WO2014055668A1 - Compositions and methods for immunotherapy - Google Patents
Compositions and methods for immunotherapy Download PDFInfo
- Publication number
- WO2014055668A1 WO2014055668A1 PCT/US2013/063097 US2013063097W WO2014055668A1 WO 2014055668 A1 WO2014055668 A1 WO 2014055668A1 US 2013063097 W US2013063097 W US 2013063097W WO 2014055668 A1 WO2014055668 A1 WO 2014055668A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antigen
- cell
- receptor
- immunoresponsive
- tumor
- Prior art date
Links
- 238000000034 method Methods 0.000 title claims abstract description 102
- 239000000203 mixture Substances 0.000 title description 33
- 238000009169 immunotherapy Methods 0.000 title description 6
- 239000000427 antigen Substances 0.000 claims abstract description 254
- 102000036639 antigens Human genes 0.000 claims abstract description 253
- 108091007433 antigens Proteins 0.000 claims abstract description 253
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 251
- 210000004027 cell Anatomy 0.000 claims abstract description 208
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 123
- 108020003175 receptors Proteins 0.000 claims abstract description 103
- 230000009826 neoplastic cell growth Effects 0.000 claims abstract description 49
- 238000011282 treatment Methods 0.000 claims abstract description 34
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 claims abstract description 22
- 210000003289 regulatory T cell Anatomy 0.000 claims abstract description 3
- 102000005962 receptors Human genes 0.000 claims description 102
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims description 82
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 claims description 77
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 claims description 77
- 102100036735 Prostate stem cell antigen Human genes 0.000 claims description 60
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 claims description 49
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 claims description 49
- 150000007523 nucleic acids Chemical group 0.000 claims description 34
- 241000701022 Cytomegalovirus Species 0.000 claims description 32
- 230000014509 gene expression Effects 0.000 claims description 32
- -1 EGP-40 Proteins 0.000 claims description 31
- 239000013598 vector Substances 0.000 claims description 26
- 108091008874 T cell receptors Proteins 0.000 claims description 23
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 claims description 23
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 22
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 22
- 239000003446 ligand Substances 0.000 claims description 21
- 210000004881 tumor cell Anatomy 0.000 claims description 21
- 206010060862 Prostate cancer Diseases 0.000 claims description 19
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 19
- 244000052769 pathogen Species 0.000 claims description 17
- 230000001717 pathogenic effect Effects 0.000 claims description 17
- 101000610551 Homo sapiens Prominin-1 Proteins 0.000 claims description 16
- 102100040120 Prominin-1 Human genes 0.000 claims description 16
- 230000011664 signaling Effects 0.000 claims description 15
- 102100032912 CD44 antigen Human genes 0.000 claims description 14
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 claims description 14
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 claims description 14
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 claims description 14
- 230000004068 intracellular signaling Effects 0.000 claims description 13
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 claims description 13
- 230000004936 stimulating effect Effects 0.000 claims description 13
- 230000003612 virological effect Effects 0.000 claims description 13
- 102000003735 Mesothelin Human genes 0.000 claims description 12
- 108090000015 Mesothelin Proteins 0.000 claims description 12
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 claims description 12
- 208000026310 Breast neoplasm Diseases 0.000 claims description 11
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 claims description 11
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 claims description 11
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 claims description 11
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 claims description 11
- 230000001939 inductive effect Effects 0.000 claims description 11
- 210000004698 lymphocyte Anatomy 0.000 claims description 11
- 206010006187 Breast cancer Diseases 0.000 claims description 10
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 claims description 10
- 102100034256 Mucin-1 Human genes 0.000 claims description 10
- 101000994365 Homo sapiens Integrin alpha-6 Proteins 0.000 claims description 9
- 102100032816 Integrin alpha-6 Human genes 0.000 claims description 9
- 206010033128 Ovarian cancer Diseases 0.000 claims description 9
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 9
- 229940014144 folate Drugs 0.000 claims description 9
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 claims description 9
- 235000019152 folic acid Nutrition 0.000 claims description 9
- 239000011724 folic acid Substances 0.000 claims description 9
- 102000006306 Antigen Receptors Human genes 0.000 claims description 8
- 108010083359 Antigen Receptors Proteins 0.000 claims description 8
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 claims description 8
- 101000874179 Homo sapiens Syndecan-1 Proteins 0.000 claims description 8
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 claims description 8
- 102100035721 Syndecan-1 Human genes 0.000 claims description 8
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 claims description 8
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 7
- 230000001105 regulatory effect Effects 0.000 claims description 7
- 102100032937 CD40 ligand Human genes 0.000 claims description 6
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 claims description 6
- 102000003729 Neprilysin Human genes 0.000 claims description 6
- 108090000028 Neprilysin Proteins 0.000 claims description 6
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 6
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 claims description 6
- 230000001605 fetal effect Effects 0.000 claims description 6
- 238000004519 manufacturing process Methods 0.000 claims description 6
- 239000008194 pharmaceutical composition Substances 0.000 claims description 6
- 108700012439 CA9 Proteins 0.000 claims description 5
- 102100024423 Carbonic anhydrase 9 Human genes 0.000 claims description 5
- 208000034578 Multiple myelomas Diseases 0.000 claims description 5
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 claims description 4
- 102100038080 B-cell receptor CD22 Human genes 0.000 claims description 4
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 claims description 4
- 108010009685 Cholinergic Receptors Proteins 0.000 claims description 4
- 102100030595 HLA class II histocompatibility antigen gamma chain Human genes 0.000 claims description 4
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 claims description 4
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 claims description 4
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 claims description 4
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 claims description 4
- 101000868215 Homo sapiens CD40 ligand Proteins 0.000 claims description 4
- 101001082627 Homo sapiens HLA class II histocompatibility antigen gamma chain Proteins 0.000 claims description 4
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 claims description 4
- 101001078143 Homo sapiens Integrin alpha-IIb Proteins 0.000 claims description 4
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 claims description 4
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 claims description 4
- 102100025306 Integrin alpha-IIb Human genes 0.000 claims description 4
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 claims description 4
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 claims description 4
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 claims description 4
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 claims description 4
- 102000034337 acetylcholine receptors Human genes 0.000 claims description 4
- 230000030833 cell death Effects 0.000 claims description 4
- 230000034994 death Effects 0.000 claims description 4
- 231100000517 death Toxicity 0.000 claims description 4
- 208000032839 leukemia Diseases 0.000 claims description 4
- 102100026423 Adhesion G protein-coupled receptor E5 Human genes 0.000 claims description 3
- 208000004736 B-Cell Leukemia Diseases 0.000 claims description 3
- 102100027207 CD27 antigen Human genes 0.000 claims description 3
- 102000016289 Cell Adhesion Molecules Human genes 0.000 claims description 3
- 108010067225 Cell Adhesion Molecules Proteins 0.000 claims description 3
- 101000718243 Homo sapiens Adhesion G protein-coupled receptor E5 Proteins 0.000 claims description 3
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 claims description 3
- 101001103039 Homo sapiens Inactive tyrosine-protein kinase transmembrane receptor ROR1 Proteins 0.000 claims description 3
- 101001103036 Homo sapiens Nuclear receptor ROR-alpha Proteins 0.000 claims description 3
- 101000914496 Homo sapiens T-cell antigen CD7 Proteins 0.000 claims description 3
- 102100039615 Inactive tyrosine-protein kinase transmembrane receptor ROR1 Human genes 0.000 claims description 3
- 102100027208 T-cell antigen CD7 Human genes 0.000 claims description 3
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 3
- 101001136592 Homo sapiens Prostate stem cell antigen Proteins 0.000 claims 7
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 claims 4
- 102100031940 Epithelial cell adhesion molecule Human genes 0.000 claims 4
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 claims 4
- 101000920667 Homo sapiens Epithelial cell adhesion molecule Proteins 0.000 claims 4
- 102100022019 Pregnancy-specific beta-1-glycoprotein 2 Human genes 0.000 claims 4
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 claims 3
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 claims 3
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 claims 3
- 101150047061 tag-72 gene Proteins 0.000 claims 2
- 210000001671 embryonic stem cell Anatomy 0.000 claims 1
- 108091008034 costimulatory receptors Proteins 0.000 abstract description 43
- 230000028993 immune response Effects 0.000 abstract description 15
- 230000007170 pathology Effects 0.000 abstract description 4
- 101710120463 Prostate stem cell antigen Proteins 0.000 description 53
- 108090000765 processed proteins & peptides Proteins 0.000 description 43
- 102000004196 processed proteins & peptides Human genes 0.000 description 39
- 229920001184 polypeptide Polymers 0.000 description 38
- 241000699670 Mus sp. Species 0.000 description 34
- 108090000623 proteins and genes Proteins 0.000 description 31
- 102000039446 nucleic acids Human genes 0.000 description 28
- 108020004707 nucleic acids Proteins 0.000 description 28
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 26
- 102000004169 proteins and genes Human genes 0.000 description 26
- 235000018102 proteins Nutrition 0.000 description 25
- 230000004913 activation Effects 0.000 description 23
- 208000015181 infectious disease Diseases 0.000 description 22
- 230000008029 eradication Effects 0.000 description 19
- 210000001519 tissue Anatomy 0.000 description 19
- 201000010099 disease Diseases 0.000 description 18
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 17
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 17
- 230000000694 effects Effects 0.000 description 17
- 239000012634 fragment Substances 0.000 description 17
- 102000004127 Cytokines Human genes 0.000 description 16
- 108090000695 Cytokines Proteins 0.000 description 16
- 201000011510 cancer Diseases 0.000 description 16
- 241000700605 Viruses Species 0.000 description 15
- 230000008685 targeting Effects 0.000 description 15
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 14
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 14
- 238000013459 approach Methods 0.000 description 14
- 150000001413 amino acids Chemical group 0.000 description 13
- 230000001404 mediated effect Effects 0.000 description 13
- 238000003556 assay Methods 0.000 description 11
- 238000002474 experimental method Methods 0.000 description 11
- 108091033319 polynucleotide Proteins 0.000 description 11
- 102000040430 polynucleotide Human genes 0.000 description 11
- 239000002157 polynucleotide Substances 0.000 description 11
- 230000035755 proliferation Effects 0.000 description 11
- 230000001177 retroviral effect Effects 0.000 description 11
- 239000001509 sodium citrate Substances 0.000 description 11
- 230000001225 therapeutic effect Effects 0.000 description 11
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 11
- 229940038773 trisodium citrate Drugs 0.000 description 11
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 10
- 230000003213 activating effect Effects 0.000 description 10
- 235000001014 amino acid Nutrition 0.000 description 10
- 229940024606 amino acid Drugs 0.000 description 10
- 230000009885 systemic effect Effects 0.000 description 10
- 238000010361 transduction Methods 0.000 description 10
- 230000026683 transduction Effects 0.000 description 10
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 9
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 9
- 230000001154 acute effect Effects 0.000 description 9
- 230000007774 longterm Effects 0.000 description 9
- 230000009257 reactivity Effects 0.000 description 9
- 238000011160 research Methods 0.000 description 9
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 8
- 210000004369 blood Anatomy 0.000 description 8
- 239000008280 blood Substances 0.000 description 8
- 239000003795 chemical substances by application Substances 0.000 description 8
- 230000004940 costimulation Effects 0.000 description 8
- 208000035475 disorder Diseases 0.000 description 8
- 238000009396 hybridization Methods 0.000 description 8
- 210000000822 natural killer cell Anatomy 0.000 description 8
- 210000000056 organ Anatomy 0.000 description 8
- 238000002560 therapeutic procedure Methods 0.000 description 8
- 201000009030 Carcinoma Diseases 0.000 description 7
- 230000006044 T cell activation Effects 0.000 description 7
- 208000009956 adenocarcinoma Diseases 0.000 description 7
- 230000000735 allogeneic effect Effects 0.000 description 7
- 238000001415 gene therapy Methods 0.000 description 7
- 238000001727 in vivo Methods 0.000 description 7
- 239000007788 liquid Substances 0.000 description 7
- 230000002265 prevention Effects 0.000 description 7
- 208000023958 prostate neoplasm Diseases 0.000 description 7
