoms, e.g.
- the alkyl moiety, including alkanyl, alkenyl or alkynyl groups, of the heteroarylalkyl group is 1 to 6 carbon atoms and the heteroaryl moiety is 5 to 14 carbon atoms and 1 to 3 heteroatoms selected from N, O, P, and S.
- the heteroaryl moiety of the heteroarylalkyl group may be a monocycle having 3 to 7 ring members (2 to 6 carbon atoms or a bicycle having 7 to 10 ring members (4 to 9 carbon atoms and 1 to 3 heteroatoms selected from N, O, P, and S), for example: a bicyclo[4,5], [5,5], [5,6], or [6,6] system.
- Heteroaryl and “heterocycloalkyl” as used herein refer to an aromatic or non aromatic ring system, respectively, in which one or more ring atoms is a heteroatom, e.g. nitrogen, oxygen, and sulfur.
- the heteroaryl or heterocycloalkyl radical comprises 2 to 20 carbon atoms and 1 to 3 heteroatoms selected from N, O, P, and S.
- a heteroaryl or heterocycloalkyl may be a monocycle having 3 to 7 ring members (2 to 6 carbon atoms and 1 to 3 heteroatoms selected from N, O, P, and S) or a bicycle having 7 to 10 ring members (4 to 9 carbon atoms and 1 to 3 heteroatoms selected from N, O, P, and S), for example: a bicyclo[4,5], [5,5], [5,6], or [6,6] system.
- Heteroaryl and heterocycloalkyl can be unsubstituted or substituted.
- heteroaryl groups include by way of example and not limitation pyridyl, thiazolyl, tetrahydrothiophenyl, pyrimidinyl, furanyl, thienyl, pyrrolyl, pyrazolyl, imidazolyl, tetrazolyl, benzofuranyl, thianaphthalenyl, indolyl, indolenyl, quinolinyl, isoquinolinyl, benzimidazolyl, isoxazolyl, pyrazinyl, pyridazinyl, indolizinyl, isoindolyl, 3H-indolyl, 1H- indazolyl, purinyl, 4H-quinolizinyl, phthalazinyl, naphthyridinyl, quinoxalinyl, quinazolinyl, cinnolinyl, pteridinyl, 4aH-carb
- heterocycloalkyls include by way of example and not limitation dihydroypyridyl, tetrahydropyridyl (piperidyl), tetrahydrothiophenyl, piperidinyl, 4-piperidonyl, pyrrolidinyl, 2-pyrrolidonyl, tetrahydrofuranyl, tetrahydropyranyl, bis-tetrahydropyranyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, octahydroisoquinolinyl, piperazinyl, quinuclidinyl, and morpholinyl.
- carbon bonded heteroaryls and heterocycloalkyls are bonded at position 2, 3, 4, 5, or 6 of a pyridine, position 3, 4, 5, or 6 of a pyridazine, position 2, 4, 5, or 6 of a pyrimidine, position 2, 3, 5, or 6 of a pyrazine, position 2, 3, 4, or 5 of a furan, tetrahydrofuran, thiofuran, thiophene, pyrrole or tetrahydropyrrole, position 2, 4, or 5 of an oxazole, imidazole or thiazole, position 3, 4, or 5 of an isoxazole, pyrazole, or isothiazole, position 2 or 3 of an aziridine, position 2, 3, or 4 of an azetidine, position 2, 3, 4, 5, 6, 7, or 8 of a quinoline or position 1 , 3, 4, 5, 6, 7, or 8 of an isoquinoline.
- carbon bonded heterocycles include 2-pyridyl, 3-pyridyl, 4-pyridyl, 5- pyridyl, 6-pyridyl, 3-pyridazinyl, 4-pyridazinyl, 5-pyridazinyl, 6-pyridazinyl, 2-pyrimidinyl, 4- pyrimidinyl, 5-pyrimidinyl, 6-pyrimidinyl, 2-pyrazinyl, 3-pyrazinyl, 5-pyrazinyl, 6-pyrazinyl, 2- thiazolyl, 4-thiazolyl, or 5-thiazolyl.
- nitrogen bonded heteroaryls and heterocycloalkyls are bonded at position 1 of an aziridine, azetidine, pyrrole, pyrrolidine, 2- pyrroline, 3-pyrroline, imidazole, imidazolidine, 2-imidazoline, 3-imidazoline, pyrazole, pyrazoline, 2-pyrazoline, 3-pyrazoline, piperidine, piperazine, indole, indoline, 1H-indazole, position 2 of a isoindole, or isoindoline, position 4 of a morpholine, and position 9 of a carbazole, or beta-carboline.
- nitrogen bonded heterocycles include 1- aziridyl, 1-azetedyl, 1-pyrrolyl, 1-imidazolyl, 1-pyrazolyl, and 1-piperidinyl.
- Substituted as used herein and as applied to any of the above alkyl, alkenyl, alkynyl, aryl, arylalkyl, cycloalkyl, heteroaryl, heterocyclyl, and the like, means that one or more hydrogen atoms are each independently replaced with a substituent.
- the foregoing chemical moieties such as “alkyl”, “alkylene”, “heteroalkyl”, “heteroalkylene”, “alkenyl”, “alkenylene”, “heteroalkenyl”, “heteroalkenylene”, “alkynyl”, “alkynylene”, “heteroalkynyl”, “heteroalkynylene”, “cycloalkyl”, “cycloalkylene”, “heterocyclolalkyl”, heterocycloalkylene”, “aryl,” “arylene”, “heteroaryl”, and “heteroarylene” groups can optionally be substituted.
- radical naming conventions can include either a mono-radical or a di-radical, depending on the context.
- a substituent requires two points of attachment to the rest of the molecule, it is understood that the substituent is a di-radical.
- a substituent identified as alkyl that requires two points of attachment includes di-radicals such as -CH 2 -, -CH 2 CH 2 -, -CH 2 CH(CH 3 )CH 2 -, and the like.
- Other radical naming conventions clearly indicate that the radical is a di-radical such as "alkylene,” “alkenylene,” “arylene,” “heterocycloalkylene,” and the like.
- a substituent is depicted as a di-radical (i.e., has two points of attachment to the rest of the molecule), it is to be understood that the substituent can be attached in any directional configuration unless otherwise indicated.
- "Isomerism” means compounds that have identical molecular formulae but differ in the sequence of bonding of their atoms or in the arrangement of their atoms in space. Isomers that differ in the arrangement of their atoms in space are termed “stereoisomers.” Stereoisomers that are not mirror images of one another are termed “diastereoisomers,” and stereoisomers that are non-superimposable mirror images of each other are termed “enantiomers,” or sometimes “optical isomers.”
- chiral center A carbon atom bonded to four non-identical substituents is termed a "chiral center.”
- “Chiral isomer” means a compound with at least one chiral center. Compounds with more than one chiral center may exist either as an individual diastereomer or as a mixture of diastereomers, termed “diastereomeric mixture.”
- a stereoisomer may be characterized by the absolute configuration (R or S) of that chiral center. Absolute configuration refers to the arrangement in space of the substituents attached to the chiral center. The substituents attached to the chiral center under consideration are ranked in accordance with the Sequence Rule of Cahn, Ingold and Prelog.
- the compounds disclosed in this description and in the claims may comprise one or more asymmetric centers, and different diastereomers and/or enantiomers of each of the compounds may exist.
- the description of any compound in this description and in the claims is meant to include all enantiomers, diastereomers, and mixtures thereof, unless stated otherwise.
- the description of any compound in this description and in the claims is meant to include both the individual enantiomers, as well as any mixture, racemic or otherwise, of the enantiomers, unless stated otherwise.
- the structure of a compound is depicted as a specific enantiomer, it is to be understood that the coumponds disclosed herein are not limited to that specific enantiomer.
- the structural formula of the compound represents a certain isomer for convenience in some cases, but the present disclosure includes all isomers, such as geometrical isomers, optical isomers based on an asymmetrical carbon, stereoisomers, tautomers, and the like, it being understood that not all isomers may have the same level of activity.
- the compounds may occur in different tautomeric forms.
- the compounds according to the disclosure are meant to include all tautomeric forms, unless stated otherwise. When the structure of a compound is depicted as a specific tautomer, it is to be understood that the instant disclosure is not limited to that specific tautomer.
- a salt for example, can be formed between an anion and a positively charged group (e.g., amino) on a compound of the disclosure.
- Suitable anions include chloride, bromide, iodide, sulfate, bisulfate, sulfamate, nitrate, phosphate, citrate, methanesulfonate, trifluoroacetate, glutamate, glucuronate, glutarate, malate, maleate, succinate, fumarate, tartrate, tosylate, salicylate, lactate, naphthalenesulfonate, and acetate (e.g., trifluoroacetate).
- pharmaceutically acceptable anion refers to an anion suitable for forming a pharmaceutically acceptable salt.
- a salt can also be formed between a cation and a negatively charged group (e.g., carboxylate) on a compound of the disclosure.
- Suitable cations include sodium ion, potassium ion, magnesium ion, calcium ion, and an ammonium cation such as tetramethylammonium ion.
- Examples of some suitable substituted ammonium ions are those derived from: ethylamine, diethylamine, dicyclohexylamine, triethylamine, butylamine, ethylenediamine, ethanolamine, diethanolamine, piperazine, benzylamine, phenylbenzylamine, choline, meglumine, and tromethamine, as well as amino acids, such as lysine and arginine.
- the compounds of the disclosure also include those salts containing quaternary nitrogen atoms.
- suitable inorganic anions include, but are not limited to, those derived from the following inorganic acids: hydrochloric, hydrobromic, hydroiodic, sulfuric, sulfurous, nitric, nitrous, phosphoric, and phosphorous.
- Suitable organic anions include, but are not limited to, those derived from the following organic acids: 2-acetyoxybenzoic, acetic, ascorbic, aspartic, benzoic, camphorsulfonic, cinnamic, citric, edetic, ethanedisulfonic, ethanesulfonic, fumaric, glucheptonic, gluconic, glutamic, glycolic, hydroxymaleic, hydroxynaphthalene carboxylic, isethionic, lactic, lactobionic, lauric, maleic, malic, methanesulfonic, mucic, oleic, oxalic, palmitic, pamoic, pantothenic, phenylacetic, phenylsulfonic, propionic, pyruvic, salicylic, stearic, succinic, sulfanilic, tartaric, toluenesulfonic, and valeric.
- the compounds of the present disclosure can exist in either hydrated or unhydrated (the anhydrous) form or as solvates with other solvent molecules.
- Non-limiting examples of hydrates include monohydrates, dihydrates, etc.
- Non-limiting examples of solvates include ethanol solvates, acetone solvates, etc.
- “Solvate” means solvent addition forms that contain either stoichiometric or non-stoichiometric amounts of solvent. Some compounds have a tendency to trap a fixed molar ratio of solvent molecules in the crystalline solid state, thus forming a solvate. If the solvent is water the solvate formed is a hydrate; and if the solvent is alcohol, the solvate formed is an alcoholate.
- Hydrates are formed by the combination of one or more molecules of water with one molecule of the substance in which the water retains its molecular state as H 2 0.
- a hydrate refers to, for example, a mono-hydrate, a di-hydrate, a tri-hydrate, etc.
- a crystal polymorphism may be present for the compounds or salts thereof represented by the formulae disclosed herein. It is noted that any crystal form, crystal form mixture, or anhydride or hydrate thereof, is included in the scope of the present disclosure.
- the present disclosure provides methods and compositions for treating a human subject with an antibody drug conjugate (ADC) comprising an anti-CD117 antibody conjugated to a cytotoxin (e.g., an amatoxin).
- ADC antibody drug conjugate
- cytotoxin e.g., an amatoxin
- a receptor occupancy (RO) assay can be used to determine the amount of the anti-CD117 ADC to be delivered, where an anti-CD117 antibody (or antigen binding fragment thereof) that is the same as the anti-CD117 antibody of the ADC is used as a therapeutic antibody in an RO assay.
- an antibody or antigen binding fragment that is competitive to the therapeutic antibody can be used in an RO assay to determine receptor saturation for a given concentration of the therapeutic antibody, fragment thereof, or competitive antibody or fragment thereof.
- the RO assay can be used to guide dose escalation decisions, allowing the dose to be escalated until target saturation occurs.
- the RO assay can be used to determine a patient’s maximum dose, where the maximum dose is the dose (or antibody concertation) resulting in 100% of receptors being bound.
- the RO assay and the determined receptor occupancy for a given antibody concertation can be used to confirm that a proposed dose is at or below a saturating dose.
- a method for treating a human subject in need thereof comprising determining CD117 receptor occupancy of a therapeutic anti-CD117 antibody on CD117 expressing cells from the human subject.
- the method includes performing a receptor occupancy (RO) assay on a sample from the human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample followed by administration to the human subject of an amount of the therapeutic anti-CD117 antibody (or preferably an ADC comprising the therapeutic antibody) that is less than about 10 times, less than about 5 times, less than about 2 times, less than about 1.5 times, less than about 1.2 times, or less than about 1.1 times an amount of the therapeutic anti-CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay.
- RO receptor occupancy
- the human subject is administered an amount of the therapeutic anti-CD117 antibody (or ADC thereof) that is less than an amount of the therapeutic anti-CD117 antibody (or ADC thereof) sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay.
- the human subject is administered an amount of the therapeutic anti-CD117 antibody (or ADC thereof) that is less than an amount of the therapeutic anti-CD117 antibody (or ADC thereof) sufficient to result in about 95% CD117 receptor occupancy as determined by the RO assay.
- the human subject is administered an amount of the therapeutic anti-CD117 antibody (or ADC thereof) that is less than an amount of the therapeutic anti-CD117 antibody (or ADC thereof) sufficient to result in about 90% CD117 receptor occupancy as determined by the RO assay.
- the human subject is administered an amount of the therapeutic anti-CD117 antibody (or ADC thereof) that is less than an amount of the therapeutic anti-CD117 antibody (or ADC thereof) sufficient to result in about 85% CD117 receptor occupancy as determined by the RO assay.
- the human subject is administered an amount of the therapeutic anti-CD117 antibody (or ADC thereof) that is less than an amount of the therapeutic anti-CD117 antibody (or ADC thereof) sufficient to result in about 80% CD117 receptor occupancy as determined by the RO assay.
- Also disclosed herein is a method for depleting CD117 expressing cells in a human subject where a dose of an anti-CD117 antibody drug conjugate (ADC) comprising an anti- CD117 antibody conjugated to an amatoxin is administered to a human subject in need thereof.
- the dose is determined by an RO assay using the therapeutic anti-CD117 antibody of the ADC (or a competitive antibody thereof).
- the dose is less than about 10 times, less than about 5 times, less than about 2 times, less than about 1.5 times, less than about 1.2 times, or less than about 1.1 times an amount of the therapeutic anti- CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay.
- the dose used for treatment of the human subject in need thereof resulted in at least about 80% receptor occupancy in the RO assay; at least about 85% receptor occupancy in the RO assay; at least about 90% receptor occupancy in the RO assay; at least about 95% receptor occupancy in the RO assay; at least about 99% receptor occupancy in the RO assay, or 100% receptor occupancy in the RO assay.
- the methods disclosed herein can be used to condition a human subject with an anti- CD117 ADC where the human subject is undergoing a cell transplant, e.g., a stem cell transplant.
- the method can further include administering the transplant to the human subject, e.g., once the ADC has substantially cleared.
- the stem cell transplant is an HSC transplant.
- the methods and compositions disclosed herein are used to treat a human subject having a stem cell disorder.
- compositions and methods described herein can be used to treat cancers directly, such as cancers characterized by cells that are CD117+.
- cancers characterized by cells that are CD117+.
- the compositions and methods described herein can be used to treat leukemia, particularly in patients that exhibit CD117+ leukemic cells.
- the compositions and methods described herein can be used to treat various cancers directly.
- Exemplary cancers that may be treated in this fashion include hematological cancers, such as acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, and non-Hodgkin's lymphoma.
- the cancer is a hematological cancer.
- Acute myeloid leukemia is a cancer of the myeloid line of blood cells, characterized by the rapid growth of abnormal white blood cells that build up in the bone marrow and interfere with the production of normal blood cells.
- AML is the most common acute leukemia affecting adults, and its incidence increases with age.
- the symptoms of AML are caused by replacement of normal bone marrow with leukemic cells, which causes a drop in red blood cells, platelets, and normal white blood cells.
- the anti-CD117 ADCs described herein are used to treat AML in a human patient in need thereof.
- the anti-CD117 ADC treatment depletes AML cells in the treated subjects. In some embodiments 50% or more of the AML cells are depleted. In other embodiments, 60% or more of the AML cells are depleted, or 70% or more of the AML cells are depleted, or 80% of more or 90% or more, or 95% or more of the AML cells are depleted.
- the cancer may be a hematological cancer, such as leukemia or myelodysplastic syndrome.
- leukemia that may be treated using the methods and compositions disclosed herein include, but are not limited to, acute myeloid leukemia, acute lymphoblastic leukemia, or chronic lymphocytic leukemia.
- the compositions and methods described herein can be used to treat autoimmune disorders. For instance, an antibody, or antigen-binding fragment thereof, can be administered to a subject, such as a human patient suffering from an autoimmune disorder, so as to kill a CD117+ immune cell.
- the CD117+ immune cell may be an autoreactive lymphocyte, such as a T-cell that expresses a T-cell receptor that specifically binds, and mounts an immune response against, a self antigen.
- an autoreactive lymphocyte such as a T-cell that expresses a T-cell receptor that specifically binds, and mounts an immune response against, a self antigen.
- the compositions and methods described herein can be used to treat autoimmune pathologies, such as those described below. Additionally or alternatively, the compositions and methods described herein can be used to treat an autoimmune disease by depleting a population of endogenous hematopoietic stem cells prior to hematopoietic stem cell transplantation therapy, in which case the transplanted cells can home to a niche created by the endogenous cell depletion step and establish productive hematopoiesis. This, in turn, can re-constitute a population of cells depleted during autoimmune cell eradication.
- Autoimmune diseases that can be treated using the compositions and methods described herein include, without limitation, psoriasis, psoriatic arthritis, Type 1 diabetes mellitus (Type 1 diabetes), rheumatoid arthritis (RA), human systemic lupus (SLE), multiple sclerosis (MS), inflammatory bowel disease (IBD), lymphocytic colitis, acute disseminated encephalomyelitis (ADEM), Addison's disease, alopecia universalis, ankylosing spondylitisis, antiphospholipid antibody syndrome (APS), aplastic anemia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune lymphoproliferative syndrome (ALPS), autoimmune oophoritis, Balo disease, Behcet's disease, bullous pemphigoid, cardiomyopathy, Chagas' disease, chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy, Crohn
- the methods include determining the receptor occupancy for an anti- CD117 antibody (or a competitive antibody thereof) on cells, e.g., hematopoietic stem cells (HSCs) to determine the percentage of available receptors that are bound as a function of drug concentration.
- Receptor occupancy can be determined using receptor occupancy (RO) assay based on a sample from the human subject.
- sample may be performed on the same sample or material obtained from the same sample.
- assays may be performed on a sample, meaning individual assays on material obtained from the same sample or the assay is performed on the same sample.
- the sample tested in the RO assay is obtained from the same subject who will be treated with the ADC comprising the anti-CD117 therapeutic antibody.
- the sample is peripheral blood or bone marrow from the human subject.
- a receptor occupancy assay is used to determine binding of a therapeutic antibody of interest.
- a competitive antibody may be used in an RO assay, which may bind to the same epitope as the therapeutic antibody or just cross block binding of the therapeutic antibody to the antigen.
- RO assay where a therapeutic antibody is referenced, a competitive antibody thereof may be used as an alternative in the assay.
- a receptor occupancy assay generally provides a percentage of how many “receptors”, e.g., CD117, are bound by an amount of a compound of interest, e.g., a therapeutic anti-CD117 antibody or a competitive antibody.
- a receptor occupancy assay measures the percentage of CD117 that is bound by an amount of the antibody of interest, e.g., Ab85 which is an anti-CD117 antibody. The percentage of bound CD117 is dependent on the amount of antibody used in the assay.
- the amount of antibody can be adjusted in order to achieve the desired saturation percentage, e.g., at least about 80% receptor occupancy, at least about 85% receptor occupancy, at least about 90% receptor occupancy, at least about 95% receptor occupancy, at least about 96% receptor occupancy, at least about 97% receptor occupancy, at least about 98% receptor occupancy, at least about 99% receptor occupancy, or 100% receptor occupancy.
- the term is intended to include a population of cells. For example, if a cell is contacted with a labelled anti-CD117 antibody, it is intended to also refer to a population of cells being contacted.
- the methods disclosed herein are based, at least in part, on the discovery that receptor occupancy and cell surface expression of CD117, including HSCs from human patients in need of a stem cell transplant, are capable of being assessed by RO assays, such as a flow cytometry RO assay.
- RO assays such as a flow cytometry RO assay.
- the output of the RO assays contemplated herein can be used to select an appropriate dosage of a therapeutic antibody to be administered to a subject.
- a flow cytometry receptor occupancy (RO) assay is an in vitro or ex vivo cell assay using flow cytometry to determine the percentage of available receptors on a cell.
- a flow cytometry RO assay can be used to determine the total number of available receptors on a cell, e.g., a hematopoietic stem cell (HSC) or a leukemic blast cell, from a given subject.
- HSC hematopoietic stem cell
- leukemic blast cell a leukemic blast cell
- a receptor occupancy assay is a free receptor occupancy assay, in which unbound (or unoccupied) receptors (e.g., CD117) on a cell are determined by contacting the cell with both the therapeutic antibody of interest and a competitive antibody.
- One of the two antibodies is labeled with a detectable agent.
- the competitive antibody is labeled with a detectable agent. The binding of the unlabeled antibody is then determined by measuring the signal from the detectable agent of the labeled antibody, which provides a means to then calculate the level of unoccupied receptors (e.g., CD117).
- a receptor occupancy assay is a free and total receptor occupancy assay, in which unbound (or unoccupied) receptors (e.g., CD117) on a cell are determined by contacting the cell with the therapeutic antibody of interest, a competitive antibody labeled with a first detectable agent, and a non-competitive antibody labeled with a second detectable agent, whereby the non-competitive antibody is used to determine the total number of receptors, e.g., CD117, on a cell surface.
- unbound (or unoccupied) receptors e.g., CD117
- Such an assay measures the binding of a desired therapeutic antibody to its receptor site, e.g., CD117, by subtracting the signal from the second detectable agent (i.e., the non-competitive antibody, which provides the total number of available receptors on a cell) from the signal from the first detectable agent (i.e., the competitive antibody, which provides the number of unbound (or unoccupied) receptors).
- the non-competing antibody does not compete for binding with the therapeutic antibody of interest (or with the competitive antibody).
- This information can be useful in determining dosing in patients where the target may have differential expression depending on the patient, e.g., where the receptor level or cell numbers can markedly change (up or down) over time.
- the methods disclosed herein can be used to determine dosing of an ADC comprising Ab85 conjugated via a linker to an amatoxin (described in more detail below).
- detection reagents that can be used to in RO assays for determining receptor occupancy of Ab85 (or an antigen binding fragment thereof) which is representative of an anti-CD117 ADC containing the Ab85 antibody.
- an RO assay may use a labeled Ab85 (or an antigen binding fragment thereof).
- a label may be, for example, a fluorophore.
- a labeled Ab85 antibody (or an antigen binding fragment thereof) may be used in combination with an unlabeled competitive anti-CD117 antibody (or vice versa regarding labelling; one of the antibodies is labeled).
- a competitive antibody may, in some embodiments, bind to the same epitope as Ab85.
- the therapeutic anti-CD117 antibody e.g., Ab85
- a method for determining receptor occupancy of a therapeutic anti-CD117 antibody on CD117 expressing cells from a human subject comprising performing a receptor occupancy (RO) assay on a sample from a human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample.
- RO receptor occupancy
- the RO assay is used to determine the RO of the therapeutic antibody.
- the therapeutic antibody is used.
- a surrogate antibody which represents the therapeutic antibody e.g., an antibody that competes with the therapeutic antibody for antigen binding, is used.
- the method for determining receptor occupancy of a therapeutic anti-CD117 antibody on CD117 expressing cells from a human subject comprises performing a receptor occupancy (RO) assay on a sample from a human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample, wherein the therapeutic anti-CD117 antibody, e.g., an anitbody comprising a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
- the therapeutic anti-CD117 antibody e.g., an anitbody comprising a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106
- the RO assay comprises contacting the sample with the anti-CD117 therapeutic antibody, detecting the amount of the anti-CD117 therapeutic antibody bound to CD117 expressing cells in the sample, and calculating the percentage of CD117 bound by the anti-CD117 therapeutic antibody.
- the RO assay comprises contacting the sample with an amount of a surrogate of the therapeutic antibody, where the surrogate is an antigen binding fragment of the therapeutic antibody, a competitive anti-CD117 antibody that cross blocks the therapeutic antibody, or an antigen-binding fragment of the competitive anti-CD117 antibody, detecting the amount of the surrogate bound to CD117 expressing cells in the sample, calculating the fraction of CD117 bound by the amount of the surrogate, and correlating the fraction of CD117 bound by the amount of the surrogate to an amount of the therapeutic antibody that would result in substantially the same fraction of CD117 being bound by the therapeutic antibody.
- an RO assay comprises contacting a sample from a human subject with the anti-CD117 therapeutic antibody, an antigen binding fragment thereof, a competitive anti-CD117 antibody thereof, or an antigen-binding fragment of the competitive anti-CD117 antibody, and contacting the sample (or an equivalent sample) with a second anti-CD117 antibody, or an antigen-binding fragment thereof, which does not cross block the therapeutic anti-CD117 antibody, wherein the competitive anti-CD117 antibody, or an antigen binding fragment thereof of the competitive anti-CD117 antibody, is labelled with a first detectable agent and the second anti-CD117 antibody, or an antigen-binding fragment thereof, is labeled with a second detectable agent.
- a second anti-CD117 antibody that does not cross block the therapeutic anti-CD117 antibody may be useful, for example, as a reference in instances where the therapeutic anti-CD117 antibody may at least partially obscure the output of an RO assay.
- a therapeutic anti-CD117 antibody may antagonize CD117 thereby reducing the true number of CD117 molecules in a sample, e.g., by causing cell death or otherwise reducing the number of CD117 molecules on the surface of the cell.
- a second anti-CD117 antibody that does not cross block the therapeutic anti-CD117 antibody may provide a reference for the RO assay to control for any loss of CD117 in the sample due to the therapeutic anti-CD117 antibody.
- second anti- CD117 antibody that does not cross block the therapeutic anti-CD117 antibody may be useful, for example, for determining the total number of CD117 on a cell in the sample.
- an RO assay comprises contacting a sample from a human subject with a) the anti-CD117 therapeutic antibody, an antigen binding fragment thereof, the competitive anti-CD117 antibody, or an antigen binding fragment thereof, and b) a second antibody, or an antigen-binding fragment thereof, which is labelled and specifically binds to the therapeutic anti-CD117 antibody an antigen binding fragment thereof, the competitive anti-CD117 antibody, or an antigen binding fragment thereof.
- the sample is then contacted with a third anti-CD117 antibody, or an antigen-binding fragment thereof, which does not compete with the therapeutic anti-CD117 antibody for binding to human CD117, where the second antibody, or antigen-binding fragment thereof, does not cross react with the third anti-CD117 antibody, or an antigen-binding fragment thereof, and where the second anti- CD117 antibody, or antigen binding fragment thereof, is labelled with a first detectable agent and the third antibody, or an antigen-binding fragment thereof, is labeled with a second detectable agent.
- an RO assay comprises contacting a sample from a human subject with a) the therapeutic anti-CD117 antibody, an antigen binding fragment thereof, b) a second anti-CD117 antibody, or an antigen-binding fragment thereof, which is labelled with a first detectable agent and competes with the therapeutic anti-CD117 antibody for binding to human CD117, and c) a third anti-CD117 antibody, or an antigen-binding fragment thereof, which is labelled with a second detectable agent and does not compete with the therapeutic anti- CD117 antibody for binding to human CD117.
- an RO assay comprises contacting a sample from a human subject with a) the therapeutic anti-CD117 antibody, an antigen binding fragment thereof, the competitive anti-CD117 antibody, or an antigen binding fragment thereof, b) a second anti-CD117 antibody, or an antigen-binding fragment thereof, which is labelled with a first detectable agent and does not compete with the therapeutic anti- CD117 antibody for binding to human CD117, and c) a third antibody, or an antigen-binding fragment thereof, which is labeled with a second detectable agent and specifically binds to the therapeutic anti-CD117 antibody, an antigen binding fragment thereof, the competitive anti-CD117 antibody, or an antigen binding fragment thereof, and the second anti-CD117 antibody.
- the detectable agent is selected from the group consisting of a fluorescent label, a luminescent label, a bioluminescent label, a magnetic label, a radiolabel, and an enzyme.
- the detectable agent is a fluorescent label (i.e., a fluorophore).
- a first detectable agent may be a first fluorophore
- a second detectable agent may be a second fluorophore which is detected at a different emission wavelength than the first detectable agent.
- fluorophores include, but are not limited to, phycoerythrin (PE), allophycocyanin (APC), BD Horizon BrilliantTM Violet 421 (BV421), BD Horizon BrilliantTM Violet 510 (BV510), BD Horizon BrilliantTM Violet 785 (BV785), fluorescein (FITC), PerCP-Cy5.5, and Alexa Fluor® 647 (AF647).
- the phycoerythrin is phycoerythrin (PE)-Dazzle 594, PE/Cy5, PE/Cy5.5 or PE/Cy7.
- the phycoerythrin is allophycocyanin is allophycocyanin- Cy7.
- Receptor occupancy generally can be determined by measuring a signal from the first detectable agent, measuring a signal from the second detectable agent, and comparing the signals in order to determine the percent receptor occupancy.
- the percentage of therapeutic anti-CD117 antibody bound to CD117 expressing cells, as well as, or alternatively, mean fluorescent intensity (MFI) of bound antibody will be quantified by a flow cytometry-based receptor occupancy assay.
- This assay can be performed on whole blood, peripheral blood and /or bone marrow aspirates.
- the receptor occupancy assay provides data to determine the amount and/or type of CD117 expressing cells that the therpaetuic antibody (or competitive antibody thereof) is interacting with.
- samples from a human subject suffering from a disease or disorder which is treatable with an HSC transplant are taken prior to treatment with the anti- CD117 ADC to determine an appropriate dose to achieve a level of receptor occupancy in the human subject.
- samples from a human subject are taken to determine the amount of CD117 expressed on a cell surface in order to determine an appropriate dose to achieve a level of receptor occupancy in the human subject.
- samples from a human subject suffering from a disease or disorder which is treatable with an HSC transplant are taken after treatment with the anti-CD117 ADC to determine an appropriate dose to achieve a level of receptor occupancy in the human subject.
- an anti-CD117 antibody, or antigen binding fragment thereof comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
- an anti-CD117 antibody, or antigen binding fragment thereof comprises a light chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 104, and a heavy chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 103.
- VH heavy chain variable region amino acid sequence of Ab85
- SEQ ID NO: 103 The heavy chain variable region (VH) amino acid sequence of Ab85 is provided below as SEQ ID NO: 103.
- the VH CDR amino acid sequences of Ab85 are underlined below and are as follows: NYWIG (VH CDR1 ; SEQ ID NO: 105); IINPRDSDTRYRPSFQG (VH CDR2; SEQ ID NO: 106); and HGRGYEGYEGAFDI (VH CDR3; SEQ ID NO: 107).
- VL light chain variable region amino acid sequence of Ab85
- SEQ ID NO: 104 The light chain variable region amino acid sequence of Ab85 is provided below as SEQ ID NO: 104.
- the VL CDR amino acid sequences of Ab85 are underlined below and are as follows: RSSQGIRSDLG (VL CDR1 ; SEQ ID NO: 108); DASNLET (VL CDR2; SEQ ID NO: 109); and QQANGFPLT (VL CDR3; SEQ ID NO: 110).
- an anti-CD117 antibody, or antigen binding fragment thereof comprises a heavy chain having the amino acid sequence as set forth as SEQ ID NO: 130, and a light chain having an amino acid sequence set forth as SEQ ID NO: 144.
- an anti-CD117 antibody is an lgG1 isotype.
- the anti-CD117 antibody comprising any of the sequences set forth in the Sequence Tables 1-2 can be an intact antibody and/or an lgG1 or an lgG4 isotype.
- the anti-CD117 antibody, or binding fragment thereof comprises a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule has an altered affinity for an FcgammaR.
- Certain amino acid positions within the Fc region are known through crystallography studies to make a direct contact with FcyR. Specifically, amino acids 234- 239 (hinge region), amino acids 265-269 (B/C loop), amino acids 297-299 (C'/E loop), and amino acids 327-332 (F/G) loop (see Sondermann et al., 2000 Nature, 406: 267-273).
- an anti-CD117 antibody described herein comprises an Fc region comprising an amino acid substituion at L234 and/or L235, e.g., L234A and L235A (EU index).
- the anti-CD117 antibodies described herein may comprise variant Fc regions comprising modification of at least one residue that makes a direct contact with an FcyR based on structural and crystallographic analysis.
- the Fc region of the anti-CD117 antibody (or Fc containing fragment thereof) comprises an amino acid substitution at amino acid 265 according to the EU index as in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, NH1 , MD (1991), expressly incorporated herein by references.
- the "EU index as in Kabat” or “EU index” refers to the numbering of the human lgG1 EU antibody and is used herein in reference to Fc amino acid positions unless otherwise indicated.
- the Fc region comprises a D265A mutation. In one embodiment, the Fc region comprises a D265C mutation.
- the Fc region of the anti-CD117 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 234 according to the EU index as in Kabat. In one embodiment, the Fc region comprises a L234A mutation. In some embodiments, the Fc region of the anti-CD117 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 235 according to the EU index as in Kabat. In one embodiment, the Fc region comprises a L235A mutation. In yet another embodiment, the Fc region comprises a L234A and L235A mutation. In a further embodiment, the Fc region comprises a D265C, L234A, and L235A mutation.
- a variant IgG Fc domain comprises one or more amino acid substitutions resulting in decreased or ablated binding affinity for an FcgammaR and/or C1q as compared to the wild type Fc domain not comprising the one or more amino acid substitutions.
- Fc binding interactions are essential for a variety of effector functions and downstream signaling events including, but not limited to, antibody dependent cell-mediated cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC).
- ADCC antibody dependent cell-mediated cytotoxicity
- CDC complement dependent cytotoxicity
- an antibody comprising a modified Fc region e.g., comprising a L234A, L235A, and a D265C mutation
- Affinity to an Fc region can be determined using a variety of techniques known in the art, for example but not limited to, equilibrium methods (e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52-60, 2008; or radioimmunoassay (RIA)), or by a surface plasmon resonance assay or other mechanism of kinetics-based assay (e.g., BIACORETM analysis or OctetTM analysis (forteBIO)), and other methods such as indirect binding assays, competitive binding assays fluorescence resonance energy transfer (FRET), gel electrophoresis and chromatography (e.g., gel filtration).
- equilibrium methods e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52-60, 2008; or radioimmunoassay (
- These and other methods may utilize a label on one or more of the components being examined and/or employ a variety of detection methods including but not limited to chromogenic, fluorescent, luminescent, or isotopic labels.
- detection methods including but not limited to chromogenic, fluorescent, luminescent, or isotopic labels.
- a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen with the antibody of interest in the presence of increasing amounts of unlabeled antigen, and the detection of the antibody bound to the labeled antigen.
- the affinity of the antibody of interest for a particular antigen and the binding off- rates can be determined from the data by scatchard plot analysis.
- Competition with a second antibody can also be determined using radioimmunoassays.
- the antigen is incubated with antibody of interest conjugated to a labeled compound in the presence of increasing amounts of an unlabeled second antibody.
- an anti-CD117 antibody described herein comprises an Fc region comprising L235A, L235A, and D265C (EU index).
- the antibodies of the invention may be further engineered to further modulate antibody half-life by introducing additional Fc mutations, such as those described for example in (Dall'Acqua et al. (2006) J Biol Chem 281: 23514-24), (Zalevsky et al. (2010) Nat Biotechnol 28: 157-9), (Hinton et al. (2004) J Biol Chem 279: 6213-6), (Hinton et al. (2006) J Immunol 176: 346-56), (Shields et al.
- the Fc region comprises a mutation resulting in a decrease in half life.
- An antibody having a short half-life may be advantageous in certain instances where the antibody is expected to function as a short-lived therapeutic, e.g., the conditioning step described herein where the antibody is administered followed by HSCs. Ideally, the antibody would be substantially cleared prior to delivery of the HSCs, which also generally express CD117 but are not the target of the anti-CD117 antibody, unlike the endogenous stem cells.
- the Fc region comprises a mutation at position 435 (EU index according to Kabat). In one embodiment, the mutation is an H435A mutation.