- 230000004044 response Effects 0.000 description 7
- 230000000638 stimulation Effects 0.000 description 7
- 206010061598 Immunodeficiency Diseases 0.000 description 6
- 108060003951 Immunoglobulin Proteins 0.000 description 6
- 206010027476 Metastases Diseases 0.000 description 6
- 102000004473 OX40 Ligand Human genes 0.000 description 6
- 108010042215 OX40 Ligand Proteins 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 6
- 102100022748 Wilms tumor protein Human genes 0.000 description 6
- 239000000654 additive Substances 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 108700010039 chimeric receptor Proteins 0.000 description 6
- 230000003247 decreasing effect Effects 0.000 description 6
- 230000009977 dual effect Effects 0.000 description 6
- 239000005090 green fluorescent protein Substances 0.000 description 6
- 102000018358 immunoglobulin Human genes 0.000 description 6
- 238000000338 in vitro Methods 0.000 description 6
- 230000001965 increasing effect Effects 0.000 description 6
- 238000004020 luminiscence type Methods 0.000 description 6
- 230000004048 modification Effects 0.000 description 6
- 238000012986 modification Methods 0.000 description 6
- 238000000926 separation method Methods 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 238000005406 washing Methods 0.000 description 6
- 108010022366 Carcinoembryonic Antigen Proteins 0.000 description 5
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 5
- 208000035473 Communicable disease Diseases 0.000 description 5
- 108020004414 DNA Proteins 0.000 description 5
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 5
- 241000725303 Human immunodeficiency virus Species 0.000 description 5
- 108010002350 Interleukin-2 Proteins 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 108091006629 SLC13A2 Proteins 0.000 description 5
- 230000009089 cytolysis Effects 0.000 description 5
- 230000004069 differentiation Effects 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 210000002865 immune cell Anatomy 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 201000001441 melanoma Diseases 0.000 description 5
- 238000012552 review Methods 0.000 description 5
- 230000009385 viral infection Effects 0.000 description 5
- 239000013603 viral vector Substances 0.000 description 5
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 4
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 4
- 206010039491 Sarcoma Diseases 0.000 description 4
- 230000006052 T cell proliferation Effects 0.000 description 4
- 208000036142 Viral infection Diseases 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 229910052804 chromium Inorganic materials 0.000 description 4
- 239000011651 chromium Substances 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 231100000433 cytotoxic Toxicity 0.000 description 4
- 239000003814 drug Substances 0.000 description 4
- 239000012636 effector Substances 0.000 description 4
- 239000003623 enhancer Substances 0.000 description 4
- 239000000499 gel Substances 0.000 description 4
- 208000026278 immune system disease Diseases 0.000 description 4
- 238000010369 molecular cloning Methods 0.000 description 4
- 230000001575 pathological effect Effects 0.000 description 4
- 210000005259 peripheral blood Anatomy 0.000 description 4
- 239000011886 peripheral blood Substances 0.000 description 4
- 230000002093 peripheral effect Effects 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 210000002307 prostate Anatomy 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 150000003839 salts Chemical class 0.000 description 4
- 230000028327 secretion Effects 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 210000000130 stem cell Anatomy 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- 210000001541 thymus gland Anatomy 0.000 description 4
- 238000012546 transfer Methods 0.000 description 4
- 238000001262 western blot Methods 0.000 description 4
- 208000023275 Autoimmune disease Diseases 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 3
- 206010009944 Colon cancer Diseases 0.000 description 3
- 206010014967 Ependymoma Diseases 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 101000655352 Homo sapiens Telomerase reverse transcriptase Proteins 0.000 description 3
- 206010025323 Lymphomas Diseases 0.000 description 3
- 206010029260 Neuroblastoma Diseases 0.000 description 3
- 241000194017 Streptococcus Species 0.000 description 3
- 102100036922 Tumor necrosis factor ligand superfamily member 13B Human genes 0.000 description 3
- 230000004075 alteration Effects 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 230000006023 anti-tumor response Effects 0.000 description 3
- 230000000890 antigenic effect Effects 0.000 description 3
- 210000003719 b-lymphocyte Anatomy 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 230000033228 biological regulation Effects 0.000 description 3
- 230000006037 cell lysis Effects 0.000 description 3
- 230000001684 chronic effect Effects 0.000 description 3
- 238000003501 co-culture Methods 0.000 description 3
- 230000001086 cytosolic effect Effects 0.000 description 3
- 230000001472 cytotoxic effect Effects 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 3
- 238000012239 gene modification Methods 0.000 description 3
- 230000005017 genetic modification Effects 0.000 description 3
- 235000013617 genetically modified food Nutrition 0.000 description 3
- 230000003394 haemopoietic effect Effects 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 230000006698 induction Effects 0.000 description 3
- 238000001802 infusion Methods 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 210000000265 leukocyte Anatomy 0.000 description 3
- 210000001165 lymph node Anatomy 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 208000010658 metastatic prostate carcinoma Diseases 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 230000026731 phosphorylation Effects 0.000 description 3
- 238000006366 phosphorylation reaction Methods 0.000 description 3
- 210000003705 ribosome Anatomy 0.000 description 3
- 239000000523 sample Substances 0.000 description 3
- 206010041823 squamous cell carcinoma Diseases 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 238000006467 substitution reaction Methods 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 239000002562 thickening agent Substances 0.000 description 3
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 description 3
- 241000712461 unidentified influenza virus Species 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- 201000003076 Angiosarcoma Diseases 0.000 description 2
- 206010003571 Astrocytoma Diseases 0.000 description 2
- 206010004146 Basal cell carcinoma Diseases 0.000 description 2
- 102100023995 Beta-nerve growth factor Human genes 0.000 description 2
- 206010005003 Bladder cancer Diseases 0.000 description 2
- 108010029697 CD40 Ligand Proteins 0.000 description 2
- 102100025221 CD70 antigen Human genes 0.000 description 2
- 101710098119 Chaperonin GroEL 2 Proteins 0.000 description 2
- 208000005243 Chondrosarcoma Diseases 0.000 description 2
- 201000009047 Chordoma Diseases 0.000 description 2
- 208000006332 Choriocarcinoma Diseases 0.000 description 2
- 208000009798 Craniopharyngioma Diseases 0.000 description 2
- 206010061818 Disease progression Diseases 0.000 description 2
- 201000009051 Embryonal Carcinoma Diseases 0.000 description 2
- 241000709661 Enterovirus Species 0.000 description 2
- 101710181478 Envelope glycoprotein GP350 Proteins 0.000 description 2
- 208000006168 Ewing Sarcoma Diseases 0.000 description 2
- 201000008808 Fibrosarcoma Diseases 0.000 description 2
- 208000032612 Glial tumor Diseases 0.000 description 2
- 206010018338 Glioma Diseases 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 208000001258 Hemangiosarcoma Diseases 0.000 description 2
- 241000700721 Hepatitis B virus Species 0.000 description 2
- 208000017604 Hodgkin disease Diseases 0.000 description 2
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 108010063738 Interleukins Proteins 0.000 description 2
- 102000015696 Interleukins Human genes 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 208000018142 Leiomyosarcoma Diseases 0.000 description 2
- 108060001084 Luciferase Proteins 0.000 description 2
- 239000005089 Luciferase Substances 0.000 description 2
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 2
- 208000007054 Medullary Carcinoma Diseases 0.000 description 2
- 206010027406 Mesothelioma Diseases 0.000 description 2
- 108010025020 Nerve Growth Factor Proteins 0.000 description 2
- 101710163270 Nuclease Proteins 0.000 description 2
- 201000010133 Oligodendroglioma Diseases 0.000 description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 208000007641 Pinealoma Diseases 0.000 description 2
- 208000007452 Plasmacytoma Diseases 0.000 description 2
- 108020005067 RNA Splice Sites Proteins 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 201000000582 Retinoblastoma Diseases 0.000 description 2
- 201000010208 Seminoma Diseases 0.000 description 2
- 230000024932 T cell mediated immunity Effects 0.000 description 2
- 230000005867 T cell response Effects 0.000 description 2
- 208000024313 Testicular Neoplasms Diseases 0.000 description 2
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 2
- 102100032100 Tumor necrosis factor ligand superfamily member 8 Human genes 0.000 description 2
- 241000700618 Vaccinia virus Species 0.000 description 2
- 208000014070 Vestibular schwannoma Diseases 0.000 description 2
- 208000008383 Wilms tumor Diseases 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 208000004064 acoustic neuroma Diseases 0.000 description 2
- SRHNADOZAAWYLV-XLMUYGLTSA-N alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc Chemical compound O[C@H]1[C@H](O)[C@H](O)[C@H](C)O[C@H]1O[C@H]1[C@H](O[C@H]2[C@@H]([C@@H](NC(C)=O)[C@H](O)O[C@@H]2CO)O[C@H]2[C@H]([C@H](O)[C@H](O)[C@H](C)O2)O)O[C@H](CO)[C@H](O)[C@@H]1O SRHNADOZAAWYLV-XLMUYGLTSA-N 0.000 description 2
- 230000002424 anti-apoptotic effect Effects 0.000 description 2
- 230000003190 augmentative effect Effects 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 229940098773 bovine serum albumin Drugs 0.000 description 2
- 210000000481 breast Anatomy 0.000 description 2
- 208000003362 bronchogenic carcinoma Diseases 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000009109 curative therapy Methods 0.000 description 2
- 208000002445 cystadenocarcinoma Diseases 0.000 description 2
- 230000001461 cytolytic effect Effects 0.000 description 2
- 231100000599 cytotoxic agent Toxicity 0.000 description 2
- 230000003013 cytotoxicity Effects 0.000 description 2
- 231100000135 cytotoxicity Toxicity 0.000 description 2
- 238000002784 cytotoxicity assay Methods 0.000 description 2
- 231100000263 cytotoxicity test Toxicity 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 239000008121 dextrose Substances 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 230000005750 disease progression Effects 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- 230000005714 functional activity Effects 0.000 description 2
- 208000005017 glioblastoma Diseases 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 208000025750 heavy chain disease Diseases 0.000 description 2
- 201000002222 hemangioblastoma Diseases 0.000 description 2
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 2
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 229940047122 interleukins Drugs 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 230000009545 invasion Effects 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 231100000636 lethal dose Toxicity 0.000 description 2
- 206010024627 liposarcoma Diseases 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 201000005202 lung cancer Diseases 0.000 description 2
- 201000005296 lung carcinoma Diseases 0.000 description 2
- 208000020816 lung neoplasm Diseases 0.000 description 2
- 230000000527 lymphocytic effect Effects 0.000 description 2
- 230000036210 malignancy Effects 0.000 description 2
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 2
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 2
- 206010027191 meningioma Diseases 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 230000005012 migration Effects 0.000 description 2
- 238000013508 migration Methods 0.000 description 2
- 238000009126 molecular therapy Methods 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 208000001611 myxosarcoma Diseases 0.000 description 2
- 229940053128 nerve growth factor Drugs 0.000 description 2
- 201000008968 osteosarcoma Diseases 0.000 description 2
- 201000002528 pancreatic cancer Diseases 0.000 description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 description 2
- 201000010198 papillary carcinoma Diseases 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 208000024724 pineal body neoplasm Diseases 0.000 description 2
- 201000004123 pineal gland cancer Diseases 0.000 description 2
- 238000003752 polymerase chain reaction Methods 0.000 description 2
- 230000004481 post-translational protein modification Effects 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 2
- 230000020978 protein processing Effects 0.000 description 2
- 230000005855 radiation Effects 0.000 description 2
- 238000001959 radiotherapy Methods 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 201000010965 sweat gland carcinoma Diseases 0.000 description 2
- 206010042863 synovial sarcoma Diseases 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 201000003120 testicular cancer Diseases 0.000 description 2
- 230000002463 transducing effect Effects 0.000 description 2
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 241001529453 unidentified herpesvirus Species 0.000 description 2
- 238000011870 unpaired t-test Methods 0.000 description 2
- 210000000626 ureter Anatomy 0.000 description 2
- 210000003708 urethra Anatomy 0.000 description 2
- 210000003932 urinary bladder Anatomy 0.000 description 2
- 206010046766 uterine cancer Diseases 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 230000003442 weekly effect Effects 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- BFSVOASYOCHEOV-UHFFFAOYSA-N 2-diethylaminoethanol Chemical compound CCN(CC)CCO BFSVOASYOCHEOV-UHFFFAOYSA-N 0.000 description 1
- NIXOWILDQLNWCW-UHFFFAOYSA-N Acrylic acid Chemical compound OC(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 description 1
- 241000186041 Actinomyces israelii Species 0.000 description 1
- 102000005869 Activating Transcription Factors Human genes 0.000 description 1
- 108010005254 Activating Transcription Factors Proteins 0.000 description 1
- 206010000830 Acute leukaemia Diseases 0.000 description 1
- 206010048998 Acute phase reaction Diseases 0.000 description 1
- 208000010507 Adenocarcinoma of Lung Diseases 0.000 description 1
- 241000701242 Adenoviridae Species 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 241000701386 African swine fever virus Species 0.000 description 1
- 241000712892 Arenaviridae Species 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 108010028006 B-Cell Activating Factor Proteins 0.000 description 1
- 208000003950 B-cell lymphoma Diseases 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 241001148536 Bacteroides sp. Species 0.000 description 1
- 206010004593 Bile duct cancer Diseases 0.000 description 1
- 241000701822 Bovine papillomavirus Species 0.000 description 1
- 108700031361 Brachyury Proteins 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 108010046080 CD27 Ligand Proteins 0.000 description 1
- 241001286462 Caio Species 0.000 description 1
- 108090000565 Capsid Proteins Proteins 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 102100023321 Ceruloplasmin Human genes 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 241000193403 Clostridium Species 0.000 description 1
- 241000193449 Clostridium tetani Species 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 102000007644 Colony-Stimulating Factors Human genes 0.000 description 1
- 108010071942 Colony-Stimulating Factors Proteins 0.000 description 1
- 241000186227 Corynebacterium diphtheriae Species 0.000 description 1
- 241000186249 Corynebacterium sp. Species 0.000 description 1
- 241000709687 Coxsackievirus Species 0.000 description 1
- 241000252233 Cyprinus carpio Species 0.000 description 1
- 150000008574 D-amino acids Chemical class 0.000 description 1
- 206010011968 Decreased immune responsiveness Diseases 0.000 description 1
- 241000710829 Dengue virus group Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 241000006271 Discosoma sp. Species 0.000 description 1
- 241001115402 Ebolavirus Species 0.000 description 1
- 241001466953 Echovirus Species 0.000 description 1
- 241000194033 Enterococcus Species 0.000 description 1
- 241000194032 Enterococcus faecalis Species 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 208000000832 Equine Encephalomyelitis Diseases 0.000 description 1
- 241000186810 Erysipelothrix rhusiopathiae Species 0.000 description 1
- 102000003951 Erythropoietin Human genes 0.000 description 1
- 108090000394 Erythropoietin Proteins 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 102000015212 Fas Ligand Protein Human genes 0.000 description 1
- 108010039471 Fas Ligand Protein Proteins 0.000 description 1
- 241000711950 Filoviridae Species 0.000 description 1
- 206010017533 Fungal infection Diseases 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 241000605986 Fusobacterium nucleatum Species 0.000 description 1
- 208000005577 Gastroenteritis Diseases 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 208000034826 Genetic Predisposition to Disease Diseases 0.000 description 1
- 241000713813 Gibbon ape leukemia virus Species 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 241000856850 Goose coronavirus Species 0.000 description 1
- 241001506229 Goose reovirus Species 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 1
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 1
- 241000606768 Haemophilus influenzae Species 0.000 description 1
- 206010061192 Haemorrhagic fever Diseases 0.000 description 1
- 241000150562 Hantaan orthohantavirus Species 0.000 description 1
- 241000590002 Helicobacter pylori Species 0.000 description 1
- 241000700739 Hepadnaviridae Species 0.000 description 1
- 208000005176 Hepatitis C Diseases 0.000 description 1
- 208000005331 Hepatitis D Diseases 0.000 description 1
- 241000709721 Hepatovirus A Species 0.000 description 1
- 241000700586 Herpesviridae Species 0.000 description 1
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 1
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 1
- 101100207070 Homo sapiens TNFSF8 gene Proteins 0.000 description 1
- 101000638251 Homo sapiens Tumor necrosis factor ligand superfamily member 9 Proteins 0.000 description 1
- 241000701085 Human alphaherpesvirus 3 Species 0.000 description 1
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 1
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 1
- 208000029462 Immunodeficiency disease Diseases 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- 102000003812 Interleukin-15 Human genes 0.000 description 1
- 102100030704 Interleukin-21 Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 208000005016 Intestinal Neoplasms Diseases 0.000 description 1
- 241000701377 Iridoviridae Species 0.000 description 1
- 241000588915 Klebsiella aerogenes Species 0.000 description 1
- 241000588747 Klebsiella pneumoniae Species 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 150000008575 L-amino acids Chemical class 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 241000589248 Legionella Species 0.000 description 1
- 208000007764 Legionnaires' Disease Diseases 0.000 description 1
- 241000589902 Leptospira Species 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- 102000004083 Lymphotoxin-alpha Human genes 0.000 description 1
- 108090000542 Lymphotoxin-alpha Proteins 0.000 description 1
- 102000003959 Lymphotoxin-beta Human genes 0.000 description 1
- 108090000362 Lymphotoxin-beta Proteins 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 241000712079 Measles morbillivirus Species 0.000 description 1
- 206010027457 Metastases to liver Diseases 0.000 description 1
- 108010008707 Mucin-1 Proteins 0.000 description 1
- 102000007298 Mucin-1 Human genes 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 101100207071 Mus musculus Tnfsf8 gene Proteins 0.000 description 1
- 241000186367 Mycobacterium avium Species 0.000 description 1
- 241000187484 Mycobacterium gordonae Species 0.000 description 1
- 241000186363 Mycobacterium kansasii Species 0.000 description 1
- 208000031888 Mycoses Diseases 0.000 description 1
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 1
- 241000588650 Neisseria meningitidis Species 0.000 description 1
- 206010061309 Neoplasm progression Diseases 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 208000001388 Opportunistic Infections Diseases 0.000 description 1
- 241000712464 Orthomyxoviridae Species 0.000 description 1
- 241000150218 Orthonairovirus Species 0.000 description 1
- 101710160107 Outer membrane protein A Proteins 0.000 description 1
- 208000007571 Ovarian Epithelial Carcinoma Diseases 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 241000711504 Paramyxoviridae Species 0.000 description 1
- 208000002606 Paramyxoviridae Infections Diseases 0.000 description 1
- 208000030852 Parasitic disease Diseases 0.000 description 1
- 241000606860 Pasteurella Species 0.000 description 1
- 102000002508 Peptide Elongation Factors Human genes 0.000 description 1
- 108010068204 Peptide Elongation Factors Proteins 0.000 description 1
- 102000003993 Phosphatidylinositol 3-kinases Human genes 0.000 description 1
- 108090000430 Phosphatidylinositol 3-kinases Proteins 0.000 description 1
- 108010047620 Phytohemagglutinins Proteins 0.000 description 1
- 241000709664 Picornaviridae Species 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 241001505332 Polyomavirus sp. Species 0.000 description 1
- 241000700625 Poxviridae Species 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 241000711798 Rabies lyssavirus Species 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 241000702247 Reoviridae Species 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- 241000712907 Retroviridae Species 0.000 description 1
- 241000711931 Rhabdoviridae Species 0.000 description 1
- 241000606701 Rickettsia Species 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 241000702670 Rotavirus Species 0.000 description 1
- 241000710799 Rubella virus Species 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 1
- 229920002125 Sokalan® Polymers 0.000 description 1
- 241000295644 Staphylococcaceae Species 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 241001478880 Streptobacillus moniliformis Species 0.000 description 1
- 241000193985 Streptococcus agalactiae Species 0.000 description 1
- 241000194049 Streptococcus equinus Species 0.000 description 1
- 241000193998 Streptococcus pneumoniae Species 0.000 description 1
- 241000193996 Streptococcus pyogenes Species 0.000 description 1
- 241001505901 Streptococcus sp. 'group A' Species 0.000 description 1
- 241000193990 Streptococcus sp. 'group B' Species 0.000 description 1
- 206010042971 T-cell lymphoma Diseases 0.000 description 1
- 101000588258 Taenia solium Paramyosin Proteins 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 206010043515 Throat cancer Diseases 0.000 description 1
- 241000710924 Togaviridae Species 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 101800000385 Transmembrane protein Proteins 0.000 description 1
- 102000008579 Transposases Human genes 0.000 description 1
- 108010020764 Transposases Proteins 0.000 description 1
- 241000589886 Treponema Species 0.000 description 1
- 241000589904 Treponema pallidum subsp. pertenue Species 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 108010065158 Tumor Necrosis Factor Ligand Superfamily Member 14 Proteins 0.000 description 1
- 102100024586 Tumor necrosis factor ligand superfamily member 14 Human genes 0.000 description 1
- 102100026890 Tumor necrosis factor ligand superfamily member 4 Human genes 0.000 description 1
- 102100032101 Tumor necrosis factor ligand superfamily member 9 Human genes 0.000 description 1
- 108091005956 Type II transmembrane proteins Proteins 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 241000700647 Variola virus Species 0.000 description 1
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 241000711975 Vesicular stomatitis virus Species 0.000 description 1
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 1
- 101710127857 Wilms tumor protein Proteins 0.000 description 1
- 241000120645 Yellow fever virus group Species 0.000 description 1
- 108010017070 Zinc Finger Nucleases Proteins 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 239000002253 acid Chemical group 0.000 description 1
- 208000017733 acquired polycythemia vera Diseases 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 210000005006 adaptive immune system Anatomy 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 108700010877 adenoviridae proteins Proteins 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 238000011316 allogeneic transplantation Methods 0.000 description 1
- 239000003708 ampul Substances 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- 230000000118 anti-neoplastic effect Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 210000000612 antigen-presenting cell Anatomy 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 238000000149 argon plasma sintering Methods 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 210000001130 astrocyte Anatomy 0.000 description 1
- 244000309743 astrovirus Species 0.000 description 1
- 230000005784 autoimmunity Effects 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 201000007180 bile duct carcinoma Diseases 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000008033 biological extinction Effects 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 201000001531 bladder carcinoma Diseases 0.000 description 1
- 201000006598 bladder squamous cell carcinoma Diseases 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- KGBXLFKZBHKPEV-UHFFFAOYSA-N boric acid Chemical compound OB(O)O KGBXLFKZBHKPEV-UHFFFAOYSA-N 0.000 description 1
- 239000004327 boric acid Substances 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 201000010983 breast ductal carcinoma Diseases 0.000 description 1
- 201000003714 breast lobular carcinoma Diseases 0.000 description 1
- 238000009395 breeding Methods 0.000 description 1
- 230000001488 breeding effect Effects 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 229960001631 carbomer Drugs 0.000 description 1
- 125000004432 carbon atom Chemical group C* 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 229940105329 carboxymethylcellulose Drugs 0.000 description 1
- 210000000845 cartilage Anatomy 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000002771 cell marker Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 238000002659 cell therapy Methods 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- 210000003679 cervix uteri Anatomy 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000009614 chemical analysis method Methods 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 239000012707 chemical precursor Substances 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 210000000038 chest Anatomy 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 208000006990 cholangiocarcinoma Diseases 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 208000024207 chronic leukemia Diseases 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 229940047120 colony stimulating factors Drugs 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000002591 computed tomography Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 230000000139 costimulatory effect Effects 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 230000016396 cytokine production Effects 0.000 description 1
- 206010052015 cytokine release syndrome Diseases 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 239000002254 cytotoxic agent Substances 0.000 description 1
- 230000007402 cytotoxic response Effects 0.000 description 1
- 239000002619 cytotoxin Substances 0.000 description 1
- 230000005860 defense response to virus Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000000432 density-gradient centrifugation Methods 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 230000006866 deterioration Effects 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 206010014599 encephalitis Diseases 0.000 description 1
- 239000012645 endogenous antigen Substances 0.000 description 1
- 229940092559 enterobacter aerogenes Drugs 0.000 description 1
- 208000037828 epithelial carcinoma Diseases 0.000 description 1
- 230000000925 erythroid effect Effects 0.000 description 1
- 229940105423 erythropoietin Drugs 0.000 description 1
- 210000003238 esophagus Anatomy 0.000 description 1
- 201000007280 estrogen-receptor negative breast cancer Diseases 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 210000004700 fetal blood Anatomy 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 239000011888 foil Substances 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 238000002825 functional assay Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 230000005021 gait Effects 0.000 description 1
- 210000000232 gallbladder Anatomy 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 229940047650 haemophilus influenzae Drugs 0.000 description 1