- the anti-CD117 antibody described herein has a half-life of equal to or less than 24 hours, equal to or less than 22 hours, equal to or less than 20 hours, equal to or less than 18 hours, equal to or less than 16 hours, equal to or less than 14 hours, equal to or less than 13 hours, equal to or less than 12 hours, or equal to or less than 11 hours.
- the half-life of the antibody is 11 hours to 24 hours; 12 hours to 22 hours;
- Antibodies may be produced using recombinant methods and compositions, e.g., as described in U.S. Pat. No. 4,816,567.
- isolated nucleic acid encoding an anti-CD117 antibody described herein is provided.
- Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody).
- one or more vectors e.g., expression vectors
- a host cell comprising such nucleic acid is provided.
- a host cell comprises (e.g., has been transformed with): (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody.
- the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, Sp20 cell).
- a method of making an anti-CLL-1 antibody comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
- nucleic acid encoding an antibody is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
- nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
- Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
- antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
- expression of antibody fragments and polypeptides in bacteria see, e.g., U.S. Pat. Nos. 5,648,237, 5,789,199, and 5,840,523. (See also Charlton, Methods in Molecular Biology,
- the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
- Vertebrate cells may also be used as hosts.
- mammalian cell lines that are adapted to grow in suspension may be useful.
- Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK); mouse sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod.
- monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells.
- Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR- CHO cells (Urlaub et al., Proc. Natl. Acad. Sci.
- the anti-CD117 antibody, or antigen binding fragment thereof comprises variable regions having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
- the anti-CD117 antibody, or antigen binding fragment thereof comprises CDRs comprising the SEQ ID Nos disclosed herein with framework regions of the variable regions described herein having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein in any of Tables land 2.
- the anti-CD117 antibody, or antigen binding fragment thereof comprises a heavy chain variable region and a heavy chain constant region having an amino acid sequence that is disclosed herein (e.g., Tables 1 or 2).
- the anti- CD117 antibody, or antigen binding fragment thereof comprises a light chain variable region and a light chain constant region having an amino acid sequence that is disclosed herein (e.g., Tables 1or 2).
- the anti-CD117 antibody, or antigen binding fragment thereof comprises a heavy chain variable region, a light chain variable region, a heavy chain constant region and a light chain constant region having an amino acid sequence that is disclosed herein (e.g., Tables 1 and 2). TABLE 1 : ANTI-CD117 ANTIBODY SEQUENCES AND ANTIBODY CONSTANT REGION SEQUENCES
- Anti-CD117 antibodies, and antigen-binding fragments thereof, described herein in Tabels 1 and 2, e.g., Ab85 can be conjugated (linked) to a cytotoxin.
- the cytotoxic molecule is conjugated to a cell internalizing anti-CD117 antibody, or antigen-binding fragment thereof as disclosed herein such that following the cellular uptake of the antibody, or fragment thereof, the cytotoxin may access its intracellular target and mediate hematopoietic cell death.
- An example of such an antibody is Ab85.
- cytotoxins can be conjugated to an anti-CD117 antibody or antigen-binding fragment thereof via a linker for use in the therapies described herein.
- the terms "cytotoxin", “cytotoxic moiety", and “drug” are used interchangeably.
- ADCs of the present invention therefore may be of the general formula Ab-(Z-L-D) n , wherein an anti-CD117 antibody or antigen-binding fragment thereof (Ab) is conjugated (covalently linked) to a linker (L), and through a chemical moiety (Z), to a cytotoxic moiety (“drug,” D).
- the anti-CD117 antibody or antigen-binding fragment thereof may be conjugated to a number of drug moieties as indicated by integer n, which represents the average number of cytotoxins per antibody. Any number of cytotoxins can be conjugated to the antibody, e.g., about 1 , about 2, about 3, about 4, about 5, about 6, about 7, or about 8.
- n is from 1 to 4. In some embodiments, n is from 1 to 3. In some embodiments, n is about 2. In some embodiments, n is about 1.
- the average number of drug moieties per antibody in preparations of ADC from conjugation reactions may be characterized by conventional means such as mass spectroscopy, ELISA assay, and HPLC. The quantitative distribution of ADC in terms of n may also be determined. In some instances, separation, purification, and characterization of homogeneous ADC where n is a certain value from ADC with other drug loadings may be achieved by means such as reverse phase HPLC or electrophoresis.
- n may be limited by the number of attachment sites on the antibody.
- an antibody may have only one or several cysteine thiol groups, or may have only one or several sufficiently reactive thiol groups through which a linker may be attached.
- antibodies do not contain many free and reactive cysteine thiol groups which may be linked to a drug moiety; primarily, cysteine thiol residues in antibodies exist as disulfide bridges.
- an antibody may be reduced with a reducing agent such as dithiothreitol (DTT) or tricarbonylethylphosphine (TCEP), under partial or total reducing conditions, to generate reactive cysteine thiol groups.
- a reducing agent such as dithiothreitol (DTT) or tricarbonylethylphosphine (TCEP)
- DTT dithiothreitol
- TCEP tricarbonylethylphosphine
- higher drug loading e.g. n>5
- an antibody may contain, for example, lysine residues that do not react with the drug-linker intermediate or linker reagent, as discussed below. Only the most reactive lysine groups may react with an amine-reactive linker reagent. In certain embodiments, an antibody is subjected to denaturing conditions to reveal reactive nucleophilic groups such as lysine or cysteine.
- the loading (drug/antibody ratio) of an ADC may be controlled in different ways, e.g., by: (i) limiting the molar excess of drug-linker intermediate or linker reagent relative to antibody, (ii) limiting the conjugation reaction time or temperature, (iii) partial or limiting reductive conditions for cysteine thiol modification, (iv) engineering by recombinant techniques the amino acid sequence of the antibody such that the number and position of cysteine residues is modified for control of the number and/or position of linker-drug attachments.
- Cytotoxins e.g., limiting the molar excess of drug-linker intermediate or linker reagent relative to antibody, (ii) limiting the conjugation reaction time or temperature, (iii) partial or limiting reductive conditions for cysteine thiol modification, (iv) engineering by recombinant techniques the amino acid sequence of the antibody such that the number and position of cysteine residues is modified for control of the number and/
- Cytotoxins suitable for use with the compositions and methods described herein include DNA-intercalating agents, (e.g., anthracyclines), agents capable of disrupting the mitotic spindle apparatus (e.g., vinca alkaloids, maytansine, maytansinoids, and derivatives thereof), RNA polymerase inhibitors (e.g., an amatoxin, such as a-amanitin, and derivatives thereof), and agents capable of disrupting protein biosynthesis (e.g., agents that exhibit rRNA N-glycosidase activity, such as saporin and ricin A-chain), among others known in the art.
- DNA-intercalating agents e.g., anthracyclines
- agents capable of disrupting the mitotic spindle apparatus e.g., vinca alkaloids, maytansine, maytansinoids, and derivatives thereof
- RNA polymerase inhibitors e.g., an amatoxin, such as a-amanitin,
- the cytotoxin is a microtubule-binding agent (for instance, maytansine or a maytansinoid), an amatoxin, pseudomonas exotoxin A, deBouganin, diphtheria toxin, saporin, an auristatin, an anthracycline, a calicheamicin, irinotecan, SN-38, a duocarmycin, a pyrrolobenzodiazepine, a pyrrolobenzodiazepine dimer, an indolinobenzodiazepine, an indolinobenzodiazepine dimer, or a variant thereof, or another cytotoxic compound described herein or known in the art.
- a microtubule-binding agent for instance, maytansine or a maytansinoid
- an amatoxin for instance, maytansine or a maytansinoid
- an amatoxin for instance, maytansine or a maytans
- cytotoxins suitable for use with the compositions and methods described herein include, without limitation, 5-ethynyluracil, abiraterone, acylfulvene, adecypenol, adozelesin, aldesleukin, altretamine, ambamustine, amidox, amifostine, aminolevulinic acid, amrubicin, amsacrine, anagrelide, anastrozole, andrographolide, angiogenesis inhibitors, antarelix, anti-dorsalizing morphogenetic protein-1, antiandrogen, prostatic carcinoma, antiestrogen, antineoplaston, antisense oligonucleotides, aphidicolin glycinate, apoptosis gene modulators, apoptosis regulators, apurinic acid, asulacrine, atamestane, atrimustine, axinastatin 1, axinastatin 2, axinastatin 3,
- Anti-CD117 antibodies, and antigen-binding fragments thereof, described herein can be conjugated to a cytotoxin that is a microtubule binding agent.
- cytotoxin that is a microtubule binding agent.
- microtubule-binding agent refers to a compound which acts by disrupting the microtubular network that is essential for mitotic and interphase cellular function in a cell.
- microtubule-binding agents include, but are not limited to, maytasine, maytansinoids, and derivatives thereof, such as those described herein or known in the art, vinca alkaloids, such as vinblastine, vinblastine sulfate, vincristine, vincristine sulfate, vindesine, and vinorelbine, taxanes, such as docetaxel and paclitaxel, macrolides, such as discodermolides, cochicine, and epothilones, and derivatives thereof, such as epothilone B or a derivative thereof.
- vinca alkaloids such as vinblastine, vinblastine sulfate, vincristine, vincristine sulfate, vindesine, and vinorelbine
- taxanes such as docetaxel and paclitaxel
- macrolides such as discodermolides, cochicine, and epothilones, and derivatives thereof, such as epothil
- the microtubule binding agent is a maytansine, a maytansinoid or a maytansinoid analog.
- Maytansinoids are mitototic inhibitors which bind microtubules and act by inhibiting tubulin polymerization. Maytansine was first isolated from the east African shrub Maytenus serrata (U.S. Pat. No. 3,896,111). Subsequently, it was discovered that certain microbes also produce maytansinoids, such as maytansinol and C-3 maytansinol esters (U.S. Pat. No. 4,151,042). Synthetic maytansinol and derivatives and analogues thereof are disclosed, for example, in U.S. Pat. Nos.
- Maytansinoid drug moieties are attractive drug moieties in antibody drug conjugates because they are: (i) relatively accessible to prepare by fermentation or chemical modification, derivatization of fermentation products, (ii) amenable to derivatization with functional groups suitable for conjugation through the non-disulfide linkers to antibodies, (iii) stable in plasma, and (iv) effective against a variety of tumor cell lines.
- Suitable maytansinoids include esters of maytansinol, synthetic maytansinol, and maytansinol analogs and derivatives. Included herein are any cytotoxins that inhibit microtubule formation and that are highly toxic to mammalian cells, as are maytansinoids, maytansinol, and maytansinol analogs, and derivatives.
- suitable maytansinol esters include those having a modified aromatic ring and those having modifications at other positions.
- Such suitable maytansinoids are disclosed in U.S. Pat. Nos. 4,137,230; 4,151 ,042; 4,248,870; 4,256,746; 4,260,608; 4,265,814; 4,294,757 4,307,016; 4,308,268; 4,308,269; 4,309,428; 4,313,946; 4,315,929; 4,317,821 ; 4,322,348 4,331 ,598; 4,361 ,650; 4,362,663; 4,364,866; 4,424,219 ;4, 450, 254; 4,322,348; 4,362,663 4,371 ,533; 5,208,020; 5,416,064; 5,475,092; 5,585,499; 5,846,545; 6,333,410; 7,276,497; and 7,473,796, the disclosures of each of which are
- the immunoconjugates of the invention utilize the thiol- containing maytansinoid (DM1), formally termed N 2 '-deacetyl-N 2 '-(3-mercapto-1-oxopropyl)- maytansine, as the cytotoxic agent.
- DM1 is represented by the structural formula (V):
- the conjugates of the present invention utilize the thiol- containing maytansinoid N 2 '-deacetyl-N 2 '(4-methyl-4-mercapto-1 -oxopentyl)-maytansine (e.g., DM4) as the cytotoxic agent.
- DM4 is represented by the structural formula (VI):
- N 2 '-deacetyl-N- 2 '(4-mercapto-1-oxopentyl)-maytansine (termed DM3), represented by the structural formula (VII):
- each of the maytansinoids taught in U.S. Pat. Nos. 5,208,020 and 7,276,497 can also be used in the conjugate of the present invention.
- the entire disclosure of 5,208,020 and 7,276,697 is incorporated herein by reference.
- Many positions on maytansinoids can serve as the position to chemically link the linking moiety. For example, the C-3 position having a hydroxyl group, the C-14 position modified with hydroxymethyl, the C-15 position modified with hydroxy and the C-20 position having a hydroxy group are all expected to be useful.
- the C-3 position serves as the position to chemically link the linking moiety
- the C-3 position of maytansinol serves as the position to chemically link the linking moiety.
- linking groups known in the art for making antibody- maytansinoid conjugates, including, for example, those disclosed in U.S. Pat. Nos. 5,208,020, 6,441,163, and EP Patent No. 0425235 B1 ; Chari et al., Cancer Research 52:127-131 (1992); and U.S. 2005/0169933 A1, the disclosures of which are hereby expressly incorporated by reference. Additional linking groups are described and exemplified herein.
- the present disclosure also includes various isomers and mixtures of maytansinoids and conjugates.
- Certain compounds and conjugates of the present invention may exist in various stereoisomeric, enantiomeric, and diastereomeric forms.
- Several descriptions for producing such antibody-maytansinoid conjugates are provided in U.S. Pat. Nos. 5,208,020, 5,416,0646,333,410, 6,441,163, 6,716,821, and 7,368,565, each of which is incorporated herein in its entirety.
- a therapeutically effective number of maytansinoid molecules bound per antibody molecule can be determined by measuring spectrophotometrically the ratio of the absorbance at 252 nm and 280 nm.
- An average of 3 to 4 maytansinoid molecules conjugated per antibody molecule can enhancing cytotoxicity of target cells without negatively affecting the function or solubility of the antibody, although one molecule of toxin/antibody can enhance cytotoxicity over antibody alone.
- the average number of maytansinoid molecules/antibody or antigen binding fragment thereof can be, for example, 1-10 or 2-5.
- the antibodies and antigen-binding fragments thereof described herein can be conjugated to a cytotoxin that is an anthracycline molecule.
- Anthracyclines are antibiotic compounds that exhibit cytotoxic activity. Studies have indicated that anthracyclines may operate to kill cells by a number of different mechanisms including: 1) intercalation of the drug molecules into the DNA of the cell thereby inhibiting DNA-dependent nucleic acid synthesis; 2) production by the drug of free radicals which then react with cellular macromolecules to cause damage to the cells or 3) interactions of the drug molecules with the cell membrane [see, e.g., C.
- anthracyclines have been used in the treatment of numerous cancers such as leukemia, breast carcinoma, lung carcinoma, ovarian adenocarcinoma and sarcomas [see e.g., P.H- Wiernik, in Anthracvcline: Current Status And New Developments p 11]
- Commonly used anthracyclines include doxorubicin, epirubicin, idarubicin and daunomycin.
- anthracyclines include, but are not limited to daunorubicin (Cerubidine; Bedford Laboratories), doxorubicin (Adriamycin; Bedford Laboratories; also referred to as doxorubicin hydrochloride, hydroxy-daunorubicin, and Rubex), epirubicin (Ellence; Pfizer), and idarubicin (Idamycin; Pfizer Inc.)
- the anthracycline analog, doxorubicin ADRIAMYCINO
- ADRIAMYCINO is thought to interact with DNA by intercalation and inhibition of the progression of the enzyme topoisomerase II, which unwinds DNA for transcription.
- Doxorubicin stabilizes the topoisomerase II complex after it has broken the DNA chain for replication, preventing the DNA double helix from being resealed and thereby stopping the process of replication.
- Doxorubicin and daunorubicin are prototype cytotoxic natural product anthracycline chemotherapeutics (Sessa et al., (2007) Cardiovasc. Toxicol. 7:75-79).
- the anti-CD117 antibodies or antigen-binding fragments thereof described herein can be conjugated to a cytotoxin that is a pyrrolobenzodiazepine (PBD) or a cytotoxin that comprises a PBD.
- PBDs are natural products produced by certain actinomycetes and have been shown to be sequence selective DNA alkylating compounds.
- PBD cytotoxins include, but are not limited to, anthramycin, dimeric PBDs, and those disclosed in, for example, Hartley, J.A. (2011). “The development of pyrrolobenzodiazepines as antitumour agents.” Expert Opin. Inv. Drug, 20(6), 733-744; and Antonow, D.; Thurston,
- the antibodies and antigen-binding fragments thereof described herein can be conjugated to a cytotoxin that is an enediyne antitumor antibiotic (e.g., calicheamicins, ozogamicin).
- a cytotoxin that is an enediyne antitumor antibiotic (e.g., calicheamicins, ozogamicin).
- the calicheamicin family of antibiotics are capable of producing double-stranded DNA breaks at sub-picomolar concentrations.
- Examples of calicheamicins suitable for use in the present invention are disclosed, for example, in U.S. Pat. No. 4,671 ,958; U.S. Pat. No. 4,970,198, U.S. Pat. No. 5,053,394, U.S. Pat. No. 5,037,651 ; and U.S. Pat. No.
- Structural analogues of calicheamicin which may be used include, but are not limited to, those disclosed in, for example, Hinman et al., Cancer Research 53:3336-3342 (1993), Lode et al., Cancer Research 58:2925-2928 (1998), and the aforementioned U.S. patents to American Cyanamid.
- Anti-CD117 antibodies, and antigen-binding fragments thereof, described herein can be conjugated to a cytotoxin that is an auristatin (U.S. Pat. Nos. 5,635,483; 5,780,588).
- Auristatins are anti-mitotic agents that interfere with microtubule dynamics, GTP hydrolysis, and nuclear and cellular division (Woyke et al (2001) Antimicrob. Agents and Chemother. 45(12):3580-3584) and have anticancer (U.S. Pat. No. 5,663,149) and antifungal activity (Pettit et al (1998) Antimicrob. Agents Chemother. 42:2961-2965). (U.S. Pat. Nos.
- the auristatin drug moiety may be attached to the antibody through the N- (amino) terminus or the C- (carboxyl) terminus of the peptidic drug moiety (WO 02/088172).
- Exemplary auristatin embodiments include the N-terminus linked monomethylauristatin drug moieties DE and DF, disclosed in Senter et al, Proceedings of the American Association for Cancer Research, Volume 45, Abstract Number 623, presented Mar. 28, 2004, the disclosure of which is expressly incorporated by reference in its entirety.
- An exemplary auristatin embodiment is MMAE, wherein the wavy line indicates the point of covalent attachment to the linker of an antibody-linker conjugate (-L-Z-Ab, as described herein).
- MMAF Another exemplary auristatin embodiment is MMAF, wherein the wavy line indicates the point of covalent attachment to the linker of an antibody-linker conjugate (-L-Z-Ab, as described herein), as disclosed in US 2005/0238649:
- Auristatins may be prepared according to the methods of: U.S. Pat. No. 5,635,483; U.S. Pat. No. 5,780,588; Pettit et al (1989) J. Am. Chem. Soc. 111 :5463-5465; Pettit et al (1998) Anti-Cancer Drug Design 13:243-277; Pettit, G. R., et al. Synthesis, 1996, 719-725;
- the cytotoxin of the antibody-drug conjugate is an RNA polymerase inhibitor.
- the RNA polymerase inhibitor is an amatoxin or derivative thereof.
- the cytotoxin is an amatoxin or derivative thereof, such as a-amanitin, b-amanitin, y-amanitin, e-amanitin, amanin, amaninamide, amanullin, amanullinic acid, and proamanullin.
- Amatoxins useful in conjunction with the compositions and methods described herein include compounds according to, but are not limited to, formula (I) (SEQ ID NO: 291), wherein:
- Ri is H, OH, or OR A ;
- R 2 is H, OH, or OR B ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R 3 is H or R d ;
- R4 is H, OH, ORD, or R D ;
- R 5 is H, OH, ORD, or R D ;
- R 6 is H, OH, ORD, or R D ;
- R7 is H, OH, ORD, or R D ;
- Rs is OH, NH 2 , or ORD;
- Rg is H, OH, or ORD;
- X is -S-, -S(O)-, or -SO 2 -;
- R D is optionally substituted alkyl (e.g., C 1 -C 6 alkyl), optionally substituted heteroalkyl (e.g., C 1 -C 6 heteroalkyl), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 - C& alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.
- alkyl e.g., C 1 -C 6 alkyl
- optionally substituted heteroalkyl e.g., C 1 -C 6 heteroalkyl
- optionally substituted alkenyl
- amatoxins useful in conjunction with the compositions and methods described herein include compounds according to formula (la) (SEQ ID NO: 292) wherein R , R 5 , X, and Rs are each as defined above.
- amatoxins useful in conjunction with the compositions and methods described herein include compounds according to formula (lb) (SEQ ID NO: 293), below:
- Ri is H, OH, or OR A ;
- R 2 is H, OH, or ORB
- R A and RB when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R 3 is H or R d ;
- R4 is H, OH, ORD, or R D ;
- R 5 is H, OH, ORD, or R D ;
- R 6 is H, OH, ORD, or R D ;
- R7 is H, OH, ORD, or R D ;
- Rg is H, OH, or ORD
- X is -S-, -S(O)-, or -SO 2 -;
- RD is optionally substituted alkyl (e.g., C 1 -C 6 alkyl), optionally substituted heteroalkyl (e.g., C 1 -C 6 heteroalkyl), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 - C& alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.
- alkyl e.g., C 1 -C 6 alkyl
- heteroalkyl e.g., C 1 -C 6 heteroalkyl
- optionally substituted alkenyl e.g
- amatoxins useful in conjunction with the compositions and methods described herein also include compounds according to formula (lc) (SEQ ID NO: 294), below:
- Ri is H, OH, or OR A ;
- R 2 is H, OH, or OR B ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R 3 is H or R d ;
- R4 is H, OH, ORD, or R D ;
- R 5 is H, OH, ORD, or R D ;
- R 6 is H, OH, ORD, or R D ;
- R7 is H, OH, ORD, or R D ;
- Rg is H, OH, or OR D ;
- X is -S-, -S(O)-, or -SO 2 -;
- R D is optionally substituted alkyl (e.g., C 1 -C 6 alkyl), optionally substituted heteroalkyl (e.g., C 1 -C 6 heteroalkyl), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 - C& alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.
- alkyl e.g., C 1 -C 6 alkyl
- optionally substituted heteroalkyl e.g., C 1 -C 6 heteroalkyl
- optionally substituted alkenyl
- the cytotoxin in the ADC is an amatoxin or derivative thereof according to formula (I, la, lb, or lc).
- the ADC is represented by the general formula Ab-Z-L-Am, wherein Ab is an antibody or antigen-binding fragment thereof that binds CD117, L is a linker, Z is a chemical moiety, and Am is an amatoxin.
- the ADC having the general formula Ab-Z-L-Am is represented by formula (II) (SEQ ID NO: 295): wherein: Ri is H, OH, ORA, or ORc;
- R2 is H, OH, ORB, or ORc
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form a 5-membered heterocycloalkyl group
- R 3 is H, Rc, or R D ;
- R4 is H, OH, ORc, ORD, R C; or RD;
- R 5 is H, OH, ORc, ORD, R C , or RD;
- Re is H, OH, ORc, ORD, R C , or RD;
- R7 is H, OH, ORc, ORD, R C , or RD;
- R 8 is OH, IMH2, ORc, ORD, NHR c , or NR C R D ;
- Rg is H, OH, ORc, or ORD;
- X is -S-, -S(O)-, or -SO2-;
- Rc is-L-Z-Ab
- R D is C 1 -C 6 alkyl, C 1 -C 6 heteroalkyl, C 2 -C 6 alkenyl, C 2 -C 6 heteroalkenyl, C 2 -C 6 alkynyl, C 2 -C 6 heteroalkynyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, or a combination thereof, wherein each C 1 -C 6 alkyl, C 1 -C 6 heteroalkyl, C 2 -C 6 alkenyl, C 2 -C 6 heteroalkenyl, C 2 -C 6 alkynyl, C 2 -C 6 heteroalkynyl, cycloalkyl, heterocycloalkyl, aryl, or heteroaryl is optionally substituted with from 1 to 5 substituents independently selected for each occasion from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, alkaryl, alkyl
- Z is a chemical moiety formed from a coupling reaction between a reactive substituent 71 present on L and a reactive substituent present within an antibody, or antigen binding fragment thereof, that binds CD117 (such as GNNK+ CD117).
- Am contains exactly one Rc substituent.
- the cytotoxin is an amatoxin or derivative thereof and the ADC Ab-Z-L-Am is represented by formula (II), wherein:
- Ri and R2 are each independently H or OH;
- R3 is R c ;
- R4, R 6 , and R are each H;
- R 5 is H, OH, or OC1-C6 alkyl
- R 9 is H or OH
- X is -S-, -S(O)-, or -SO2-;
- Rcand RD are as defined above.
- amatoxin-linker conjugates are described, for example, in U.S. Patent Application Publication No. 2014/0294865, the disclosure of which is incorporated herein by reference in its entirety.
- the cytotoxin is an amatoxin or derivative thereof and the ADC Ab-Z-L-Am is represented by formula (II), wherein:
- Ri and R2 are each independently H or OH;
- R 3 , R 6 , and R are each H;
- R4 and R 5 are each independently H, OH, ORc, or R c ;
- R 9 is H or OH; X is -S-, -S(O)-, or -SO2-; and
- Rc and RD are as defined above.
- amatoxin-linker conjugates are described, for example, in U.S. Patent Application Publication No. 2015/0218220, the disclosure of which is incorporated herein by 5 reference in its entirety.
- the cytotoxin is an amatoxin or derivative thereof and the ADC Ab-Z-L-Am is represented by formula (II), wherein:
- Ri and R2 are each independently H or OH;
- R 3 , R6, and R7 are each H; 0 R4 and R 5 are each independently H or OH;
- R 8 is OH, NH 2 , OR C , or NHR C ;
- R 9 is H or OH
- X is -S-, -S(O)-, or -SO2-;
- Rc and RD are as defined above. 5
- amatoxin conjugates are described, for example, in U.S. Patent Nos. 9,233,173 and 9,399,681 , the disclosures of each of which are incorporated herein by reference in their entirety.
- the ADC Ab-Z-L-Am is represented by formula (IIA) (SEQ ID NO: 296): wherein each of Ri, R2, RA, RB, R3, R4, Rs, R6, R7, Rs, R9, Rc, RD, X, L, and Z are as defined above with respect to Formula (III).
- the ADC Ab-Z-L-Am is represented by formula (MB) (SEQ ID NO: 297):
- linkers can be used to conjugate antibodies, or antigen-binding fragments, as described herein (e.g., antibodies, or antigen-binding fragments thereof, that recognize and bind CD117 (such as GNNK+ CD117) with a cytotoxic molecule.
- Linker means a divalent chemical moiety comprising a covalent bond or a chain of atoms that covalently attaches an anti-CD117 antibody or fragment thereof (Ab) to a drug moiety (D) to form antibody-drug conjugates (ADC) of formula II.
- Suitable linkers have two reactive termini, one for conjugation to an antibody and the other for conjugation to a cytotoxin.
- the antibody conjugation reactive terminus of the linker is typically a site that is capable of conjugation to the antibody through a cysteine thiol or lysine amine group on the antibody, and so is typically a thiol- reactive group such as a double bond (as in maleimide) or a leaving group such as a chloro, bromo, iodo, or an R-sulfanyl group, or an amine-reactive group such as a carboxyl group; while the cytotoxin conjugation reactive terminus of the linker is typically a site that is capable of conjugation to the cytotoxin.
- Non-limiting examples for linker-cytotoxin conjugation include, for example, formation of an amide bond with a basic amine or carboxyl group on the cytotoxin, via a carboxyl or basic amine group on the linker, respectively, or formation of an ether or the like, via alkylation of an OH group on the cytotoxin, via e.g., a leaving group on the linker.
- cytotoxin-linker conjugation is through formation of an amide bond with a basic amine or carboxyl group on the cytotoxin, and so the reactive substituent on the linker is respectively a carboxyl or basic amine group.
- linker When the term "linker” is used in describing the linker in conjugated form, one or both of the reactive termini will be absent (such as reactive moiety Z', having been converted to chemical moiety Z) or incomplete (such as being only the carbonyl of the carboxylic acid) because of the formation of the bonds between the linker and/or the cytotoxin, and between the linker and/or the antibody or antigen-binding fragment thereof.
- conjugation reactions are described further herein below.
- the linker is cleavable under intracellular conditions, such that cleavage of the linker releases the drug unit from the antibody in the intracellular environment.
- the linker unit is not cleavable and the drug is released, for example, by antibody degradation.
- the linkers useful for the present ADCs are preferably stable extracellularly, prevent aggregation of ADC molecules and keep the ADC freely soluble in aqueous media and in a monomeric state. Before transport or delivery into a cell, the ADC is preferably stable and remains intact, i.e. the antibody remains linked to the drug moiety.
- the linkers are stable outside the target cell and may be cleaved at some efficacious rate inside the cell.
- An effective linker will: (i) maintain the specific binding properties of the antibody; (ii) allow intracellular delivery of the conjugate or drug moiety; (iii) remain stable and intact, i.e. not cleaved, until the conjugate has been delivered or transported to its targeted site; and (iv) maintain a cytotoxic, cell-killing effect or a cytostatic effect of the cytotoxic moiety.
- Stability of the ADC may be measured by standard analytical techniques such as mass spectroscopy, HPLC, and the separation/analysis technique LC/MS. Covalent attachment of the antibody and the drug moiety requires the linker to have two reactive functional groups, i.e. bivalency in a reactive sense.
- Bivalent linker reagents which are useful to attach two or more functional or biologically active moieties, such as peptides, nucleic acids, drugs, toxins, antibodies, haptens, and reporter groups are known, and methods have been described their resulting conjugates (Hermanson, G. T. (1996) Bioconjugate Techniques; Academic Press: New York, p. 234-242).
- Suitable cleavable linkers include those that may be cleaved, for instance, by enzymatic hydrolysis, photolysis, hydrolysis under acidic conditions, hydrolysis under basic conditions, oxidation, disulfide reduction, nucleophilic cleavage, or organometallic cleavage (see, for example, Leriche et al., Bioorg. Med. Chem., 20:571-582, 2012, the disclosure of which is incorporated herein by reference as it pertains to linkers suitable for covalent conjugation).
- Suitable cleavable linkers may include, for example, chemical moieties such as a hydrazine, a disulfide, a thioether or a dipeptide.
- Linkers hydrolyzable under acidic conditions include, for example, hydrazones, semicarbazones, thiosemicarbazones, cis-aconitic amides, orthoesters, acetals, ketals, or the like.
- linkers suitable for covalent conjugation include, for example, hydrazones, semicarbazones, thiosemicarbazones, cis-aconitic amides, orthoesters, acetals, ketals, or the like.
- Linkers cleavable under reducing conditions include, for example, a disulfide.
- a variety of disulfide linkers are known in the art, including, for example, those that can be formed using SATA (N-succinimidyl-S-acetylthioacetate), SPDP (N-succinimidyl-3-(2- pyridyldithiojpropionate), SPDB (N-succinimidyl-3-(2-pyridyldithio)butyrate) and SMPT (N- succinimidyl-oxycarbonyl-alpha-methyl-alpha-(2-pyridyl-dithio)toluene), SPDB and SMPT (See, e.g., Thorpe et al., 1987, Cancer Res.
- Additional linkers suitable for the synthesis of drug-antibody conjugates conjugates as described herein include those capable of releasing a cytotoxin by a 1 ,6-elimination process (a "self-immolative" group), such as p-aminobenzyl alcohol (PABC), p-aminobenzyl (PAB), 6-maleimidohexanoic acid, pH-sensitive carbonates, and other reagents described in Jain et al., Pharm. Res. 32:3526-3540, 2015, the disclosure of which is incorporated herein by reference in its entirety.
- PABC p-aminobenzyl alcohol
- PAB p-aminobenzyl
- 6-maleimidohexanoic acid pH-sensitive carbonates
- the linker includes a self-immolative group such as the afore mentioned PAB or PABC (para-aminobenzyloxycarbonyl), which are disclosed in, for example, Carl et al., J. Med. Chem. (1981) 24:479-480; Chakravarty et al (1983) J. Med. Chem.
- PAB para-aminobenzyloxycarbonyl
- Linkers susceptible to enzymatic hydrolysis can be, e.g., a peptide-containing linker that is cleaved by an intracellular peptidase or protease enzyme, including, but not limited to, a lysosomal or endosomal protease.
- intracellular proteolytic release of the therapeutic agent is that the agent is typically attenuated when conjugated and the serum stabilities of the conjugates are typically high.
- the peptidyl linker is at least two amino acids long or at least three amino acids long.
- Exemplary amino acid linkers include a dipeptide, a tripeptide, a tetrapeptide or a pentapeptide.
- suitable peptides include those containing amino acids such as Valine, Alanine, Citrulline (Cit), Phenylalanine, Lysine, Leucine, and Glycine.
- Amino acid residues which comprise an amino acid linker component include those occurring naturally, as well as minor amino acids and non-naturally occurring amino acid analogs, such as citrulline.
- Exemplary dipeptides include valine-citrulline (vc or val-cit) and alanine-phenylalanine (af or ala-phe).
- Exemplary tripeptides include glycine-valine-citrulline (gly-val-cit) and glycine-glycine-glycine (gly-gly- gly).
- the linker includes a dipeptide such as Val-Cit, Ala-Val, or Phe- Lys, Val-Lys, Ala-Lys, Phe-Cit, Leu-Cit, lle-Cit, Phe-Arg, or Trp-Cit.
- Linkers containing dipeptides such as Val-Cit or Phe-Lys are disclosed in, for example, U.S. Pat. No.
- linker suitable for covalent conjugation.
- the linker includes a dipeptide selected from Val-Ala and Val-Cit.
- a dipeptide is used in combination with a self-immolative linker.
- Linkers suitable for use herein further may include one or more groups selected from Ci-C 6 alkylene, C1-C 6 heteroalkylene, C2-C 6 alkenylene, C2-C 6 heteroalkenylene, C2-C 6 alkynylene, C 2 -C 6 heteroalkynylene, C 3 -C 6 cycloalkylene, heterocycloalkylene, arylene, heteroarylene, and combinations thereof, each of which may be optionally substituted.
- each C 1 -C 6 alkyl, C 1 -C 6 heteroalkyl, C 2 -C 6 alkenyl, C 2 -C 6 heteroalkenyl, C 2 -C 6 alkynyl, C 2 -C 6 heteroalkynyl, C 3 -C 6 cycloalkyl, heterocycloalkyl, aryl, or heteroaryl group may be optionally substituted with from 1 to 5 substituents independently selected for each occasion from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, alkaryl, alkyl heteroaryl, amino, ammonium, acyl, acyloxy, acylamino, aminocarbonyl, alkoxycarbonyl, ureido, carbamate, aryl, heteroaryl, sulfinyl, sulfonyl, hydroxyl, alkoxy, sulfanyl, halogen,
- each C 1 -C 6 alkyl, C 1 -C 6 heteroalkyl, C 2 -C 6 alkenyl, C 2 -C 6 heteroalkenyl, C 2 -C 6 alkynyl, C 2 -C 6 heteroalkynyl, C 3 -C 6 cycloalkyl, heterocycloalkyl, aryl, or heteroaryl group may optionally be interrupted by one or more heteroatoms selected from O, S and N.
- each C 1 -C 6 alkyl, C 1 -C 6 heteroalkyl, C 2 -C 6 alkenyl, C 2 -C 6 heteroalkenyl, C 2 -C 6 alkynyl, C 2 -C 6 heteroalkynyl, C 3 -C 6 cycloalkyl, heterocycloalkyl, aryl, or heteroaryl group may optionally be interrupted by one or more heteroatoms selected from O, S and N and may be optionally substituted with from 1 to 5 substituents independently selected for each occasion from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, alkaryl, alkyl heteroaryl, amino, ammonium, acyl, acyloxy, acylamino, aminocarbonyl, alkoxycarbonyl, ureido, carbamate, aryl, heteroaryl, sulfinyl, sulfonyl
- Suitable linkers may contain groups having solubility enhancing properties.
- Linkers including the (CH 2 CH 2 0)p unit polyethylene glycol, PEG), for example, can enhance solubility, as can alkyl chains substituted with amino, sulfonic acid, phosphonic acid or phosphoric acid residues. Linkers including such moieties are disclosed in, for example,
- solubility enhancing groups include, for example, acyl and carbamoyl sulfamide groups, having the structure: wherein a is 0 or 1 ;
- R 10 is selected from the group consisting of hydrogen, Ci-C 24 alkyl groups, C 3 -C 24 cycloalkyl groups, Ci-C 24 (hetero)aryl groups, Ci-C 24 alkyl(hetero)aryl groups and Ci-C 24 (hetero)arylalkyl groups, the Ci-C 24 alkyl groups, C 3 -C 24 cycloalkyl groups, C 2 -C 24 (hetero)aryl groups, C 3 -C 24 alkyl(hetero)aryl groups and C 3 -C 24 (hetero)arylalkyl groups, each of which may be optionally substituted and/or optionally interrupted by one or more heteroatoms selected from O, S and NR 11 R 12 , wherein R 11 and R 12 are independently selected from the group consisting of hydrogen and C1 -C4 alkyl groups; or R 10 is a cytotoxin, wherein the cytotoxin is optionally connected to N via a spacer moiety.