- 210000002216 heart Anatomy 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 208000029570 hepatitis D virus infection Diseases 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 230000003118 histopathologic effect Effects 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 238000001794 hormone therapy Methods 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 1
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 1
- 229940071676 hydroxypropylcellulose Drugs 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000008004 immune attack Effects 0.000 description 1
- 230000006058 immune tolerance Effects 0.000 description 1
- 230000007813 immunodeficiency Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000011221 initial treatment Methods 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 230000018711 interleukin-13 production Effects 0.000 description 1
- 230000004073 interleukin-2 production Effects 0.000 description 1
- 108010074108 interleukin-21 Proteins 0.000 description 1
- 201000002313 intestinal cancer Diseases 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 201000010985 invasive ductal carcinoma Diseases 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 210000000244 kidney pelvis Anatomy 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 230000021633 leukocyte mediated immunity Effects 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000008297 liquid dosage form Substances 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 208000037829 lymphangioendotheliosarcoma Diseases 0.000 description 1
- 208000012804 lymphangiosarcoma Diseases 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 238000007885 magnetic separation Methods 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 210000000110 microvilli Anatomy 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 230000000116 mitigating effect Effects 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 210000001167 myeloblast Anatomy 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 208000025189 neoplasm of testis Diseases 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 208000007538 neurilemmoma Diseases 0.000 description 1
- 210000004498 neuroglial cell Anatomy 0.000 description 1
- 210000004882 non-tumor cell Anatomy 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 210000003101 oviduct Anatomy 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 238000002559 palpation Methods 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 201000008129 pancreatic ductal adenocarcinoma Diseases 0.000 description 1
- 238000004091 panning Methods 0.000 description 1
- 208000004019 papillary adenocarcinoma Diseases 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 230000036281 parasite infection Effects 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000010412 perfusion Effects 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 230000001885 phytohemagglutinin Effects 0.000 description 1
- 210000004180 plasmocyte Anatomy 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 208000037244 polycythemia vera Diseases 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000002250 progressing effect Effects 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000009696 proliferative response Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 229940021993 prophylactic vaccine Drugs 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 201000005825 prostate adenocarcinoma Diseases 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 210000000512 proximal kidney tubule Anatomy 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 108010054624 red fluorescent protein Proteins 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 238000002271 resection Methods 0.000 description 1
- 108010056030 retronectin Proteins 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 206010039667 schwannoma Diseases 0.000 description 1
- 201000008407 sebaceous adenocarcinoma Diseases 0.000 description 1
- 238000010187 selection method Methods 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 210000002027 skeletal muscle Anatomy 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- HELHAJAZNSDZJO-OLXYHTOASA-L sodium L-tartrate Chemical compound [Na+].[Na+].[O-]C(=O)[C@H](O)[C@@H](O)C([O-])=O HELHAJAZNSDZJO-OLXYHTOASA-L 0.000 description 1
- 229910001415 sodium ion Inorganic materials 0.000 description 1
- 239000001433 sodium tartrate Substances 0.000 description 1
- 229960002167 sodium tartrate Drugs 0.000 description 1
- 235000011004 sodium tartrates Nutrition 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 230000000392 somatic effect Effects 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 210000000278 spinal cord Anatomy 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 229940031000 streptococcus pneumoniae Drugs 0.000 description 1
- 229940076156 streptococcus pyogenes Drugs 0.000 description 1
- 210000000225 synapse Anatomy 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 229940021747 therapeutic vaccine Drugs 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 210000003437 trachea Anatomy 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- 210000005102 tumor initiating cell Anatomy 0.000 description 1
- 230000005751 tumor progression Effects 0.000 description 1
- 230000001173 tumoral effect Effects 0.000 description 1
- 241000724775 unclassified viruses Species 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 208000010570 urinary bladder carcinoma Diseases 0.000 description 1
- 208000012991 uterine carcinoma Diseases 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 210000001215 vagina Anatomy 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 210000005166 vasculature Anatomy 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 239000000230 xanthan gum Substances 0.000 description 1
- 235000010493 xanthan gum Nutrition 0.000 description 1
- 229920001285 xanthan gum Polymers 0.000 description 1
- 229940082509 xanthan gum Drugs 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/15—Cells of the myeloid line, e.g. granulocytes, basophils, eosinophils, neutrophils, leucocytes, monocytes, macrophages or mast cells; Myeloid precursor cells; Antigen-presenting cells, e.g. dendritic cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001103—Receptors for growth factors
- A61K39/001106—Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ErbB4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001103—Receptors for growth factors
- A61K39/001109—Vascular endothelial growth factor receptors [VEGFR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001111—Immunoglobulin superfamily
- A61K39/001113—CD22, BL-CAM, siglec-2 or sialic acid- binding Ig-related lectin 2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001111—Immunoglobulin superfamily
- A61K39/001114—CD74, Ii, MHC class II invariant chain or MHC class II gamma chain
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001116—Receptors for cytokines
- A61K39/001117—Receptors for tumor necrosis factors [TNF], e.g. lymphotoxin receptor [LTR] or CD30
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001116—Receptors for cytokines
- A61K39/001119—Receptors for interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001124—CD20
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001128—CD44 not IgG
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001129—Molecules with a "CD" designation not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001152—Transcription factors, e.g. SOX or c-MYC
- A61K39/001153—Wilms tumor 1 [WT1]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001154—Enzymes
- A61K39/001157—Telomerase or TERT [telomerase reverse transcriptase]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001166—Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001166—Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
- A61K39/001168—Mesothelin [MSLN]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001169—Tumor associated carbohydrates
- A61K39/00117—Mucins, e.g. MUC-1
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001169—Tumor associated carbohydrates
- A61K39/001171—Gangliosides, e.g. GM2, GD2 or GD3
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/00118—Cancer antigens from embryonic or fetal origin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/00118—Cancer antigens from embryonic or fetal origin
- A61K39/001182—Carcinoembryonic antigen [CEA]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001184—Cancer testis antigens, e.g. SSX, BAGE, GAGE or SAGE
- A61K39/001186—MAGE
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001184—Cancer testis antigens, e.g. SSX, BAGE, GAGE or SAGE
- A61K39/001188—NY-ESO
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001193—Prostate associated antigens e.g. Prostate stem cell antigen [PSCA]; Prostate carcinoma tumor antigen [PCTA]; PAP or PSGR
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001193—Prostate associated antigens e.g. Prostate stem cell antigen [PSCA]; Prostate carcinoma tumor antigen [PCTA]; PAP or PSGR
- A61K39/001195—Prostate specific membrane antigen [PSMA]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/44—Antibodies bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464493—Prostate associated antigens e.g. Prostate stem cell antigen [PSCA]; Prostate carcinoma tumor antigen [PCTA]; Prostatic acid phosphatase [PAP]; Prostate-specific G-protein-coupled receptor [PSGR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464493—Prostate associated antigens e.g. Prostate stem cell antigen [PSCA]; Prostate carcinoma tumor antigen [PCTA]; Prostatic acid phosphatase [PAP]; Prostate-specific G-protein-coupled receptor [PSGR]
- A61K39/464495—Prostate specific membrane antigen [PSMA]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/08—Drugs for disorders of the urinary system of the prostate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
- A61P15/08—Drugs for genital or sexual disorders; Contraceptives for gonadal disorders or for enhancing fertility, e.g. inducers of ovulation or of spermatogenesis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
- A61P15/14—Drugs for genital or sexual disorders; Contraceptives for lactation disorders, e.g. galactorrhoea
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70521—CD28, CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3069—Reproductive system, e.g. ovaria, uterus, testes, prostate
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
- C12N5/0638—Cytotoxic T lymphocytes [CTL] or lymphokine activated killer cells [LAK]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5156—Animal cells expressing foreign proteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/74—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2999/00—Further aspects of viruses or vectors not covered by groups C12N2710/00 - C12N2796/00 or C12N2800/00
- C12N2999/002—Adverse teaching
Definitions
- Immunotherapy is a targeted therapy that in principle provides for the treatment of such cancers .
- Targeted T ceil therapies utilizing genetically modified autologous T cells are beginning to show evidence of therapeutic efficacy in melanoma and indolent B cell malignancies.
- Current T ceil engineering strategies retarget patient T cells to tumor antigens through a transduced T cell receptor (TCR) or a chimeric antigen receptor (CAR).
- TCR transduced T cell receptor
- CAR chimeric antigen receptor
- the present invention generally provides immunoresponsive cells, including T ceils and Natural Killer (NK) cells, expressing an antigen binding receptor (e.g., CAR or TCR) having immune cell activating actvity and a chimeric co-stimulating receptor (CCR), and methods of use therefore for the treatment of neoplasia, infectious disease, and other pathologies.
- an antigen binding receptor e.g., CAR or TCR
- CCR chimeric co-stimulating receptor
- the invention provides an isolated immunoresponsive cell having an antigen recognizing receptor that binds a first antigen with low affinity, where the binding activates the immunoresponsive ceil, and a chimeric co stimulating receptor (CCR) that binds a second antigen and stimulates the immunoresponsive ceil.
- CCR chimeric co stimulating receptor
- the invention provides a method of inducing tumor cell death in a subject, the method comprising administering an effective amount of an immunoresponsive cell comprising an antigen recognizing receptor that binds a first antigen with low affinity, where the binding activates the immunoresponsive cell, and a chimeric co-stimulating receptor (CCR) that binds a second antigen and stimulates the immunoresponsive cell, thereby inducing tumor cell death in the subject.
- an immunoresponsive cell comprising an antigen recognizing receptor that binds a first antigen with low affinity, where the binding activates the immunoresponsive cell, and a chimeric co-stimulating receptor (CCR) that binds a second antigen and stimulates the immunoresponsive cell, thereby inducing tumor cell death in the subject.
- CCR chimeric co-stimulating receptor
- the invention provides a method of treating or preventing a neoplasia in a subject, the method comprising administering an effective amount of an immunoresponsive cell comprising an antigen recognizing receptor that binds a first antigen with low affinity, where the binding activates the immunoresponsive ceil, and a chimeric co-stimulating receptor (CCR) that binds a second antigen and stimulates the immunoresponsive cell, thereby treating or preventing a neoplasia in the subject.
- an immunoresponsive cell comprising an antigen recognizing receptor that binds a first antigen with low affinity, where the binding activates the immunoresponsive ceil, and a chimeric co-stimulating receptor (CCR) that binds a second antigen and stimulates the immunoresponsive cell, thereby treating or preventing a neoplasia in the subject.
- CCR chimeric co-stimulating receptor
- the invention provides a method of treating prostate cancer in a subject in need thereof, the method comprising
- a T cell comprising an antigen recognizing receptor that binds PSCA or CD19 with low affinity, where the binding activates the immunoresponsive cell, and a chimeric co-stimulating receptor (CCR) that binds PSMA and stimulates the
- the invention provides a method for producing an antigen- specific immunoresponsive ceil, the method involving introducing into the immunoresponsive cell a nucleic acid sequence that encodes a chimeric co- stimulating receptor (CCR), where the chimeric co-stimulating receptor has an antigen-binding domain coupled to an intracellular signaling domain that stimulates an immunoresponsive cell, where the immunoresponsive cell has an antigen recognizing receptor that binds a first antigen with low affinity, wherein the binding activates the immunoresponsive cell.
- CCR chimeric co- stimulating receptor
- the invention provides a pharmaceutical composition comprising an effective amount of an immunoresponsive ceil of the invention (e.g., a tumor antigen-specific T cell in a pharmaceutical composition for the treatment of neoplasia) in a pharmaceutically acceptable excipient.
- an immunoresponsive ceil of the invention e.g., a tumor antigen-specific T cell in a pharmaceutical composition for the treatment of neoplasia
- the invention provides a kit for treatment of a neoplasia, pathogen infection, an autoimmune disorder, or an allogeneic transplant, the kit containing an immunoresponsive cell having an antigen recognizing receptor that binds a first antigen and activates the
- kits may further comprise written instructions for using the immunoresponsive cell for the treatment of a subject having a neoplasia, a pathogen infection, an autoimmune disorder, or an allogeneic transplant.
- the immunoresponsive cell is selected as having an antigen recognizing receptor with low affinity. This may involve selecting the immunoresponsive cell as having an antigen recognizing receptor that binds a first antigen with low affinity, in various embodiments of any of the aspects delineated herein, the antigen recognizing receptor is selected as having low affinity for expression in the cell. This may involve introducing a second nucleic acid sequence that encodes a chimeric antigen receptor, where the chimeric antigen receptor comprises a second antigen-binding domain coupled to a second intracellular signaling domain that activates an immunoresponsive cell.
- the antigen recognizing receptor is a T cell receptor (TCR) or chimeric antigen receptor (CAR).
- TCR T cell receptor
- CAR chimeric antigen receptor
- the intracellular signaling domain of said antigen recognizing receptor is the CD3-chain signaling domain.
- the intracellular signaling domain of the chimeric co-stimulating receptor (CCR) is a CD97, CD1 1a-CD18, CD2, ICOS, CD27, CD154, CD5, OX40, 4-1 BB or CD28 signaling domain.
- the antigen recognizing receptor is exogenous or endogenous.
- the antigen recognizing receptor is recombinantly expressed.
- the antigen recognizing receptor is expressed from a vector.
- the chimeric co-stimulating receptor (CCR) is expressed from a vector.
- the immunoresponsive cell expresses a recombinant or an
- endogenous antigen receptor that is 19z1 or Pz1.
- the immunoresponsive cell is a T cell, a Natural Killer (NK) cell, a cytotoxic T
- lymphocyte CTL
- regulatory T cell a human embryonic stem ceil
- human embryonic stem ceil a human embryonic stem ceil
- the antigen is a tumor or pathogen antigen.
- one or more antigen-binding domains are tumor antigen-binding domains.
- the antigens or tumor antigens are selected from CAIX, CEA, CD5, CD7, CD10, CD19, CD20, CD22, CD30, CD33, CD34, CD38, CD41 , CD44, CD49f, CD56, CD74, CD133, CD138, a cytomegalovirus (CMV) infected ceil antigen, EGP-2, EGP-40, EpCAM, erb-B2,3,4, FBP, Fetal acetylcholine receptor, folate receptor-a, GD2, GD3, HER-2, hTERT, IL13R-a2, x-iight chain, KDR, LeY, Li cell adhesion molecule, MAGE-AI , MUC1 , Mesothelin, NKG2D iigands, NY- ES0-1 , oncofetal antigen (h5T4), PSCA, PSMA, ROR1 , TAG-72, VEGF-
- CMV cytomegalovirus
- the first and second antigens are selected from CD133, a cytomegalovirus (CMV) infected cell antigen, erbB2, KDR Mesothelin, NKG2D Iigands, NY-ES0-1 , oncofetal antigen (h5T4), PSCA, PSMA, CD19, VEGF-R2, and WT-1.
- the first and second antigens are selected from HER2, MUC1 , CD44, CD49f, EpCAM, CEA, CD133, a
- cytomegalovirus (CMV) infected cell antigen EGP-2, EGP-40, EpCAM, erb-B2,3,4, FBP, KDR, Mesothelin, NKG2D Iigands, NY-ES0-1 , oncofetal antigen (h5T4), PSCA, PSMA, VEGF-R2, or WT-1.
- the first and second antigens are selected from CD10 and CD19.
- the first and second antigens are selected from CD56 and CD138.
- the first and second antigens are selected from mesothelin, folate receptor-a, CD44, and CD133.
- the neoplasia is selected from the group consisting of prostate cancer, breast cancer, B cell leukemia, multiple myeloma, and ovarian cancer.
- the method reduces the number of tumor cells, reduces tumor size, and/or eradicates the tumor in the subject.
- the neoplasia is prostate cancer and the first and second tumor antigens are distinct antigens selected from PSCA, PSMA, CD19, CD133, a cytomegalovirus (CMV) infected cell antigen, erb-B2, KDR
- the neoplasia is breast cancer and the first and second tumor antigens are distinct antigens selected from HER2, MUC1 , CD44, CD49f, EpCAM, CEA, CD133, a cytomegalovirus (CMV) infected cell antigen, EGP-2, EGP-40, EpCAM, erb-B2,3,4, FBP, KDR, Mesothelin, NKG2D iigands, NY- ESO-1 , oncofetal antigen (h5T4), PSCA, PSMA, VEGF-R2, or WT-1 .
- CMV cytomegalovirus
- the neoplasia is B cell leukemia and the first and second tumor antigens are selected from CDIO and CD19.
- the neoplasia is multiple myeloma and the first and second tumor antigens are selected from CD56 and CD138.
- the neoplasia is ovarian cancer and the first and second tumor antigens are distinct antigens selected from mesothe!in, folate receptor-a, CD44, and CD133.
- compositions and methods that provide for T ceil targeting of tumor cells.
- Compositions and articles defined by the invention were isolated or otherwise manufactured in connection with the examples provided below. Other features and advantages of the invention will be apparent from the detailed description, and from the claims.
- Figures 1A-C are graphics depicting chimeric antigen receptor (CAR) and chimeric costimulatory receptor (CCR) vector design and expression via transduction of primary human T cells.
- CAR chimeric antigen receptor
- CCR costimulatory receptor
- CAR expression can be easily detected by correlation to dsRED fluorescence (data not shown).
- the CCR was generated by fusing an scFv to a CD28 transmembrane and signaling domain 15 , fused to a 4-1 BB (aka CD137) cytosoiic signaling domain. 21 CCR expression can be correlated to the bicistronic expression of hrGFP (data not shown).
- LTR Long Terminal Repeat
- SD Splice Donor site
- SA Splice Acceptor site
- VH or V L -Variable Heavy or Light domains respectively
- EC Extracellular domain
- TM Transmembrane domain
- C Cytosoiic domain
- IRES Internal Ribosomal Entry Site
- hrGFP Human
- Recombinant Green Fluorescent Protein depicts representative transduction efficiencies of primary human T cells using these retroviral vectors.
- C depicts transduction of CTLs with different and multiple CARs for the present studies.
- Figures 2A-D show that dual-receptor, CAR/CCR-mediated activation of human T cells allowed for robust CTL function, long-term proliferation, and enhanced tumor eradication upon binding of two antigens.
- A shows that T cells expressing chimeric receptors lysed cells positive for antigen when the
- CAR specific to CD19 is expressed by T cells in CTL assays, compared to untransduced or P28BB transduced T cells.
- Plots are representative of n > 4 experiments, with error bars representing standard deviation of the mean of 3 replicates.
- (B) shows long-term proliferation of T cells by absolute T cell counts over 31 days of T cells expressing none, one, or both chimeric receptors that were co-cultured with human tumor cell lines expressing both or either antigen alone. Arrows indicate re-stimulation of T cells using freshly irradiated tumor cells. Only when dual-receptor expressing T ceils encounter both antigens is robust long-term proliferation observed.
- Plots are representative of n > 4 experiments with error bars representing standard deviation of the mean of 3 replicates.
- TTS tumor- sensing T
- IV intravenously
- (D) depicts selective eradication of DP tumors using a tri-tumor mouse model by subcutaneously injecting 1 x 10 6 PC3 tumors cells each of ceils positive for CD19 alone into the left flanks, cells positive for PSMA alone into the right flanks, and cells positive for both CD19 and PSMA into the backs of the mice.
- T ceils expressing either 19z1 , P28BB, or both 19z1 + P28BB of the chimeric receptors were infused intravenously 7 days post tumor infusion. Representative images of 2 mice per group bearing these tumors are shown with luminescence of tumors represented in color. Tumors were quantitatively measured using calipers and tumor volumes were plotted versus time for each tumor. Error bars represent standard deviation from the mean of 6 mice.
- Statistical significance was determined using two- tailed unpaired t tests to compare values obtained from 19z1 T cells and 19z1 + P28BB T cells and p values are represented as * for ⁇ 0.05 or ** for ⁇ 0.01.
- FIGS 3A-E depict that tumor-sensing T (T TS ) ceils selectively eradicated human prostate tumors when targeting two prostate tumor antigens
- T TS tumor-sensing T
- A depicts the evaluation of three different scFvs specific to PSCA for their assembly into bispecific antibodies that contain specificity for CD3 as well. T ceils were co- cultured at ratio of 20:1 with PSCA + PC3 tumor cells and antibodies added at varying amounts and specific iysis was measured.
- (B) depicts generation of CARs using the anti-PSCA scFvs that display varied efficacy in cytotoxicity assays.
- Figures 4A-D depict enhanced cytokine secretion and Bd xL
- TTS ceils when co-cultured on DP tumors.
- A depicts multiplex cytokine analysis of untransduced T cells or T cells transduced with 19z1 , P28BB, or both 48 hours post first antigen stimulation using either untransduced PC3 cells (Empty) or CD19 + PSMA + PC3 ceils. Error bars represent standard deviation from the mean of 2 biological replicates.
- B-D depict multiplex cytokine analysis of untransduced T cells or T cells transduced with Hz] (B), Mzl (C), and Lz1 (D) anti-PSCA CARs, P28BB CCRs, or both CAR + CCR is shown 48 hours post second antigen stimulation using either Empty or PSCA+PSMA+ PC3 cells.
- E depicts Western blot analysis for BdxL performed using cellular lysates of untransduced T ceils or T ceils transduced with 19z1 , P28BB, or both after 24 hours post initial antigen stimulation. Total amount of Akt was used as a loading control.
- FIG. 5 depicts generation of prostate tumor cells for the expression of fusion protein GFP-Firefiy Luciferase (GFP/Luc) and tumor antigens.
- Untransduced PC3 cells (Empty) were transduced with GFP/Luc and either CD19, PSMA, PSCA, or a combination of two antigens using retroviral expression constructs. Cells were purified via double purity FACS for GFP/Luc, CD19, PSMA, and/or PSCA.
- FIG. 6A-C illustrate the tumor-sensing T cell concept.
- A depicts that TTS cells expressing an efficient CAR, become potently stimulated by A + 113 + cells to facilitate immune response against A + ceils.
- CAR + CCR + cells can bind tumor antigen A + cells with a CAR that supplies CD3 activation signals. This can result in short-term cell lysis.
- CAR + CCR + cells can bind tumor antigen B + cells with a CCR that supplies CD28 and CD137 signals. This signal alone is not sufficient to induce lysis or proliferation. Only when CAR + CCR + cells bind tumor antigen A + B + ceils with a CAR and CCR can both activation and stimulation be provided.
- FIG. 6B depicts that by reducing the efficacy of the CAR, TTs celis can be functionally rescued by CCR binding when A + B + cells are encountered to selectively respond and eradicate A + 13 + ceils, while avoiding response to A+ cells.
- (C) shows that by co-expressing one CAR that supplies a TCR activation signal upon binding a tumor antigen and a second CAR that supplies stimulation signals upon binding a different tumor antigen, T lymphocytes will only eradicate tumors expressing both antigens, but not tumors expressing either antigen alone.
- an immunoresponsive ceil activates induction of signal transduction or changes in protein expression in the cell resulting in initiation of an immune response.
- CD3 Chains cluster in response to ligand binding and immunoreceptor tyrosine-based inhibition motifs (ITAMs) a signal transduction cascade is produced.