- Linkers containing such groups are described, for example, in U.S. Patent No. 9,636,421 and U.S. Patent Application Publication No. 2017/0298145, the disclosures of which are incorporated herein by reference in their entirety as they pertain to linkers suitable for covalent conjugation to cytotoxins and antibodies or antigen-binding fragments thereof.
- the linker comprises a ((CH 2 ) m O) n (CH 2 ) m - group where n and m are each independently selected from 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10; and a heteroaryl group, wherein the heteroaryl group is a triazole.
- the ((CH 2 ) m O) n (CH 2 ) m - group and triazole together comprise where n is from 1 to 10, and the wavy lines indicate attachment points to additional linker components, the chemical moiety Z, or the amatoxin.
- R 13 is independently selected for each occasion from H and C1-C6 alkyl; m is independently selected for each occasion from 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10; n is independently selected for each occasion from 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 and 14; and wherein the single asterisk ( * ) indicates the attachment point to the cytotoxin (e.g., an amatoxin), and the double asterisk ( ** ) indicates the attachment point to the reactive substituent Z or chemical moiety Z, with the proviso that Li and l_ 2 are not both absent.
- the single asterisk ( * ) indicates the attachment point to the cytotoxin (e.g., an amatoxin)
- the double asterisk ( ** ) indicates the attachment point to the reactive substituent Z or chemical moiety Z, with the proviso that Li and l_ 2 are not both absent.
- the linker includes a p-aminobenzyl group (PAB).
- PAB p-aminobenzyl group
- the p-aminobenzyl group is disposed between the cytotoxic drug and a protease cleavage site in the linker.
- the p-aminobenzyl group is part of a p-aminobenzyloxycarbonyl unit.
- the p-aminobenzyl group is part of a p- aminobenzylamido unit.
- the linker comprises PAB, Val-Cit-PAB, Val-Ala- PAB, Val-Lys(Ac)-PAB, Phe-Lys-PAB, Phe-Lys(Ac)-PAB, D-Val-Leu-Lys, Gly-Gly-Arg, Ala- Ala-Asn-PAB, or Ala-PAB.
- the linker comprises a combination of one or more of a peptide, oligosaccharide, -(CH 2 ) n -, -(CH 2 CH 2 0) n -, PAB, Val-Cit-PAB, Val-Ala-PAB, Val- Lys(Ac)-PAB, Phe-Lys-PAB, Phe-Lys(Ac)-PAB, D-Val-Leu-Lys, Gly-Gly-Arg, Ala-Ala-Asn- PAB, or Ala-PAB.
- the linker comprises PAB-Ala-Val-propionyl, represented by the structure wherein the wavy lines indicate attachment points to the cytotoxin and the reactive moiety Z'.
- the linker comprises PAB-Cit-Val-propionyl, represented by the structure wherein the wavy lines indicate attachment points to the cytotoxin and the reactive moiety Z'.
- PAB-dipeptide-propionyl linkers are disclosed in, e.g., Patent Application Publication No. WO2017/149077, which is incorporated by reference herein in its entirety.
- the linker of the ADC is maleimidocaproyl-Val-Ala-para- aminobenzyl (mc-Val-Ala-PAB). In certain embodiments, the linker of the ADC is maleimidocaproyl-Val-Cit-para- aminobenzyl (mc-vc-PAB).
- the linker comprises
- the linker comprises MCC (4-[N- maleimidomethyl]cyclohexane-1 -carboxylate).
- the linker comprises a -(CH2) n - unit, wherein n is an integer from 2 to 6.
- Linkers that can be used to conjugate an antibody, or antigen-binding fragment thereof, to a cytotoxic agent include those that are covalently bound to the cytotoxic agent on one end of the linker and, on the other end of the linker, contain a chemical moiety formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within the antibody, or antigen-binding fragment thereof, that binds CD117 (such as GNNK+ CD117).
- Reactive substituents that may be present within an antibody, or antigen-binding fragment thereof, that binds CD117 include, without limitation, hydroxyl moieties of serine, threonine, and tyrosine residues; amino moieties of lysine residues; carboxyl moieties of aspartic acid and glutamic acid residues; and thiol moieties of cysteine residues, as well as propargyl, azido, haloaryl (e.g., fluoroaryl), haloheteroaryl (e.g., fluoroheteroaryl), haloalkyl, and haloheteroalkyl moieties of non-naturally occurring amino acids.
- haloaryl e.g., fluoroaryl
- haloheteroaryl e.g., fluoroheteroaryl
- haloalkyl e.g., fluoroheteroaryl
- linkers useful for the synthesis of drug-antibody conjugates conjugates include those that contain electrophiles, such as Michael acceptors (e.g., maleimides), activated esters, electron-deficient carbonyl compounds, and aldehydes, among others, suitable for reaction with nucleophilic substituents present within antibodies or antigen binding fragments, such as amine and thiol moieties.
- electrophiles such as Michael acceptors (e.g., maleimides), activated esters, electron-deficient carbonyl compounds, and aldehydes, among others, suitable for reaction with nucleophilic substituents present within antibodies or antigen binding fragments, such as amine and thiol moieties.
- linkers suitable for the synthesis of drug-antibody conjugates include, without limitation, succinimidyl 4-(N- maleimidomethyl)-cyclohexane-L-carboxylate (SMCC), N- succinimidyl iodoacetate (SIA), sulfo-SMCC, m-maleimidobenzoyl-/V-hydroxysuccinimidyl ester (MBS), sulfo-MBS, and succinimidyl iodoacetate, among others described, for instance, Liu et al., 18:690-697, 1979, the disclosure of which is incorporated herein by reference as it pertains to linkers for chemical conjugation.
- SMCC succinimidyl 4-(N- maleimidomethyl)-cyclohexane-L-carboxylate
- SIA N- succinimidyl iodoacetate
- MBS m-maleimidobenzoyl-/V-hydroxysuccinimid
- Additional linkers include the non-cleavable maleimidocaproyl linkers, which are particularly useful for the conjugation of microtubule-disrupting agents such as auristatins, are described by Doronina et al., Bioconjugate Chem. 17:14-24, 2006, the disclosure of which is incorporated herein by reference as it pertains to linkers for chemical conjugation.
- Linkers useful in conjunction with the antibody-drug described herein include, without limitation, linkers containing chemical moieties formed by coupling reactions as depicted in Table 3, below. Curved lines designate points of attachment to the antibody, or antigen binding fragment, and the cytotoxic molecule, respectively.
- antibody-drug conjugates useful in conjunction with the methods described herein may be formed by the reaction of an antibody, or antigen-binding fragment thereof, with a linker or cytotoxin-linker conjugate, as described herein, the linker or cytotoxin-linker conjugate including a reactive substituent Z', suitable for reaction with a reactive substituent on the antibody, or antigen-binding fragment thereof, to form the chemical moiety Z.
- R 13 is independently selected for each occasion from H and C 1 -C 6 alkyl;
- R 16 is independently selected for each occasion from H, C 1 -C 6 alkyl, F, Cl, and -OH;
- R 17 is independently selected for each occasion from H, C 1 -C 6 alkyl, F, Cl, -NH 2 , - OCH 3 , -OCH 2 CH 3 , -N(CH 3 ) 2 , -CN, -N0 2 and-OH;
- examples of suitably reactive substituents on the linker and antibody or antigen-binding fragment thereof include a nucleophile/electrophile pair (e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/ a,b -unsaturated carbonyl pair, and the like), a diene/dienophile pair (e.g., an azide/alkyne pair, or a diene/ a,b-unsaturated carbonyl pair, among others), and the like.
- a nucleophile/electrophile pair e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/ a,b -unsaturated carbonyl pair, and the like
- a diene/dienophile pair e.g., an azide/alkyne pair, or a diene/ a,
- Coupling reactions between the reactive substitutents to form the chemical moiety Z include, without limitation, thiol alkylation, hydroxyl alkylation, amine alkylation, amine or hydroxylamine condensation, hydrazine formation, amidation, esterification, disulfide formation, cycloaddition (e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others), nucleophilic aromatic substitution, electrophilic aromatic substitution, and other reactive modalities known in the art or described herein.
- the linker contains an electrophilic functional group for reaction with a nucleophilic functional group on the antibody, or antigen-binding fragment thereof.
- Reactive substituents that may be present within an antibody, or antigen-binding fragment thereof, as disclosed herein include, without limitation, nucleophilic groups such as (i) N-terminal amine groups, (ii) side chain amine groups, e.g. lysine, (iii) side chain thiol groups, e.g. cysteine, and (iv) sugar hydroxyl or amino groups where the antibody is glycosylated.
- nucleophilic groups such as (i) N-terminal amine groups, (ii) side chain amine groups, e.g. lysine, (iii) side chain thiol groups, e.g. cysteine, and (iv) sugar hydroxyl or amino groups where the antibody is glycosylated.
- Reactive substituents that may be present within an antibody, or antigen binding fragment thereof, as disclosed herein include, without limitation, hydroxyl moieties of serine, threonine, and tyrosine residues; amino moieties of lysine residues; carboxyl moieties of aspartic acid and glutamic acid residues; and thiol moieties of cysteine residues, as well as propargyl, azido, haloaryl (e.g., fluoroaryl), haloheteroaryl (e.g., fluoroheteroaryl), haloalkyl, and haloheteroalkyl moieties of non-naturally occurring amino acids.
- haloaryl e.g., fluoroaryl
- haloheteroaryl e.g., fluoroheteroaryl
- haloalkyl e.g., fluoroheteroaryl
- the reactive substituents present within an antibody, or antigen-binding fragment thereof as disclosed herein include, are amine or thiol moieties.
- Certain antibodies have reducible interchain disulfides, i.e. cysteine bridges.
- Antibodies may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (dithiothreitol).
- DTT dithiothreitol
- Each cysteine bridge will thus form, theoretically, two reactive thiol nucleophiles. Additional nucleophilic groups can be introduced into antibodies through the reaction of lysines with 2-iminothiolane (Traut's reagent) resulting in conversion of an amine into a thiol.
- Reactive thiol groups may be introduced into the antibody (or fragment thereof) by introducing one, two, three, four, or more cysteine residues (e.g., preparing mutant antibodies comprising one or more non-native cysteine amino acid residues).
- U.S. Pat. No. 7,521 ,541 teaches engineering antibodies by introduction of reactive cysteine amino acids.
- the reactive moiety Z' attached to the linker is a nucleophilic group which is reactive with an electrophilic group present on an antibody.
- Useful electrophilic groups on an antibody include, but are not limited to, aldehyde and ketone carbonyl groups.
- the heteroatom of a nucleophilic group can react with an electrophilic group on an antibody and form a covalent bond to the antibody.
- Useful nucleophilic groups include, but are not limited to, hydrazide, oxime, amino, hydroxyl, hydrazine, thiosemicarbazone, hydrazine carboxylate, and arylhydrazide.
- Z is the product of a reaction between reactive nucleophilic substituents present within the antibodies, or antigen-binding fragments thereof, such as amine and thiol moieties, and a reactive electrophilic substituent Z'.
- Z' may be a Michael acceptor (e.g., maleimide), activated ester, electron-deficient carbonyl compound, or an aldehyde, among others.
- linkers suitable for the synthesis of ADCs of the disclosure include, without limitation, reactive substituents Z' such as maleimide or haloalkyl groups. These may be attached to the linker by reagents such as succinimidyl 4-(N-maleimidomethyl)- cyclohexane-L-carboxylate (SMCC), N- succinimidyl iodoacetate (SIA), sulfo-SMCC, m- maleimidobenzoyl-/V-hydroxysuccinimidyl ester (MBS), sulfo-MBS, and succinimidyl iodoacetate, among others described, in for instance, Liu et al., 18:690-697, 1979, the disclosure of which is incorporated herein by reference as it pertains to linkers for chemical conjugation.
- reagents such as succinimidyl 4-(N-maleimidomethyl)- cyclohexane-L-carboxylate (SM
- the reactive substituent Z' attached to linker L is a maleimide, azide, or alkyne.
- a maleimide-containing linker is the non-cleavable maleimidocaproyl-based linker.
- the reactive substituent is an N-maleimidyl group, halogenated N-alkylamido group, sulfonyloxy N-alkylamido group, carbonate group, sulfonyl halide group, thiol group or derivative thereof, alkynyl group comprising an internal carbon- carbon triple bond, (het-ero)cycloalkynyl group, bicyclo[6.1 0]non-4-yn-9-yl group, alkenyl group comprising an internal carbon-carbon double bond, cycloalkenyl group, tetrazinyl group, azido group, phosphine group, nitrile oxide group, nitrone group, nitrile imine group, diazo group, ketone group, (O-alkyl)hydroxylamino group, hydrazine group, halogenated N- maleimidyl group, 1,1 -bis (sulfonylmethyl)methylcarbonyl group or
- the anti-CD117 ADC comprises an anti-CD117 antibody conjugated to an amatoxin of formula I as disclosed herein, via a linker and a chemical moiety Z.
- the linker includes a hydrazine, a disulfide, a thioether or a dipeptide.
- the linker includes a dipeptide selected from Val-Ala and Val-Cit.
- the linker includes a para-aminobenzyl group (PAB).
- PAB para-aminobenzyl group
- the linker includes the moiety PAB-Cit-Val.
- the linker includes the moiety PAB-Ala-Val.
- the chemical moiety Z is selected from Table 3 or Table 4. In some embodiments, the chemical moiety Z is where S is a sulfur atom which represents the reactive substituent present within an antibody, or antigen-binding fragment thereof, that binds CD117 (e.g., from the -SH group of a cysteine residue).
- an amatoxin as disclosed herein is conjugated to a linker- reactive moiety -L-Z' having the following formula: where the wavy line indicates the point of attachment to a substituent on the cytotoxin (e.g., an amatoxin).
- This linker-reactive substituent group L-Z' may alternatively be referred to as N-beta-maleimidopropionyl-Val-Ala-para-aminobenzyl (BMP-Val-Ala-PAB).
- an amatoxin as disclosed herein is conjugated to a linker- reactive moiety -L-Z' having the following formula: where the wavy line indicates the point of attachment to a substituent on the cytotoxin (e.g., an amatoxin).
- This linker-reactive substituent group L-Z' may alternatively be referred to as N-beta-maleimidopropyl-Val-Cit-para-aminobenzyl (BMP-Val-Cit-PAB).
- the linker-reactive substituent group structure L-Z' prior to conjugation with the antibody or antigen binding fragment thereof, is:
- the linker L and the chemical moiety Z, taken together as L-Z is where S is a sulfur atom which represents the reactive substituent present within an antibody, or antigen-binding fragment thereof, such as an anti-CD117 antibody (e.g., from the -SH group of a cysteine residue).
- S is a sulfur atom which represents the reactive substituent present within an antibody, or antigen-binding fragment thereof, such as an anti-CD117 antibody (e.g., from the -SH group of a cysteine residue).
- the wavy line at the linker terminus indicates the point of attachment to the amatoxin.
- the linker L and the chemical moiety Z after conjugation to the antibody, taken together as L-Z-Ab, has the structure: where S is a sulfur atom which represents the reactive substituent present within an antibody, or antigen-binding fragment thereof, such as an anti-CD-117 antibody.
- S is a sulfur atom which represents the reactive substituent present within an antibody, or antigen-binding fragment thereof, such as an anti-CD-117 antibody.
- the wavy line at the linker terminus indicates the point of attachment to the amatoxin.
- linker- reactive substituent group structure prior to conjugation with the antibody or antigen binding fragment thereof, includes a maleimide as the group Z'.
- group Z' a maleimide
- an ant-CD117 antibody or antigen binding fragment thereof is conjugated to one or more cytotoxic drug moieties (D), e.g. about 1 to about 20 drug moieties per antibody, through a linker L and a chemical moiety Z as disclosed herein.
- D cytotoxic drug moieties
- the ADCs of the present disclosure may be prepared by several routes, employing organic chemistry reactions, conditions, and reagents known to those skilled in the art, including: (1) reaction of a reactive substituent of an antibody or antigen binding fragment thereof with a bivalent linker reagent to form Ab-Z-L as described herein above, followed by reaction with a drug moiety D; or (2) reaction of a reactive substituent of a drug moiety with a bivalent linker reagent to form D-L-Z, followed by reaction with a reactive substituent of an antibody or antigen binding fragment thereof as described herein above to form an ADC of formula D-L- Z-Ab, such as Am-Z-L-Ab. Additional methods for preparing ADC are described herein.
- the antibody or antigen binding fragment thereof has one or more lysine residues that can be chemically modified to introduce one or more sulfhydryl groups.
- the ADC is then formed by conjugation through the sulfhydryl group's sulfur atom as described herein above.
- the reagents that can be used to modify lysine include, but are not limited to, N-succinimidyl S-acetylthioacetate (SATA) and 2-lminothiolane hydrochloride (Traut's Reagent).
- the antibody or antigen binding fragment thereof can have one or more carbohydrate groups that can be chemically modified to have one or more sulfhydryl groups.
- the ADC is then formed by conjugation through the sulfhydryl group's sulfur atom as described herein above.
- the antibody can have one or more carbohydrate groups that can be oxidized to provide an aldehyde (-CHO) group (see, for e.g., Laguzza, et al., J. Med. Chem. 1989, 32(3), 548-55).
- the ADC is then formed by conjugation through the corresponding aldehyde as described herein above.
- Other protocols for the modification of proteins for the attachment or association of cytotoxins are described in Coligan et al., Current Protocols in Protein Science, vol. 2, John Wiley & Sons (2002), incorporated herein by reference.
- linker-drug moieties to cell-targeted proteins such as antibodies, immunoglobulins or fragments thereof are found, for example, in U.S. Pat. No. 5,208,020; U.S. Pat. No. 6,441 ,163; W02005037992; W02005081711 ; and W02006/034488, all of which are hereby expressly incorporated by reference in their entirety.
- linker moieties and amatoxin-linker conjugates are described, for example, in U.S. Patent Application Publication No. 2015/0218220 and Patent Application Publication No. WO2017/149077, the disclosure of each of which is incorporated herein by reference in its entirety.
- linker moieties and amatoxin-linker conjugates are described, for example, in U.S. Patent Application Publication No. 2015/0218220 and Patent Application Publication No. WO2017/149077, the disclosure of each of which is incorporated herein by reference in its entirety.
- the CD117 antibodies, or antigen-binding fragments, described herein may be bound to an amatoxin so as to form an ADC represented by the formula Ab- Z-L-Am, wherein Ab is the CD117 antibody, or antigen-binding fragment thereof, L is a linker, Z is a chemical moiety and Am is an amatoxin, each as described herein.
- Am-L-Z-Ab is one of (SEQ ID NOS 298, 298, and 298): In some embodiments, Am-L-Z-Ab is (SEQ ID NO: 299):
- the anti-CD117 ADC has the structure of formula (III) (SEQ ID NO: 285):
- X is S or-S(O)-
- L is a linker
- Z is a chemical moiety formed by a coupling reaction between a reactive substituent present on L and a reactive substituent present within the anti-CD117 antibody; and Ab is the anti-CD117 antibody.
- L is a non-cleavable linker
- an anti-CD117 ADC described herein has the structure of formula (Ilia) (SEQ ID NO: 286): (Ilia). or formula (lllb) (SEQ ID NO: 287):
- the anti-CD117 ADC has the structure of formula (IV) (SEQ ID NO: 288): a stereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein Ab is the anti-CD117 antibody.
- the anti-CD117 ADC has the structure of formula (IVa) (SEQ ID NO: 289):
- the anti-CD117 ADC has the structure of formula (IVb) (SEQ ID NO: 29): a stereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein Ab is the anti-CD117 antibody.
- the therapeutic antibody is anti-CD117 antibody Ab85.
- Example 1 Preparation of Antibody Cocktail
- Antibody cocktails used in Example 2 were prepared as follows. LiveDead Aqua (ThermoFisher, Cat # L34957) supplied as lyophilized stock. As needed, dye reconstituted in 50 pl_ DMSO and aliquoted into 5 mI_ aliquots, was stored at -20°C. For each experiment, one 5mI_ aliquot thawed to room temperature and 45 mI_ 1x PBS added. 5 mI_ of this stock is used per sample. Six 5 ml. falcon tubes labeled for unstained and five panel conditions for each sample as described below:
- a master mix of common markers for all tubes was prepared as follows: 47.5 mI_ mix added to appropriate tubes. Panel-specific antibodies (see below) were added to appropriate tubes:
- CD117 receptor occupancy by a therapeutic antibody can be determined in an in vitro or ex vivo assay based on flow cytometric analysis of CD117-expressing cells in whole blood. Since receptor occupancy is typically measured in whole blood system, the assay is dependent on the target expression levels of circulating cells. While high expression levels of the target receptor (i.e. the CD117 receptor) and an abundant population of circulating cells is ideal, in practice however, this is not always the case. As described in more detail below, it has been demonstrated that non-ideal conditions can be solved using a high affinity detection antibody (both a competing antibody (i.e., to measure free receptor) and a non competing antibody (i.e., to measure total receptor)) and a strong fluorophore signal.
- a high affinity detection antibody both a competing antibody (i.e., to measure free receptor) and a non competing antibody (i.e., to measure total receptor)
- a strong fluorophore signal both a competing antibody (i.e., to measure free receptor) and a non competing
- a whole blood spike-in assay was developed (Fig. 4). Briefly, a sample of whole blood from a healthy human subject was spiked with either hematopoietic stem cells (FISCs) or a CD117+ cell line (e.g., Kasumi-1 cells) at 10% of whole blood cell count (WBC) and stained with the fluorophore-labeled anti-CD117 antibodies Fig. 4). After cell lysis and washing steps, the resulting samples were analyzed using a flow cytometer to measure the gMFI. Representative data for the anti-CD117 antibody 104D2-labeled with phycoerythrin (i.e.,
- 104D2-PE are provided in Fig. 5 and show the readout for single color whole blood spike- in assay using a spike of Kasumi cells (Fig. 5B) was significantly higher in comparison to the readout for single color whole blood (Fig. 5A).
- a series of whole blood spike-in assay were performed by staining with 3 different antibody cocktails, each having a different CD117 fluorophore (Figs.
- FISCs hematopoietic stem cells
- CD117+ cell line e.g., Kasumi-1 cells
- WBC whole blood cell count
- Ab85 conjugated to either fluorophore PE i.e., Ab85-PE (a competing antibody)
- fluorophore AF647 i.e., Ab85-AF647 (a competing antibody)
- Occupancy was measured on CD117 expressing cells using flow cytometry.
- the results of the assay are provided in Fig. 9 and show that in the presence of bound therapeutic antibody, Ab85-PE is blocked from binding CD117 in a concentration dependent manner, providing a measure of CD117 receptor occupancy for healthy human subjects. Under these conditions, the assay is capable of detecting saturation of receptor binding by the therapeutic antibody (i.e. 100%
- the data showed that the AF647 fluorophore had a significantly high background, and therefore, an insufficient dynamic range.
- the data for the PE and BV421 fluorophores demonstrated significantly higher (and relatively similar) dynamic ranges. Accordingly, the competing anti-CD117 antibody and non-competing anti-CD117 antibody for the receptor occupancy assay were the Ab85 labeled with the fluorophore PE and anti-CD117 antibody 104D2 conjugated with the fluorophore BV421 , respectively.
- Receptor occupancy will be determined using a pre-dose, 2h, 4h, 8h, 24h, 36h and 48h post-dose peripheral blood samples from the human patient.
- the dosing schedule is typically designed to achieve exposures that result in sustained receptor occupancy (RO) based on typical pharmacokinetic properties of a therapeutic antibody.
- the blood samples will be fixed immediately post collection to chemically preserve the sample and shipped for subsequent analysis using quantitative flow cytometry.
- To determine receptor occupancy each sample will be split for analysis with two detection monoclonal antibodies (MAbs), one competing with the drug (antibody) to determine the number of free (unbound) CD117 receptors, and one non-competing MAb binding to a different epitope on the receptor to determine the total number of CD117 receptors on the cell surface.
- MAbs detection monoclonal antibodies
- the absolute receptor numbers will be determined.
- detection MAbs conjugated to Brilliant VioletTM 421 (BV421) with a defined antibody: BV421 ratio the absolute receptor numbers will be determined.
- detection MAbs conjugated to phycoerythin (PE) fluorescent protein with a defined antibody: PE ratio the free receptor numbers will be determined using a standard curve generated with quantibrite beads with defined and varying numbers of PE molecules.
- the % RO free receptors can be determined using the following formula:
- the % RO total receptors can be determined using the following formula:
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Veterinary Medicine (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Medical Informatics (AREA)
- Primary Health Care (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Disclosed are receptor occupancy assays for an anti-CD117 antibody drug conjugate, and related methods for treating a human subject.
Description
METHODS AND COMPOSITIONS FOR ANTI-CD117 ANTIBODY DRUG CONJUGATE (ADC) TREATMENT
Related Applications
This application claims priority to U.S. Provisional Application No. 63/223,937, filed on July 20, 2021. The entire contents of the priority application are incorporated by reference herein.
Sequence Listing
The instant application contains a Sequence Listing which has been submitted electronically in XML format and is hereby incorporated by reference in its entirety. Said copy, created on July 19, 2022, is named M103034_2280WO_0730_1_SL.xml and is 331 kilobytes in size.
Background
CD117 (also referred to as c-kit or Stem Cell Factor Receptor (SCRF)) is a single transmembrane, receptor tyrosine kinase that binds the ligand Stem Cell Factor (SCF). SCF induces homodimerization of CD117 which activates its tyrosine kinase activity and signals through both the P13-AKT and MAPK pathways (Kindblom et al., Am J. Path. 1998 152(5):1259).
CD117 was initially discovered as an oncogene and has been studied in the field of oncology (see, for example, Stankov et al. (2014) Curr Pharm Des. 20(17):2849-80). CD117 is highly expressed on hematopoietic stem cells (HSCs).
Although targeting CD117 represents a potential therapeutic target for treating diseases such as cancer, and as a conditioning agent for cell transplantation, e.g., given its expression on HSCs, the nature of treating such diseases presents unique challenges, including adverse effects of the cancer on bone marrow and hematologic function.
CD117 is highly expressed on hematopoietic stem cells (HSCs) and on acute myeloid leukemia (AML) tumor cells. This expression pattern makes CD117 a potential target for both conditioning and treating patients across a broad range of diseases. There remains, however, a need for a minimium safe and biologically effective (MSBE) dose of a therapeutic anti-CD117 antibody (or antibody drug conjugate (ADC)). CD117 receptor occupancy by a therapeutic anti-CD117 antibody (or ADC) can be measured and MSBE dose can be determined based on receptor occupancy.
Summary
Described herein are compositions and methods for treating a human subject with an anti-CD117 antibody drug conjugate (ADC). In particular, methods and compositions disclosed herein may be used to determine dosing of the ADC for treatment of a human subject, e.g., treatment for cancer or as a conditioning agent. The methods described herein generally rely on receptor occupancy (RO) assays, e.g., flow cytometry RO assays. In certain embodiments, an RO assay is used to determine the percentage of available receptors, i.e., CD117, that are bound as a function of drug (antibody) concentration.
Provided herein is a method for treating a human subject in need thereof, comprising: determining CD117 receptor occupancy of a therapeutic anti-CD117 antibody on CD117 expressing cells from a human subject, said method comprising performing a receptor occupancy (RO) assay on a sample from the human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample; and administering to the human subject an amount of the therapeutic anti- CD117 antibody that is less than 100 times an amount of the therapeutic anti-CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay, wherein the therapeutic anti-CD117 antibody depletes CD117+ cells in the human subject thereby treating the human subject.
Also disclosed herein is a method for treating a human subject in need thereof, comprising: determining CD117 receptor occupancy of a therapeutic anti-CD117 antibody on CD117 expressing cells from a human subject, said method comprising performing a receptor occupancy (RO) assay on a sample from the human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample; and administering to the human subject an amount of the therapeutic anti-CD117 antibody that is less than 50 times an amount of the therapeutic anti-CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay, wherein the therapeutic anti-CD117 antibody depletes CD117+ cells in the human subject thereby treating the human subject.
Also disclosed herein is a method for treating a human subject in need thereof, comprising: determining CD117 receptor occupancy of a therapeutic anti-CD117 antibody on CD117 expressing cells from a human subject, said method comprising performing a receptor occupancy (RO) assay on a sample from the human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample; and administering to the human subject an amount of the therapeutic anti-CD117 antibody that is less than 10 times an amount of the therapeutic anti-CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the
RO assay, wherein the therapeutic anti-CD117 antibody depletes CD117+ cells in the human subject thereby treating the human subject.
In one embodiment, the therapeutic anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
In one embodiment, the therapeutic anti-CD117 antibody, or antigen binding fragment thereof, comprises a light chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 104, and a heavy chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 103.
In another embodiment, the therapeutic anti-CD117 antibody comprises a heavy chain having the amino acid sequence as set forth as SEQ ID NO: 138, and a light chain having an amino acid sequence set forth as SEQ ID NO: 144.
In one embodiment, the therapeutic anti-CD117 antibody is an lgG1 isotype.
In one embodiment, the human subject is administered an amount of the therapeutic anti-CD117 antibody that is less than an amount of the therapeutic anti-CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay.
In one embodiment, the human subject is administered an amount of the therapeutic anti-CD117 antibody that is less than an amount of the therapeutic anti-CD117 antibody sufficient to result in about 90% CD117 receptor occupancy as determined by the RO assay.
In one embodiment, the human subject is administered an amount of the therapeutic anti-CD117 antibody that is less than an amount of the therapeutic anti-CD117 antibody sufficient to result in about 80% CD117 receptor occupancy as determined by the RO assay.
In one embodiment, the human subject is administered an amount of the therapeutic anti-CD117 antibody that is less than an amount of the therapeutic anti-CD117 antibody sufficient to result in about 70% CD117 receptor occupancy as determined by the RO assay.
In one embodiment, the human subject is administered an amount of the therapeutic anti-CD117 antibody that is less than an amount of the therapeutic anti-CD117 antibody sufficient to result in about 60% CD117 receptor occupancy as determined by the RO assay.
In one embodiment, the human subject is administered an amount of the therapeutic anti-CD117 antibody that is less than an amount of the therapeutic anti-CD117 antibody sufficient to result in about 50% CD117 receptor occupancy as determined by the RO assay.
In a further embodment, the RO assay comprises contacting the sample with an anti- CD117 antibody, or an antigen binding fragment thereof, that cross-blocks the therapeutic anti-CD117 antibody.
In yet another embodiment, the therapeutic anti-CD117 antibody that is administered to the human subject as an anti-CD117 antibody drug conjugate (ADC) comprising the therapeutic anti-CD117 antibody conjugated via a linker to an amatoxin.
X is S or S(O); L is a linker;
Z is a chemical moiety formed by a coupling reaction between a reactive substituent Z' present on L and a reactive substituent present within the anti-CD117 antibody; and
Ab is the anti-CD117 antibody.
In another embodiment, the ADC has the structure of formula (Ilia) (SEQ ID NO:
In one embodiment, L comprises one or more moieties selected from a bond, - (C=0)-, a -C(0)NH- group, an -0C(0)NH- group, C1-C6 alkylene, C1-C6 heteroalkylene, C2-C6 alkenylene, C2-C6 heteroalkenylene, C2-C6 alkynylene, C2-C6 heteroalkynylene, C3- C6 cycloalkylene, heterocycloalkylene, arylene, heteroarylene, a -(CH2CH20)P- group where p is an integer from 1-6; a solubility enhancing group, and a peptide; wherein each C1-C6 alkylene, C1-C6 heteroalkylene, C2-C6 alkenylene, C2-C6 heteroalkenylene, C2-C6 alkynylene, C2-C6 heteroalkynylene, C3-C6 cycloalkylene, heterocycloalkylene, arylene, or heteroarylene may optionally be substituted with from 1 to 5 substituents independently selected for each occasion from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, alkaryl, alkyl heteroaryl, amino, ammonium, acyl, acyloxy, acylamino, aminocarbonyl, alkoxycarbonyl, ureido, carbamate, aryl, heteroaryl,
sulfinyl, sulfonyl, hydroxyl, alkoxy, sulfanyl, halogen, carboxy, trihalomethyl, cyano, hydroxy, mercapto, and nitro; or each C1-C6 alkylene, C1-C6 heteroalkylene, C2-C6 alkenylene, C2-C6 heteroalkenylene, C2-C6 alkynylene, C2-C6 heteroalkynylene, C3-C6 cycloalkylene, heterocycloalkylene, arylene, or heteroarylene may optionally be interrupted by one or more heteroatoms selected from O, S and N.
In still another embodiment, the ADC has the structure of formula (IV) (SEQ ID NO:
288):
a stereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein Ab is the anti- CD117 antibody.
In another embodiment, the ADC has the structure of formula (IVa) (SEQ ID NO:
In one embodiment, the ADC has the structure of formula (IVb) (SEQ ID NO: 290):
a stereoisomer thereof, or a pharmaceutically acceptable salt thereof.
Also disclosed herein is a method for determining receptor occupancy of a therapeutic anti-CD117 antibody on a CD117 expressing cell from a human subject, said method comprising performing a receptor occupancy (RO) assay on a sample obtained from a human subject, and determining the percent receptor occupancy of the therapeutic anti- CD117 antibody on the CD117 expressing cell from the sample, wherein the therapeutic anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
In one embodiment, the RO assay comprises the steps of (a) contacting the sample with an amount of the anti-CD117 therapeutic antibody, (b) contacting the sample with an amount of a second anti-CD117 antibody, or an antigen-binding fragment thereof, that competes with the anti-CD117 therapeutic antibody for binding to CD117 on the CD117 expressing cell, wherein the second anti-CD117 antibody, or an antigen-binding fragment thereof, is labelled with a first detectable agent; (c) detecting the amount of the second antibody bound to the CD117 on the cell surface on the CD117 expressing cell in the
sample, and (d) calculating the percentage of CD117 bound by the anti-CD117 therapeutic antibody, thereby determining receptor occupancy of the therapeutic anti-CD117 antibody.
Also disclosed herein is a method for determining receptor occupancy of a therapeutic anti-CD117 antibody on a CD117 expressing cell from a human subject who has been administered the therapeutic antibody, said method comprising performing a receptor occupancy (RO) assay on a sample from a human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on the CD117 expressing cell from the sample , and wherein therapeutic anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively. In one embodiment, the RO assay comprises the steps of: (a) obtaining a sample from the human subject administered the therapeutic antibody; (b) contacting the sample with an amount of a second anti-CD117 antibody, or an antigen-binding fragment thereof, that competes with the anti-CD117 therapeutic antibody for binding to a CD117 receptor, wherein the second anti-CD117 antibody, or an antigen binding fragment thereof, is labelled with a first detectable agent; (c) detecting the amount of the second antibody bound to the CD117 receptor on the CD117 expressing cell in the sample, and (d) calculating the percentage of CD117 bound by the anti-CD117 therapeutic antibody, thereby determining receptor occupancy of the therapeutic anti-CD117 antibody
In one embodiment, the step of calculating the percentage of CD117 bound by the anti-CD117 therapeutic antibody further comprises the steps contacting the sample (or an equivalent sample) with an amount of a third anti-CD117 antibody, or an antigen-binding fragment thereof, that does not compete with the anti-CD117 therapeutic antibody for binding to a CD117 receptor, wherein the third anti-CD117 antibody, or an antigen-binding fragment thereof, is labelled with a second detectable agent, and detecting the amount of the third anti-CD117 antibody, or an antigen-binding fragment thereof, bound to the CD117 receptor on the CD117 expressing cell in the sample, thereby determining the total amount of the CD117 receptor on the CD117 expressing cell in the sample. In another embodiment, the second detectable agent is detected at a different emission wavelength than the first detectable agent.
In one embodiment, the receptor occupancy of the therapeutic anti-CD117 antibody is determined by detecting a signal from the first detectable agent, detecting a signal from the second detectable agent, and comparing the signals in order to determine the percent receptor occupancy.
In one embodiment, the detecting is determined using flow cytometry.
In one embodiment, the second anti-CD117 antibody, or an antigen-binding fragment thereof, is an antigen binding fragment of the therapeutic antibody, a competitive anti-CD117 antibody that cross blocks the therapeutic antibody, or an antigen-binding fragment of a competitive anti-CD117 antibody that cross blocks the therapeutic antibody.
In one embodiment, the amount of the second anti-CD117 antibody is a saturating amount of the second anti-CD117 antibody.
In one embodiment, the amount of the third anti-CD117 antibody is a saturating amount of the third anti-CD117 antibody.
In one embodiment, the detectable agent is selected from the group consisting of a fluorescent label, a luminescent label, a bioluminescent label, a magnetic label, a radiolabel, and an enzyme.
In one embodiment, the detectable agent is a fluorescent label selected from the group consisting of phycoerythrin (PE), allophycocyanin (APC), BD Horizon Brilliant™ Violet 421 (BV421), BD Horizon Brilliant™ Violet 510 (BV510), BD Horizon Brilliant™ Violet 785 (BV785), fluorescein (FITC), PerCP-Cy5.5, and Alexa Fluor® 647 (AF647).