- ITAMs immunoreceptor tyrosine-based inhibition motifs
- a formation of an immunologicai synapse occurs that includes clustering of many molecuies near the bound receptor (e.g. CD4 or CD8, CD3 / / / , etc.) This clustering of membrane bound signaling molecules allows for ITAM motifs contained within the CD3 chains to become phosphorylated.
- T ceil activation pathway ultimately activating transcription factors, such as NF-KB and AP-1.
- transcription factors induce global gene expression of the T cell to increase IL-2 production for proliferation and express master regulator T cell proteins in order to initiate a T ceil mediated immune response.
- Stimulates an immunoresponsive cell is meant a signal that results in a robust and sustained immune response. In various embodiments, this occurs after immune cell (e.g., T-cell) activation or concomitantly mediated through receptors including, but not limited to, CD28, CD137 (4-1 BB), OX40, and ICOS.
- receiving multiple stimulatory signals is important to mount a robust and long-term T cell mediated immune response.
- T cells Without receiving these stimulatory signals, T cells quickly become inhibited and unresponsive to antigen. While the effects of these co-stimuiatory signals vary and remain partially understood, they generally result in increasing gene expression in order to generate long lived, proliferative, and anti-apoptotic T cells that robustly respond to antigen for complete and sustained eradication.
- antigen recognizing receptor refers to a receptor that is capable of activating an immune cell (e.g., a T-cell) in response to antigen binding.
- exemplary antigen recognizing receptors may be native or endogenous T cell receptors or chimeric antigen receptors in which a tumor antigen-binding domain is fused to an intracellular signaling domain capable of activating activating an immune cell (e.g., a T-cell).
- an antigen recognizing receptor is selected to have low or minimal affinity or avidity for the antigen.
- affinity is meant a measure of the binding strength between antibody and a simple hapten or antigen determinant. Without being bound to theory, affinity depends on the closeness of stereochemical fit between antibody combining sites and antigen determinants, on the size of the area of contact between them, and on the distribution of charged and hydrophobic groups. Affinity also includes the term “avidity,” which refers to the strength of the antigen-antibody bond after formation of reversible complexes. Methods for calculating the affinity of an antibody for an antigen are known in the art, including use of binding experiments to calculate affinity. In the case of an antibody (Ab) binding to an antigen (Ag), the affinity constant is used (expressed as inverted dissociation constant).
- the chemical equilibrium of antibody binding is also the ratio of the on-rate (k forward) and off-rate (kback) constants.
- Two antibodies can have the same affinity, but one may have both a high on- and off-rate constant, while the other may have both a low on- and off-rate constant.
- Antibody activity in functionai assays is also reflective of antibody affinity.
- the antigen recognizing receptor has low affinity.
- Low affinity includes micromolar and nanomolar affinities (e.g. IfJ 5 , 50 "6 , I0 “6 , 5x 1fJ 7 , 10 "7 , 5x 10 "8 , 10 “8 , 5x1 fJ 9 , iO "9 M).
- Anitbody and affinities can be phenotypically characterized and compared using functional assay (e.g., cell lysis assay).
- chimeric co-stimulatory receptor refers to a specific type of chimeric antigen receptor (CAR) that mediates costimulation independently of activation.
- CAR chimeric antigen receptor
- the CCR When expressed on immunoresponsive cells in combination with an antigen recognizing receptor (e.g., CAR or TCR that activates the cell), the CCR is targeted to a second antigen.
- the CCR has mid or high affinity for its target antigen.
- chimeric antigen receptor refers to a tumor antigen-binding domain that is fused to an intracellular signaling domain capable of activating or stimulating T ceils. Most commonly, the CAR'S
- extracellular binding domain is composed of a single chain variable fragment (scFv) derived from fusing the variable heavy and light regions of a murine or humanized monoclonal antibody.
- scFv's may be used that are derived from Fab's (instead of from an antibody, e.g., obtained from Fab libraries).
- this scFv is fused to a transmembrane domain and then to intracellular signaling domain.
- “First-generation” CARs include those that solely provide CD3 signals upon antigen binding
- “Second-generation” CARs include those that provide both costimulation (e.g. CD28 or CD137) and activation (CD3 ).
- “Third-generation” CARs include those that provide multiple
- CD3 polypeptide is meant a protein having at least 85, 90, 95, 96, 97, 98, 99 or 100% identity to NCBI Reference No: NP_932170 or a fragment thereof that has activating or stimulatory activity.
- An exemplary CD3 is provided in Table 1 below.
- CD3 nucleic acid molecule is meant a polynucleotide encoding a CD3 polypeptide.
- CD8 polypeptide is meant a protein having at least 85, 90, 95, 96, 97, 98, 99or 100% identity to NCBI Reference No: NP_001759 or a fragment thereof that has stimulatory activity.
- An exemplary CD8 is provided in Table 1 below.
- CD8 nucleic acid molecule is meant a polynucleotide encoding a CD8 polypeptide.
- CD28 polypeptide is meant a protein having at least 85, 90, 95, 96, 97, 98, 99 or 100% identity to NCBI Reference No: NP_006130 or a fragment thereof that has stimulatory activity.
- An exemplary CD28 is provided in Table 1 below.
- CD28 nucleic acid molecule is meant a polynucleotide encoding a CD28 polypeptide.
- 4-1 BB polypeptide is meant a protein having at least 85, 90, 95,
- 4-1 BBL nucleic acid molecule is meant a polynucleotide encoding a 4-1 BBL polypeptide.
- CD80 polypeptide is meant a protein having at least 85, 90, 95, 96,
- CD80 polypeptide is provided in Table 1 below.
- CD80 nucleic acid molecule any polynucleotide encoding a CD80 polypeptide.
- An exemplary CD80 nucleic acid molecule is NM_005191 .
- OX40L polypeptide is meant a protein having at least 85, 90, 95, 96,
- OX40L nucleic acid molecule is meant a polynucleotide encoding a OX40L polypeptide.
- 19z1 polypeptide is meant a protein having at least 85, 90, 95, 96, 97, 98, 99 or 100% identity to the sequence provided below and having activating activity when bound to CD19.
- P28z polypeptide is meant a protein having at least 85, 90, 95, 96, 97, 98, 99 or 100% identity to the sequence provided below.
- CD19 is meant a protein having at least 85, 90, 95, 96, 97, 98, 99 or 100% identity to the sequence provided below and is able to bind CD19.
- PSMA is meant a protein having at least 85, 90, 95, 96, 97, 98, 99 or 100% identity to the sequence provided below and is able to bind PSMA.
- P28BB is meant a protein having at least 85, 90, 95, 96, 97, 98, 99 or 100% identity to the sequence provided below and having stimulatory activity when bound to PSMA.
- CD3 ⁇ mkwkalftaa ilqaqlpite aqsfglldpk lcylldgilf iygviltalf Irvkfsrsad apayqqgqnq lynelnlgrr eeydvldkrr grdpemggkp qrrknpqegl ynelqkdkma eayseigmkg errrgkghdg lyqglsta tkdtydalhm qalppr
- CD80 evkevatlsc ghnvsveela qtriywqkek kmvltmmsgd mni peyknr tifditnnls ivilalrpsd egtyecvvlk yekdafkreh laevtlsvka dfptpsisdf eiptsnirri icstsggfpe phlswlenge elnainttvs qdpetelyav sskldfnmtt nhsfmcliky ghlrvnqtfn wnttkqehfp dnllpswait lisvngif i ccltycfapr crerrrnerl rresvrov mervqpleen vgnaarprfe rnklllvasv iqglgl ll
- GYAFSSYWMNWKQRPGQGLE IGQIYPGDGDTNYNGKFKGQA TLTADKSSSTAYMQLSGLTSEDSAVYECARKTISSWDFYFDY WGQGTTVTVSSGGGGSGGGGSGGGGSDIELTQSPKFMSTSVGD RVSVTCKASQ VGT VAWYQQKPGQSPKPLIYSATYRNSGVPD RFTGSGSGTDFTLTITNVQSKDLADYFCQQYNRYPYTSGGGTK LEIKRAAAPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGA VHTRGLDFACDIYI APLAGTCGVLLLSLVITLYCNHRVKFSR SAEPPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP RRK PQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQG LSTATKDTYDALHMQALPPR
- Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having "substantial identity" to an endogenous
- hybridize is meant pair to form a double- stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency.
- complementary polynucleotide sequences e.g., a gene described herein
- stringent salt concentration will ordinarily be less than about 750 mM NaCI and 75 mM trisodium citrate, preferably less than about 500 mM NaC1 and 50 mM trisodium citrate, and more preferably less than about 250 mM NaC1 and 25 mM trisodium citrate.
- Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high
- stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide.
- Stringent temperature conditions wiil ordinarily inciude temperatures of at least about 30° C, more preferably of at least about 37° C, and most preferably of at least about 42° C.
- Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA are well known to those skilled in the art.
- Various levels of stringency are accomplished by combining these various conditions as needed. In a preferred: embodiment, hybridization will occur at 30° C in 750 mM NaCI, 75 mM trisodium citrate, and 1% SDS.
- hybridization will occur at 37° C in 500 mM NaCI, 50 mM trisodium citrate, 1 % SDS, 35% formamide, and 1001.1 g/m1 denatured salmon sperm DNA (ssDNA).
- hybridization wiil occur at 42° C C. in 250 mM NaCI, 25 mM trisodium citrate, 1 % SDS, 50% formamide, and 200 p.g/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
- wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature.
- stringent salt concentration for the wash steps will preferably be less than about 30 mM NaC1 and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCI and 1.5 mM trisodium citrate.
- Stringent temperature conditions for the wash steps wiil ordinarily inciude a temperature of at least about 25° C, more preferably of at least about 42° C, and even more preferably of at least about 68° C.
- wash steps wiil occur at 25°C in 30 mM NaCI, 3 mM trisodium citrate, and 0.1% SDS.
- wash steps will occur at
- wash steps wiil occur at 68° C in 15 mM NaC1 , 1.5 mM trisodium citrate, and 0.1% SDS. Additional variations on these conditions will be readily apparent to those skilled in the art.
- Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196:180, 1977); Grunstein and Hogness (Proc. Natl. Acad.Sci., USA 72:3961 , 1975); Ausubel et al. (Current Protocols in Molecular Biology, Wiley Interscience, New York, 2001 ); Berger and Kimmei (Guide to Molecular Cloning Techniques, 1987, Academic Press, New York); and Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York.
- substantially identical is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein).
- a reference amino acid sequence for example, any one of the amino acid sequences described herein
- nucleic acid sequence for example, any one of the nucleic acid sequences described herein.
- such a sequence is at least 60%, more preferably 80% or 85%, and more preferably 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison.
- Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications.
- sequence analysis software for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs.
- Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, g!utamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
- a BLAST program may be used, with a probability score between e-3 and e-100 indicating a closely related sequence.
- analog is meant a structurally related polypeptide or nucleic acid molecule having the function of a reference polypeptide or nucleic acid molecule.
- iigand refers to a molecule that binds to a receptor.
- the iigand binds a receptor on another cell, allowing for cell-to-cel! recognition.
- disease is meant any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ.
- diseases include neoplasia or pathogen infection of cell.
- effective amount is meant an amount sufficient to arrest, ameliorate, or inhibit the continued proiiferation, growth, or metastasis (e.g., invasion, or migration) of a neoplasia.
- enforcing tolerance is meant preventing the activity of self-reactive cells or immunoresponsive cells that target transplanted organs or tissues.
- exogenous is meant a nucleic acid molecule or polypeptide that is not endogenously present in the cell, or not present at a level sufficient to achieve the functional effects obtained when over-expressed.
- exogenous would therefore encompass any recombinant nucleic acid molecule or polypeptide expressed in a cell, such as foreign, heterologous, and over- expressed nucleic acid molecules and polypeptides.
- nucleic acid molecule or polypeptide a nucleic acid molecule (e.g., a cDNA, DNA or RNA molecule) or polypeptide that is not normally present in a cell or sample obtained from a cell.
- This nucleic acid may be from another organism, or it may be, for example, an mRNA molecule that is not normally expressed in a cell or sample.
- immunoresponsive cell is meant a cell that functions in an immune response or a progenitor, or progeny thereof.
- isolated cell is meant a ceil that is separated from the molecular and/or cellular components that naturally accompany the cell.
- isolated refers to material that is free to varying degrees from components which normally accompany it as found in its native state.
- Isolate denotes a degree of separation from original source or surroundings.
- Purify denotes a degree of separation that is higher than isolation.
- A"purified” or “biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by
- purified can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel.
- modifications for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
- tumor antigen-binding domain refers to a domain capable of specifically binding a particular antigenic determinant or set of antigenic determinants present on a tumor.
- modulate is meant to alter positively or negatively.
- exemplary modulations include a 1%, 2%, 5%, 10%, 25%, 50%, 75%, or 100% change.
- Neoplasia is meant a disease characterized by the pathological proliferation of a cell or tissue and its subsequent migration to or invasion of other issues or organs. Neoplasia growth is typically uncontrolled and progressive, and occurs under conditions that would not elicit, or would cause cessation of, multiplication of normal cells.
- Neoplasias can affect a variety of cell types, tissues, or organs, including but not limited to an organ selected from the group consisting of bladder, bone, brain, breast, cartilage, glia, esophagus, fallopian tube, gallbladder, heart, intestines, kidney, liver, lung, lymph node, nervous tissue, ovaries, pancreas, prostate, skeletal muscle, skin, spinal cord, spleen, stomach, testes, thymus, thyroid, trachea, urogenital tract, ureter, urethra, uterus, and vagina, or a tissue or cell type thereof.
- an organ selected from the group consisting of bladder, bone, brain, breast, cartilage, glia, esophagus, fallopian tube, gallbladder, heart, intestines, kidney, liver, lung, lymph node, nervous tissue, ovaries, pancreas, prostate, skeletal muscle, skin, spinal cord, spleen, stomach, teste
- Neoplasias include cancers, such as sarcomas, carcinomas, or plasmacytomas ⁇ malignant tumor of the plasma cells).
- Illustrative neoplasms for which the invention can be used include, but are not limited to leukemias (e.g., acute Ieukemia, acute lymphocytic Ieukemia, acute myelocytic leukemi a, acute myeloblasts Ieukemia, acute promyelocytic ieukemia, acute myelomonocytic ieukemia, acute monocytic Ieukemia, acute erythroieukemia, chronic Ieukemia, chronic myelocytic Ieukemia, chronic lymphocytic Ieukemia), polycythemia vera, lymphoma (Hodgkin's disease, non-Hodgkin's disease),
- leukemias e.g., acute Ieukemia, acute lymphocytic Ieukemia, acute myelocy
- Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors such as sarcomas and carcinomas ⁇ e.g., fibrosarcoma, myxosarcoma,
- liposarcoma chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma,iymphangiosarcoma,lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous giand carcinoma, papillary carcinoma, papillary
- adenocarcinomas cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal ceil carcinoma, hepatoma, nile duct carcinoma,
- choriocarcinoma seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, uterine cancer, testicular cancer, lung carcinoma, small ceil lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, medullobiastoma, craniopharyngioma, ependymoma, pinealoma,
- screening methods of the invention identify compositions that are useful for treating breast or lung cancer.
- receptor is meant a polypeptide, or portion thereof, present on a cell membrane that selectively binds one or more ligands.
- a T cell that recognizes a virus typically expresses a receptor that binds an antigen expressed by the virus.
- Retroviridae e.g. human immunodeficiency viruses, such as HIV-1 (also referred to as HDTV-ill, LAVE or HTLV-III/LAV, or HIV-III; and other isolates, such as HIV- LP; Picornaviridae (e.g. polio viruses, hepatitis A virus; enteroviruses, human Coxsackie viruses, rhinoviruses, echoviruses); Calciviridae (e.g. strains that cause gastroenteritis); Togaviridae (e.g. equine encephalitis viruses, rubella viruses); Flaviridae (e.g. dengue viruses, encephalitis viruses, yellow fever viruses);
- Retroviridae e.g. human immunodeficiency viruses, such as HIV-1 (also referred to as HDTV-ill, LAVE or HTLV-III/LAV, or HIV-III; and other isolates, such as HIV- LP; Picornaviridae (e.g.
- Coronoviridae e.g. coronaviruses
- Rhabdoviridae e.g. vesicular stomatitis viruses, rabies viruses
- Filoviridae e.g. ebola viruses
- Paramyxoviridae e.g. parainfluenza viruses, mumps virus, measles virus, respiratory syncytial virus
- Orthomyxoviridae e.g . influenza viruses
- Bungaviridae e.g. Hantaan viruses, bunga viruses, phieboviruses and Nairo viruses
- Arena Viridae hemorrhagic fever viruses
- Reoviridae e.g. reoviruses, orbiviurses and
- rotaviruses rotaviruses
- S/ ' ma r/ ' c/ae Hepadnaviridae (Hepatitis B virus); Parvovihda ⁇ parvov ⁇ ruses);Papovaviridae (papilloma viruses, polyoma viruses);
- Adenoviridae most adenoviruses
- Herpesviridae herpes simplex virus (HSV) 1 and 2, varicella zoster virus, cytomegalovirus (CMV), herpes virus
- Poxviridae variola viruses, vaccinia viruses, pox viruses
- Iridoviridae e.g. African swine fever virus
- Exemplary bacteria include, but are not limited to, Pasteurella, Staphylococci, Streptococcus, Escherichia coli, Pseudomonas species, and Salmonella species.
- Specific examples of infectious bacteria include but are not limited to, Helicobacter pyloris, Borelia burgdoiferi, Legionella
- pneumophilia e.g. M. tuberculosis, M. avium, M.
- M. kansaii M. gordonae
- Staphylococcus aureus Staphylococcus aureus
- Neisseria gonorrhoeae Neisseria meningitidis
- Listeria monocytogenes Listeria monocytogenes
- Streptococcus pyo genes (Group A Streptococcus), Streptococcus agalactiae (Group B Streptococcus), Streptococcus (viridans group), Streptococcus faecalis, Streptococcus bovis, Streptococcus (anaerobic sps.), Streptococcus pneumoniae, pathogen cCampylobacter sp.,
- corynebacterium diphtheriae corynebacterium sp., Erysipelothrix rhusiopathiae, Clostridium perfringers, Clostridium tetani, Enterobacter aerogenes, Klebsiella pneumoniae, Pasturella multocida, Bacteroides sp., Fusobacterium nucleatum, Streptobacillus moniliformis, Treponema pallidium, Treponema peramba, Leptospira, Rickettsia, and Actinomyces israelii.
- polypeptide or fragment thereof that recognizes and binds a polypeptide of interest, but which does not
- a sample for example, a biological sample, which naturally includes a polypeptide of the invention.
- tumor antigen refers to any polypeptide expressed by a tumor that is capable of inducing an immune response.
- virus antigen is meant a polypeptide expressed by a virus that is capable of inducing an immune response.
- treatment refers to clinical intervention in an attempt to alter the disease course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology.
- Therapeutic effects of treatment include, without limitation, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastases, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
- a treatment can prevent deterioration due to a disorder in an affected or diagnosed subject or a subject suspected of having the disorder, but also a treatment may prevent the onset of the disorder or a symptom of the disorder in a subject at risk for the disorder or suspected of having the disorder.
- subject refers to a vertebrate, preferably a mammal, more preferably a human.
- immunocompromised refers to a subject who has an immunodeficiency.
- the subject is very vulnerable to opportunistic infections, infections caused by organisms that usually do not cause disease in a person with a healthy immune system, but can affect people with a poorly functioning or suppressed immune system.
- the present invention generally provides cells, including genetically modified immunoresponsive cells (e.g., T cells, Natural Killer (NK) cells, cytotoxic T lymphocytes (CTL) ceils) expressing at least a combination of an antigen- recognizing receptor (e.g., TCR or CAR) and a chimeric co-stimulating receptor (CCR), and methods of use therefore for the treatment of neoplasia and other pathologies where an increase in an antigen-specific immune response is desired.
- genetically modified immunoresponsive cells e.g., T cells, Natural Killer (NK) cells, cytotoxic T lymphocytes (CTL) ceils
- an antigen- recognizing receptor e.g., TCR or CAR
- CTL chimeric co-stimulating receptor
- the invention is based, at least in part, on the discovery that the simultaneous engagement of two antigens co-expressed by a tumor cell by an antigen-recognizing receptor and chimeric co-stimulating receptor is useful for activating and stimulating an immunoreactive cell without systemic effects.
- the reactivity against tissues expressing either antigen alone is preferably minimal, inducing T cell activaiion in the presence of both antigens but not either one alone.
- T ceil activation is mediated by a TCR or a CAR targeted to an antigen (e.g., CD19 or prostate stem cell antigen, PSCA).
- Costimulation is independently mediated by a "chimeric costimulatory receptor" (CCR), 2 ' 3 which is targeted to a second antigen (e.g., prostate-specific membrane antigen, PSMA).
- CCR chimeric costimulatory receptor
- PSMA prostate-specific membrane antigen
- this approach is not limited to the treatment of neoplasias, but is amenable to a wide range of applications where an increase in an antigen-specific immune response is desired, such applications include not only the treatment of neoplasias, but also for the enhancement of an immune response against a pathogen infection or an infectious disease and to reinforce immune tolerance in regulatory T ceils in the context of autoimmunity or allogeneic transplantation.
- lymphoid lineage comprising B, T and natural killer (NK) cells, provides for the production of antibodies, regulation of the cellular immune system, detection of foreign agents in the blood, detection of cells foreign to the host, and the iike.
- T cells refers to lymphocytes that mature in the thymus and are chiefly responsible for cell- mediated immunity. T cells are involved in the adaptive immune system.
- NK ceils refers to lymphocytes that are part of cell-mediated immunity and act during the innate immune response. They do not require prior activation in order to perform their cytotoxic effect on target ceils. Cytotoxic T cells (CTL or killer T ceils) are a subset of T TTL or killer T ceils.
- lymphocytes capable of inducing the death of infected somatic or tumor cells.
- the present invention provides cells expressing a combination of an antigen-recognizing receptor that activates an immunoresponsive ceil (e.g., TCR, CAR) and a chimeric co-stimulating receptor (CCR), and methods of using such cells for the treaiment of a disease that requires an enhanced immune response.
- an immunoresponsive ceil e.g., TCR, CAR
- CCR chimeric co-stimulating receptor
- tumor antigen-specific T cells, NK cells, CTL ceils or other immunoresponsive cells are used as shuttles for the selective enrichment of one or more co-stimulatory ligands for the treaiment or prevention of neoplasia.
- a T cell expressing a chimeric antigen receptor 19z1 that recognizes CD19 is co-expressed in a T cell that expresses a chimeric co- stimuiatory receptor P28BB that recognizes and binds Prostate Specific
- PSMA Membrane Antigen
- T cells NK cells
- CTL cells can be used for the treatment of viral diseases.
- a chimeric co-stimuiatory antigen receptor that recognizes a first CMV antigen and a chimeric antigen receptor that recognizes and binds a second CMV antigen are co-expressed in cytotoxic T lymphocytes for the treatment of CMV.
- Types of tumor antigen-specific human lymphocytes that can be used in the methods of the invention include, without limitation, peripheral donor lymphocytes genetically modified to express chimeric antigen receptors (CARs) (Sadelain, M., et al. 2003 Nat Rev Cancer 3:35-45), peripheral donor
- CARs chimeric antigen receptors
- lymphocytes genetically modified to express a full-length tumor antigen- recognizing T cell receptor complex comprising the a and p heterodimer (Morgan, R.A., et al. 2006 Science 314:126-129), lymphocyte cultures derived from tumor infiltrating lymphocytes (TILs) in tumor biopsies (Panelii, M.C., et al. 2000 J Immunol 164:495-504; Panelii, M.C., et al.
- TILs tumor infiltrating lymphocytes
- T ceils may be autologous, allogeneic, or derived in vitro from engineered progenitor or stem cells.