In one embodiment, the PE is phycoerythrin (PE)-Dazzle 594, PE/Cy5, PE/Cy5.5 and PE/Cy7. In one embodiment, the APC is allophycocyanin-Cy7.
In one embodiment, the third anti-CD117 antibody comprises antibody 104D2 conjugated to BV421.
In one embodiment, the second antibody is the anti-CD117 therapeutic antibody conjugated to phycoerythrin.
In one embodiment, the sample is obtained from the human subject immediately following administration of the anti-CD117 therapeutic antibody to the human subject. In another embodiment, the sample is obtained from the human subject at about 2 hours after administration of the anti-CD117 therapeutic antibody to the human subject. In another embodiment, the sample is obtained from the human subject at about 4 hours after administration of the anti-CD117 therapeutic antibody to the human subject. In another embodiment, the sample is obtained from the human subject at about 8 hours after administration of the anti-CD117 therapeutic antibody to the human subject. In another embodiment, the sample is obtained from the human subject at about 24 hours after administration of the anti-CD117 therapeutic antibody to the human subject. In another embodiment, the sample is obtained from the human subject at about 36 hours after administration of the anti-CD117 therapeutic antibody to the human subject. In another embodiment, the sample is obtained from the human subject at about 48 hours after administration of the anti-CD117 therapeutic antibody to the human subject.
In one embodiment, the sample comprises a CD117+ cell.
In one embodiment, the sample comprises a leukemic blast cell, a hematopoietic stem cell (HSC), or a hematopoietic stem and progenitor cell (HSPC).
In one embodiment, the sample is whole blood or bone marrow from the human subject.
In one embodiment, the second anti-CD117 antibody, or the antigen binding fragment thereof, binds to the same epitope as the therapeutic antibody.
In one embodiment, the RO assay comprises contacting the sample with a) the anti- CD117 therapeutic antibody, the antigen binding fragment thereof, and b) a second antibody, or an antigen-binding fragment thereof, which is labelled and specifically binds to the therapeutic anti-CD117 antibody, or an antigen binding fragment thereof, and contacting the sample (or an equivalent sample) with a third anti-CD117 antibody, or an antigen-binding fragment thereof, which does not compete with the therapeutic anti-CD117 antibody for binding to human CD117, wherein the second antibody, or antigen-binding fragment thereof, does not cross react with the third anti-CD117 antibody, or an antigen-binding fragment thereof, and wherein the second anti-CD117 antibody, or antigen binding fragment thereof, is labelled with a first detectable agent and the third antibody, or an antigen-binding fragment thereof, is labeled with a second detectable agent.
In one embodiment, the therapeutic anti-CD117 antibody, or antigen binding fragment thereof, comprises a light chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 104, and a heavy chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 103.
In one embodiment, the therapeutic anti-CD117 antibody comprises a heavy chain having the amino acid sequence as set forth as SEQ ID NO: 138, and a light chain having an amino acid sequence set forth as SEQ ID NO: 144.
In one embodiment, the therapeutic anti-CD117 antibody is an lgG1 isotype.
In yet another embodiment, the method disclosed herein further comprises determining a dose of the therapeutic antibody for treating a human subject in need based on the percent receptor occupancy.
Also provided herein is a method of depleting CD117 expressing cells in a human subject, comprising administering an dose of an anti-CD117 antibody drug conjugate (ADC) comprising an anti-CD117 antibody conjugated to an amatoxin via a linker, to the human subject, wherein the dose is determined using the method of any one of the methods disclosed herein, and wherein the anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region
comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
Another embodiment disclosed herein is a method of treating a human subject in need thereof, comprising administering an dose of an anti-CD117 antibody drug conjugate (ADC) comprising an anti-CD117 antibody conjugated to an amatoxin to the human subject, wherein the dose is determined using the method of any one of the methods disclosed herein, and wherein the anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
Further provided is a method of conditioning a human subject, comprising administering an dose of an anti-CD117 antibody drug conjugate (ADC) comprising an anti- CD117 antibody conjugated to an amatoxin to the human subject, wherein the dose is determined using the method of any one of the methods disclosed herein, and wherein the anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
In one embodiment, the sample is from the same human subject.
In one embodiment, the amount administered to the human subject is less than 1.1 times an amount of the therapeutic anti-CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay.
In one embodiment, the dose resulted in at least about 80% receptor occupancy in the RO assay. In one embodiment, the dose resulted in at least about 85% receptor occupancy in the RO assay. In one embodiment, the dose resulted in at least about 90% receptor occupancy in the RO assay. In one embodiment, the dose resulted in at least about 95% receptor occupancy in the RO assay. In one embodiment, the dose resulted in at least about 99% receptor occupancy in the RO assay.
Also provided herein is a method of conditioning a human subject in need thereof, the method comprising administering to the human subject an amount of an anti-CD117 ADC sufficient to achieve and/or maintain a receptor occupancy of at least about 80% as determined according to any one of the methods disclosed herein, wherein the anti-CD117 ADC comprises an anti-CD117 antibody conjugated to an amatoxin, and wherein the anti- CD117 antibody comprises a heavy chain variable region comprising CDR1 , CDR2 and
CDR3 as set forth in SEQ ID NO: 105, 106, and 107, respectively, and a light chain variable region comprising CDR1 , CDR2 and CDR3 as set forth in SEQ ID NO: 108, 109, and 110, respectively.
In one embodiment, the receptor occupancy achieved and/or maintained is at least about 85%. In one embodiment, the receptor occupancy achieved and/or maintained is at least about 90%. In one embodiment, the receptor occupancy achieved and/or maintained is at least about 95%. In one embodiment, the receptor occupancy achieved and/or maintained is at least about 99%. In one embodiment, the receptor occupancy achieved and/or maintained is about 100%. In certain embodiments, the ADC has the structure of formula (III) (SEQ ID NO: 285):
or a stereoisomer thereof; wherein: X is S or S(O);
L is a linker;
Z is a chemical moiety formed by a coupling reaction between a reactive substituent Z' present on L and a reactive substituent present within the anti-CD117 antibody; and Ab is the anti-CD117 antibody.
In another embodiment, the ADC has the structure of formula (Ilia) (SEQ ID NO:
In one embodiment, L comprises one or more moieties selected from a bond, - (C=0)-, a -C(0)NH- group, an -0C(0)NH- group, C1-C6 alkylene, C1-C6 heteroalkylene, C2-C6 alkenylene, C2-C6 heteroalkenylene, C2-C6 alkynylene, C2-C6 heteroalkynylene, C3- C6 cycloalkylene, heterocycloalkylene, arylene, heteroarylene, a -(CH2CH20)P- group where p is an integer from 1-6, a solubility enhancing group, and a peptide; wherein each C1-C6 alkylene, C1-C6 heteroalkylene, C2-C6 alkenylene, C2-C6 heteroalkenylene, C2-C6 alkynylene, C2-C6 heteroalkynylene, C3-C6 cycloalkylene, heterocycloalkylene, arylene, or heteroarylene may optionally be substituted with from 1 to 5 substituents independently selected for each occasion from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, alkaryl, alkyl heteroaryl, amino, ammonium, acyl, acyloxy, acylamino, aminocarbonyl, alkoxycarbonyl, ureido, carbamate, aryl, heteroaryl,
sulfinyl, sulfonyl, hydroxyl, alkoxy, sulfanyl, halogen, carboxy, trihalomethyl, cyano, hydroxy, mercapto, and nitro; or each C1-C6 alkylene, C1-C6 heteroalkylene, C2-C6 alkenylene, C2-C6 heteroalkenylene, C2-C6 alkynylene, C2-C6 heteroalkynylene, C3-C6 cycloalkylene, heterocycloalkylene, arylene, or heteroarylene may optionally be interrupted by one or more heteroatoms selected from O, S and N.
In one embodiment, the ADC has the structure of formula (IV) (SEQ ID NO: 288):
a stereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein Ab is the anti- CD117 antibody.
In one embodiment, the ADC has the structure of formula (IVa) (SEQ ID NO: 289):
In one embodiment, the ADC has the structure of formula (IVb) (SEQ ID NO: 290):
a stereoisomer thereof, or a pharmaceutically acceptable salt thereof.
In certain embodiments, the methods disclosed herein further comprise administering a stem cell transplant to the human subject. In one embodiment, the stem cell transplant comprises HSCs. In one embodiment, the stem cell transplant consists essentially of HSCs. In one embodiment, the HSCs are allogeneic.
In certain embodiments, the human subject has a disorder that would benefit from CD117+ cell depletion. In one embodiment, the human subject is in need of a cell transplant.
In another embodiment, the human subject has a stem cell disorder.
In still another embodiment, the human subject has cancer or an autoimmune disease.
In one embodiment, the cancer is a hematological cancer. In one embodiment, the hematological cancer is leukemia. In one embodiment, the leukemia is acute myeloid leukemia.
In one embodiment, the leukemia is acute lymphoblastic leukemia or chronic lymphocytic leukemia. In one embodiment, the hematological cancer is myelodysplastic syndrome.
Also provided herein is a method for determining receptor occupancy of a therapeutic anti-CD117 antibody on CD117 expressing cells from a human subject, said method comprising performing a receptor occupancy (RO) assay on a sample from a human subject,
and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample, wherein the therapeutic anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
Brief Description of the Drawings
Fig. 1 depicts a schematic of an assay for selecting fluorophores for a receptor occupancy assay.
Figs. 2A and 2B graphically depict the results of an assay to measure the geometric mean fluorescence intensity (gMFI) of various antibodies labeled with a variety of detectable agents in the presence of CD117+ cells (Kasumi-1 cells; Fig. 2A) and a negative control (Kasumi-1 KO cells; Fig. 2B).
Fig.3 summarizes the results of an assay to measure the geometric mean fluorescence intensity (gMFI) of various antibodies labeled with a variety of detectable agents in the presence of CD117+ cells (Kasumi-1 cells) and a negative control (Kasumi-1 KO cells).
Fig.4 depicts a schematic of a whole blood spike-in assay.
Figs. 5A and 5B graphically depicts flow cytometry data for a whole blood spike-in assay using a spike of Kasumi-1 cells and the anti-CD117 antibody 104D2-labeled with phycoerythrin (i.e., “104D2-PE”; Fig. 5A)) in comparison to a control sample without a spike of Kasumi-1 cells;(Fig. 5B).
Figs. 6A-6C depicts three different antibody cocktails, each having a different CD117 fluorophore (Figs. 6A-6C) for use in whole blood spike-in assays.
Fig.7 graphically depicts flow cytometry data for a whole blood spike-in assay to measure the geometric mean fluorescence intensity (gMFI) of various antibodies labeled with a variety of detectable agents.
Figs. 8A-8D summarizes the results of an assay comparing the dynamic range of Brilliant Violet™ 421 (BV421 ; Figs. 8A and 8D) to phycoerythrin (PE; Figs. 8B and 8D) and Alexa Fluor 647 (AF647; Fig. 8C and 8D).
Fig.9 depicts the results of a receptor occupancy assay using various fluorophore- labeled antibodies.
Detailed Description
Described herein are compositions and methods relating to dosing regimens for administering an anti-CD117 antibody drug conjugates (ADCs) to a human patient in need thereof, e.g., as a conditioning agent for a cell transplant or for treating cancer or an autoimmune disease.
Definitions
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this invention pertains. Otherwise, certain terms used herein have the meanings as set forth in the specification.
It must be noted that as used herein and in the appended claims, the singular forms "a," "an," and "the" include plural reference unless the context clearly dictates otherwise.
As used herein, the term “about” refers to a value that is within 10% above or below the value being described.
As used herein, the term “amatoxin” refers to a member of the amatoxin family of peptides which are generally produced by Amanita phalloides mushrooms, or a derivative thereof, such as a variant or derivative thereof capable of inhibiting RNA polymerase II activity. Amatoxins may be isolated from a variety of mushroom species (e.g., Amanita phalloides, Gaiehna marginata, Lepiota brunneo-incarnata) or may be prepared semi- synthetically or synthetically. A member of this family, oc-amanitin, is described in Wieland, Int. J. Pept. Protein Res.1983, 22(3):257-276. A derivative of an amatoxin may be obtained by chemical modification of a naturally occurring compound ("semi-synthetic"), or may be obtained from an entirely synthetic source. Synthetic routes to various amatoxin derivatives are disclosed in, for example, U.S. Patent No. 9,676,702 and in Perrin et al., J. Am. Chem. Soc. 2018, 140, p. 6513-6517, each of which is incorporated by reference herein in their entirety with respect to synthetic methods for preparing and derivatizing amatoxins. Amatoxins useful in conjunction with the compositions and methods described herein include compounds such, as, but not limited to, compounds of Formula (I), a-amanitin, b-amanitin, y- amanitin, e-amanitin, amanin, amaninamide, amanullin, amanullinic acid, and proamanullin.
As used herein, the term "antibody" refers to an immunoglobulin molecule that specifically binds to, or is immunologically reactive with, a particular antigen, and includes monoclonal, chimeric antibodies, humanized antibodies, heteroconjugate antibodies (e.g., bi- tri- and quad-specific antibodies, diabodies, triabodies, and tetrabodies), and antigen binding fragments of antibodies, including, for example, Fab', F(ab')2, Fab, Fv, rlgG, and scFv fragments. Antibodies described herein are generally isolated or recombinant. "Isolated,"
when used herein refers to a polypeptide, e.g., an antibody, that has been identified and separated and/or recovered from a cell or cell culture from which it was expressed. Ordinarily, an isolated antibody will be prepared by at least one purification step. Thus, an "isolated antibody," refers to an antibody which is substantially free of other antibodies having different antigenic specificities. For instance, an isolated antibody that specifically binds to CD117 is substantially free of antibodies that specifically bind antigens other than CD117.
Generally, antibodies comprise heavy and light chains containing antigen binding regions. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, CH1 , CH2 and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The VH, and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). As used herein, the term “complementarity determining region” (CDR) refers to a hypervariable region found both in the light chain and the heavy chain variable domains of an antibody. Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
The amino acid positions that delineate a hypervariable region of an antibody can vary, depending on the context and the various definitions known in the art. Some positions within a variable domain may be viewed as hybrid hypervariable positions in that these positions can be deemed to be within a hypervariable region under one set of criteria while being deemed to be outside a hypervariable region under a different set of criteria. One or more of these positions can also be found in extended hypervariable regions. The antibodies described herein may contain modifications in these hybrid hypervariable positions. The variable domains of native heavy and light chains each contain four framework regions that primarily adopt a b-sheet configuration, connected by three CDRs, which form loops that connect, and in some cases form part of, the b-sheet structure. The CDRs in each chain are held together in close proximity by the framework regions in the order FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 and, with the CDRs from the other antibody
chains, contribute to the formation of the target binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, National Institute of Health, Bethesda,
MD., 1987). In certain embodiments, numbering of immunoglobulin amino acid residues is performed according to the immunoglobulin amino acid residue numbering system of Kabat et al., unless otherwise indicated (although any antibody numbering scheme, including, but not limited to IMGT and Chothia, can be utilized).
The term “antigen-binding fragment” or “antigen binding portion” as used interchangeably herein, refers to one or more fragments of an antibody that retains the ability to specifically bind to the target antigen of the instant antibody from which it is derived. The antigen-binding function of an antibody can be performed by fragments of a full-length antibody. Examples of antigen-binding fragments include, but are not limited to: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL, and CH1 domains; (ii) a F(ab')2 fragment, a bivalent fragment containing two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb including VH and VL domains; (vi) a dAb fragment that consists of a VH domain (see, e.g., Ward et al., Nature 341 :544-546, 1989); (vii) a dAb which consists of a VH or a VL domain; (viii) an isolated complementarity determining region (CDR); and (ix) a combination of two or more (e.g., two, three, four, five, or six) isolated CDRs which may optionally be joined by a synthetic linker. Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see, for example, Bird et al., Science 242:423-426, 1988 and Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883, 1988). These antibody fragments can be obtained using conventional techniques known to those of skill in the art, and the fragments can be screened for utility in the same manner as intact antibodies. Antigen-binding fragments can be produced by recombinant DNA techniques, enzymatic or chemical cleavage of intact immunoglobulins, or, in certain cases, by chemical peptide synthesis procedures known in the art.
As used herein, the term “scFv” refers to a single chain Fv antibody in which the variable domains of the heavy chain and the light chain from an antibody have been joined to form one chain. scFv fragments contain a single polypeptide chain that includes the variable region of an antibody light chain (VL) (e.g., CDR-L1, CDR-L2, and/or CDR-L3) and the variable region of an antibody heavy chain (VH) (e.g., CDR-H1 , CDR-H2, and/or CDR- H3) separated by a linker. The linker that joins the VL and VH regions of a scFv fragment can be a peptide linker composed of proteinogenic amino acids.
The term "monoclonal antibody" as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen. Thus, the modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
An "intact" or "full length" antibody, as used herein, refers to an antibody having two heavy (H) chain polypeptides and two light (L) chain polypeptides interconnected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, CH1 , CH2 and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The VH, and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
As used herein, the term “conjugate” refers to a compound formed by the chemical bonding of a reactive functional group of one molecule, such as an antibody or antigen binding fragment thereof, with an appropriately reactive functional group of another molecule, such as a cytotoxin described herein. The foregoing conjugates are also referred to interchangeably herein as a “drug antibody conjugate”, an “antibody drug conjugate” and an “ADC”. In one embodiment, an ADC is formed by the chemical bonding of a reactive functional group of one molecule, such as an antibody or antigen-binding fragment thereof, with an appropriately reactive functional group of another molecule, such as a cytotoxin described herein. Conjugates may include a linker between the two molecules bound to one
another, e.g., between an antibody and a cytotoxin. Examples of linkers that can be used for the formation of a conjugate include peptide-containing linkers, such as those that contain naturally occurring or non-naturally occurring amino acids, such as D-amino acids. Linkers can be prepared using a variety of strategies described herein and known in the art. Depending on the reactive components therein, a linker may be cleaved, for example, by enzymatic hydrolysis, photolysis, hydrolysis under acidic conditions, hydrolysis under basic conditions, oxidation, disulfide reduction, nucleophilic cleavage, or organometallic cleavage (see, for example, Leriche et al., Bioorg. Med. Chem., 20:571-582, 2012).
As used herein, the term “anti-CD117 antibody” or "an antibody that binds to CD117" refers to an antibody that is capable of binding CD117, e.g., human CD117 (hCD117) with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting CD117.
The term “therapeutic antibody”, as used herein, refers to an antibody that can be used for treating or conditioning a human subject. The term is intended to include a naked antibody as well as an antibody that may be conjugated to a cytotoxin, thus forming an antibody drug conjugate (ADC). In one embodiment, a therapeutic antibody is an anti- CD117 antibody, e.g., Ab85, which is conjugated to an amatoxin for conditioning or treating a human subject in need thereof.
The term “cross competes" refers to the ability of an antibody or antibody fragment to interfere with the binding of other antibodies or antibody fragments to a specific antigen in a standard competitive binding assay. An antibody or antigen binding fragment that cross competes with another is a “competitive antibody”. The ability or extent to which an antibody, antibody fragment or other antigen-binding moieties is able to interfere with the binding of another antibody or antibody fragment to a specific antigen, and, therefore whether it can be said to cross-compete, can be determined using standard competition binding assays. One suitable assay involves the use of the Biacore technology (e.g. by using the BIAcore 3000 instrument (Biacore, Uppsala, Sweden)), which can measure the extent of interactions using surface plasmon resonance technology. Another assay for measuring cross-competing uses an ELISA-based approach. A high throughput process for "epitope binning" antibodies based upon their cross-competition is described in International Patent Application No. WO 2003/48731.
"Binds the same epitope as" means the ability of an antibody or antibody fragment to bind to a specific antigen whereby it binds to the same epitope as the exemplified antibody when using the same epitope mapping technique for comparing the antibodies or fragments thereof. The epitopes of the exemplified antibody and other antibodies can be determined using epitope mapping techniques. Epitope mapping techniques are well known in the art.
For example, conformational epitopes are readily identified by determining spatial conformation of amino acids such as by, e.g., hydrogen/deuterium exchange, x-ray crystallography and two-dimensional nuclear magnetic resonance.
As used herein, the term "consists essentially of," or variations such as "consist essentially of" or "consisting essentially of" as used throughout the specification and claims, indicate the inclusion of any recited integer or group of integers, and the optional inclusion of any recited integer or group of integers that do not materially change the basic or novel properties of the specified method, structure or composition.
As used herein, the terms “condition” and “conditioning” refer to processes by which a patient is prepared for receipt of a transplant, e.g., a transplant containing hematopoietic stem cells (HSCs). Such procedures promote the engraftment of a hematopoietic stem cell transplant (for instance, as inferred from a sustained increase in the quantity of viable hematopoietic stem cells within a blood sample isolated from a patient following a conditioning procedure and subsequent hematopoietic stem cell transplantation). According to the methods described herein, a patient may be conditioned for hematopoietic stem cell transplant therapy by administration to the patient of an anti-CD117 ADC. Administration of an anti-CD117 ADC to a patient in need of hematopoietic stem cell transplant therapy can promote the engraftment of a hematopoietic stem cell graft, for example, by selectively depleting endogenous hematopoietic stem cells, thereby creating a vacancy filled by an exogenous hematopoietic stem cell transplant.
As used herein, the term “hematopoietic stem cells” (“HSCs”) refers to immature blood cells having the capacity to self-renew and to differentiate into mature blood cells containing diverse lineages including but not limited to granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing megakaryocytes, platelets), monocytes (e.g., monocytes, macrophages), dendritic cells, microglia, osteoclasts, and lymphocytes (e.g., NK cells, B-cells and T-cells). Such cells may include CD34+ cells.
CD34+ cells are immature cells that express the CD34 cell surface marker.
As used herein, patients that are “in need of” a hematopoietic stem cell transplant include patients that exhibit a defect or deficiency in one or more blood cell types, as well as patients having a stem cell disorder, autoimmune disease, cancer, or other pathology described herein. Hematopoietic stem cells generally exhibit 1) multi-potency, and can thus differentiate into multiple different blood lineages including, but not limited to, granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing megakaryocytes, platelets), monocytes (e.g., monocytes, macrophages), dendritic cells, microglia,
osteoclasts, and lymphocytes (e.g., NK cells, B-cells and T-cells), 2) self-renewal, and can thus give rise to daughter cells that have equivalent potential as the mother cell, and 3) the ability to be reintroduced into a transplant recipient whereupon they home to the hematopoietic stem cell niche and re-establish productive and sustained hematopoiesis. Hematopoietic stem cells can thus be administered to a patient defective or deficient in one or more cell types of the hematopoietic lineage in order to re-constitute the defective or deficient population of cells in vivo. For example, the patient may be suffering from cancer, and the deficiency may be caused by administration of a chemotherapeutic agent or other medicament that depletes, either selectively or non-specifically, the cancerous cell population. Additionally or alternatively, the patient may be suffering from a hemoglobinopathy (e.g., a non-malignant hemoglobinopathy), such as sickle cell anemia, thalassemia, Fanconi anemia, aplastic anemia, and Wiskott-Aldrich syndrome. The subject may be one that is suffering from adenosine deaminase severe combined immunodeficiency (ADA SCID), HIV/AIDS, metachromatic leukodystrophy, Diamond-Blackfan anemia, and Schwachman-Diamond syndrome. The subject may have or be affected by an inherited blood disorder (e.g., sickle cell anemia) or an autoimmune disorder. Additionally or alternatively, the subject may have or be affected by a malignancy, such as neuroblastoma or a hematologic cancer. For instance, the subject may have a leukemia, lymphoma, or myeloma. In some embodiments, the subject has acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, or non-Hodgkin’s lymphoma. In some embodiments, the subject has myelodysplastic syndrome. In some embodiments, the subject has an autoimmune disease, such as scleroderma, multiple sclerosis, ulcerative colitis, Crohn’s disease, Type 1 diabetes, or another autoimmune pathology described herein. In some embodiments, the subject is in need of chimeric antigen receptor T-cell (CART) therapy. In some embodiments, the subject has or is otherwise affected by a metabolic storage disorder. The subject may suffer or otherwise be affected by a metabolic disorder selected from the group consisting of glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingolipidoses, metachromatic leukodystrophy, or any other diseases or disorders which may benefit from the treatments and therapies disclosed herein and including, without limitation, severe combined immunodeficiency, Wiscott-Aldrich syndrome, hyper immunoglobulin M (IgM) syndrome, Chediak-Higashi disease, hereditary lymphohistiocytosis, osteopetrosis, osteogenesis imperfecta, storage diseases, thalassemia major, sickle cell disease, systemic sclerosis, systemic lupus erythematosus, multiple sclerosis, juvenile rheumatoid arthritis and those diseases, or disorders described in "Bone Marrow Transplantation for Non-Malignant Disease," ASH Education Book, 1 :319-338
(2000), the disclosure of which is incorporated herein by reference in its entirety as it pertains to pathologies that may be treated by administration of hematopoietic stem cell transplant therapy. Additionally or alternatively, a patient “in need of” a hematopoietic stem cell transplant may one that is or is not suffering from one of the foregoing pathologies, but nonetheless exhibits a reduced level (e.g., as compared to that of an otherwise healthy subject) of one or more endogenous cell types within the hematopoietic lineage, such as megakaryocytes, thrombocytes, platelets, erythrocytes, mast cells, myeoblasts, basophils, neutrophils, eosinophils, microglia, granulocytes, monocytes, osteoclasts, antigen-presenting cells, macrophages, dendritic cells, natural killer cells, T-lymphocytes, and B-lymphocytes. One of skill in the art can readily determine whether one’s level of one or more of the foregoing cell types, or other blood cell type, is reduced with respect to an otherwise healthy subject, for instance, by way of flow cytometry and fluorescence activated cell sorting (FACS) methods, among other procedures, known in the art.
As used herein, the term “recipient” refers to a patient that receives a transplant, such as a transplant containing a population of hematopoietic stem cells. The transplanted cells administered to a recipient may be, e.g., autologous, syngeneic, or allogeneic cells.
The term "allogeneic" when used in reference to a cell transplant or graft broadly means any transplant which is not genetically identical to a patient recipient. More specifically, any transplant from any donor who is not an identical twin to a patient recipient, is referred to as an allogeneic transplant as these transplants are not genetically identical to a patient recipient. Thus, the term "donor" of an allogeneic transplant means any donor who is not an identical twin to a patient recipient.
As used herein, the term “sample” refers to a specimen (e.g., blood, blood component (e.g., serum or plasma), urine, saliva, amniotic fluid, cerebrospinal fluid, tissue (e.g., placental or dermal), pancreatic fluid, chorionic villus sample, and cells) taken from a subject.
As used herein, the terms “subject” and “patient”, used interchangeably herein, refer to an organism, such as a human, that receives treatment for a particular disease or condition as described herein. For instance, a patient, such as a human patient, may receive treatment prior to hematopoietic stem cell transplant therapy in order to promote the engraftment of exogenous hematopoietic stem cells.
As used herein, the phrase “substantially cleared from the blood” refers to a point in time following administration of a therapeutic agent to a patient when the concentration of the therapeutic agent in a blood sample isolated from the patient is such that the therapeutic agent is not detectable by conventional means (for instance, such that the therapeutic agent is not detectable above the noise threshold of the device or assay used to detect the
therapeutic agent). A variety of techniques known in the art can be used to detect antibodies, antibody fragments, and protein ligands, such as ELISA-based detection assays known in the art or described herein. Additional assays that can be used to detect antibodies, or antibody fragments, include immunoprecipitation techniques and immunoblot assays, among others known in the art.
As used herein, the phrase "stem cell disorder" broadly refers to any disease, disorder, or condition that may be treated or cured by conditioning a subject's target tissues, and/or by ablating an endogenous stem cell population in a target tissue (e.g., ablating an endogenous hematopoietic stem or progenitor cell population from a subject's bone marrow tissue) and/or by engrafting or transplanting stem cells in a subject's target tissues. For example, Type I diabetes has been shown to be cured by hematopoietic stem cell transplant and may benefit from conditioning in accordance with the compositions and methods described herein. Additional disorders that can be treated using the compositions and methods described herein include, without limitation, sickle cell anemia, thalassemias, Fanconi anemia, aplastic anemia, Wiskott-Aldrich syndrome, ADA SCID, HIV/AIDS, metachromatic leukodystrophy, Diamond-Blackfan anemia, and Schwachman-Diamond syndrome. Additional diseases that may be treated using the patient conditioning and/or hematopoietic stem cell transplant methods described herein influde inherited blood disorders (e.g., sickle cell anemia) and autoimmune disorders, such as scleroderma, multiple sclerosis, ulcerative colitis, and Chrohn’s disease. Additional diseases that may be treated using the conditioning and/or transplantation methods described herein include a malignancy, such as a neuroblastoma or hematologic cancers, such as leukemia, lymphoma, and myeloma. For instance, the cancer may be acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, or non-Flodgkin’s lymphoma. Additional diseases treatable using the conditioning and/or transplantation methods described herein include myelodysplastic syndrome. In some embodiments, the subject has or is otherwise affected by a metabolic storage disorder. For example, the subject may suffer or otherwise be affected by a metabolic disorder selected from the group consisting of glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingolipidoses, metachromatic leukodystrophy, or any other diseases or disorders which may benefit from the treatments and therapies disclosed herein and including, without limitation, severe combined immunodeficiency, Wiscott-Aldrich syndrome, hyper immunoglobulin M (IgM) syndrome, Chediak-Fligashi disease, hereditary lymphohistiocytosis, osteopetrosis, osteogenesis imperfecta, storage diseases, thalassemia major, sickle cell disease, systemic sclerosis, systemic lupus erythematosus, multiple sclerosis, juvenile rheumatoid arthritis and
those diseases, or disorders described in "Bone Marrow Transplantation for Non-Malignant Disease," ASH Education Book, 1 :319-338 (2000), the disclosure of which is incorporated herein by reference in its entirety as it pertains to pathologies that may be treated by administration of hematopoietic stem cell transplant therapy.
As used herein, the terms “treat” or “treatment” refers to reducing the severity and/or frequency of disease symptoms, eliminating disease symptoms and/or the underlying cause of said symptoms, reducing the frequency or likelihood of disease symptoms and/or their underlying cause, and improving or remediating damage caused, directly or indirectly, by disease. Beneficial or desired clinical results include, but are not limited to, promoting the engraftment of exogenous hematopoietic cells in a patient following antibody conditioning therapy as described herein and subsequent hematopoietic stem cell transplant therapy. Additional beneficial results include an increase in the cell count or relative concentration of hematopoietic stem cells in a patient in need of a hematopoietic stem cell transplant following conditioning therapy and subsequent administration of an exogenous hematopoietic stem cell graft to the patient. Beneficial results of therapy described herein may also include an increase in the cell count or relative concentration of one or more cells of hematopoietic lineage, such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeoblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting cell, macrophage, dendritic cell, natural killer cell, T- lymphocyte, or B-lymphocyte, following conditioning therapy and subsequent hematopoietic stem cell transplant therapy. Additional beneficial results may include the reduction in quantity of a disease-causing cell population, such as a population of cancer cells or autoimmune cells. Insofar as the methods disclosed herein are directed to preventing disorders, it is understood that the term "prevent" does not require that the disease state be completely thwarted. Rather, as used herein, the term preventing refers to the ability of the skilled artisan to identify a population that is susceptible to disorders, such that administration of the compounds disclosed herein may occur prior to onset of a disease. The term does not imply that the disease state is completely avoided. As used herein, the term “treatment” encompasses conditioning, unless otherwise indicated.
As used herein, the terms "variant" and "derivative" are used interchangeably and refer to naturally-occurring, synthetic, and semi-synthetic analogues of a compound, peptide, protein, or other substance described herein. A variant or derivative of a compound, peptide, protein, or other substance described herein may retain or improve upon the biological activity of the original material.
As used herein, the term “coupling reaction” refers to a chemical reaction in which two or more substituents suitable for reaction with one another react so as to form a
chemical moiety that joins (e.g., covalently) the molecular fragments bound to each substituent. Coupling reactions include those in which a reactive substituent bound to a fragment that is a cytotoxin, such as a cytotoxin known in the art or described herein, reacts with a suitably reactive substituent bound to a fragment that is an antibody, or antigen binding fragment thereof, such as an antibody, antigen-binding fragment thereof, or specific anti-CD117 antibody that binds CD117 known in the art or described herein. Examples of suitably reactive substituents include a nucleophile/electrophile pair (e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/a, b-unsaturated carbonyl pair, among others), a diene/dienophile pair (e.g., an azide/alkyne pair, among others), and the like. Coupling reactions include, without limitation, thiol alkylation, hydroxyl alkylation, amine alkylation, amine condensation, amidation, esterification, disulfide formation, cycloaddition (e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others), nucleophilic aromatic substitution, electrophilic aromatic substitution, and other reactive modalities known in the art or described herein.
The term "acyl" as used herein refers to -C(=0)R, wherein R is hydrogen (“aldehyde”), C1-C12 alkyl, C2-C12 alkenyl, C2-C12 alkynyl, C3-C7 carbocyclyl, C6-C20 aryl, 5-10 membered heteroaryl, or 5-10 membered heterocyclyl, as defined herein. Non-limiting examples include formyl, acetyl, propanoyl, benzoyl, and acryloyl.
The term "C1-C12 alkyl" as used herein refers to a straight chain or branched, saturated hydrocarbon having from 1 to 12 carbon atoms. Representative C1-C12 alkyl groups include, but are not limited to, -methyl, -ethyl, -n-propyl, -n-butyl, -n-pentyl, and -n- hexyl; while branched C1-C12 alkyls include, but are not limited to, -isopropyl, -sec-butyl, - isobutyl, -tert-butyl, -isopentyl, and 2-methylbutyl. A C1-C12 alkyl group can be unsubstituted or substituted.
The term "alkenyl" as used herein refers to C2-C12 hydrocarbon containing normal, secondary, or tertiary carbon atoms with at least one site of unsaturation, i.e., a carbon- carbon, sp2 double bond. Examples include, but are not limited to: ethylene or vinyl, -allyl, -1- butenyl, -2-butenyl, -isobutylenyl, -1-pentenyl, -2-pentenyl, -3-methyl-1-butenyl, -2-methyl-2- butenyl, -2,3-dimethyl-2-butenyl, and the like. An alkenyl group can be unsubstituted or substituted.
"Alkynyl" as used herein refers to a C2-C12 hydrocarbon containing normal, secondary, or tertiary carbon atoms with at least one site of unsaturation, i.e., a carbon- carbon, sp triple bond. Examples include, but are not limited to acetylenic and propargyl. An alkynyl group can be unsubstituted or substituted.
"Aryl" as used herein refers to a C6-C20 carbocyclic aromatic group. Examples of aryl groups include, but are not limited to, phenyl, naphthyl and anthracenyl. An aryl group can be unsubstituted or substituted.
"Arylalkyl" as used herein refers to an acyclic alkyl radical in which one of the hydrogen atoms bonded to a carbon atom, typically a terminal or sp3 carbon atom, is replaced with an aryl radical. Typical arylalkyl groups include, but are not limited to, benzyl, 2-phenylethan-1-yl, 2-phenylethen-1-yl, naphthylmethyl, 2-naphthylethan-1-yl, 2- naphthylethen-1-yl, naphthobenzyl, 2-naphthophenylethan-1-yl and the like. The arylalkyl group comprises 6 to 20 carbon atoms, e.g. the alkyl moiety, including alkanyl, alkenyl or alkynyl groups, of the arylalkyl group is 1 to 6 carbon atoms and the aryl moiety is 5 to 14 carbon atoms. An alkaryl group can be unsubstituted or substituted.
“Cycloalkyl” as used herein refers to a saturated carbocyclic radical, which may be mono- or bicyclic. Cycloalkyl groups include a ring having 3 to 7 carbon atoms as a monocycle or 7 to 12 carbon atoms as a bicycle. Examples of monocyclic cycloalkyl groups include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl. A cycloalkyl group can be unsubstituted or substituted.
“Cycloalkenyl” as used herein refers to an unsaturated carbocyclic radical, which may be mono- or bicyclic. Cycloalkenyl groups include a ring having 3 to 6 carbon atoms as a monocycle or 7 to 12 carbon atoms as a bicycle. Examples of monocyclic cycloalkenyl groups include 1-cyclopent-1-enyl, 1-cyclopent-2-enyl, 1-cyclopent-3-enyl, 1 -cyclohex-1 - enyl, 1-cyclohex-2-enyl, and 1-cyclohex-3-enyl. A cycloalkenyl group can be unsubstituted or substituted.