- any suitable tumor antigen is suitable for use in the tumor-related embodiments described herein.
- Sources of antigen include, but are not limited to cancer proteins.
- the antigen can be expressed as a peptide or as an intact protein or portion thereof.
- the intact protein or a portion thereof can be native or mutagenized.
- Suitable antigens include prostate specific membrane antigen (PSMA) and prostate stem cell antigen (PCSA).
- Viral antigen-specific T lymphocytes and NK cells
- Suitable antigens for use in the treatment of pathogen infection or other infectious disease, for example, in an immunocompromised subject include, without limitation, viral antigens present in Cytomegalovirus (CMV), Epstein Barr Virus (EBV), Human Immunodeficiency Virus (HIV), and influenza virus.
- CMV Cytomegalovirus
- EBV Epstein Barr Virus
- HAV Human Immunodeficiency Virus
- the unpurified source of CTLs may be any known in the art, such as the bone marrow, fetal, neonate or adult or other hematopoietic ceil source, e.g. , fetal liver, peripheral blood or umbilical cord blood.
- hematopoietic ceil source e.g. , fetal liver, peripheral blood or umbilical cord blood.
- Various techniques can be employed to separate the cells. For instance, negative selection methods can remove non-CTLs initially. mAbs are particularly useful for identifying markers associated with particular cell lineages and/or stages of differentiation for both positive and negative selections.
- a large proportion of terminally differentiated cells can be initially removed by a relatively crude separation.
- magnetic bead separations can be used initially to remove large numbers of irrelevant ceils.
- at least about 80%, usually at least 70% of the total hematopoietic cells will be removed prior to cell isolation.
- Procedures for separation include, but are not limited to, density gradient centrifugation; resetting; coupling to particles that modify cell density; magnetic separation with antibody-coated magnetic beads; affinity
- cytotoxic agents joined to or used in conjunction with a mAb including, but not limited to, complement and cytotoxins; and panning with antibody attached to a solid matrix, e.g. plate, chip, elutriation or any other convenient technique.
- Techniques for separation and analysis include, but are not limited to, flow cytometry, which can have varying degrees of sophistication, e.g., a plurality of color channels, low angle and obtuse light scattering detecting channels, impedance channels.
- the cells can be selected against dead cells, by employing dyes associated with dead cells such as propidium iodide (PI).
- PI propidium iodide
- the ceils are coi!ected in a medium comprising 2% fetal calf serum (FCS) or 0.2% bovine serum albumin (BSA) or any other suitable, preferably sterile, isotonic medium.
- FCS fetal calf serum
- BSA bovine serum albumin
- the invention generally provides an immunoresponsive celi, such as a virus specific or tumor specific T cell comprising a receptor that binds a first antigen and activates the immunresponsive celi and a receptor that binds a second antigen and stimulates the immunresponsive cell.
- an immunoresponsive celi such as a virus specific or tumor specific T cell comprising a receptor that binds a first antigen and activates the immunresponsive celi and a receptor that binds a second antigen and stimulates the immunresponsive cell.
- immunoresponsive ceils e.g., T cells, CTL cells, NK cells
- Genetic modification of immunoresponsive ceils can be accomplished by transducing a substantially homogeneous cell composition with a recombinant DNA construct.
- a retroviral vector (either gamma-retroviral or lentiviral) is employed for the introduction of the DNA construct into the ceil.
- a polynucleotide encoding a receptor that binds an antigen can be cloned into a retroviral vector and expression can be driven from its endogenous promoter, from the retroviral long terminal repeat, or from a promoter specific for a target cell type of interest.
- an antigen e.g., a tumor antigen, or a variant, or a fragment thereof
- Non-viral vectors may be used as well.
- a retroviral vector is generally employed for transduction, however any other suitable viral vector or non-viral delivery system can be used.
- retroviral gene transfer for subsequent genetic modification of the cells to provide ceils comprising an antigen presenting complex comprising at least two co- stimulatory ligands, retroviral gene transfer (transduction) likewise proves effective.
- Combinations of retroviral vector and an appropriate packaging line are also suitable, where the capsid proteins will be functional for infecting human cells.
- Various amphotropic virus-producing cell lines are known, including, but not limited to, PA12 (Miller, et ai. (1985) Mol. Cell. Biol.
- Non- amphotropic particles are suitable too, e.g., particles pseudotyped with VSVG, RD114 or GALV envelope and any other known in the art.
- Possible methods of transduction also include direct co-culture of the cells with producer cells, e.g., by the method of Bregni, et al. (1992) Blood 80:1418- 1422, or culturing with viral supernatant alone or concentrated vector stocks with or without appropriate growth factors and poiycations, e.g., by the method of Xu, et al. (1994) Exp. Hemat. 22:223-230; and Hughes, et al. (1992) J. Clin. Invest. 89:1817.
- transducing viral vectors can be used to express a co-stimulatory ligand of the invention in an immunoresponsive ceil.
- the chosen vector exhibits high efficiency of infection and stable integration and expression (see, e.g., Cayouette et ai., Human Gene Therapy 8:423-430, 1997; Kido et al., Current Eye Research 15:833-844, 1996; Bloomer et al., Journal of Virology 71 :6641-6649, 1997; Naldini et al., Science 272:263-267, 1996; and Miyoshi et al., Proc. Natl. Acad. Sci. U.S.A. 94:10319, 1997).
- viral vectors that can be used include, for example, adenoviral, lentiviral, and adeno-associated viral vectors, vaccinia virus, a bovine papilloma virus, or a herpes virus, such as Epstein-Barr Virus (also see, for example, the vectors of Miller, Human Gene Therapy 15-14, 1990; Friedman, Science 244:1275-1281 , 1989; Eglitis et al., BioTechniques 6:608-614, 1988;
- Epstein-Barr Virus also see, for example, the vectors of Miller, Human Gene Therapy 15-14, 1990; Friedman, Science 244:1275-1281 , 1989; Eglitis et al., BioTechniques 6:608-614, 1988;
- Retroviral vectors are particularly well developed and have been used in clinical settings (Rosenberg et al., N. Engl. J . Med 323:370, 1990; Anderson et al., U.S. Pat. No. 5,399,346).
- Non-viral approaches can also be employed for the expression of a protein in ceil.
- a nucleic acid molecule can be introduced into a cell by administering the nucleic acid in the presence of lipofection (Feigner et al., Proc. Natl. Acad. Sci. U.S.A. 84:741 3, 1987; Ono et a!., Neuroscience Letters 17:259, 1990; Brigham et al., Am. J. Med. Sci. 298:278, 1989;
- RNA molecules can also be potentially beneficial for delivery of DNA into a ceil.
- Transplantation of normal genes into the affected tissues of a subject can also be accomplished by transferring a normal nucleic acid into a cuitivatable ceil type ex vivo (e.g., an autologous or heterologous primary cell or progeny thereof), after which the cell (or its descendants) are injected into a targeted tissue or are injected systemically.
- Recombinant receptors can also be derived or obtained using transposases or targeted nucleases (e.g. Zinc finger nucleases, meganucleases, or TALE nucleases).
- Transient expression may be obtained by RNA
- cDNA expression for use in polynucleotide therapy methods can be directed from any suitable promoter (e.g., the human cytomegalovirus (CMV), simian virus 40 (SV40), or metailothionein promoters), and regulated by any appropriate mammalian regulatory element or intron (e.g. the elongation factor 1c enhancer/promoter/intron structure).
- CMV human cytomegalovirus
- SV40 simian virus 40
- metailothionein promoters regulated by any appropriate mammalian regulatory element or intron (e.g. the elongation factor 1c enhancer/promoter/intron structure).
- enhancers known to preferentially direct gene expression in specific cell types can be used to direct the expression of a nucleic acid.
- the enhancers used can include, without limitation, those that are characterized as tissue- or cell-specific enhancers.
- regulation can be mediated by the cognate regulatory sequences or, if desired, by regulatory sequences derived from a heterologous source, including any of the promoters or regulatory elements described above.
- the resulting cells can then be grown under conditions similar to those for unmodified cells, whereby the modified ceils can be expanded and used for a variety of purposes.
- Also included in the invention are 19z1 , CD19, CD8, CD3 , dsRed, P28BB, PSMA, CD28, 4-1 BB, GFP polypeptides or fragments thereof that are modified in ways that enhance their anti-neopiastic activity when expressed in an immunoresponsive cell.
- the invention provides methods for optimizing an amino acid sequence or nucleic acid sequence by producing an alteration in the sequence. Such alterations may include certain mutations, deletions, insertions, or post-translational modifications.
- the invention further includes analogs of any naturally-occurring polypeptide of the invention. Analogs can differ from a naturally-occurring polypeptide of the invention by amino acid sequence differences, by post-translational modifications, or by both.
- Analogs of the invention will generally exhibit at least 85%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identity with all or part of a naturally-occurring amino, acid sequence of the invention.
- the length of sequence comparison is at least 5, 10, 15 or 20 amino acid residues, preferably at least 25, 50, or 75 amino acid residues, and more preferably more than 100 amino acid residues.
- a BLAST program may be used, with a probability score between e 3 and e " 00 indicating a closely related sequence.
- Modifications include in vivo and in vitro chemical derivatization of polypeptides, e.g., acetylation, carboxyiation, phosphorylation, or giycosylation; such modifications may occur during polypeptide synthesis or processing or following treatment with isolated modifying enzymes.
- Analogs can also differ from the naturally-occurring polypeptides of the invention by alterations in primary sequence.
- the invention also provides fragments of any one of the polypeptides or peptide domains of the invention.
- a fragment means at least 5, 10, 13, or 15 amino acids.
- a fragment is at least 20 contiguous amino acids, at least 30 contiguous amino acids, or at least 50 contiguous amino acids, and in other embodiments at least 60 to 80, 100, 200, 300 or more contiguous amino acids.
- Fragments of the invention can be generated by methods known to those skilled in the art or may result from normal protein processing (e.g., removal of amino acids from the nascent polypeptide that are not required for biological activity or removal of amino acids by alternative mRNA splicing or alternative protein processing events).
- Non-protein analogs have a chemical structure designed to mimic the functional activity of a protein of the invention. Such analogs are administered according to methods of the invention. Such analogs may exceed the
- Co- stimulatory ligands include, without limitation, tumor necrosis factor (TNF) ligands, cytokines (such as IL-2, IL-12, !L-15 or IL21 ), and immunoglobulin (ig) superfamily ligands.
- TNF tumor necrosis factor
- cytokines such as IL-2, IL-12, !L-15 or IL21
- immunoglobulin (ig) superfamily ligands include, without limitation, tumor necrosis factor (TNF) ligands, cytokines (such as IL-2, IL-12, !L-15 or IL21 ), and immunoglobulin (ig) superfamily ligands.
- ig immunoglobulin
- Tumor necrosis factor is a cytokine involved in systemic inflammation and stimulates the acute phase reaction, its primary role is in the regulation of immune cells.
- Tumor necrosis factor (TNF) ligands share a number of common features. The majority of the ligands are synthesized as type II transmembrane proteins (extracelluiarC-terminus) containing a short cytoplasmic segment and a relatively long extracellular region.
- TNF ligands include, without limitation, nerve growth factor (NGF), CD40L (CD40L)/CD154, CD137L/4- 1 BBL, tumor necrosis factor alpha (TNFa), CD134L/OX40L/CD252, CD27L/CD70, Fas ligand (FasL), CD30L/CD153, tumor necrosis factor beta (TNF(3)/iymphotoxin- aipha (LTa), lymphotoxin-beta (ur(3), CD257/B cell-activating factor
- immunoglobulin (Ig) superfamily is a large group of cell surface and soluble proteins that are involved in the recognition, binding, or adhesion processes of cells. These proteins share structural features with immunoglobulins - they possess an immunoglobulin domain (fold). Immunoglobulin superfamily ligands include, without limitation, CD80 and CD86, both ligands for CD28.
- compositions comprising genetically modified immunoresponsive ceils of the invention can be provided systemically or directly to a subject for the treatment of a neoplasia