"Heteroaralkyl" as used herein refers to an acyclic alkyl radical in which one of the hydrogen atoms bonded to a carbon atom, typically a terminal or sp3 carbon atom, is replaced with a heteroaryl radical. Typical heteroaryl alkyl groups include, but are not limited to, 2-benzimidazolylmethyl, 2-furylethyl, and the like. The heteroarylalkyl group comprises 6 to 20 carbon atoms, e.g. the alkyl moiety, including alkanyl, alkenyl or alkynyl groups, of the heteroarylalkyl group is 1 to 6 carbon atoms and the heteroaryl moiety is 5 to 14 carbon atoms and 1 to 3 heteroatoms selected from N, O, P, and S. The heteroaryl moiety of the heteroarylalkyl group may be a monocycle having 3 to 7 ring members (2 to 6 carbon atoms or a bicycle having 7 to 10 ring members (4 to 9 carbon atoms and 1 to 3 heteroatoms selected from N, O, P, and S), for example: a bicyclo[4,5], [5,5], [5,6], or [6,6] system.
"Heteroaryl" and "heterocycloalkyl" as used herein refer to an aromatic or non aromatic ring system, respectively, in which one or more ring atoms is a heteroatom, e.g. nitrogen, oxygen, and sulfur. The heteroaryl or heterocycloalkyl radical comprises 2 to 20 carbon atoms and 1 to 3 heteroatoms selected from N, O, P, and S. A heteroaryl or
heterocycloalkyl may be a monocycle having 3 to 7 ring members (2 to 6 carbon atoms and 1 to 3 heteroatoms selected from N, O, P, and S) or a bicycle having 7 to 10 ring members (4 to 9 carbon atoms and 1 to 3 heteroatoms selected from N, O, P, and S), for example: a bicyclo[4,5], [5,5], [5,6], or [6,6] system. Heteroaryl and heterocycloalkyl can be unsubstituted or substituted.
Heteroaryl and heterocycloalkyl groups are described in Paquette, Leo A.; "Principles of Modern Heterocyclic Chemistry" (W. A. Benjamin, New York, 1968), particularly Chapters 1, 3, 4, 6, 7, and 9; "The Chemistry of Heterocyclic Compounds, A series of Monographs"
(John Wiley & Sons, New York, 1950 to present), in particular Volumes 13, 14, 16, 19, and 28; and J. Am. Chem. Soc. (1960) 82:5566.
Examples of heteroaryl groups include by way of example and not limitation pyridyl, thiazolyl, tetrahydrothiophenyl, pyrimidinyl, furanyl, thienyl, pyrrolyl, pyrazolyl, imidazolyl, tetrazolyl, benzofuranyl, thianaphthalenyl, indolyl, indolenyl, quinolinyl, isoquinolinyl, benzimidazolyl, isoxazolyl, pyrazinyl, pyridazinyl, indolizinyl, isoindolyl, 3H-indolyl, 1H- indazolyl, purinyl, 4H-quinolizinyl, phthalazinyl, naphthyridinyl, quinoxalinyl, quinazolinyl, cinnolinyl, pteridinyl, 4aH-carbazolyl, carbazolyl, phenanthridinyl, acridinyl, pyrimidinyl, phenanthrolinyl, phenazinyl, phenothiazinyl, furazanyl, phenoxazinyl, isochromanyl, chromanyl, imidazolidinyl, imidazolinyl, pyrazolidinyl, pyrazolinyl, benzotriazolyl, benzisoxazolyl, and isatinoyl.
Examples of heterocycloalkyls include by way of example and not limitation dihydroypyridyl, tetrahydropyridyl (piperidyl), tetrahydrothiophenyl, piperidinyl, 4-piperidonyl, pyrrolidinyl, 2-pyrrolidonyl, tetrahydrofuranyl, tetrahydropyranyl, bis-tetrahydropyranyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, octahydroisoquinolinyl, piperazinyl, quinuclidinyl, and morpholinyl.
By way of example and not limitation, carbon bonded heteroaryls and heterocycloalkyls are bonded at position 2, 3, 4, 5, or 6 of a pyridine, position 3, 4, 5, or 6 of a pyridazine, position 2, 4, 5, or 6 of a pyrimidine, position 2, 3, 5, or 6 of a pyrazine, position 2, 3, 4, or 5 of a furan, tetrahydrofuran, thiofuran, thiophene, pyrrole or tetrahydropyrrole, position 2, 4, or 5 of an oxazole, imidazole or thiazole, position 3, 4, or 5 of an isoxazole, pyrazole, or isothiazole, position 2 or 3 of an aziridine, position 2, 3, or 4 of an azetidine, position 2, 3, 4, 5, 6, 7, or 8 of a quinoline or position 1 , 3, 4, 5, 6, 7, or 8 of an isoquinoline. Still more typically, carbon bonded heterocycles include 2-pyridyl, 3-pyridyl, 4-pyridyl, 5- pyridyl, 6-pyridyl, 3-pyridazinyl, 4-pyridazinyl, 5-pyridazinyl, 6-pyridazinyl, 2-pyrimidinyl, 4- pyrimidinyl, 5-pyrimidinyl, 6-pyrimidinyl, 2-pyrazinyl, 3-pyrazinyl, 5-pyrazinyl, 6-pyrazinyl, 2- thiazolyl, 4-thiazolyl, or 5-thiazolyl.
By way of example and not limitation, nitrogen bonded heteroaryls and heterocycloalkyls are bonded at position 1 of an aziridine, azetidine, pyrrole, pyrrolidine, 2- pyrroline, 3-pyrroline, imidazole, imidazolidine, 2-imidazoline, 3-imidazoline, pyrazole, pyrazoline, 2-pyrazoline, 3-pyrazoline, piperidine, piperazine, indole, indoline, 1H-indazole, position 2 of a isoindole, or isoindoline, position 4 of a morpholine, and position 9 of a carbazole, or beta-carboline. Still more typically, nitrogen bonded heterocycles include 1- aziridyl, 1-azetedyl, 1-pyrrolyl, 1-imidazolyl, 1-pyrazolyl, and 1-piperidinyl.
"Substituted” as used herein and as applied to any of the above alkyl, alkenyl, alkynyl, aryl, arylalkyl, cycloalkyl, heteroaryl, heterocyclyl, and the like, means that one or more hydrogen atoms are each independently replaced with a substituent. Unless otherwise constrained by the definition of the individual substituent, the foregoing chemical moieties, such as “alkyl”, “alkylene”, “heteroalkyl”, “heteroalkylene”, “alkenyl”, “alkenylene”, “heteroalkenyl”, “heteroalkenylene”, “alkynyl”, “alkynylene”, “heteroalkynyl”, “heteroalkynylene”, “cycloalkyl”, “cycloalkylene”, “heterocyclolalkyl”, heterocycloalkylene”, “aryl,” “arylene”, “heteroaryl”, and “heteroarylene” groups can optionally be substituted. Typical substituents include, but are not limited to, -X, -R, -OH, -OR, -SH, -SR, NH2, -NHR, - N(R)2, -N+(R)3, -CX3, -CN, -OCN, -SON, -NCO, -NCS, -NO, -N02, -N3, -NC(=0)H, -NC(=0)R, -C(=0)H, -C(=0)R, -C(=0)NH2, -C(=0)N(R)2, -S03-, -S03H, -S(=0)2R, -OS(=0)2OR, - S(=0)2NH2, -S(=0)2N(R)2, -S(=0)R, -OP(=0)(OH)2, -OP(=0)(OR)2, -P(=0)(OR)2, -PO3, - P03H2, -C(=0)X, -C(=S)R, -C02H, -C02R, -C02-, -C(=S)OR, -C(=0)SR, -C(=S)SR, - C(=0)NH2, -C(=0)N(R)2, -C(=S)NH2, -C(=S)N(R)2, -C(=NH)NH2, and -C(=NR)N(R)2; wherein each X is independently selected for each occasion from F, Cl, Br, and I; and each R is independently selected for each occasion from Ci-Ci2 alkyl, C6-C2o aryl, C3-Ci4 heterocycloalkyl or heteroaryl, protecting group and prodrug moiety. Wherever a group is described as "optionally substituted," that group can be substituted with one or more of the above substituents, independently for each occasion.
It is to be understood that certain radical naming conventions can include either a mono-radical or a di-radical, depending on the context. For example, where a substituent requires two points of attachment to the rest of the molecule, it is understood that the substituent is a di-radical. For example, a substituent identified as alkyl that requires two points of attachment includes di-radicals such as -CH2-, -CH2CH2-, -CH2CH(CH3)CH2-, and the like. Other radical naming conventions clearly indicate that the radical is a di-radical such as "alkylene," "alkenylene," “arylene,” “heterocycloalkylene,” and the like.
Wherever a substituent is depicted as a di-radical (i.e., has two points of attachment to the rest of the molecule), it is to be understood that the substituent can be attached in any directional configuration unless otherwise indicated.
"Isomerism" means compounds that have identical molecular formulae but differ in the sequence of bonding of their atoms or in the arrangement of their atoms in space. Isomers that differ in the arrangement of their atoms in space are termed "stereoisomers." Stereoisomers that are not mirror images of one another are termed "diastereoisomers," and stereoisomers that are non-superimposable mirror images of each other are termed "enantiomers," or sometimes "optical isomers."
A carbon atom bonded to four non-identical substituents is termed a "chiral center." "Chiral isomer" means a compound with at least one chiral center. Compounds with more than one chiral center may exist either as an individual diastereomer or as a mixture of diastereomers, termed "diastereomeric mixture." When one chiral center is present, a stereoisomer may be characterized by the absolute configuration (R or S) of that chiral center. Absolute configuration refers to the arrangement in space of the substituents attached to the chiral center. The substituents attached to the chiral center under consideration are ranked in accordance with the Sequence Rule of Cahn, Ingold and Prelog. (Cahn et al., Angew. Chem. Inter. Edit. 1966, 5, 385; errata 511 ; Cahn et al., Angew. Chem. 1966, 78, 413; Cahn and Ingold, J. Chem. Soc. 1951 (London), 612; Cahn et al., Experientia 1956, 12, 81; Cahn, J. Chem. Educ. 1964, 41 , 116). A mixture containing equal amounts of individual enantiomeric forms of opposite chirality is termed a "racemic mixture."
The compounds disclosed in this description and in the claims may comprise one or more asymmetric centers, and different diastereomers and/or enantiomers of each of the compounds may exist. The description of any compound in this description and in the claims is meant to include all enantiomers, diastereomers, and mixtures thereof, unless stated otherwise. In addition, the description of any compound in this description and in the claims is meant to include both the individual enantiomers, as well as any mixture, racemic or otherwise, of the enantiomers, unless stated otherwise. When the structure of a compound is depicted as a specific enantiomer, it is to be understood that the coumponds disclosed herein are not limited to that specific enantiomer. Accordingly, enantiomers, optical isomers, and diastereomers of each of the structural formulae of the present disclosure are contemplated herein. In the present specification, the structural formula of the compound represents a certain isomer for convenience in some cases, but the present disclosure includes all isomers, such as geometrical isomers, optical isomers based on an asymmetrical carbon, stereoisomers, tautomers, and the like, it being understood that not all isomers may have the same level of activity. The compounds may occur in different tautomeric forms. The compounds according to the disclosure are meant to include all tautomeric forms, unless stated otherwise. When the structure of a compound is depicted as
a specific tautomer, it is to be understood that the instant disclosure is not limited to that specific tautomer.
The compounds of any formula described herein include the compounds themselves, as well as their salts, and their solvates, if applicable. A salt, for example, can be formed between an anion and a positively charged group (e.g., amino) on a compound of the disclosure. Suitable anions include chloride, bromide, iodide, sulfate, bisulfate, sulfamate, nitrate, phosphate, citrate, methanesulfonate, trifluoroacetate, glutamate, glucuronate, glutarate, malate, maleate, succinate, fumarate, tartrate, tosylate, salicylate, lactate, naphthalenesulfonate, and acetate (e.g., trifluoroacetate). The term "pharmaceutically acceptable anion" refers to an anion suitable for forming a pharmaceutically acceptable salt. Likewise, a salt can also be formed between a cation and a negatively charged group (e.g., carboxylate) on a compound of the disclosure. Suitable cations include sodium ion, potassium ion, magnesium ion, calcium ion, and an ammonium cation such as tetramethylammonium ion. Examples of some suitable substituted ammonium ions are those derived from: ethylamine, diethylamine, dicyclohexylamine, triethylamine, butylamine, ethylenediamine, ethanolamine, diethanolamine, piperazine, benzylamine, phenylbenzylamine, choline, meglumine, and tromethamine, as well as amino acids, such as lysine and arginine. The compounds of the disclosure also include those salts containing quaternary nitrogen atoms.
Examples of suitable inorganic anions include, but are not limited to, those derived from the following inorganic acids: hydrochloric, hydrobromic, hydroiodic, sulfuric, sulfurous, nitric, nitrous, phosphoric, and phosphorous. Examples of suitable organic anions include, but are not limited to, those derived from the following organic acids: 2-acetyoxybenzoic, acetic, ascorbic, aspartic, benzoic, camphorsulfonic, cinnamic, citric, edetic, ethanedisulfonic, ethanesulfonic, fumaric, glucheptonic, gluconic, glutamic, glycolic, hydroxymaleic, hydroxynaphthalene carboxylic, isethionic, lactic, lactobionic, lauric, maleic, malic, methanesulfonic, mucic, oleic, oxalic, palmitic, pamoic, pantothenic, phenylacetic, phenylsulfonic, propionic, pyruvic, salicylic, stearic, succinic, sulfanilic, tartaric, toluenesulfonic, and valeric. Examples of suitable polymeric organic anions include, but are not limited to, those derived from the following polymeric acids: tannic acid, carboxymethyl cellulose.
Additionally, the compounds of the present disclosure, for example, the salts of the compounds, can exist in either hydrated or unhydrated (the anhydrous) form or as solvates with other solvent molecules. Non-limiting examples of hydrates include monohydrates, dihydrates, etc. Non-limiting examples of solvates include ethanol solvates, acetone solvates, etc. "Solvate" means solvent addition forms that contain either stoichiometric or
non-stoichiometric amounts of solvent. Some compounds have a tendency to trap a fixed molar ratio of solvent molecules in the crystalline solid state, thus forming a solvate. If the solvent is water the solvate formed is a hydrate; and if the solvent is alcohol, the solvate formed is an alcoholate. Hydrates are formed by the combination of one or more molecules of water with one molecule of the substance in which the water retains its molecular state as H20. A hydrate refers to, for example, a mono-hydrate, a di-hydrate, a tri-hydrate, etc.
In addition, a crystal polymorphism may be present for the compounds or salts thereof represented by the formulae disclosed herein. It is noted that any crystal form, crystal form mixture, or anhydride or hydrate thereof, is included in the scope of the present disclosure.
Therapeutic Methods and Compositions
The present disclosure provides methods and compositions for treating a human subject with an antibody drug conjugate (ADC) comprising an anti-CD117 antibody conjugated to a cytotoxin (e.g., an amatoxin). The approach described herein provides for individualized or personalized dosing. A receptor occupancy (RO) assay can be used to determine the amount of the anti-CD117 ADC to be delivered, where an anti-CD117 antibody (or antigen binding fragment thereof) that is the same as the anti-CD117 antibody of the ADC is used as a therapeutic antibody in an RO assay. Alternatively, an antibody or antigen binding fragment that is competitive to the therapeutic antibody can be used in an RO assay to determine receptor saturation for a given concentration of the therapeutic antibody, fragment thereof, or competitive antibody or fragment thereof.
The RO assay can be used to guide dose escalation decisions, allowing the dose to be escalated until target saturation occurs. In other instances, the RO assay can be used to determine a patient’s maximum dose, where the maximum dose is the dose (or antibody concertation) resulting in 100% of receptors being bound. Alternatively, the RO assay and the determined receptor occupancy for a given antibody concertation can be used to confirm that a proposed dose is at or below a saturating dose.
Provided herein is a method for treating a human subject in need thereof, comprising determining CD117 receptor occupancy of a therapeutic anti-CD117 antibody on CD117 expressing cells from the human subject. The method includes performing a receptor occupancy (RO) assay on a sample from the human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample followed by administration to the human subject of an amount of the therapeutic anti-CD117 antibody (or preferably an ADC comprising the therapeutic antibody) that is less than about 10 times, less than about 5 times, less than about 2 times, less than about 1.5
times, less than about 1.2 times, or less than about 1.1 times an amount of the therapeutic anti-CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay.
In certain embodiments, the human subject is administered an amount of the therapeutic anti-CD117 antibody (or ADC thereof) that is less than an amount of the therapeutic anti-CD117 antibody (or ADC thereof) sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay.
In another embodiment, the human subject is administered an amount of the therapeutic anti-CD117 antibody (or ADC thereof) that is less than an amount of the therapeutic anti-CD117 antibody (or ADC thereof) sufficient to result in about 95% CD117 receptor occupancy as determined by the RO assay.
In another embodiment, the human subject is administered an amount of the therapeutic anti-CD117 antibody (or ADC thereof) that is less than an amount of the therapeutic anti-CD117 antibody (or ADC thereof) sufficient to result in about 90% CD117 receptor occupancy as determined by the RO assay.
In another embodiment, the human subject is administered an amount of the therapeutic anti-CD117 antibody (or ADC thereof) that is less than an amount of the therapeutic anti-CD117 antibody (or ADC thereof) sufficient to result in about 85% CD117 receptor occupancy as determined by the RO assay.
In another embodiment, the human subject is administered an amount of the therapeutic anti-CD117 antibody (or ADC thereof) that is less than an amount of the therapeutic anti-CD117 antibody (or ADC thereof) sufficient to result in about 80% CD117 receptor occupancy as determined by the RO assay.
Also disclosed herein is a method for depleting CD117 expressing cells in a human subject where a dose of an anti-CD117 antibody drug conjugate (ADC) comprising an anti- CD117 antibody conjugated to an amatoxin is administered to a human subject in need thereof. The dose is determined by an RO assay using the therapeutic anti-CD117 antibody of the ADC (or a competitive antibody thereof). In some embodiments, the dose is less than about 10 times, less than about 5 times, less than about 2 times, less than about 1.5 times, less than about 1.2 times, or less than about 1.1 times an amount of the therapeutic anti- CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay.
In certain embodiments, the dose used for treatment of the human subject in need thereof resulted in at least about 80% receptor occupancy in the RO assay; at least about 85% receptor occupancy in the RO assay; at least about 90% receptor occupancy in the RO
assay; at least about 95% receptor occupancy in the RO assay; at least about 99% receptor occupancy in the RO assay, or 100% receptor occupancy in the RO assay.
The methods disclosed herein can be used to condition a human subject with an anti- CD117 ADC where the human subject is undergoing a cell transplant, e.g., a stem cell transplant. The method can further include administering the transplant to the human subject, e.g., once the ADC has substantially cleared. In certain embodiments, the stem cell transplant is an HSC transplant.
In certain embodiments, the methods and compositions disclosed herein are used to treat a human subject having a stem cell disorder.
In addition, the compositions and methods described herein can be used to treat cancers directly, such as cancers characterized by cells that are CD117+. For instance, the compositions and methods described herein can be used to treat leukemia, particularly in patients that exhibit CD117+ leukemic cells. By depleting CD117+ cancerous cells, such as leukemic cells, the compositions and methods described herein can be used to treat various cancers directly. Exemplary cancers that may be treated in this fashion include hematological cancers, such as acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, and non-Hodgkin's lymphoma. In certain embodiments, the cancer is a hematological cancer.
Acute myeloid leukemia (AML) is a cancer of the myeloid line of blood cells, characterized by the rapid growth of abnormal white blood cells that build up in the bone marrow and interfere with the production of normal blood cells. AML is the most common acute leukemia affecting adults, and its incidence increases with age. The symptoms of AML are caused by replacement of normal bone marrow with leukemic cells, which causes a drop in red blood cells, platelets, and normal white blood cells. As an acute leukemia, AML progresses rapidly and may be fatal within weeks or months if left untreated. In one embodiment, the anti-CD117 ADCs described herein are used to treat AML in a human patient in need thereof. In certain embodiments the anti-CD117 ADC treatment depletes AML cells in the treated subjects. In some embodiments 50% or more of the AML cells are depleted. In other embodiments, 60% or more of the AML cells are depleted, or 70% or more of the AML cells are depleted, or 80% of more or 90% or more, or 95% or more of the AML cells are depleted.
The cancer may be a hematological cancer, such as leukemia or myelodysplastic syndrome. Examples of leukemia that may be treated using the methods and compositions disclosed herein include, but are not limited to, acute myeloid leukemia, acute lymphoblastic leukemia, or chronic lymphocytic leukemia.
In addition, the compositions and methods described herein can be used to treat autoimmune disorders. For instance, an antibody, or antigen-binding fragment thereof, can be administered to a subject, such as a human patient suffering from an autoimmune disorder, so as to kill a CD117+ immune cell. The CD117+ immune cell may be an autoreactive lymphocyte, such as a T-cell that expresses a T-cell receptor that specifically binds, and mounts an immune response against, a self antigen. By depleting self-reactive, CD117+ cells, the compositions and methods described herein can be used to treat autoimmune pathologies, such as those described below. Additionally or alternatively, the compositions and methods described herein can be used to treat an autoimmune disease by depleting a population of endogenous hematopoietic stem cells prior to hematopoietic stem cell transplantation therapy, in which case the transplanted cells can home to a niche created by the endogenous cell depletion step and establish productive hematopoiesis. This, in turn, can re-constitute a population of cells depleted during autoimmune cell eradication.
Autoimmune diseases that can be treated using the compositions and methods described herein include, without limitation, psoriasis, psoriatic arthritis, Type 1 diabetes mellitus (Type 1 diabetes), rheumatoid arthritis (RA), human systemic lupus (SLE), multiple sclerosis (MS), inflammatory bowel disease (IBD), lymphocytic colitis, acute disseminated encephalomyelitis (ADEM), Addison's disease, alopecia universalis, ankylosing spondylitisis, antiphospholipid antibody syndrome (APS), aplastic anemia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune lymphoproliferative syndrome (ALPS), autoimmune oophoritis, Balo disease, Behcet's disease, bullous pemphigoid, cardiomyopathy, Chagas' disease, chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy, Crohn's disease, cicatrical pemphigoid, coeliac sprue-dermatitis herpetiformis, cold agglutinin disease, CREST syndrome, Degos disease, discoid lupus, dysautonomia, endometriosis, essential mixed cryoglobulinemia, fibromyalgia-fibromyositis, Goodpasture's syndrome, Grave's disease, Guillain-Barre syndrome (GBS), Hashimoto's thyroiditis, Hidradenitis suppurativa, idiopathic and/or acute thrombocytopenic purpura, idiopathic pulmonary fibrosis, IgA neuropathy, interstitial cystitis, juvenile arthritis, Kawasaki's disease, lichen planus, Lyme disease, Meniere disease, mixed connective tissue disease (MCTD), myasthenia gravis, neuromyotonia, opsoclonus myoclonus syndrome (OMS), optic neuritis, Ord's thyroiditis, pemphigus vulgaris, pernicious anemia, polychondritis, polymyositis and dermatomyositis, primary biliary cirrhosis, polyarteritis nodosa, polyglandular syndromes, polymyalgia rheumatica, primary agammaglobulinemia, Raynaud phenomenon, Reiter's syndrome, rheumatic fever, sarcoidosis, scleroderma, Sjogren's syndrome, stiff person syndrome, Takayasu's arteritis, temporal arteritis (also known as "giant cell arteritis"),
ulcerative colitis, collagenous colitis, uveitis, vasculitis, vitiligo, vulvodynia ("vulvar vestibulitis"), and Wegener's granulomatosis.
Other diseases and conditions that can be treated using the methods disclosed herein are provided in U.S. Patent No. 10,899,843, which is incorporated by reference herein.
In particular, the methods include determining the receptor occupancy for an anti- CD117 antibody (or a competitive antibody thereof) on cells, e.g., hematopoietic stem cells (HSCs) to determine the percentage of available receptors that are bound as a function of drug concentration. Receptor occupancy can be determined using receptor occupancy (RO) assay based on a sample from the human subject.
Note that throughout where the term “sample” is used, assays may be performed on the same sample or material obtained from the same sample. Thus, assays may be performed on a sample, meaning individual assays on material obtained from the same sample or the assay is performed on the same sample. In certain instances, the sample tested in the RO assay is obtained from the same subject who will be treated with the ADC comprising the anti-CD117 therapeutic antibody. In one embodiment, the sample is peripheral blood or bone marrow from the human subject.
A receptor occupancy assay is used to determine binding of a therapeutic antibody of interest. As a substitute of the therapeutic antibody, a competitive antibody may be used in an RO assay, which may bind to the same epitope as the therapeutic antibody or just cross block binding of the therapeutic antibody to the antigen. Thus, in the context of an RO assay, where a therapeutic antibody is referenced, a competitive antibody thereof may be used as an alternative in the assay.
A receptor occupancy assay generally provides a percentage of how many “receptors”, e.g., CD117, are bound by an amount of a compound of interest, e.g., a therapeutic anti-CD117 antibody or a competitive antibody. In the current disclosure, a receptor occupancy assay measures the percentage of CD117 that is bound by an amount of the antibody of interest, e.g., Ab85 which is an anti-CD117 antibody. The percentage of bound CD117 is dependent on the amount of antibody used in the assay. By determining the percentage of bound CD117 for a given amount of antibody, the amount of antibody can be adjusted in order to achieve the desired saturation percentage, e.g., at least about 80% receptor occupancy, at least about 85% receptor occupancy, at least about 90% receptor occupancy, at least about 95% receptor occupancy, at least about 96% receptor occupancy, at least about 97% receptor occupancy, at least about 98% receptor occupancy, at least about 99% receptor occupancy, or 100% receptor occupancy.
It should be noted that when referring to a cell in reference to a free receptor assay or free and total receptor assay described herein, the term is intended to include a population of cells. For example, if a cell is contacted with a labelled anti-CD117 antibody, it is intended to also refer to a population of cells being contacted.
The methods disclosed herein are based, at least in part, on the discovery that receptor occupancy and cell surface expression of CD117, including HSCs from human patients in need of a stem cell transplant, are capable of being assessed by RO assays, such as a flow cytometry RO assay. In certain embodiments, the output of the RO assays contemplated herein can be used to select an appropriate dosage of a therapeutic antibody to be administered to a subject.
A flow cytometry receptor occupancy (RO) assay is an in vitro or ex vivo cell assay using flow cytometry to determine the percentage of available receptors on a cell. A flow cytometry RO assay can be used to determine the total number of available receptors on a cell, e.g., a hematopoietic stem cell (HSC) or a leukemic blast cell, from a given subject. In addition, depending on the type of antibody or antibodies used in the assay, the number of receptor sites occupied by an antibody of interest (e.g., therapeutic antibody) vs. the total number of available sites can be determined.
In one embodiment, a receptor occupancy assay is a free receptor occupancy assay, in which unbound (or unoccupied) receptors (e.g., CD117) on a cell are determined by contacting the cell with both the therapeutic antibody of interest and a competitive antibody. One of the two antibodies is labeled with a detectable agent. In a preferred embodiment, the competitive antibody is labeled with a detectable agent. The binding of the unlabeled antibody is then determined by measuring the signal from the detectable agent of the labeled antibody, which provides a means to then calculate the level of unoccupied receptors (e.g., CD117).
In another embodiment, a receptor occupancy assay is a free and total receptor occupancy assay, in which unbound (or unoccupied) receptors (e.g., CD117) on a cell are determined by contacting the cell with the therapeutic antibody of interest, a competitive antibody labeled with a first detectable agent, and a non-competitive antibody labeled with a second detectable agent, whereby the non-competitive antibody is used to determine the total number of receptors, e.g., CD117, on a cell surface. Such an assay measures the binding of a desired therapeutic antibody to its receptor site, e.g., CD117, by subtracting the signal from the second detectable agent (i.e., the non-competitive antibody, which provides the total number of available receptors on a cell) from the signal from the first detectable agent (i.e., the competitive antibody, which provides the number of unbound (or unoccupied) receptors). In this scenario, the non-competing antibody does not compete for binding with
the therapeutic antibody of interest (or with the competitive antibody). This information can be useful in determining dosing in patients where the target may have differential expression depending on the patient, e.g., where the receptor level or cell numbers can markedly change (up or down) over time.
The methods disclosed herein can be used to determine dosing of an ADC comprising Ab85 conjugated via a linker to an amatoxin (described in more detail below). As such, there are a number of detection reagents that can be used to in RO assays for determining receptor occupancy of Ab85 (or an antigen binding fragment thereof) which is representative of an anti-CD117 ADC containing the Ab85 antibody. For example, an RO assay may use a labeled Ab85 (or an antigen binding fragment thereof). Such a label may be, for example, a fluorophore. A labeled Ab85 antibody (or an antigen binding fragment thereof) may be used in combination with an unlabeled competitive anti-CD117 antibody (or vice versa regarding labelling; one of the antibodies is labeled). A competitive antibody may, in some embodiments, bind to the same epitope as Ab85. In another embodiment, the therapeutic anti-CD117 antibody, e.g., Ab85, is not labeled but instead is contacted with an anti-idiotype antibody which specifically recognizes the therapeutic anti-CD117 antibody, e.g., Ab85.
In one embodiment, provided herein is a method for determining receptor occupancy of a therapeutic anti-CD117 antibody on CD117 expressing cells from a human subject, said method comprising performing a receptor occupancy (RO) assay on a sample from a human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample.
Generally, the RO assay is used to determine the RO of the therapeutic antibody. In certain aspects to determine the therapeutic antibody RO, the therapeutic antibody is used.
In other embodiments, a surrogate antibody which represents the therapeutic antibody, e.g., an antibody that competes with the therapeutic antibody for antigen binding, is used.
In certain aspects, the method for determining receptor occupancy of a therapeutic anti-CD117 antibody on CD117 expressing cells from a human subject, comprises performing a receptor occupancy (RO) assay on a sample from a human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample, wherein the therapeutic anti-CD117 antibody, e.g., an anitbody comprising a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively. The RO assay comprises contacting the sample with the anti-CD117 therapeutic antibody, detecting
the amount of the anti-CD117 therapeutic antibody bound to CD117 expressing cells in the sample, and calculating the percentage of CD117 bound by the anti-CD117 therapeutic antibody. In certain embodiments, the RO assay comprises contacting the sample with an amount of a surrogate of the therapeutic antibody, where the surrogate is an antigen binding fragment of the therapeutic antibody, a competitive anti-CD117 antibody that cross blocks the therapeutic antibody, or an antigen-binding fragment of the competitive anti-CD117 antibody, detecting the amount of the surrogate bound to CD117 expressing cells in the sample, calculating the fraction of CD117 bound by the amount of the surrogate, and correlating the fraction of CD117 bound by the amount of the surrogate to an amount of the therapeutic antibody that would result in substantially the same fraction of CD117 being bound by the therapeutic antibody.
In one embodiment, an RO assay comprises contacting a sample from a human subject with the anti-CD117 therapeutic antibody, an antigen binding fragment thereof, a competitive anti-CD117 antibody thereof, or an antigen-binding fragment of the competitive anti-CD117 antibody, and contacting the sample (or an equivalent sample) with a second anti-CD117 antibody, or an antigen-binding fragment thereof, which does not cross block the therapeutic anti-CD117 antibody, wherein the competitive anti-CD117 antibody, or an antigen binding fragment thereof of the competitive anti-CD117 antibody, is labelled with a first detectable agent and the second anti-CD117 antibody, or an antigen-binding fragment thereof, is labeled with a second detectable agent. Inclusion of a second anti-CD117 antibody that does not cross block the therapeutic anti-CD117 antibody may be useful, for example, as a reference in instances where the therapeutic anti-CD117 antibody may at least partially obscure the output of an RO assay. As one non-limiting example, and without wishing to be bound by any theory, a therapeutic anti-CD117 antibody may antagonize CD117 thereby reducing the true number of CD117 molecules in a sample, e.g., by causing cell death or otherwise reducing the number of CD117 molecules on the surface of the cell.
A second anti-CD117 antibody that does not cross block the therapeutic anti-CD117 antibody may provide a reference for the RO assay to control for any loss of CD117 in the sample due to the therapeutic anti-CD117 antibody. In another embodiment, second anti- CD117 antibody that does not cross block the therapeutic anti-CD117 antibody may be useful, for example, for determining the total number of CD117 on a cell in the sample.
In one embodiment, an RO assay comprises contacting a sample from a human subject with a) the anti-CD117 therapeutic antibody, an antigen binding fragment thereof, the competitive anti-CD117 antibody, or an antigen binding fragment thereof, and b) a second antibody, or an antigen-binding fragment thereof, which is labelled and specifically binds to the therapeutic anti-CD117 antibody an antigen binding fragment thereof, the competitive
anti-CD117 antibody, or an antigen binding fragment thereof. The sample is then contacted with a third anti-CD117 antibody, or an antigen-binding fragment thereof, which does not compete with the therapeutic anti-CD117 antibody for binding to human CD117, where the second antibody, or antigen-binding fragment thereof, does not cross react with the third anti-CD117 antibody, or an antigen-binding fragment thereof, and where the second anti- CD117 antibody, or antigen binding fragment thereof, is labelled with a first detectable agent and the third antibody, or an antigen-binding fragment thereof, is labeled with a second detectable agent.
In one embodiment, an RO assay comprises contacting a sample from a human subject with a) the therapeutic anti-CD117 antibody, an antigen binding fragment thereof, b) a second anti-CD117 antibody, or an antigen-binding fragment thereof, which is labelled with a first detectable agent and competes with the therapeutic anti-CD117 antibody for binding to human CD117, and c) a third anti-CD117 antibody, or an antigen-binding fragment thereof, which is labelled with a second detectable agent and does not compete with the therapeutic anti- CD117 antibody for binding to human CD117.
In one embodiment, an RO assay comprises contacting a sample from a human subject with a) the therapeutic anti-CD117 antibody, an antigen binding fragment thereof, the competitive anti-CD117 antibody, or an antigen binding fragment thereof, b) a second anti-CD117 antibody, or an antigen-binding fragment thereof, which is labelled with a first detectable agent and does not compete with the therapeutic anti- CD117 antibody for binding to human CD117, and c) a third antibody, or an antigen-binding fragment thereof, which is labeled with a second detectable agent and specifically binds to the therapeutic anti-CD117 antibody, an antigen binding fragment thereof, the competitive anti-CD117 antibody, or an antigen binding fragment thereof, and the second anti-CD117 antibody.
Any suitable detectable agent can be used in the RO assays described herein. In certain embodiments, the detectable agent is selected from the group consisting of a fluorescent label, a luminescent label, a bioluminescent label, a magnetic label, a radiolabel, and an enzyme. In one particular embodiment, the detectable agent is a fluorescent label (i.e., a fluorophore). In situations where two detectable agents are used to determine occupancy, different signals (e.g., different fluorophores) can be used to distinguish the variables. For example, a first detectable agent may be a first fluorophore, and a second detectable agent may be a second fluorophore which is detected at a different emission wavelength than the first detectable agent. Exemplary embodiments of fluorophores include, but are not limited to, phycoerythrin (PE), allophycocyanin (APC), BD Horizon Brilliant™
Violet 421 (BV421), BD Horizon Brilliant™ Violet 510 (BV510), BD Horizon Brilliant™ Violet 785 (BV785), fluorescein (FITC), PerCP-Cy5.5, and Alexa Fluor® 647 (AF647). In certain embodiments, the phycoerythrin is phycoerythrin (PE)-Dazzle 594, PE/Cy5, PE/Cy5.5 or PE/Cy7. In certain embodiments, the phycoerythrin is allophycocyanin is allophycocyanin- Cy7.
Receptor occupancy generally can be determined by measuring a signal from the first detectable agent, measuring a signal from the second detectable agent, and comparing the signals in order to determine the percent receptor occupancy.
In one embodiment, the percentage of therapeutic anti-CD117 antibody bound to CD117 expressing cells, as well as, or alternatively, mean fluorescent intensity (MFI) of bound antibody, will be quantified by a flow cytometry-based receptor occupancy assay. This assay can be performed on whole blood, peripheral blood and /or bone marrow aspirates. The receptor occupancy assay provides data to determine the amount and/or type of CD117 expressing cells that the therpaetuic antibody (or competitive antibody thereof) is interacting with. In certain embodiments, samples from a human subject suffering from a disease or disorder which is treatable with an HSC transplant are taken prior to treatment with the anti- CD117 ADC to determine an appropriate dose to achieve a level of receptor occupancy in the human subject. In other embodiments, samples from a human subject (e.g., a leukemic patient) are taken to determine the amount of CD117 expressed on a cell surface in order to determine an appropriate dose to achieve a level of receptor occupancy in the human subject. In certain other embodiments, samples from a human subject suffering from a disease or disorder which is treatable with an HSC transplant are taken after treatment with the anti-CD117 ADC to determine an appropriate dose to achieve a level of receptor occupancy in the human subject.
Anti-CD117 Antibodies
Amino acid sequences of anti-CD117 antibodies that can be used both in the RO assays described herein and in the therapeutic compositions described herein are described in U.S. Patent No. 10,899,843, which is incorporated by reference herein. The sequence tables provided herein (Tables 1 and 2) also describes amino acid sequences for anti- CD117 antibodies that can be used in the compositions and methods disclosed herein.
In one embodiment, an anti-CD117 antibody, or antigen binding fragment thereof, comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
In one embodiment, an anti-CD117 antibody, or antigen binding fragment thereof, comprises a light chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 104, and a heavy chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 103.
The heavy chain variable region (VH) amino acid sequence of Ab85 is provided below as SEQ ID NO: 103. The VH CDR amino acid sequences of Ab85 are underlined below and are as follows: NYWIG (VH CDR1 ; SEQ ID NO: 105); IINPRDSDTRYRPSFQG (VH CDR2; SEQ ID NO: 106); and HGRGYEGYEGAFDI (VH CDR3; SEQ ID NO: 107).
Ab85 VH sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTNYWIGWVRQMPGKGLEWMAIINPRDSDTRY RPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARHGRGYEGYEGAFDIWGQGTLVT VSS (SEQ ID NO: 103)
The light chain variable region (VL) amino acid sequence of Ab85 is provided below as SEQ ID NO: 104. The VL CDR amino acid sequences of Ab85 are underlined below and are as follows: RSSQGIRSDLG (VL CDR1 ; SEQ ID NO: 108); DASNLET (VL CDR2; SEQ ID NO: 109); and QQANGFPLT (VL CDR3; SEQ ID NO: 110).
Ab85 VL sequence
DIQMTQSPSSLSASVGDRVTITCRSSQGIRSDLGWYQQKPGKAPKLLIYDASNLETGVPSR FSGSGSGTDFTLTISSLQPEDFATYYCQQANGFPLTFGGGTKVEIK (SEQ ID NO: 104)
In one embodiment, an anti-CD117 antibody, or antigen binding fragment thereof, comprises a heavy chain having the amino acid sequence as set forth as SEQ ID NO: 130, and a light chain having an amino acid sequence set forth as SEQ ID NO: 144.
In certain embodiments, an anti-CD117 antibody is an lgG1 isotype. The anti-CD117 antibody comprising any of the sequences set forth in the Sequence Tables 1-2 can be an intact antibody and/or an lgG1 or an lgG4 isotype.
In one embodiment, the anti-CD117 antibody, or binding fragment thereof, comprises a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule has an altered affinity for an FcgammaR. Certain amino acid positions within the Fc region are known through crystallography studies to make a direct contact with FcyR. Specifically, amino acids 234- 239 (hinge region), amino acids 265-269 (B/C loop), amino acids 297-299 (C'/E loop), and amino acids 327-332 (F/G) loop (see Sondermann et al., 2000 Nature, 406: 267-273). For example, amino acid substitutions at amino acid positions 234 and 235 of the Fc region have
been identified as decreasing affinity of an IgG antibody for binding to an Fc receptor, particularly an Fc gamma receptor (FcyR). In one embodiment, an anti-CD117 antibody described herein comprises an Fc region comprising an amino acid substituion at L234 and/or L235, e.g., L234A and L235A (EU index). Thus, the anti-CD117 antibodies described herein may comprise variant Fc regions comprising modification of at least one residue that makes a direct contact with an FcyR based on structural and crystallographic analysis. In one embodiment, the Fc region of the anti-CD117 antibody (or Fc containing fragment thereof) comprises an amino acid substitution at amino acid 265 according to the EU index as in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, NH1 , MD (1991), expressly incorporated herein by references. The "EU index as in Kabat" or “EU index” refers to the numbering of the human lgG1 EU antibody and is used herein in reference to Fc amino acid positions unless otherwise indicated.
In one embodiment, the Fc region comprises a D265A mutation. In one embodiment, the Fc region comprises a D265C mutation.
In some embodiments, the Fc region of the anti-CD117 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 234 according to the EU index as in Kabat. In one embodiment, the Fc region comprises a L234A mutation. In some embodiments, the Fc region of the anti-CD117 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 235 according to the EU index as in Kabat. In one embodiment, the Fc region comprises a L235A mutation. In yet another embodiment, the Fc region comprises a L234A and L235A mutation. In a further embodiment, the Fc region comprises a D265C, L234A, and L235A mutation.
In certain aspects a variant IgG Fc domain comprises one or more amino acid substitutions resulting in decreased or ablated binding affinity for an FcgammaR and/or C1q as compared to the wild type Fc domain not comprising the one or more amino acid substitutions. Fc binding interactions are essential for a variety of effector functions and downstream signaling events including, but not limited to, antibody dependent cell-mediated cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC). Accordingly, in certain aspects, an antibody comprising a modified Fc region (e.g., comprising a L234A, L235A, and a D265C mutation) has substantially reduced or abolished effector functions.
Affinity to an Fc region can be determined using a variety of techniques known in the art, for example but not limited to, equilibrium methods (e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52-60, 2008; or radioimmunoassay (RIA)), or by a surface plasmon resonance assay or other mechanism of kinetics-based assay (e.g., BIACORE™ analysis or Octet™ analysis (forteBIO)), and other methods such as indirect binding assays, competitive binding assays
fluorescence resonance energy transfer (FRET), gel electrophoresis and chromatography (e.g., gel filtration). These and other methods may utilize a label on one or more of the components being examined and/or employ a variety of detection methods including but not limited to chromogenic, fluorescent, luminescent, or isotopic labels. A detailed description of binding affinities and kinetics can be found in Paul, W. E., ed., Fundamental Immunology,
4th Ed., Lippincott-Raven, Philadelphia (1999), which focuses on antibody-immunogen interactions. One example of a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen with the antibody of interest in the presence of increasing amounts of unlabeled antigen, and the detection of the antibody bound to the labeled antigen. The affinity of the antibody of interest for a particular antigen and the binding off- rates can be determined from the data by scatchard plot analysis. Competition with a second antibody can also be determined using radioimmunoassays. In this case, the antigen is incubated with antibody of interest conjugated to a labeled compound in the presence of increasing amounts of an unlabeled second antibody.
In one embodiment, an anti-CD117 antibody described herein comprises an Fc region comprising L235A, L235A, and D265C (EU index). The antibodies of the invention may be further engineered to further modulate antibody half-life by introducing additional Fc mutations, such as those described for example in (Dall'Acqua et al. (2006) J Biol Chem 281: 23514-24), (Zalevsky et al. (2010) Nat Biotechnol 28: 157-9), (Hinton et al. (2004) J Biol Chem 279: 6213-6), (Hinton et al. (2006) J Immunol 176: 346-56), (Shields et al. (2001 ) J Biol Chem 276: 6591-604), (Petkova et al. (2006) Int Immunol 18: 1759-69), (Datta-Mannan et al. (2007) Drug Metab Dispos 35: 86-94), (Vaccaro et al. (2005) Nat Biotechnol 23: 1283- 8), (Yeung et al. (2010) Cancer Res 70: 3269-77) and (Kim et al. (1999) Eur J Immunol 29: 2819-25), and include positions 250, 252, 253, 254, 256, 257, 307, 376, 380, 428, 434 and 435. Exemplary mutations that may be made singularly or in combination are T250Q,
M252Y, 1253A, S254T, T256E, P2571, T307A, D376V, E380A, M428L, H433K, N434S, N434A, N434H, N434F, H435A and H435R mutations.
Thus, in one embodiment, the Fc region comprises a mutation resulting in a decrease in half life. An antibody having a short half-life may be advantageous in certain instances where the antibody is expected to function as a short-lived therapeutic, e.g., the conditioning step described herein where the antibody is administered followed by HSCs. Ideally, the antibody would be substantially cleared prior to delivery of the HSCs, which also generally express CD117 but are not the target of the anti-CD117 antibody, unlike the endogenous stem cells. In one embodiment, the Fc region comprises a mutation at position 435 (EU index according to Kabat). In one embodiment, the mutation is an H435A mutation.
In one embodiment, the anti-CD117 antibody described herein has a half-life of equal to or less than 24 hours, equal to or less than 22 hours, equal to or less than 20 hours, equal to or less than 18 hours, equal to or less than 16 hours, equal to or less than 14 hours, equal to or less than 13 hours, equal to or less than 12 hours, or equal to or less than 11 hours. In one embodiment, the half-life of the antibody is 11 hours to 24 hours; 12 hours to 22 hours;
10 hours to 20 hours; 8 hours to 18 hours; or 14 hours to 24 hours
Antibodies may be produced using recombinant methods and compositions, e.g., as described in U.S. Pat. No. 4,816,567. In one embodiment, isolated nucleic acid encoding an anti-CD117 antibody described herein is provided. Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody). In a further embodiment, one or more vectors (e.g., expression vectors) comprising such nucleic acid are provided. In a further embodiment, a host cell comprising such nucleic acid is provided. In one such embodiment, a host cell comprises (e.g., has been transformed with): (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody. In one embodiment, the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, Sp20 cell). In one embodiment, a method of making an anti-CLL-1 antibody is provided, wherein the method comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
For recombinant production of an anti-CD117 antibody, nucleic acid encoding an antibody, e.g., as described above, is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell. Such nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein. For example, antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed. For expression of antibody fragments and polypeptides in bacteria, see, e.g., U.S. Pat. Nos. 5,648,237, 5,789,199, and 5,840,523. (See also Charlton, Methods in Molecular Biology,
Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, N.J., 2003), pp. 245-254, describing
expression of antibody fragments in E. coli.) After expression, the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
Vertebrate cells may also be used as hosts. For example, mammalian cell lines that are adapted to grow in suspension may be useful. Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK); mouse sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod. 23:243-251 (1980)); monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells. Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR- CHO cells (Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)); and myeloma cell lines such as Y0, NS0 and Sp2/0. For a review of certain mammalian host cell lines suitable for antibody production, see, e.g., Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B. K. C. Lo, ed., Humana Press, Totowa, N.J.), pp. 255-268 (2003).
In one embodiment, the anti-CD117 antibody, or antigen binding fragment thereof, comprises variable regions having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein. Alternatively, the anti-CD117 antibody, or antigen binding fragment thereof, comprises CDRs comprising the SEQ ID Nos disclosed herein with framework regions of the variable regions described herein having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein in any of Tables land 2.
In one embodiment, the anti-CD117 antibody, or antigen binding fragment thereof, comprises a heavy chain variable region and a heavy chain constant region having an amino acid sequence that is disclosed herein (e.g., Tables 1 or 2). In another embodiment, the anti- CD117 antibody, or antigen binding fragment thereof, comprises a light chain variable region and a light chain constant region having an amino acid sequence that is disclosed herein (e.g., Tables 1or 2). In yet another embodiment, the anti-CD117 antibody, or antigen binding fragment thereof, comprises a heavy chain variable region, a light chain variable region, a heavy chain constant region and a light chain constant region having an amino acid sequence that is disclosed herein (e.g., Tables 1 and 2).
TABLE 1 : ANTI-CD117 ANTIBODY SEQUENCES AND ANTIBODY CONSTANT REGION SEQUENCES
TABLE 2: ANTI-CD117 ANTIBODY SEQUENCES
Anti-CD117 ADCs
Anti-CD117 antibodies, and antigen-binding fragments thereof, described herein in Tabels 1 and 2, e.g., Ab85, can be conjugated (linked) to a cytotoxin. In some embodiments, the cytotoxic molecule is conjugated to a cell internalizing anti-CD117 antibody, or antigen-binding fragment thereof as disclosed herein such that following the cellular uptake of the antibody, or fragment thereof, the cytotoxin may access its intracellular target and mediate hematopoietic cell death. An example of such an antibody is Ab85. Various cytotoxins can be conjugated to an anti-CD117 antibody or antigen-binding fragment thereof via a linker for use in the therapies described herein. As used herein, the terms "cytotoxin", "cytotoxic moiety", and "drug" are used interchangeably.
ADCs of the present invention therefore may be of the general formula Ab-(Z-L-D)n, wherein an anti-CD117 antibody or antigen-binding fragment thereof (Ab) is conjugated (covalently linked) to a linker (L), and through a chemical moiety (Z), to a cytotoxic moiety (“drug,” D).
Accordingly, the anti-CD117 antibody or antigen-binding fragment thereof may be conjugated to a number of drug moieties as indicated by integer n, which represents the
average number of cytotoxins per antibody. Any number of cytotoxins can be conjugated to the antibody, e.g., about 1 , about 2, about 3, about 4, about 5, about 6, about 7, or about 8.
In some embodiments, n is from 1 to 4. In some embodiments, n is from 1 to 3. In some embodiments, n is about 2. In some embodiments, n is about 1. The average number of drug moieties per antibody in preparations of ADC from conjugation reactions may be characterized by conventional means such as mass spectroscopy, ELISA assay, and HPLC. The quantitative distribution of ADC in terms of n may also be determined. In some instances, separation, purification, and characterization of homogeneous ADC where n is a certain value from ADC with other drug loadings may be achieved by means such as reverse phase HPLC or electrophoresis.
For some anti-CD117 ADCs, n may be limited by the number of attachment sites on the antibody. For example, where the attachment is a cysteine thiol, an antibody may have only one or several cysteine thiol groups, or may have only one or several sufficiently reactive thiol groups through which a linker may be attached. Generally, antibodies do not contain many free and reactive cysteine thiol groups which may be linked to a drug moiety; primarily, cysteine thiol residues in antibodies exist as disulfide bridges. In certain embodiments, an antibody may be reduced with a reducing agent such as dithiothreitol (DTT) or tricarbonylethylphosphine (TCEP), under partial or total reducing conditions, to generate reactive cysteine thiol groups. In certain embodiments, higher drug loading, e.g. n>5, may cause aggregation, insolubility, toxicity, or loss of cellular permeability of certain antibody-drug conjugates.
In certain embodiments, fewer than the theoretical maximum number of drug moieties are conjugated to an antibody during a conjugation reaction. An antibody may contain, for example, lysine residues that do not react with the drug-linker intermediate or linker reagent, as discussed below. Only the most reactive lysine groups may react with an amine-reactive linker reagent. In certain embodiments, an antibody is subjected to denaturing conditions to reveal reactive nucleophilic groups such as lysine or cysteine.
The loading (drug/antibody ratio) of an ADC may be controlled in different ways, e.g., by: (i) limiting the molar excess of drug-linker intermediate or linker reagent relative to antibody, (ii) limiting the conjugation reaction time or temperature, (iii) partial or limiting reductive conditions for cysteine thiol modification, (iv) engineering by recombinant techniques the amino acid sequence of the antibody such that the number and position of cysteine residues is modified for control of the number and/or position of linker-drug attachments.
Cytotoxins
Cytotoxins suitable for use with the compositions and methods described herein include DNA-intercalating agents, (e.g., anthracyclines), agents capable of disrupting the mitotic spindle apparatus (e.g., vinca alkaloids, maytansine, maytansinoids, and derivatives thereof), RNA polymerase inhibitors (e.g., an amatoxin, such as a-amanitin, and derivatives thereof), and agents capable of disrupting protein biosynthesis (e.g., agents that exhibit rRNA N-glycosidase activity, such as saporin and ricin A-chain), among others known in the art.
In some embodiments, the cytotoxin is a microtubule-binding agent (for instance, maytansine or a maytansinoid), an amatoxin, pseudomonas exotoxin A, deBouganin, diphtheria toxin, saporin, an auristatin, an anthracycline, a calicheamicin, irinotecan, SN-38, a duocarmycin, a pyrrolobenzodiazepine, a pyrrolobenzodiazepine dimer, an indolinobenzodiazepine, an indolinobenzodiazepine dimer, or a variant thereof, or another cytotoxic compound described herein or known in the art.
Additional cytotoxins suitable for use with the compositions and methods described herein include, without limitation, 5-ethynyluracil, abiraterone, acylfulvene, adecypenol, adozelesin, aldesleukin, altretamine, ambamustine, amidox, amifostine, aminolevulinic acid, amrubicin, amsacrine, anagrelide, anastrozole, andrographolide, angiogenesis inhibitors, antarelix, anti-dorsalizing morphogenetic protein-1, antiandrogen, prostatic carcinoma, antiestrogen, antineoplaston, antisense oligonucleotides, aphidicolin glycinate, apoptosis gene modulators, apoptosis regulators, apurinic acid, asulacrine, atamestane, atrimustine, axinastatin 1, axinastatin 2, axinastatin 3, azasetron, azatoxin, azatyrosine, baccatin III derivatives, balanol, batimastat, BCR/ABL antagonists, benzochlorins, benzoylstaurosporine, beta lactam derivatives, beta-alethine, betaclamycin B, betulinic acid, bFGF inhibitors, bicalutamide, bisantrene, bisaziridinylspermine, bisnafide, bistratene A, bizelesin, breflate, bleomycin A2, bleomycin B2, bropirimine, budotitane, buthionine sulfoximine, calcipotriol, calphostin C, camptothecin derivatives (e.g., 10-hydroxy-camptothecin), capecitabine, carboxamide-amino-triazole, carboxyamidotriazole, carzelesin, casein kinase inhibitors, castanospermine, cecropin B, cetrorelix, chlorins, chloroquinoxaline sulfonamide, cicaprost, cis-porphyrin, cladribine, clomifene and analogues thereof, clotrimazole, collismycin A, collismycin B, combretastatin A4, combretastatin analogues, conagenin, crambescidin 816, crisnatol, cryptophycin 8, cryptophycin A derivatives, curacin A, cyclopentanthraquinones, cycloplatam, cypemycin, cytarabine ocfosfate, cytolytic factor, cytostatin, dacliximab, decitabine, dehydrodidemnin B, 2'deoxycoformycin (DCF), deslorelin, dexifosfamide, dexrazoxane, dexverapamil, diaziquone, didemnin B, didox, diethylnorspermine, dihydro-5-azacytidine, dihydrotaxol, dioxamycin, diphenyl spiromustine, discodermolide, docosanol, dolasetron, doxifluridine, droloxifene, dronabinol,
duocarmycin SA, ebselen, ecomustine, edelfosine, edrecolomab, eflornithine, elemene, emitefur, epothilones, epithilones, epristeride, estramustine and analogues thereof, etoposide, etoposide 4'-phosphate (also referred to as etopofos), exemestane, fadrozole, fazarabine, fenretinide, filgrastim, finasteride, flavopiridol, flezelastine, fluasterone, fludarabine, fluorodaunorunicin hydrochloride, forfenimex, formestane, fostriecin, fotemustine, gadolinium texaphyrin, gallium nitrate, galocitabine, ganirelix, gelatinase inhibitors, gemcitabine, glutathione inhibitors, hepsulfam, homoharringtonine (HHT), hypericin, ibandronic acid, idoxifene, idramantone, ilmofosine, ilomastat, imidazoacridones, imiquimod, immunostimulant peptides, iobenguane, iododoxorubicin, ipomeanol, irinotecan, iroplact, irsogladine, isobengazole, jasplakinolide, kahalalide F, lamellarin-N triacetate, lanreotide, leinamycin, lenograstim, lentinan sulfate, leptolstatin, letrozole, lipophilic platinum compounds, lissoclinamide 7, lobaplatin, lometrexol, lonidamine, losoxantrone, loxoribine, lurtotecan, lutetium texaphyrin, lysofylline, masoprocol, maspin, matrix metalloproteinase inhibitors, menogaril, rnerbarone, meterelin, methioninase, metoclopramide, MIF inhibitor, ifepristone, miltefosine, mirimostim, mithracin, mitoguazone, mitolactol, mitomycin and analogues thereof, mitonafide, mitoxantrone, mofarotene, molgramostim, mycaperoxide B, myriaporone, N-acetyldinaline, N-substituted benzamides, nafarelin, nagrestip, napavin, naphterpin, nartograstim, nedaplatin, nemorubicin, neridronic acid, nilutamide, nisamycin, nitrullyn, octreotide, okicenone, onapristone, ondansetron, oracin, ormaplatin, oxaliplatin, oxaunomycin, paclitaxel and analogues thereof, palauamine, palmitoylrhizoxin, pamidronic acid, panaxytriol, panomifene, parabactin, pazelliptine, pegaspargase, peldesine, pentosan polysulfate sodium, pentostatin, pentrozole, perflubron, perfosfamide, phenazinomycin, picibanil, pirarubicin, piritrexim, podophyllotoxin, porfiromycin, purine nucleoside phosphorylase inhibitors, raltitrexed, rhizoxin, rogletimide, rohitukine, rubiginone B1, ruboxyl, safingol, saintopin, sarcophytol A, sargramostim, sobuzoxane, sonermin, sparfosic acid, spicamycin D, spiromustine, stipiamide, sulfinosine, tallimustine, tegafur, temozolomide, teniposide, thaliblastine, thiocoraline, tirapazamine, topotecan, topsentin, triciribine, trimetrexate, veramine, vinorelbine, vinxaltine, vorozole, zeniplatin, and zilascorb, among others.
Anti-CD117 antibodies, and antigen-binding fragments thereof, described herein can be conjugated to a cytotoxin that is a microtubule binding agent. As used herein, the term “microtubule-binding agent” refers to a compound which acts by disrupting the microtubular network that is essential for mitotic and interphase cellular function in a cell. Examples of microtubule-binding agents include, but are not limited to, maytasine, maytansinoids, and derivatives thereof, such as those described herein or known in the art, vinca alkaloids, such as vinblastine, vinblastine sulfate, vincristine, vincristine sulfate, vindesine, and vinorelbine,
taxanes, such as docetaxel and paclitaxel, macrolides, such as discodermolides, cochicine, and epothilones, and derivatives thereof, such as epothilone B or a derivative thereof.
Maytansinoids
In some embodiments, the microtubule binding agent is a maytansine, a maytansinoid or a maytansinoid analog. Maytansinoids are mitototic inhibitors which bind microtubules and act by inhibiting tubulin polymerization. Maytansine was first isolated from the east African shrub Maytenus serrata (U.S. Pat. No. 3,896,111). Subsequently, it was discovered that certain microbes also produce maytansinoids, such as maytansinol and C-3 maytansinol esters (U.S. Pat. No. 4,151,042). Synthetic maytansinol and derivatives and analogues thereof are disclosed, for example, in U.S. Pat. Nos. 4,137,230; 4,248,870; 4,256,746; 4,260,608; 4,265,814; 4,294,757; 4,307,016; 4,308,268; 4,308,269; 4,309,428; 4,313,946; 4,315,929;
4,317,821 ; 4,322,348; 4,331 ,598; 4,361 ,650; 4,364,866; 4,424,219; 4,450,254; 4,362,663; and 4,371 ,533. Maytansinoid drug moieties are attractive drug moieties in antibody drug conjugates because they are: (i) relatively accessible to prepare by fermentation or chemical modification, derivatization of fermentation products, (ii) amenable to derivatization with functional groups suitable for conjugation through the non-disulfide linkers to antibodies, (iii) stable in plasma, and (iv) effective against a variety of tumor cell lines.
Examples of suitable maytansinoids include esters of maytansinol, synthetic maytansinol, and maytansinol analogs and derivatives. Included herein are any cytotoxins that inhibit microtubule formation and that are highly toxic to mammalian cells, as are maytansinoids, maytansinol, and maytansinol analogs, and derivatives.
Examples of suitable maytansinol esters include those having a modified aromatic ring and those having modifications at other positions. Such suitable maytansinoids are disclosed in U.S. Pat. Nos. 4,137,230; 4,151 ,042; 4,248,870; 4,256,746; 4,260,608; 4,265,814; 4,294,757 4,307,016; 4,308,268; 4,308,269; 4,309,428; 4,313,946; 4,315,929; 4,317,821 ; 4,322,348 4,331 ,598; 4,361 ,650; 4,362,663; 4,364,866; 4,424,219 ;4, 450, 254; 4,322,348; 4,362,663 4,371 ,533; 5,208,020; 5,416,064; 5,475,092; 5,585,499; 5,846,545; 6,333,410; 7,276,497; and 7,473,796, the disclosures of each of which are incorporated herein by reference as they pertain
In some embodiments, the immunoconjugates of the invention utilize the thiol- containing maytansinoid (DM1), formally termed N2'-deacetyl-N2'-(3-mercapto-1-oxopropyl)- maytansine, as the cytotoxic agent. DM1 is represented by the structural formula (V):
In another embodiment, the conjugates of the present invention utilize the thiol- containing maytansinoid N2'-deacetyl-N2'(4-methyl-4-mercapto-1 -oxopentyl)-maytansine (e.g., DM4) as the cytotoxic agent. DM4 is represented by the structural formula (VI):
Another maytansinoid comprising a side chain that contains a sterically hindered thiol bond is N2'-deacetyl-N-2'(4-mercapto-1-oxopentyl)-maytansine (termed DM3), represented by the structural formula (VII):
Each of the maytansinoids taught in U.S. Pat. Nos. 5,208,020 and 7,276,497, can also be used in the conjugate of the present invention. In this regard, the entire disclosure of 5,208,020 and 7,276,697 is incorporated herein by reference.
Many positions on maytansinoids can serve as the position to chemically link the linking moiety. For example, the C-3 position having a hydroxyl group, the C-14 position modified with hydroxymethyl, the C-15 position modified with hydroxy and the C-20 position having a hydroxy group are all expected to be useful. In some embodiments, the C-3 position serves as the position to chemically link the linking moiety, and in some particular embodiments, the C-3 position of maytansinol serves as the position to chemically link the linking moiety. There are many linking groups known in the art for making antibody- maytansinoid conjugates, including, for example, those disclosed in U.S. Pat. Nos. 5,208,020, 6,441,163, and EP Patent No. 0425235 B1 ; Chari et al., Cancer Research 52:127-131 (1992); and U.S. 2005/0169933 A1, the disclosures of which are hereby expressly incorporated by reference. Additional linking groups are described and exemplified herein.
The present disclosure also includes various isomers and mixtures of maytansinoids and conjugates. Certain compounds and conjugates of the present invention may exist in various stereoisomeric, enantiomeric, and diastereomeric forms. Several descriptions for producing such antibody-maytansinoid conjugates are provided in U.S. Pat. Nos. 5,208,020, 5,416,0646,333,410, 6,441,163, 6,716,821, and 7,368,565, each of which is incorporated herein in its entirety.
A therapeutically effective number of maytansinoid molecules bound per antibody molecule can be determined by measuring spectrophotometrically the ratio of the absorbance at 252 nm and 280 nm. An average of 3 to 4 maytansinoid molecules conjugated per antibody molecule can enhancing cytotoxicity of target cells without negatively affecting the function or solubility of the antibody, although one molecule of toxin/antibody can enhance cytotoxicity over antibody alone. The average number of maytansinoid molecules/antibody or antigen binding fragment thereof can be, for example, 1-10 or 2-5.
Anthracyclines
In other embodiments, the antibodies and antigen-binding fragments thereof described herein can be conjugated to a cytotoxin that is an anthracycline molecule. Anthracyclines are antibiotic compounds that exhibit cytotoxic activity. Studies have indicated that anthracyclines may operate to kill cells by a number of different mechanisms including: 1) intercalation of the drug molecules into the DNA of the cell thereby inhibiting DNA-dependent nucleic acid synthesis; 2) production by the drug of free radicals which then react with cellular macromolecules to cause damage to the cells or 3) interactions of the drug molecules with the cell membrane [see, e.g., C. Peterson et al.," Transport And
Storage Of Anthracycline In Experimental Systems And Human Leukemia" in Anthracvcline Antibiotics In Cancer Therapy; N.R. Bachur, "Free Radical Damage" id. at pp.97-102] Because of their cytotoxic potential anthracyclines have been used in the treatment of numerous cancers such as leukemia, breast carcinoma, lung carcinoma, ovarian adenocarcinoma and sarcomas [see e.g., P.H- Wiernik, in Anthracvcline: Current Status And New Developments p 11] Commonly used anthracyclines include doxorubicin, epirubicin, idarubicin and daunomycin.
Representative examples of anthracyclines include, but are not limited to daunorubicin (Cerubidine; Bedford Laboratories), doxorubicin (Adriamycin; Bedford Laboratories; also referred to as doxorubicin hydrochloride, hydroxy-daunorubicin, and Rubex), epirubicin (Ellence; Pfizer), and idarubicin (Idamycin; Pfizer Inc.) The anthracycline analog, doxorubicin (ADRIAMYCINO) is thought to interact with DNA by intercalation and inhibition of the progression of the enzyme topoisomerase II, which unwinds DNA for transcription. Doxorubicin stabilizes the topoisomerase II complex after it has broken the DNA chain for replication, preventing the DNA double helix from being resealed and thereby stopping the process of replication. Doxorubicin and daunorubicin (DAUNOMYCIN) are prototype cytotoxic natural product anthracycline chemotherapeutics (Sessa et al., (2007) Cardiovasc. Toxicol. 7:75-79).
In other embodiments, the anti-CD117 antibodies or antigen-binding fragments thereof described herein can be conjugated to a cytotoxin that is a pyrrolobenzodiazepine (PBD) or a cytotoxin that comprises a PBD. PBDs are natural products produced by certain actinomycetes and have been shown to be sequence selective DNA alkylating compounds. PBD cytotoxins include, but are not limited to, anthramycin, dimeric PBDs, and those disclosed in, for example, Hartley, J.A. (2011). “The development of pyrrolobenzodiazepines as antitumour agents.” Expert Opin. Inv. Drug, 20(6), 733-744; and Antonow, D.; Thurston,
D.E. (2011) “Synthesis of DNA-interactive pyrrolo[2,1-c][1 ,4]benzodiazepines (PBDs).”
Chem. Rev. 111 : 2815-2864.
Calicheamicins
I In other embodiments, the antibodies and antigen-binding fragments thereof described herein can be conjugated to a cytotoxin that is an enediyne antitumor antibiotic (e.g., calicheamicins, ozogamicin). The calicheamicin family of antibiotics are capable of producing double-stranded DNA breaks at sub-picomolar concentrations. Examples of calicheamicins suitable for use in the present invention are disclosed, for example, in U.S. Pat. No. 4,671 ,958;
U.S. Pat. No. 4,970,198, U.S. Pat. No. 5,053,394, U.S. Pat. No. 5,037,651 ; and U.S. Pat. No. 5,079,233, which are incorporated herein in their entirety. Structural analogues of calicheamicin which may be used include, but are not limited to, those disclosed in, for example, Hinman et al., Cancer Research 53:3336-3342 (1993), Lode et al., Cancer Research 58:2925-2928 (1998), and the aforementioned U.S. patents to American Cyanamid.
Auristatins
Anti-CD117 antibodies, and antigen-binding fragments thereof, described herein can be conjugated to a cytotoxin that is an auristatin (U.S. Pat. Nos. 5,635,483; 5,780,588). Auristatins are anti-mitotic agents that interfere with microtubule dynamics, GTP hydrolysis, and nuclear and cellular division (Woyke et al (2001) Antimicrob. Agents and Chemother. 45(12):3580-3584) and have anticancer (U.S. Pat. No. 5,663,149) and antifungal activity (Pettit et al (1998) Antimicrob. Agents Chemother. 42:2961-2965). (U.S. Pat. Nos. 5,635,483; 5,780,588). The auristatin drug moiety may be attached to the antibody through the N- (amino) terminus or the C- (carboxyl) terminus of the peptidic drug moiety (WO 02/088172).
Exemplary auristatin embodiments include the N-terminus linked monomethylauristatin drug moieties DE and DF, disclosed in Senter et al, Proceedings of the American Association for Cancer Research, Volume 45, Abstract Number 623, presented Mar. 28, 2004, the disclosure of which is expressly incorporated by reference in its entirety. An exemplary auristatin embodiment is MMAE, wherein the wavy line indicates the point of covalent attachment to the linker of an antibody-linker conjugate (-L-Z-Ab, as described herein).
Another exemplary auristatin embodiment is MMAF, wherein the wavy line indicates the point of covalent attachment to the linker of an antibody-linker conjugate (-L-Z-Ab, as described herein), as disclosed in US 2005/0238649:
Auristatins may be prepared according to the methods of: U.S. Pat. No. 5,635,483; U.S. Pat. No. 5,780,588; Pettit et al (1989) J. Am. Chem. Soc. 111 :5463-5465; Pettit et al (1998) Anti-Cancer Drug Design 13:243-277; Pettit, G. R., et al. Synthesis, 1996, 719-725;
Pettit et al (1996) J. Chem. Soc. Perkin Trans. 15:859-863; and Doronina (2003) Nat. Biotechnol. 21(7)778-784.
Amatoxins In some embodiments, the cytotoxin of the antibody-drug conjugate (ADC) is an RNA polymerase inhibitor. In some embodiments, the RNA polymerase inhibitor is an amatoxin or derivative thereof. In some embodiments, the cytotoxin is an amatoxin or derivative thereof, such as a-amanitin, b-amanitin, y-amanitin, e-amanitin, amanin, amaninamide, amanullin, amanullinic acid, and proamanullin. Amatoxins useful in conjunction with the compositions and methods described herein include compounds according to, but are not limited to, formula (I) (SEQ ID NO: 291),
wherein:
Ri is H, OH, or ORA;
R2 is H, OH, or ORB;
RAand RB, when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
R3 is H or Rd; R4 is H, OH, ORD, or RD;
R5 is H, OH, ORD, or RD;
R6 is H, OH, ORD, or RD;
R7 is H, OH, ORD, or RD;
Rs is OH, NH2, or ORD; Rg is H, OH, or ORD;
X is -S-, -S(O)-, or -SO2-; and
RD is optionally substituted alkyl (e.g., C1-C6 alkyl), optionally substituted heteroalkyl (e.g., C1-C6 heteroalkyl), optionally substituted alkenyl (e.g., C2-C6 alkenyl), optionally substituted heteroalkenyl (e.g., C2-C6 heteroalkenyl), optionally substituted alkynyl (e.g., C2- C& alkynyl), optionally substituted heteroalkynyl (e.g., C2-C6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.
For instance, in one embodiment, amatoxins useful in conjunction with the compositions and methods described herein include compounds according to formula (la) (SEQ ID NO: 292)
wherein R , R5, X, and Rs are each as defined above.
For instance, in one embodiment, amatoxins useful in conjunction with the compositions and methods described herein include compounds according to formula (lb) (SEQ ID NO: 293), below:
Ri is H, OH, or ORA;
R2 is H, OH, or ORB;
RAand RB, when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
R3 is H or Rd;
R4 is H, OH, ORD, or RD;
R5 is H, OH, ORD, or RD;
R6 is H, OH, ORD, or RD;
R7 is H, OH, ORD, or RD;
Rs is OH, IMH2, or ORD;
Rg is H, OH, or ORD;
X is -S-, -S(O)-, or -SO2-; and
RD is optionally substituted alkyl (e.g., C1-C6 alkyl), optionally substituted heteroalkyl (e.g., C1-C6 heteroalkyl), optionally substituted alkenyl (e.g., C2-C6 alkenyl), optionally substituted heteroalkenyl (e.g., C2-C6 heteroalkenyl), optionally substituted alkynyl (e.g., C2- C& alkynyl), optionally substituted heteroalkynyl (e.g., C2-C6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.
In one embodiment, amatoxins useful in conjunction with the compositions and methods described herein also include compounds according to formula (lc) (SEQ ID NO: 294), below:
Ri is H, OH, or ORA;
R2 is H, OH, or ORB;
RAand RB, when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
R3 is H or Rd;
R4 is H, OH, ORD, or RD;
R5 is H, OH, ORD, or RD;
R6 is H, OH, ORD, or RD;
R7 is H, OH, ORD, or RD;
Rs is OH, IMH2, or ORD;
Rg is H, OH, or ORD;
X is -S-, -S(O)-, or -SO2-; and
RD is optionally substituted alkyl (e.g., C1-C6 alkyl), optionally substituted heteroalkyl (e.g., C1-C6 heteroalkyl), optionally substituted alkenyl (e.g., C2-C6 alkenyl), optionally substituted heteroalkenyl (e.g., C2-C6 heteroalkenyl), optionally substituted alkynyl (e.g., C2- C& alkynyl), optionally substituted heteroalkynyl (e.g., C2-C6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.
Synthetic methods of making amatoxin are described in U.S. Patent No. 9,676,702, which is incorporated by reference herein.
Many positions on amatoxins or derivatives thereof can serve as the position to covalently bond the linking moiety L, and, hence the antibodies or antigen-binding fragments thereof. In some embodiments, the cytotoxin in the ADC is an amatoxin or derivative thereof according to formula (I, la, lb, or lc).
In one embodiment, the ADC is represented by the general formula Ab-Z-L-Am, wherein Ab is an antibody or antigen-binding fragment thereof that binds CD117, L is a linker, Z is a chemical moiety, and Am is an amatoxin. In certain embodiments, the ADC having the general formula Ab-Z-L-Am, is represented by formula (II) (SEQ ID NO: 295):
wherein: Ri is H, OH, ORA, or ORc;
R2 is H, OH, ORB, or ORc;
RAand RB, when present, together with the oxygen atoms to which they are bound, combine to form a 5-membered heterocycloalkyl group;
R3 is H, Rc, or RD; R4 is H, OH, ORc, ORD, RC; or RD;
R5 is H, OH, ORc, ORD, RC, or RD;
Re is H, OH, ORc, ORD, RC, or RD;
R7 is H, OH, ORc, ORD, RC, or RD;
R8 is OH, IMH2, ORc, ORD, NHRc, or NRCRD; Rg is H, OH, ORc, or ORD;
X is -S-, -S(O)-, or -SO2-;
Rc is-L-Z-Ab,
RD is C1-C6 alkyl, C1-C6 heteroalkyl, C2-C6 alkenyl, C2-C6 heteroalkenyl, C2-C6 alkynyl, C2-C6 heteroalkynyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, or a combination thereof, wherein each C1-C6 alkyl, C1-C6 heteroalkyl, C2-C6 alkenyl, C2-C6 heteroalkenyl, C2-C6 alkynyl, C2-C6 heteroalkynyl, cycloalkyl, heterocycloalkyl, aryl, or heteroaryl is optionally
substituted with from 1 to 5 substituents independently selected for each occasion from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, alkaryl, alkyl heteroaryl, amino, ammonium, acyl, acyloxy, acylamino, aminocarbonyl, alkoxycarbonyl, ureido, carbamate, aryl, heteroaryl, sulfinyl, sulfonyl, hydroxyl, alkoxy, sulfanyl, halogen, carboxy, trihalomethyl, cyano, hydroxy, mercapto, and nitro.
L is a linker, such as optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted C2-C6 alkynyl, optionally substituted C2-C6 heteroalkynyl, optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, (C=0); or comprises a peptide or a dipeptide; or comprises -((CH2)mO)n(CH2)m-, where m and n are each independently selected from 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10; or a combination of any thereof; and
Z is a chemical moiety formed from a coupling reaction between a reactive substituent 71 present on L and a reactive substituent present within an antibody, or antigen binding fragment thereof, that binds CD117 (such as GNNK+ CD117).
In some embodiments, Am contains exactly one Rc substituent.
In some embodiments, the cytotoxin is an amatoxin or derivative thereof and the ADC Ab-Z-L-Am is represented by formula (II), wherein:
Ri and R2are each independently H or OH;
R3 is Rc;
R4, R6, and R are each H;
R5 is H, OH, or OC1-C6 alkyl;
Rs is OH or NH2;
R9 is H or OH;
X is -S-, -S(O)-, or -SO2-; and
Rcand RD are as defined above.
Such amatoxin-linker conjugates are described, for example, in U.S. Patent Application Publication No. 2014/0294865, the disclosure of which is incorporated herein by reference in its entirety.
In some embodiments, the cytotoxin is an amatoxin or derivative thereof and the ADC Ab-Z-L-Am is represented by formula (II), wherein:
Ri and R2 are each independently H or OH;
R3, R6, and R are each H;
R4 and R5 are each independently H, OH, ORc, or Rc;
Rs is OH or NH2;
R9 is H or OH;
X is -S-, -S(O)-, or -SO2-; and
Rc and RD are as defined above.
Such amatoxin-linker conjugates are described, for example, in U.S. Patent Application Publication No. 2015/0218220, the disclosure of which is incorporated herein by 5 reference in its entirety.
In some embodiments, the cytotoxin is an amatoxin or derivative thereof and the ADC Ab-Z-L-Am is represented by formula (II), wherein:
Ri and R2 are each independently H or OH;
R3, R6, and R7 are each H; 0 R4 and R5 are each independently H or OH;
R8 is OH, NH2, ORC, or NHRC;
R9 is H or OH;
X is -S-, -S(O)-, or -SO2-; and
Rc and RD are as defined above. 5 Such amatoxin conjugates are described, for example, in U.S. Patent Nos. 9,233,173 and 9,399,681 , the disclosures of each of which are incorporated herein by reference in their entirety.
In some embodiments, the ADC Ab-Z-L-Am is represented by formula (IIA) (SEQ ID NO: 296):
wherein each of Ri, R2, RA, RB, R3, R4, Rs, R6, R7, Rs, R9, Rc, RD, X, L, and Z are as defined above with respect to Formula (III).
In some embodiments, the ADC Ab-Z-L-Am is represented by formula (MB) (SEQ ID NO: 297):
wherein each of Ri, R2, RA, RB, R3, R4, Rs, R6, R7, Rs, R9, Rc, RD, X, L, and Z are as defined above with respect to Formula (III). Anti-CD117: Linkers
A variety of linkers can be used to conjugate antibodies, or antigen-binding fragments, as described herein (e.g., antibodies, or antigen-binding fragments thereof, that recognize and bind CD117 (such as GNNK+ CD117) with a cytotoxic molecule.
The term “Linker" as used herein means a divalent chemical moiety comprising a covalent bond or a chain of atoms that covalently attaches an anti-CD117 antibody or fragment thereof (Ab) to a drug moiety (D) to form antibody-drug conjugates (ADC) of formula II. Suitable linkers have two reactive termini, one for conjugation to an antibody and the other for conjugation to a cytotoxin. The antibody conjugation reactive terminus of the linker (reactive moiety, Z') is typically a site that is capable of conjugation to the antibody through a cysteine thiol or lysine amine group on the antibody, and so is typically a thiol- reactive group such as a double bond (as in maleimide) or a leaving group such as a chloro, bromo, iodo, or an R-sulfanyl group, or an amine-reactive group such as a carboxyl group; while the cytotoxin conjugation reactive terminus of the linker is typically a site that is capable of conjugation to the cytotoxin. Non-limiting examples for linker-cytotoxin conjugation include, for example, formation of an amide bond with a basic amine or carboxyl group on the cytotoxin, via a carboxyl or basic amine group on the linker, respectively, or formation of an ether or the like, via alkylation of an OH group on the cytotoxin, via e.g., a leaving group on the linker. In some embodiments, cytotoxin-linker conjugation is through formation of an amide bond with a basic amine or carboxyl group on the cytotoxin, and so the reactive substituent on the linker is respectively a carboxyl or basic amine group. When the term "linker" is used in describing the linker in conjugated form, one or both of the
reactive termini will be absent (such as reactive moiety Z', having been converted to chemical moiety Z) or incomplete (such as being only the carbonyl of the carboxylic acid) because of the formation of the bonds between the linker and/or the cytotoxin, and between the linker and/or the antibody or antigen-binding fragment thereof. Such conjugation reactions are described further herein below.
In some embodiments, the linker is cleavable under intracellular conditions, such that cleavage of the linker releases the drug unit from the antibody in the intracellular environment. In yet other embodiments, the linker unit is not cleavable and the drug is released, for example, by antibody degradation. The linkers useful for the present ADCs are preferably stable extracellularly, prevent aggregation of ADC molecules and keep the ADC freely soluble in aqueous media and in a monomeric state. Before transport or delivery into a cell, the ADC is preferably stable and remains intact, i.e. the antibody remains linked to the drug moiety. The linkers are stable outside the target cell and may be cleaved at some efficacious rate inside the cell. An effective linker will: (i) maintain the specific binding properties of the antibody; (ii) allow intracellular delivery of the conjugate or drug moiety; (iii) remain stable and intact, i.e. not cleaved, until the conjugate has been delivered or transported to its targeted site; and (iv) maintain a cytotoxic, cell-killing effect or a cytostatic effect of the cytotoxic moiety. Stability of the ADC may be measured by standard analytical techniques such as mass spectroscopy, HPLC, and the separation/analysis technique LC/MS. Covalent attachment of the antibody and the drug moiety requires the linker to have two reactive functional groups, i.e. bivalency in a reactive sense. Bivalent linker reagents which are useful to attach two or more functional or biologically active moieties, such as peptides, nucleic acids, drugs, toxins, antibodies, haptens, and reporter groups are known, and methods have been described their resulting conjugates (Hermanson, G. T. (1996) Bioconjugate Techniques; Academic Press: New York, p. 234-242).
Suitable cleavable linkers include those that may be cleaved, for instance, by enzymatic hydrolysis, photolysis, hydrolysis under acidic conditions, hydrolysis under basic conditions, oxidation, disulfide reduction, nucleophilic cleavage, or organometallic cleavage (see, for example, Leriche et al., Bioorg. Med. Chem., 20:571-582, 2012, the disclosure of which is incorporated herein by reference as it pertains to linkers suitable for covalent conjugation). Suitable cleavable linkers may include, for example, chemical moieties such as a hydrazine, a disulfide, a thioether or a dipeptide.
Linkers hydrolyzable under acidic conditions include, for example, hydrazones, semicarbazones, thiosemicarbazones, cis-aconitic amides, orthoesters, acetals, ketals, or the like. (See, e.g., U.S. Pat. Nos. 5,122,368; 5,824,805; 5,622,929; Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123; Neville et al., 1989, Biol. Chem. 264:14653-14661 ,
the disclosure of each of which is incorporated herein by reference in its entirety as it pertains to linkers suitable for covalent conjugation. Such linkers are relatively stable under neutral pH conditions, such as those in the blood, but are unstable at below pH 5.5 or 5.0, the approximate pH of the lysosome.
Linkers cleavable under reducing conditions include, for example, a disulfide. A variety of disulfide linkers are known in the art, including, for example, those that can be formed using SATA (N-succinimidyl-S-acetylthioacetate), SPDP (N-succinimidyl-3-(2- pyridyldithiojpropionate), SPDB (N-succinimidyl-3-(2-pyridyldithio)butyrate) and SMPT (N- succinimidyl-oxycarbonyl-alpha-methyl-alpha-(2-pyridyl-dithio)toluene), SPDB and SMPT (See, e.g., Thorpe et al., 1987, Cancer Res. 47:5924-5931 ; Wawrzynczak et al., In Immunoconjugates: Antibody Conjugates in Radioimagery and Therapy of Cancer (C. W. Vogel ed., Oxford U. Press, 1987. See also U.S. Pat. No. 4,880,935, the disclosure of each of which is incorporated herein by reference in its entirety as it pertains to linkers suitable for covalent conjugation.
Additional linkers suitable for the synthesis of drug-antibody conjugates conjugates as described herein include those capable of releasing a cytotoxin by a 1 ,6-elimination process (a "self-immolative" group), such as p-aminobenzyl alcohol (PABC), p-aminobenzyl (PAB), 6-maleimidohexanoic acid, pH-sensitive carbonates, and other reagents described in Jain et al., Pharm. Res. 32:3526-3540, 2015, the disclosure of which is incorporated herein by reference in its entirety.
In some embodiments, the linker includes a self-immolative group such as the afore mentioned PAB or PABC (para-aminobenzyloxycarbonyl), which are disclosed in, for example, Carl et al., J. Med. Chem. (1981) 24:479-480; Chakravarty et al (1983) J. Med. Chem. 26:638-644; US 6214345; US20030130189; US20030096743; US6759509; US20040052793; US6218519; US6835807; US6268488; US20040018194; W098/13059; US20040052793; US6677435; US5621002; US20040121940; W02004/032828). Other such chemical moieties capable of this process (“self-immolative linkers”) include methylene carbamates and heteroaryl groups such as aminothiazoles, aminoimidazoles, aminopyrimidines, and the like. Linkers containing such heterocyclic self-immolative groups are disclosed in, for example, U.S. Patent Publication Nos. 20160303254 and 20150079114, and U.S. Patent No. 7,754,681 ; Hay et al. (1999) Bioorg. Med. Chem. Lett. 9:2237; US 2005/0256030; de Groot et al (2001) J. Org. Chem. 66:8815-8830; and US 7223837.
Linkers susceptible to enzymatic hydrolysis can be, e.g., a peptide-containing linker that is cleaved by an intracellular peptidase or protease enzyme, including, but not limited to, a lysosomal or endosomal protease. One advantage of using intracellular proteolytic release of the therapeutic agent is that the agent is typically attenuated when conjugated and the
serum stabilities of the conjugates are typically high. In some embodiments, the peptidyl linker is at least two amino acids long or at least three amino acids long. Exemplary amino acid linkers include a dipeptide, a tripeptide, a tetrapeptide or a pentapeptide. Examples of suitable peptides include those containing amino acids such as Valine, Alanine, Citrulline (Cit), Phenylalanine, Lysine, Leucine, and Glycine. Amino acid residues which comprise an amino acid linker component include those occurring naturally, as well as minor amino acids and non-naturally occurring amino acid analogs, such as citrulline. Exemplary dipeptides include valine-citrulline (vc or val-cit) and alanine-phenylalanine (af or ala-phe). Exemplary tripeptides include glycine-valine-citrulline (gly-val-cit) and glycine-glycine-glycine (gly-gly- gly). In some embodiments, the linker includes a dipeptide such as Val-Cit, Ala-Val, or Phe- Lys, Val-Lys, Ala-Lys, Phe-Cit, Leu-Cit, lle-Cit, Phe-Arg, or Trp-Cit. Linkers containing dipeptides such as Val-Cit or Phe-Lys are disclosed in, for example, U.S. Pat. No.
6,214,345, the disclosure of which is incorporated herein by reference in its entirety as it pertains to linkers suitable for covalent conjugation. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit. In some embodiments, a dipeptide is used in combination with a self-immolative linker.
Linkers suitable for use herein further may include one or more groups selected from Ci-C6 alkylene, C1-C6 heteroalkylene, C2-C6 alkenylene, C2-C6 heteroalkenylene, C2-C6 alkynylene, C2-C6 heteroalkynylene, C3-C6cycloalkylene, heterocycloalkylene, arylene, heteroarylene, and combinations thereof, each of which may be optionally substituted. Non limiting examples of such groups include (CH2)n, (CH2CH20)n, and -(C=0)(CH2)n- units, wherein n is an integer from 1-6, independently selected for each occasion.
In some embodiments, each C1-C6 alkyl, C1-C6 heteroalkyl, C2-C6 alkenyl, C2-C6 heteroalkenyl, C2-C6 alkynyl, C2-C6heteroalkynyl, C3-C6 cycloalkyl, heterocycloalkyl, aryl, or heteroaryl group may be optionally substituted with from 1 to 5 substituents independently selected for each occasion from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, alkaryl, alkyl heteroaryl, amino, ammonium, acyl, acyloxy, acylamino, aminocarbonyl, alkoxycarbonyl, ureido, carbamate, aryl, heteroaryl, sulfinyl, sulfonyl, hydroxyl, alkoxy, sulfanyl, halogen, carboxy, trihalomethyl, cyano, hydroxy, mercapto, and nitro.
In some embodiments, each C1-C6 alkyl, C1-C6 heteroalkyl, C2-C6 alkenyl, C2-C6 heteroalkenyl, C2-C6 alkynyl, C2-C6heteroalkynyl, C3-C6 cycloalkyl, heterocycloalkyl, aryl, or heteroaryl group may optionally be interrupted by one or more heteroatoms selected from O, S and N.
In some embodiments, each C1-C6 alkyl, C1-C6 heteroalkyl, C2-C6 alkenyl, C2-C6 heteroalkenyl, C2-C6 alkynyl, C2-C6heteroalkynyl, C3-C6 cycloalkyl, heterocycloalkyl, aryl, or
heteroaryl group may optionally be interrupted by one or more heteroatoms selected from O, S and N and may be optionally substituted with from 1 to 5 substituents independently selected for each occasion from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, alkaryl, alkyl heteroaryl, amino, ammonium, acyl, acyloxy, acylamino, aminocarbonyl, alkoxycarbonyl, ureido, carbamate, aryl, heteroaryl, sulfinyl, sulfonyl, hydroxyl, alkoxy, sulfanyl, halogen, carboxy, trihalomethyl, cyano, hydroxy, mercapto, and nitro.
Suitable linkers may contain groups having solubility enhancing properties. Linkers including the (CH2CH20)p unit (polyethylene glycol, PEG), for example, can enhance solubility, as can alkyl chains substituted with amino, sulfonic acid, phosphonic acid or phosphoric acid residues. Linkers including such moieties are disclosed in, for example,
U.S. Patent Nos. 8,236,319 and 9,504,756, the disclosure of each of which is incorporated herein by reference in its entirety as it pertains to linkers suitable for covalent conjugation.
Further solubility enhancing groups include, for example, acyl and carbamoyl sulfamide groups, having the structure:
wherein a is 0 or 1 ; and
R10 is selected from the group consisting of hydrogen, Ci-C24 alkyl groups, C3-C24 cycloalkyl groups, Ci-C24 (hetero)aryl groups, Ci-C24 alkyl(hetero)aryl groups and Ci-C24 (hetero)arylalkyl groups, the Ci-C24 alkyl groups, C3-C24 cycloalkyl groups, C2-C24 (hetero)aryl groups, C3-C24 alkyl(hetero)aryl groups and C3-C24 (hetero)arylalkyl groups, each of which may be optionally substituted and/or optionally interrupted by one or more heteroatoms selected from O, S and NR11R12, wherein R11 and R12 are independently selected from the group consisting of hydrogen and C1 -C4 alkyl groups; or R10 is a cytotoxin, wherein the cytotoxin is optionally connected to N via a spacer moiety. Linkers containing such groups are described, for example, in U.S. Patent No. 9,636,421 and U.S. Patent Application Publication No. 2017/0298145, the disclosures of which are incorporated herein by reference in their entirety as they pertain to linkers suitable for covalent conjugation to cytotoxins and antibodies or antigen-binding fragments thereof.
In some embodiments, the linker comprises a ((CH2)mO) n(CH2)m- group where n and m are each independently selected from 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10; and a heteroaryl
group, wherein the heteroaryl group is a triazole. In some embodiments, the ((CH2)mO) n(CH2)m- group and triazole together comprise
where n is from 1 to 10, and the wavy lines indicate attachment points to additional linker components, the chemical moiety Z, or the amatoxin.
Other linkers that may be used in the methods and compositions described herein are described in US 2019/0144504, which is incorporated by reference herein.
In some embodiments, the linker may include one or more of a hydrazine, a disulfide, a thioether, a dipeptide, a p-aminobenzyl (PAB) group, a heterocyclic self-immolative group, an optionally substituted C1-C6 alkyl, an optionally substituted C1-C6 heteroalkyl, an optionally substituted C2-C6 alkenyl, an optionally substituted C2-C6 heteroalkenyl, an optionally substituted C2-C6alkynyl, an optionally substituted C2-C6heteroalkynyl, an optionally substituted C3-C6 cycloalkyl, an optionally substituted heterocycloalkyl, an optionally substituted aryl, an optionally substituted heteroaryl, acyl, -(C=0)-, or -(CH2CH20)n- group, wherein n is an integer from 1-6. One of skill in the art will recognize that one or more of the groups listed may be present in the form of a bivalent (diradical) species, e.g., C1-C6 alkylene and the like.
In some embodiments, the linker L comprises the moiety *-l_il_2-**, wherein:
l_2 is absent or is -(CH2)m-, -NR13(CH2)m-, -(CH2)mNR13C(=0)(CH2)m-, -X4, - (CH2)mNR13C(=0)X4, - (CH2)mNR13C(=0)-, -((CH2)mO)n(CH2)m-, -((CH2)mO)n(CH2)mX3(CH2)m-,
- NR13((CH2)mO)nX3(CH2)m-, -NR13((CH2)mO)n(CH2)mX3(CH2)m-, -XiX2C(=0)(CH2)m-, - (CH2)m(0(CH2)m)n-, -(CH2)mNR13(CH2)m-, -(CH2)mNR13C(=0)(CH2)mX3(CH2)m-, - (CH2)mC(=0)NR13(CH2)mNR13C(=0)(CH2)m-, -(CH2)mC(=0)-, - (CH2)mNR13(CH2)mC(=0)X2XiC(=0)-, -(CH2)mX3(CH2)mC(=0)X2XiC(=0)-, - (CH2)mC(=0)NR13(CH2)m-, -(CH2)mC(=0)NR13(CH2)mX3(CH2)m-, - (CH2)mX3(CH2)mNR13C(=0)(CH2)m-, -(CH2)mX3(CH2)mC(=0)NR13(CH2)m-, - (CH2)m0)n(CH2)mNR13C(=0)(CH2)m-, -(CH2)mC(=0)NR13(CH2)m(0(CH2)m)n-, -
(CH2)m(0(CH2)m)nC(=0)-, -(CH2)mNR13(CH2)mC(=0)-, -(CH2)mC(=0)NR13(CH2)mNR13C(=0)-, -(CH2)m(0(CH2)m)nX3(CH2)m-, - (CH2)mX3((CH2)mO)n(CH2)m-, -(CH2)mX3(CH2)mC(=0)-, - (CH2)mC(=0)NR13(CH2)m0)n(CH2)mX3(CH2)m-, - (CH2)mX3(CH2)m(0(CH2)m)nNR13C(=0)(CH2)m- , -(CH2)mX3(CH2)m(0(CH2)m)nC(=0)-, -(CH2)mX3(CH2)m(0(CH2)m)n-, - (CH2)mC(=0)NR13(CH2)mC(=0)-, -(CH2)mC(=0)NR13(CH2)m(0(CH2)m)nC(=0)-, - ((CH2)m0)n(CH2)mNR13C(=0)(CH2)m-, -(CH2)mC(=0)NR13(CH2)mC(=0)NR13(CH2)m-, - (CH2)mNR13C(=0)(CH2)mNR13C(=0)(CH2) -(CH2)mX3(CH2)mC(=0)NR13-, -(CH2)mC(=0)NR13-, -(CH2)mX3-, -C(R13)2(CH2)m-, -(CH2)mC(R13)2NR13-, -(CH2)mC(=0)NR13(CH2)mNR13-, - (CH2)mC(=0)NR13(CH2)mNR13C(=0)NR13-, -(CH2)mC(=0)X2XiC(=0)-, - C(R13)2(CH2)mNR13C(=0)(CH2)m-, -(CH2)mC(=0)NR13(CH2)mC(R13)2NR13-, - C(R13)2(CH2)mX3(CH2)m-, -(CH2)mX3(CH2)mC(R13)2NR13-, -C(R13)2(CH2)m0C(=0)NR13(CH2)m-, - (CH2)mNR13C(=0)0(CH2)mC(R13)2NR13-, -(CH2)mX3(CH2)mNR13-, -
(CH2)mX3(CH2)m(0(CH2)m)nNR13-, -(CH2)mNR13-, -(CH2)mC(=0)NR13(CH2)m(0(CH2)m)nNR13 -
(CH2)m(0(CH2)m)nNR13-, -(CH2CH20)n(CH2)m-, -(CH2)m(OCH2CH2)n; -(CH2)mO(CH2)m-, - (CH2)mS(=0)2-, - (CH2)mC(=0)NR13(CH2)mS(=0)2-, -(CH2)mX3(CH2)mS(=0)2-, - (CH2)mX2XiC(=0)-, -(CH2)m(0(CH2)m)nC(=0)X2XiC(=0)-, -(CH2)m(0(CH2)m)nX2XiC(=0)-, - (CH2)mX3(CH2)mX2XiC(=0)-, -(CH2)mX3(CH2)m(0(CH2)m)nX2Xi C(=0)-, - (CH2)mX3(CH2)mC(=0)NR13(CH2)mNR13C(=0)-, -(CH2)mX3(CH2)mC(=0)NR13(CH2)mC(=0)-, - (CH2)mX3(CH2)mC(=0)NR13(CH2)m(0(CH2)m)nC(=0)-, -(CH2)mC(=0)X2XiC(=0)NR13(CH2)m-, - (CH2)mX3(0(CH2)m)nC(=0)-, -(CH2)mNR13C(=0)((CH2)m0)n(CH2)m-, - (CH2)m(0(CH2)m)nC(=0)NR13(CH2)m-, -(CH2)mNR13C(=0)NR13(CH2)m- or - (CH2)mX3(CH2)mNR13C(=0)-; wherein
R13 is independently selected for each occasion from H and C1-C6 alkyl; m is independently selected for each occasion from 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10; n is independently selected for each occasion from 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 and 14; and wherein the single asterisk (*) indicates the attachment point to the cytotoxin (e.g., an amatoxin), and the double asterisk (**) indicates the attachment point to the reactive substituent Z or chemical moiety Z, with the proviso that Li and l_2 are not both absent.
In some embodiments, the linker includes a p-aminobenzyl group (PAB). In one embodiment, the p-aminobenzyl group is disposed between the cytotoxic drug and a protease cleavage site in the linker. In one embodiment, the p-aminobenzyl group is part of a p-aminobenzyloxycarbonyl unit. In one embodiment, the p-aminobenzyl group is part of a p- aminobenzylamido unit.
In some embodiments, the linker comprises PAB, Val-Cit-PAB, Val-Ala- PAB, Val-Lys(Ac)-PAB, Phe-Lys-PAB, Phe-Lys(Ac)-PAB, D-Val-Leu-Lys, Gly-Gly-Arg, Ala- Ala-Asn-PAB, or Ala-PAB.
In some embodiments, the linker comprises a combination of one or more of a peptide, oligosaccharide, -(CH2)n-, -(CH2CH20)n-, PAB, Val-Cit-PAB, Val-Ala-PAB, Val-
Lys(Ac)-PAB, Phe-Lys-PAB, Phe-Lys(Ac)-PAB, D-Val-Leu-Lys, Gly-Gly-Arg, Ala-Ala-Asn- PAB, or Ala-PAB.
In one specific embodiment, the linker comprises PAB-Ala-Val-propionyl, represented by the structure
wherein the wavy lines indicate attachment points to the cytotoxin and the reactive moiety Z'. In another specific embodiment, the linker comprises PAB-Cit-Val-propionyl, represented by the structure
wherein the wavy lines indicate attachment points to the cytotoxin and the reactive moiety Z'. Such PAB-dipeptide-propionyl linkers are disclosed in, e.g., Patent Application Publication No. WO2017/149077, which is incorporated by reference herein in its entirety.
In certain embodiments, the linker of the ADC is maleimidocaproyl-Val-Ala-para- aminobenzyl (mc-Val-Ala-PAB). In certain embodiments, the linker of the ADC is maleimidocaproyl-Val-Cit-para- aminobenzyl (mc-vc-PAB).
In some embodiments, the linker comprises MCC (4-[N- maleimidomethyl]cyclohexane-1 -carboxylate).
In some embodiments, the linker comprises a -(CH2)n- unit, wherein n is an integer from 2 to 6.
In some embodiments, the linker comprises a -(C=0)(CH2)n- unit, wherein n is an integer from 1-6.
Linkers that can be used to conjugate an antibody, or antigen-binding fragment thereof, to a cytotoxic agent include those that are covalently bound to the cytotoxic agent on one end of the linker and, on the other end of the linker, contain a chemical moiety formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within the antibody, or antigen-binding fragment thereof, that binds CD117 (such as GNNK+ CD117). Reactive substituents that may be present within an antibody, or antigen-binding fragment thereof, that binds CD117 (such as GNNK+ CD117) include, without limitation, hydroxyl moieties of serine, threonine, and tyrosine residues; amino moieties of lysine residues; carboxyl moieties of aspartic acid and glutamic acid residues; and thiol moieties of cysteine residues, as well as propargyl, azido, haloaryl (e.g., fluoroaryl), haloheteroaryl (e.g., fluoroheteroaryl), haloalkyl, and haloheteroalkyl moieties of non-naturally occurring amino acids.
Examples of linkers useful for the synthesis of drug-antibody conjugates conjugates include those that contain electrophiles, such as Michael acceptors (e.g., maleimides), activated esters, electron-deficient carbonyl compounds, and aldehydes, among others, suitable for reaction with nucleophilic substituents present within antibodies or antigen binding fragments, such as amine and thiol moieties. For instance, linkers suitable for the synthesis of drug-antibody conjugates include, without limitation, succinimidyl 4-(N- maleimidomethyl)-cyclohexane-L-carboxylate (SMCC), N- succinimidyl iodoacetate (SIA), sulfo-SMCC, m-maleimidobenzoyl-/V-hydroxysuccinimidyl ester (MBS), sulfo-MBS, and succinimidyl iodoacetate, among others described, for instance, Liu et al., 18:690-697, 1979, the disclosure of which is incorporated herein by reference as it pertains to linkers for chemical conjugation. Additional linkers include the non-cleavable maleimidocaproyl linkers, which are particularly useful for the conjugation of microtubule-disrupting agents such as auristatins, are described by Doronina et al., Bioconjugate Chem. 17:14-24, 2006, the disclosure of which is incorporated herein by reference as it pertains to linkers for chemical conjugation.
It will be recognized by one of skill in the art that any one or more of the chemical groups, moieties and features disclosed herein may be combined in multiple ways to form linkers useful for conjugation of the antibodies and cytotoxins as disclosed herein. Further linkers useful in conjunction with the compositions and methods described herein, are described, for example, in U.S. Patent Application Publication No. 2015/0218220, the disclosure of which is incorporated herein by reference in its entirety.
Linkers useful in conjunction with the antibody-drug described herein include, without limitation, linkers containing chemical moieties formed by coupling reactions as depicted in
Table 3, below. Curved lines designate points of attachment to the antibody, or antigen binding fragment, and the cytotoxic molecule, respectively.
Table 3. Exemplary chemical moieties Z formed by coupling reactions in the formation of antibody-drug
One of skill in the art will recognize that a reactive substituent Z' attached to the linker and a reactive substituent on the antibody or antigen-binding fragment thereof, are engaged in the covalent coupling reaction to produce the chemical moiety Z, and will recognize the reactive substituent Z'. Therefore, antibody-drug conjugates useful in conjunction with the methods described herein may be formed by the reaction of an antibody, or antigen-binding fragment thereof, with a linker or cytotoxin-linker conjugate, as described herein, the linker or cytotoxin-linker conjugate including a reactive substituent Z', suitable for reaction with a reactive substituent on the antibody, or antigen-binding fragment thereof, to form the chemical moiety Z.
In some embodiments, Z ' is -NR13C(=0)CH=CH2, -N3, -SH, -S(=0)2(CH=CH2), - (CH2)2S(=0)2(CH=CH2), -NR13S(=0)2(CH=CH2), -NR13C(=0)CH2R14, -NR13C(=0)CH2Br, - NR13C(=0)CH2l, -NHC(=0)CH2Br, -NHC(=0)CH2l, -ONH2, -C(0)NHNH2, -C02H, -NH2, - NH(C=0), -NC(=S),
R13 is independently selected for each occasion from H and C1-C6 alkyl; R14 is -S(CH2)nCHR15NHC(=0)R13;
R15 is R13 or -C(=0)0R13;
R16 is independently selected for each occasion from H, C1-C6 alkyl, F, Cl, and -OH; R17 is independently selected for each occasion from H, C1-C6 alkyl, F, Cl, -NH2, - OCH3, -OCH2CH3, -N(CH3)2, -CN, -N02 and-OH; and
R18 is independently selected for each occasion from H, C1-C6 alkyl, F, benzyloxy substituted with -C(=0)0H, benzyl substituted with -C(=0)0H, C1-C4 alkoxy substituted with -C(=0)0H, and C1-C4 alkyl substituted with -C(=0)0H.
As depicted in Table 3, examples of suitably reactive substituents on the linker and antibody or antigen-binding fragment thereof include a nucleophile/electrophile pair (e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/ a,b -unsaturated carbonyl pair, and the like), a diene/dienophile pair (e.g., an azide/alkyne pair, or a diene/ a,b-unsaturated carbonyl pair, among others), and the like. Coupling reactions between the reactive substitutents to form the chemical moiety Z include, without limitation, thiol alkylation, hydroxyl alkylation, amine alkylation, amine or hydroxylamine condensation, hydrazine formation, amidation, esterification, disulfide formation, cycloaddition (e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others), nucleophilic aromatic substitution, electrophilic aromatic substitution, and other reactive modalities known in the art or described herein. Preferably, the linker contains an electrophilic functional group for reaction with a nucleophilic functional group on the antibody, or antigen-binding fragment thereof.
Reactive substituents that may be present within an antibody, or antigen-binding fragment thereof, as disclosed herein include, without limitation, nucleophilic groups such as (i) N-terminal amine groups, (ii) side chain amine groups, e.g. lysine, (iii) side chain thiol groups, e.g. cysteine, and (iv) sugar hydroxyl or amino groups where the antibody is glycosylated. Reactive substituents that may be present within an antibody, or antigen binding fragment thereof, as disclosed herein include, without limitation, hydroxyl moieties of serine, threonine, and tyrosine residues; amino moieties of lysine residues; carboxyl moieties of aspartic acid and glutamic acid residues; and thiol moieties of cysteine residues, as well as propargyl, azido, haloaryl (e.g., fluoroaryl), haloheteroaryl (e.g., fluoroheteroaryl), haloalkyl, and haloheteroalkyl moieties of non-naturally occurring amino acids. In some embodiments, the reactive substituents present within an antibody, or antigen-binding fragment thereof as disclosed herein include, are amine or thiol moieties. Certain antibodies have reducible interchain disulfides, i.e. cysteine bridges. Antibodies may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (dithiothreitol). Each cysteine bridge will thus form, theoretically, two reactive thiol nucleophiles. Additional nucleophilic groups can be introduced into antibodies through the reaction of lysines with 2-iminothiolane (Traut's reagent) resulting in conversion of an amine into a thiol. Reactive thiol groups may be introduced into the antibody (or fragment thereof) by introducing one, two, three, four, or more cysteine residues (e.g., preparing mutant antibodies comprising one or more non-native cysteine amino acid residues). U.S. Pat. No. 7,521 ,541 teaches engineering antibodies by introduction of reactive cysteine amino acids.
In some embodiments, the reactive moiety Z' attached to the linker is a nucleophilic group which is reactive with an electrophilic group present on an antibody. Useful electrophilic groups on an antibody include, but are not limited to, aldehyde and ketone carbonyl groups. The heteroatom of a nucleophilic group can react with an electrophilic group on an antibody and form a covalent bond to the antibody. Useful nucleophilic groups include, but are not limited to, hydrazide, oxime, amino, hydroxyl, hydrazine, thiosemicarbazone, hydrazine carboxylate, and arylhydrazide.
In some embodiments, Z is the product of a reaction between reactive nucleophilic substituents present within the antibodies, or antigen-binding fragments thereof, such as amine and thiol moieties, and a reactive electrophilic substituent Z'. For instance, Z' may be a Michael acceptor (e.g., maleimide), activated ester, electron-deficient carbonyl compound, or an aldehyde, among others.
Several representative and non-limiting examples of reactive substituents Z' and the resulting chemical moieties Z are provided in Table 4.
Table 4. Complementary reactive substituents and chemical moieties
For instance, linkers suitable for the synthesis of ADCs of the disclosure include, without limitation, reactive substituents Z' such as maleimide or haloalkyl groups. These may be attached to the linker by reagents such as succinimidyl 4-(N-maleimidomethyl)- cyclohexane-L-carboxylate (SMCC), N- succinimidyl iodoacetate (SIA), sulfo-SMCC, m- maleimidobenzoyl-/V-hydroxysuccinimidyl ester (MBS), sulfo-MBS, and succinimidyl iodoacetate, among others described, in for instance, Liu et al., 18:690-697, 1979, the disclosure of which is incorporated herein by reference as it pertains to linkers for chemical conjugation.
In some embodiments, the reactive substituent Z' attached to linker L is a maleimide, azide, or alkyne. An example of a maleimide-containing linker is the non-cleavable maleimidocaproyl-based linker.
In some embodiments, the reactive substituent Z' is -(C=0)- or -NH(C=0)-, such that the linker may be joined to the antibody, or antigen-binding fragment thereof, by an amide or urea moiety, respectively, resulting from reaction of the -(C=0)- or -NH(C=0)- group with an amino group of the antibody or antigen-binding fragment thereof.
In some embodiments, the reactive substituent is an N-maleimidyl group, halogenated N-alkylamido group, sulfonyloxy N-alkylamido group, carbonate group, sulfonyl halide group, thiol group or derivative thereof, alkynyl group comprising an internal carbon- carbon triple bond, (het-ero)cycloalkynyl group, bicyclo[6.1 0]non-4-yn-9-yl group, alkenyl group comprising an internal carbon-carbon double bond, cycloalkenyl group, tetrazinyl group, azido group, phosphine group, nitrile oxide group, nitrone group, nitrile imine group, diazo group, ketone group, (O-alkyl)hydroxylamino group, hydrazine group, halogenated N- maleimidyl group, 1,1 -bis (sulfonylmethyl)methylcarbonyl group or elimination derivatives thereof, carbonyl halide group, or an allenamide group, each of which may be optionally substituted. In some embodiments, the reactive substituent comprises a cycloalkene group, a cycloalkyne group, or an optionally substituted (hetero)cycloalkynyl group.
In some embodiments, the anti-CD117 ADC comprises an anti-CD117 antibody conjugated to an amatoxin of formula I as disclosed herein, via a linker and a chemical moiety Z. In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit. In some embodiments, the linker includes a para-aminobenzyl group (PAB). In some embodiments, the linker includes the moiety PAB-Cit-Val. In some embodiments, the linker includes the moiety PAB-Ala-Val. In some embodiments, the linker includes a -((C=0)(CH2)n - unit, wherein n is an integer from 1-6. In some embodiments, the linker is -PAB-Cit-Val- ((C=0)(CH2)n-.
In some embodiments, the linker includes a -(CH2)n- unit, where n is an integer from 2-6. In some embodiments, the linker is -PAB-Cit-Val-((C=0)(CH2)n- In some embodiments, the linker is -PAB-Ala-Val-((C=0)(CH2)n- In some embodiments, the linker is -(CH2)n- In some embodiments, the linker is -((CH2)n-, wherein n is 6. In some embodiments, the chemical moiety Z is selected from Table 3 or Table 4. In some embodiments, the chemical moiety Z is
where S is a sulfur atom which represents the reactive substituent present within an antibody, or antigen-binding fragment thereof, that binds CD117 (e.g., from the -SH group of a cysteine residue).
In some embodiments, an amatoxin as disclosed herein is conjugated to a linker- reactive moiety -L-Z' having the following formula:
where the wavy line indicates the point of attachment to a substituent on the cytotoxin (e.g., an amatoxin). This linker-reactive substituent group L-Z' may alternatively be referred to as N-beta-maleimidopropionyl-Val-Ala-para-aminobenzyl (BMP-Val-Ala-PAB).
In some embodiments, an amatoxin as disclosed herein is conjugated to a linker- reactive moiety -L-Z' having the following formula:
where the wavy line indicates the point of attachment to a substituent on the cytotoxin (e.g., an amatoxin). This linker-reactive substituent group L-Z' may alternatively be referred to as N-beta-maleimidopropyl-Val-Cit-para-aminobenzyl (BMP-Val-Cit-PAB).
In some embodiments, the linker-reactive substituent group structure L-Z', prior to conjugation with the antibody or antigen binding fragment thereof, is:
In some embodiments, the linker L and the chemical moiety Z, taken together as L-Z, is
where S is a sulfur atom which represents the reactive substituent present within an antibody, or antigen-binding fragment thereof, such as an anti-CD117 antibody (e.g., from the -SH group of a cysteine residue). The wavy line at the linker terminus indicates the point of attachment to the amatoxin.
In some embodiments, the linker L and the chemical moiety Z, after conjugation to the antibody, taken together as L-Z-Ab, has the structure:
where S is a sulfur atom which represents the reactive substituent present within an antibody, or antigen-binding fragment thereof, such as an anti-CD-117 antibody. The wavy line at the linker terminus indicates the point of attachment to the amatoxin.
One of skill in the art will recognize the linker- reactive substituent group structure, prior to conjugation with the antibody or antigen binding fragment thereof, includes a maleimide as the group Z'. The foregoing linker moieties and amatoxin-linker conjugates, among others useful in conjunction with the compositions and methods described herein, are described, for example, in U.S. Patent Application Publication No. 2015/0218220 and Patent Application Publication No. WO2017/149077, the disclosure of each of which is incorporated herein by reference in its entirety.
Preparation of Antibody-Drug Conjugates In the ADCs as disclosed herein, an ant-CD117 antibody or antigen binding fragment thereof is conjugated to one or more cytotoxic drug moieties (D), e.g. about 1 to about 20 drug moieties per antibody, through a linker L and a chemical moiety Z as disclosed herein.
The ADCs of the present disclosure may be prepared by several routes, employing organic chemistry reactions, conditions, and reagents known to those skilled in the art, including: (1) reaction of a reactive substituent of an antibody or antigen binding fragment thereof with a bivalent linker reagent to form Ab-Z-L as described herein above, followed by reaction with a drug moiety D; or (2) reaction of a reactive substituent of a drug moiety with a bivalent linker reagent to form D-L-Z, followed by reaction with a reactive substituent of an antibody or antigen binding fragment thereof as described herein above to form an ADC of formula D-L- Z-Ab, such as Am-Z-L-Ab. Additional methods for preparing ADC are described herein.
In another aspect, the antibody or antigen binding fragment thereof has one or more lysine residues that can be chemically modified to introduce one or more sulfhydryl groups. The ADC is then formed by conjugation through the sulfhydryl group's sulfur atom as described herein above. The reagents that can be used to modify lysine include, but are not limited to, N-succinimidyl S-acetylthioacetate (SATA) and 2-lminothiolane hydrochloride (Traut's Reagent).
In another aspect, the antibody or antigen binding fragment thereof can have one or more carbohydrate groups that can be chemically modified to have one or more sulfhydryl groups. The ADC is then formed by conjugation through the sulfhydryl group's sulfur atom as described herein above.
In yet another aspect, the antibody can have one or more carbohydrate groups that can be oxidized to provide an aldehyde (-CHO) group (see, for e.g., Laguzza, et al., J. Med. Chem. 1989, 32(3), 548-55). The ADC is then formed by conjugation through the corresponding aldehyde as described herein above. Other protocols for the modification of proteins for the attachment or association of cytotoxins are described in Coligan et al., Current Protocols in Protein Science, vol. 2, John Wiley & Sons (2002), incorporated herein by reference.
Methods for the conjugation of linker-drug moieties to cell-targeted proteins such as antibodies, immunoglobulins or fragments thereof are found, for example, in U.S. Pat. No. 5,208,020; U.S. Pat. No. 6,441 ,163; W02005037992; W02005081711 ; and W02006/034488, all of which are hereby expressly incorporated by reference in their entirety.
The foregoing linker moieties and amatoxin-linker conjugates, among others useful in conjunction with the compositions and methods described herein, are described, for example, in U.S. Patent Application Publication No. 2015/0218220 and Patent Application Publication No. WO2017/149077, the disclosure of each of which is incorporated herein by reference in its entirety.
The foregoing linker moieties and amatoxin-linker conjugates, among others useful in conjunction with the compositions and methods described herein, are described, for example, in U.S. Patent Application Publication No. 2015/0218220 and Patent Application Publication No. WO2017/149077, the disclosure of each of which is incorporated herein by reference in its entirety.
In one embodiment, the CD117 antibodies, or antigen-binding fragments, described herein may be bound to an amatoxin so as to form an ADC represented by the formula Ab- Z-L-Am, wherein Ab is the CD117 antibody, or antigen-binding fragment thereof, L is a linker, Z is a chemical moiety and Am is an amatoxin, each as described herein.
In some embodiments, Am-L-Z-Ab is one of (SEQ ID NOS 298, 298, and 298):
In some embodiments, Am-L-Z-Ab is (SEQ ID NO: 299):
In some instances, the anti-CD117 ADC has the structure of formula (III) (SEQ ID NO: 285):
X is S or-S(O)-;
L is a linker;
Z is a chemical moiety formed by a coupling reaction between a reactive substituent present on L and a reactive substituent present within the anti-CD117 antibody; and Ab is the anti-CD117 antibody. In some embodiments, L is a non-cleavable linker;
In some embodiments, an anti-CD117 ADC described herein has the structure of formula (Ilia) (SEQ ID NO: 286):
(Ilia). or formula (lllb) (SEQ ID NO: 287):
In some instances, the anti-CD117 ADC has the structure of formula (IV) (SEQ ID NO: 288):
a stereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein Ab is the anti-CD117 antibody.
In some instances, the anti-CD117 ADC has the structure of formula (IVa) (SEQ ID NO: 289):
a stereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein Ab is the anti-CD117 antibody.
In some instances, the anti-CD117 ADC has the structure of formula (IVb) (SEQ ID NO: 29):
a stereoisomer thereof, or a pharmaceutically acceptable salt thereof, wherein Ab is the anti-CD117 antibody. Amatoxins that may be used in the ADCs described herein are also provided in WO
2020/216947, which is incorporated by reference herein.
Example
The following examples are put forth so as to provide those of ordinary skill in the art with a description of how the compositions and methods described herein may be used, made, and evaluated, and are intended to be purely exemplary of the present disclosure and are not intended to limit the scope of what the inventors regard as their invention.
In the following examples, the therapeutic antibody is anti-CD117 antibody Ab85.
Example 1 : Preparation of Antibody Cocktail
Antibody cocktails used in Example 2 (below) were prepared as follows. LiveDead Aqua (ThermoFisher, Cat # L34957) supplied as lyophilized stock. As needed, dye reconstituted in 50 pl_ DMSO and aliquoted into 5 mI_ aliquots, was stored at -20°C. For each experiment, one 5mI_ aliquot thawed to room temperature and 45 mI_ 1x PBS added. 5 mI_ of this stock is used per sample. Six 5 ml. falcon tubes labeled for unstained and five panel conditions for each sample as described below:
A master mix of common markers for all tubes was prepared as follows:
47.5 mI_ mix added to appropriate tubes. Panel-specific antibodies (see below) were added to appropriate tubes:
Samples were mixed by briefly vortexing and incubated at room temperature for 20 minutes. 3 ml. 1x BD Lyse (BD Biosciences, Cat # 349202) were added to each tube. Samples were mixed by inverting and incubated at room temperature for 10 minutes. All tubes were centrifuged at 540 g for 4 minutes at room temperature, and the supernatant was removed by decanting and the cells were resuspended in residual buffer by briefly vortexing. The tubes washed with 2 mL cold FCM buffer and centrifuged at 540 g for 4 minutes at room temperature. Supernatant removed by decanting and cells resuspended in residual volume buffer by briefly vortexing. Tubes transferred into 5 mL falcon flow tubes, 350 pL cold FCM (fixation) was buffer added and the tubes were placed on ice or refrigerated at 2-8 °C until acquisition on the Canto A.
Example 2: Reagent Selection for Receptor Occupancy (RO) assay
CD117 receptor occupancy by a therapeutic antibody can be determined in an in vitro or ex vivo assay based on flow cytometric analysis of CD117-expressing cells in whole blood. Since receptor occupancy is typically measured in whole blood system, the assay is dependent on the target expression levels of circulating cells. While high expression levels of the target receptor (i.e. the CD117 receptor) and an abundant population of circulating cells is ideal, in practice however, this is not always the case. As described in more detail below, it has been demonstrated that non-ideal conditions can be solved using a high affinity detection antibody (both a competing antibody (i.e., to measure free receptor) and a non competing antibody (i.e., to measure total receptor)) and a strong fluorophore signal.
In order to assess appropriate competing and non-competing anti-CD117 antiboides for the receptor occupancy assay, octet binding studies were performed with a number of different anti-CD117 antibodies to determine their ability to bind competitively or non- competitively with therapeutic antibody Ab85.
The results of the binding assays showed that the anti-CD117 antibody SR-1 (BioXcell (West Lebanon, NFI)) and Ab85 demonstrated competitive binding with the therapeutic antibody, while the anti-CD117 antibody YB5.B8 (Invitrogen), anti-CD117 antibody 104D2 (BioLegend) and Ab67 demonstrated non-competitive binding with the therapeutic antibody (data not shown).
In order to assess the signal to background range of various fluorophore-labeled anti- CD117 antibodies, an assay was performed to measure the geometric mean fluorescence
intensity (gMFI) of the aforementioned competing and non-competing antibodies labeled with a variety of detectable agents (Fig. 1). The antibodies were titrated in the presence of CD117+ cells (Kasumi-1 cells; Fig. 2A) and a negative control (Kasumi-1 KO cells; Fig. 2B), and analyzed by flow cytometry. The data are summarized in Fig. 3 and demonstrated that the gMFI for Alexa Fluor 647 (AF647) conjugates were superior to the other fluorophores tested, independent of antibody backbone. Flowever, the data suggested that the AF647 signal was non-specfic at concentrations higher than 1 nM (Fig. 3).
In order to assess the appropriate detectable agents for use in a blood sample taken from a human patient who does not have a high CD117 expression level in blood, a whole blood spike-in assay was developed (Fig. 4). Briefly, a sample of whole blood from a healthy human subject was spiked with either hematopoietic stem cells (FISCs) or a CD117+ cell line (e.g., Kasumi-1 cells) at 10% of whole blood cell count (WBC) and stained with the fluorophore-labeled anti-CD117 antibodies Fig. 4). After cell lysis and washing steps, the resulting samples were analyzed using a flow cytometer to measure the gMFI. Representative data for the anti-CD117 antibody 104D2-labeled with phycoerythrin (i.e.,
“104D2-PE”) are provided in Fig. 5 and show the readout for single color whole blood spike- in assay using a spike of Kasumi cells (Fig. 5B) was significantly higher in comparison to the readout for single color whole blood (Fig. 5A). In order to determine the preferred fluorophore and the appropriate concentration where the preferred fluorophore is saturating (1.25 per 200uL for Ab85-PE and 10uL per 200uL for 104D2 BV421 (data not shown)), a series of whole blood spike-in assay were performed by staining with 3 different antibody cocktails, each having a different CD117 fluorophore (Figs. 6A-6C; the “fluors” (i.e., fluorophores) were purchased from Biolegend; catalog numbers 303432, 301720, 317330, 343610, 303504, 304014, 302242, 420404 and 313204) and performing a dose titration of the CD117 fluorophore and analyzed using flow cytometry (Fig. 7). The data show that the phycoerythrin (PE; red color channel) had better dynamic range (~ 290) compared to Brilliant Violet™ 421 (BV421 ; blue color channel) (Figs. 8A, 8B and 8D). In addition, Alexa Fluor 647 (AF647; red color channel) had a lower dynamic range (~ 21) due to high background (Figs. 8C and 8D).
An assay was then performed to determine CD117 receptor occupancy based on the previously described whole blood spike-in assay format. Briefly, a sample of whole blood from a healthy human subject was spiked with either hematopoietic stem cells (FISCs) or a CD117+ cell line (e.g., Kasumi-1 cells) at 10% of whole blood cell count (WBC) and incubated with the therapeutic antibody (up to 1 nM) and increasing concentrations of Ab85 conjugated to either fluorophore PE (i.e., Ab85-PE (a competing antibody)) or fluorophore AF647 (i.e., Ab85-AF647 (a competing antibody)) in the presence of increasing levels of
antibody 104D2 conjugated to BV421 (i.e., a non-competing antibody). Occupancy was measured on CD117 expressing cells using flow cytometry. The results of the assay are provided in Fig. 9 and show that in the presence of bound therapeutic antibody, Ab85-PE is blocked from binding CD117 in a concentration dependent manner, providing a measure of CD117 receptor occupancy for healthy human subjects. Under these conditions, the assay is capable of detecting saturation of receptor binding by the therapeutic antibody (i.e. 100%
RO) in a concentration dependent manner.
Based on the results of the whole blood spike-in assays provided above, the data showed that the AF647 fluorophore had a significantly high background, and therefore, an insufficient dynamic range. The data for the PE and BV421 fluorophores, however, demonstrated significantly higher (and relatively similar) dynamic ranges. Accordingly, the competing anti-CD117 antibody and non-competing anti-CD117 antibody for the receptor occupancy assay were the Ab85 labeled with the fluorophore PE and anti-CD117 antibody 104D2 conjugated with the fluorophore BV421 , respectively.
Example 3: Dose determination using receptor occupancy (RO) assay
Receptor occupancy will be determined using a pre-dose, 2h, 4h, 8h, 24h, 36h and 48h post-dose peripheral blood samples from the human patient. The dosing schedule is typically designed to achieve exposures that result in sustained receptor occupancy (RO) based on typical pharmacokinetic properties of a therapeutic antibody. The blood samples will be fixed immediately post collection to chemically preserve the sample and shipped for subsequent analysis using quantitative flow cytometry. To determine receptor occupancy, each sample will be split for analysis with two detection monoclonal antibodies (MAbs), one competing with the drug (antibody) to determine the number of free (unbound) CD117 receptors, and one non-competing MAb binding to a different epitope on the receptor to determine the total number of CD117 receptors on the cell surface. By using detection MAbs conjugated to Brilliant Violet™ 421 (BV421) with a defined antibody: BV421 ratio, the absolute receptor numbers will be determined. By using detection MAbs conjugated to phycoerythin (PE) fluorescent protein with a defined antibody: PE ratio, the free receptor numbers will be determined using a standard curve generated with quantibrite beads with defined and varying numbers of PE molecules. The percentage receptor occupancy at each time point will be derived from the free and total CD117 receptor copy numbers using the formula % RO = 100 x (1- (free receptors/total receptors). In certain embodiments, the % RO free receptors can be determined using the following formula:
Analysis of the pre-dose, 2h, 4h, 8h, 24h, 36h, and 48h samples will allow measurement of receptor occupancy as well as duration of target engagement to guide dose escalation. If sustained occupancy (>90% occupancy at 24h post-dose) is achieved in subjects at a given dose level, further dose escalation will be stopped.
Other Embodiments
All publications, patents, and patent applications mentioned in this specification are incorporated herein by reference to the same extent as if each independent publication or patent application was specifically and individually indicated to be incorporated by reference.
While the invention has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the invention that come within known or customary practice within the art to which the invention pertains and may be applied to the essential features hereinbefore set forth, and follows in the scope of the claims.
Other embodiments are within the claims.
Claims
1. A method for treating a human subject in need thereof, comprising: determining CD117 receptor occupancy of a therapeutic anti-CD117 antibody on
CD117 expressing cells from a human subject, said method comprising performing a receptor occupancy (RO) assay on a sample from the human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample; and administering to the human subject an amount of the therapeutic anti-CD117 antibody that is less than 100 times an amount of the therapeutic anti-CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay, wherein the therapeutic anti-CD117 antibody depletes CD117+ cells in the human subject thereby treating the human subject.
2. The method of claim 1 , wherein the therapeutic anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
3. The method of claim 1 , wherein the therapeutic anti-CD117 antibody, or antigen binding fragment thereof, comprises a light chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 104, and a heavy chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 103.
4. The method of claim 1 , wherein the therapeutic anti-CD117 antibody comprises a heavy chain having the amino acid sequence as set forth as SEQ ID NO: 138, and a light chain having an amino acid sequence set forth as SEQ ID NO: 144.
5. The method of any one of claims 1 -4, wherein the therapeutic anti-CD117 antibody is an lgG1 isotype.
6. The method of any one of claims 1-5, wherein the human subject is administered an amount of the therapeutic anti-CD117 antibody that is less than an amount of the therapeutic
anti-CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay.
7. The method of any one of claims 1-5, wherein the human subject is administered an amount of the therapeutic anti-CD117 antibody that is less than an amount of the therapeutic anti-CD117 antibody sufficient to result in about 80% CD117 receptor occupancy as determined by the RO assay.
8. The method of any one of claims 1-5, wherein the RO assay comprises contacting the sample with an anti-CD117 antibody, or an antigen binding fragment thereof, that cross blocks the therapeutic anti-CD117 antibody.
9. The method of any one of claims 1 -8, wherein the therapeutic anti-CD117 antibody that is administered to the human subject as an anti-CD117 antibody drug conjugate (ADC) comprising the therapeutic anti-CD117 antibody conjugated via a linker to an amatoxin.
10. The method of claim 9, wherein the ADC has the structure of formula (III):
or a stereoisomer thereof; wherein:
X is S or S(O); L is a linker;
Z is a chemical moiety formed by a coupling reaction between a reactive substituent Z' present on L and a reactive substituent present within the anti-CD117 antibody; and
Ab is the anti-CD117 antibody.
12. The method of claim 10 or 11 , wherein L comprises one or more moieties selected from a bond, -(C=0)-, a -C(0)NH- group, an -OC(0)NH- group, C1-C6 alkylene, C1-C6 heteroalkylene, C2-C6 alkenylene, C2-C6 heteroalkenylene, C2-C6 alkynylene, C2-C6 heteroalkynylene, C3-C6 cycloalkylene, heterocycloalkylene, arylene, heteroarylene, a - (CH2CH20)p- group where p is an integer from 1-6; a solubility enhancing group, and a peptide; wherein each C1-C6 alkylene, C1-C6 heteroalkylene, C2-C6 alkenylene, C2-C6 heteroalkenylene, C2-C6 alkynylene, C2-C6 heteroalkynylene, C3-C6 cycloalkylene,
heterocycloalkylene, arylene, or heteroarylene may optionally be substituted with from 1 to 5 substituents independently selected for each occasion from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, alkaryl, alkyl heteroaryl, amino, ammonium, acyl, acyloxy, acylamino, aminocarbonyl, alkoxycarbonyl, ureido, carbamate, aryl, heteroaryl, sulfinyl, sulfonyl, hydroxyl, alkoxy, sulfanyl, halogen, carboxy, trihalomethyl, cyano, hydroxy, mercapto, and nitro; or each C1-C6 alkylene, C1-C6 heteroalkylene, C2-C6 alkenylene, C2-C6 heteroalkenylene, C2-C6 alkynylene, C2-C6 heteroalkynylene, C3-C6 cycloalkylene, heterocycloalkylene, arylene, or heteroarylene may optionally be interrupted by one or more heteroatoms selected from O, S and N.
14. The method of claim 13, wherein the ADC has the structure of formula (IVa):
16. A method for determining receptor occupancy of a therapeutic anti-CD117 antibody on a CD117 expressing cell from a human subject, said method comprising performing a receptor occupancy (RO) assay on a sample obtained from a human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on the CD117 expressing cell from the sample, wherein the therapeutic anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and
comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
17. The method of claim 16, wherein the RO assay comprises the steps of:
(a) contacting the sample with an amount of the anti-CD117 therapeutic antibody,
(b) contacting the sample with an amount of a second anti-CD117 antibody, or an antigen-binding fragment thereof, that competes with the anti-CD117 therapeutic antibody for binding to CD117 on the CD117 expressing cell, wherein the second anti-CD117 antibody, or an antigen-binding fragment thereof, is labelled with a first detectable agent;
(c) detecting the amount of the second antibody bound to the CD117 on the cell surface on the CD117 expressing cell in the sample, and
(d) calculating the percentage of CD117 bound by the anti-CD117 therapeutic antibody, thereby determining receptor occupancy of the therapeutic anti-CD117 antibody.
18. A method for determining receptor occupancy of a therapeutic anti-CD117 antibody on a CD117 expressing cell from a human subject who has been administered the therapeutic antibody, said method comprising performing a receptor occupancy (RO) assay on a sample from a human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on the CD117 expressing cell from the sample, and wherein therapeutic anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
19. The method of claim 18, wherein the RO assay comprises the steps of:
(a) obtaining a sample from the human subject administered the therapeutic antibody;
(b) contacting the sample with an amount of a second anti-CD117 antibody, or an antigen-binding fragment thereof, that competes with the anti-CD117 therapeutic antibody for binding to a CD117 receptor, wherein the second anti-CD117 antibody, or an antigen binding fragment thereof, is labelled with a first detectable agent;
(c) detecting the amount of the second antibody bound to the CD117 receptor on the CD117 expressing cell in the sample, and
(d) calculating the percentage of CD117 bound by the anti-CD117 therapeutic antibody, thereby determining receptor occupancy of the therapeutic anti-CD117 antibody.
20. The method of claim 17 or19, wherein calculating the percentage of CD117 bound by the anti-CD117 therapeutic antibody further comprises the steps contacting the sample (or an equivalent sample) with an amount of a third anti- CD117 antibody, or an antigen-binding fragment thereof, that does not compete with the anti-CD117 therapeutic antibody for binding to a CD117 receptor, wherein the third anti- CD117 antibody, or an antigen-binding fragment thereof, is labelled with a second detectable agent, and detecting the amount of the third anti-CD117 antibody, or an antigen-binding fragment thereof, bound to the CD117 receptor on the CD117 expressing cell in the sample, thereby determining the total amount of the CD117 receptor on the CD117 expressing cell in the sample.
21. The method of claim 20, wherein the second detectable agent is detected at a different emission wavelength than the first detectable agent.
22. The method of any one of claims 17-21, wherein the receptor occupancy of the therapeutic anti-CD117 antibody is determined by detecting a signal from the first detectable agent, detecting a signal from the second detectable agent, and comparing the signals in order to determine the percent receptor occupancy.
23. The method of any one of claims 17-22, wherein the detecting is determined using flow cytometry.
24. The method of any one of claims 17-23, wherein the second anti-CD117 antibody, or an antigen-binding fragment thereof, is an antigen binding fragment of the therapeutic antibody, a competitive anti-CD117 antibody that cross blocks the therapeutic antibody, or an antigen-binding fragment of a competitive anti-CD117 antibody that cross blocks the therapeutic antibody.
25. The method of any one of claims 17-23, wherein the detectable agent is selected from the group consisting of a fluorescent label, a luminescent label, a bioluminescent label, a magnetic label, a radiolabel, and an enzyme.
26. The method of claim 25, wherein the detectable agent is a fluorescent label selected from the group consisting of phycoerythrin (PE), allophycocyanin (APC), BD Horizon
Brilliant™ Violet 421 (BV421), BD Horizon Brilliant™ Violet 510 (BV510), BD Horizon Brilliant™ Violet 785 (BV785), fluorescein (FITC), PerCP-Cy5.5, and Alexa Fluor® 647 (AF647).
27. The method of claim 26, wherein the PE is phycoerythrin (PE)-Dazzle 594, PE/Cy5, PE/Cy5.5 and PE/Cy7.
28. The method of claim 26, wherein the APC is allophycocyanin-Cy7.
29. The method of claim 20, wherein the third anti-CD117 antibody comprises antibody 104D2 conjugated to BV421.
30. The method of claim 18 or 29, wherein the second antibody is the anti-CD117 therapeutic antibody conjugated to phycoerythrin.
31. The method of claim 19, wherein the sample is obtained from the human subject immediately following administration of the anti-CD117 therapeutic antibody to the human subject.
32. The method of claim 19, wherein the sample is obtained from the human subject at about 2 hours after administration of the anti-CD117 therapeutic antibody to the human subject.
33. The method of claim 19, wherein the sample is obtained from the human subject at about 4 hours after administration of the anti-CD117 therapeutic antibody to the human subject.
34. The method of claim 19, wherein the sample is obtained from the human subject at about 8 hours after administration of the anti-CD117 therapeutic antibody to the human subject.
35. The method of claim 19, wherein the sample is obtained from the human subject at about 24 hours after administration of the anti-CD117 therapeutic antibody to the human subject.
36. The method of claim 19, wherein the sample is obtained from the human subject at about 36 hours after administration of the anti-CD117 therapeutic antibody to the human subject.
37. The method of claim 19, wherein the sample is obtained from the human subject at about 48 hours after administration of the anti-CD117 therapeutic antibody to the human subject.
38. The method of any one of claims 16-37, wherein the sample comprises a CD117+ cell.
39. The method of any one of claims 16-37, wherein the sample comprises a leukemic blast cell, a hematopoietic stem cell (HSC), a hematopoietic stem and progenitor cell (HSPCs).
40. The method of any one of claims 16-39, wherein the sample is whole blood or bone marrow from the human subject.
41. The method of any one of claims 16-40, wherein the second anti-CD117 antibody, or the antigen binding fragment thereof, binds to the same epitope as the therapeutic antibody.
42. The method of claim 16, wherein the RO assay comprises contacting the sample with a) the anti-CD117 therapeutic antibody, the antigen binding fragment thereof, and b) a second antibody, or an antigen-binding fragment thereof, which is labelled and specifically binds to the therapeutic anti-CD117 antibody, or an antigen binding fragment thereof, and contacting the sample (or an equivalent sample) with a third anti-CD117 antibody, or an antigen-binding fragment thereof, which does not compete with the therapeutic anti- CD117 antibody for binding to human CD117, wherein the second antibody, or antigen-binding fragment thereof, does not cross react with the third anti-CD117 antibody, or an antigen-binding fragment thereof, and wherein the second anti-CD117 antibody, or antigen binding fragment thereof, is labelled with a first detectable agent and the third antibody, or an antigen-binding fragment thereof, is labeled with a second detectable agent.
43. The method of any one of claims 16-42, wherein the therapeutic anti-CD117 antibody, or antigen binding fragment thereof, comprises a light chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 104, and a heavy chain variable region comprising the amino acid sequence set forth as SEQ ID NO: 103.
44. The method of any one of claims 16-43, wherein the therapeutic anti-CD117 antibody comprises a heavy chain having the amino acid sequence as set forth as SEQ ID NO: 138, and a light chain having an amino acid sequence set forth as SEQ ID NO: 144.
45. The method of any one of claims 16-44, wherein the therapeutic anti-CD117 antibody is an lgG1 isotype.
46. The method of any one of claims 16-45, further comprising determining a dose of the therapeutic antibody for treating a human subject in need based on the percent receptor occupancy.
47. A method of depleting CD117 expressing cells in a human subject, comprising administering an dose of an anti-CD117 antibody drug conjugate (ADC) comprising an anti- CD117 antibody conjugated to an amatoxin via a linker, to the human subject, wherein the dose is determined using the method of any one of claims 16-45, and wherein the anti- CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
48. A method of treating a human subject in need thereof, comprising administering an dose of an anti-CD117 antibody drug conjugate (ADC) comprising an anti-CD117 antibody conjugated to an amatoxin to the human subject, wherein the dose is determined using the method of any one of claims 16-45, and wherein the anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
49. A method of conditioning a human subject, comprising administering an dose of an anti-CD117 antibody drug conjugate (ADC) comprising an anti-CD117 antibody conjugated to an amatoxin to the human subject, wherein the dose is determined using the method of any one of claims 16-45, and wherein the anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
50. The method of any one of claims 47-49, wherein the sample is from the same human subject.
51. The method of any one of claims 47-49, wherein the amount administered to the human subject is less than 1.1 times an amount of the therapeutic anti-CD117 antibody sufficient to result in about 100% CD117 receptor occupancy as determined by the RO assay.
52. The method of any one of claims 47-49, wherein the dose resulted in at least about 80% receptor occupancy in the RO assay.
53. The method of any one of claims 47-49, wherein the dose resulted in at least about 85% receptor occupancy in the RO assay.
54. The method of any one of claims 47-49, wherein the dose resulted in at least about 90% receptor occupancy in the RO assay.
55. The method of any one of claims 47-49, wherein the dose resulted in at least about 95% receptor occupancy in the RO assay.
56. The method of any one of claims 47-49, wherein the dose resulted in at least about 99% receptor occupancy in the RO assay.
57. A method of conditioning a human subject in need thereof, the method comprising administering to the human subject an amount of an anti-CD117 ADC sufficient to achieve and/or maintain a receptor occupancy of at least about 80% as determined according to any one of the methods of claims 16-30, wherein the anti-CD117 ADC comprises an anti-CD117
antibody conjugated to an amatoxin, and wherein the anti-CD117 antibody comprises a heavy chain variable region comprising CDR1 , CDR2 and CDR3 as set forth in SEQ ID NO: 105, 106, and 107, respectively, and a light chain variable region comprising CDR1, CDR2 and CDR3 as set forth in SEQ ID NO: 108, 109, and 110, respectively.
58. The method of claim 57, wherein the receptor occupancy achieved and/or maintained is at least about 85%.
59. The method of claim 57, wherein the receptor occupancy achieved and/or maintained is at least about 90%.
60. The method of claim 57, wherein the receptor occupancy achieved and/or maintained is at least about 95%.
61 . The method of claim 57, wherein the receptor occupancy achieved and/or maintained is at least about 99%.
62. The method of claim 57, wherein the receptor occupancy achieved and/or maintained is about 100%.
63. The method of any one of claims 47-62, wherein the ADC has the structure of formula (III):
or a stereoisomer thereof;
wherein:
X is S or S(O);
L is a linker;
Z is a chemical moiety formed by a coupling reaction between a reactive substituent Z' present on L and a reactive substituent present within the anti-CD117 antibody; and
Ab is the anti-CD117 antibody.
65. The method of claim 64, wherein L comprises one or more moieties selected from a bond, -(C=0)-, a -C(0)NH- group, an -0C(0)NH- group, C1-C6 alkylene, C1-C6 heteroalkylene, C2-C6 alkenylene, C2-C6 heteroalkenylene, C2-C6 alkynylene, C2-C6 heteroalkynylene, C3-C6 cycloalkylene, heterocycloalkylene, arylene, heteroarylene, a - (CH2CH20)p- group where p is an integer from 1-6, a solubility enhancing group, and a peptide; wherein each C1-C6 alkylene, C1-C6 heteroalkylene, C2-C6 alkenylene, C2-C6 heteroalkenylene, C2-C6 alkynylene, C2-C6 heteroalkynylene, C3-C6 cycloalkylene, heterocycloalkylene, arylene, or heteroarylene may optionally be substituted with from 1 to 5 substituents independently selected for each occasion from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, alkaryl, alkyl heteroaryl, amino, ammonium, acyl, acyloxy, acylamino, aminocarbonyl, alkoxycarbonyl, ureido, carbamate, aryl, heteroaryl, sulfinyl, sulfonyl, hydroxyl, alkoxy, sulfanyl, halogen, carboxy, trihalomethyl, cyano, hydroxy, mercapto, and nitro; or each C1-C6 alkylene, C1-C6 heteroalkylene, C2-C6 alkenylene, C2-C6 heteroalkenylene, C2-C6 alkynylene, C2-C6 heteroalkynylene, C3-C6 cycloalkylene, heterocycloalkylene, arylene, or heteroarylene may optionally be interrupted by one or more heteroatoms selected from O, S and N.
69. The method of any one of claims 47-68, further comprising administering a stem cell transplant to the human subject.
70. The method of claim 69, wherein the stem cell transplant comprises HSCs.
71. The method of claim 69, wherein the stem cell transplant consists essentially of
HSCs.
72. The method of claim 70 or 71 , wherein the HSCs are allogeneic.
73. The method of any one of claims 1-72, wherein the human subject has a disorder that would benefit from CD117+ cell depletion.
74. The method of any one of claims 1-72, wherein the human subject is in need of a cell transplant.
75. The method of any one of claims 1-72, wherein the human subject has a stem cell disorder.
76. The method of any one of claims 1-69, wherein the human subject has cancer or an autoimmune disease.
77. The method of claim 76, wherein the cancer is a hematological cancer.
78. The method of claim 77, wherein the hematological cancer is leukemia.
79. The method of claim 78, wherein the leukemia is acute myeloid leukemia.
80. The method of claim 78, wherein the leukemia is acute lymphoblastic leukemia or chronic lymphocytic leukemia.
81. The method of claim 77, wherein the hematological cancer is myelodysplastic syndrome.
82. A method for determining receptor occupancy of a therapeutic anti-CD117 antibody on CD117 expressing cells from a human subject, said method comprising performing a receptor occupancy (RO) assay on a sample from a human subject, and determining the percent receptor occupancy of the therapeutic anti-CD117 antibody on CD117 expressing cells from the sample, wherein the therapeutic anti-CD117 antibody comprises a heavy chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 105, 106, and 107, respectively, and comprises a light chain variable region comprising a CDR1 , CDR2 and CDR3 having an amino acid sequence as set forth as SEQ ID NO: 108, 109, and 110, respectively.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202163223937P | 2021-07-20 | 2021-07-20 | |
US63/223,937 | 2021-07-20 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2023002415A2 true WO2023002415A2 (en) | 2023-01-26 |
WO2023002415A3 WO2023002415A3 (en) | 2023-03-02 |
Family
ID=84978781
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/IB2022/056720 WO2023002415A2 (en) | 2021-07-20 | 2022-07-20 | Methods and compositions for anti-cd117 antibody drug conjugate (adc) treatment |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2023002415A2 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN116482345A (en) * | 2023-06-16 | 2023-07-25 | 军科正源(北京)药物研究有限责任公司 | Method for detecting occupancy of dual-target drug receptor |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP2019515899A (en) * | 2016-04-15 | 2019-06-13 | ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー | Methods of determining and achieving a therapeutically effective dose of an anti-CD47 agent in the treatment of cancer |
TWI788340B (en) * | 2017-04-07 | 2023-01-01 | 美商必治妥美雅史谷比公司 | Anti-icos agonist antibodies and uses thereof |
EP3700568A4 (en) * | 2017-10-24 | 2021-11-10 | Magenta Therapeutics, Inc. | Compositions and methods for the depletion of cd117+ cells |
-
2022
- 2022-07-20 WO PCT/IB2022/056720 patent/WO2023002415A2/en unknown
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN116482345A (en) * | 2023-06-16 | 2023-07-25 | 军科正源(北京)药物研究有限责任公司 | Method for detecting occupancy of dual-target drug receptor |
CN116482345B (en) * | 2023-06-16 | 2023-09-22 | 军科正源(北京)药物研究有限责任公司 | Method for detecting occupancy of dual-target drug receptor |
Also Published As
Publication number | Publication date |
---|---|
WO2023002415A3 (en) | 2023-03-02 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11572411B2 (en) | Anti-CD117 antibodies and conjugates | |
US20200255523A1 (en) | Fc silenced antibody drug conjugates (adcs) and uses thereof | |
US20210371524A1 (en) | Anti-cd45 antibodies and conjugates thereof | |
US20210283267A1 (en) | Therapeutic methods using antibody drug conjugates (adcs) | |
US20210355230A1 (en) | Use of anti-cd5 antibody drug conjugate (adc) in allogeneic cell therapy | |
US20210260212A1 (en) | Use of an anti-cd2 antibody drug conjugate (adc) in allogeneic cell therapy | |
US20240075157A1 (en) | Fc silenced antibody drug conjugates (adcs) and uses thereof | |
US20220267441A1 (en) | Anti-cd45 antibodies and conjugates thereof | |
US20220249683A1 (en) | T-cell depleting therapies | |
WO2023002415A2 (en) | Methods and compositions for anti-cd117 antibody drug conjugate (adc) treatment | |
US20220273811A1 (en) | Methods and compositions for treating autoimmune diseases | |
JPWO2021087368A5 (en) | ||
WO2019173780A2 (en) | Anti-cd252 antibodies, conjugates, and methods of use |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22845542 Country of ref document: EP Kind code of ref document: A2 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |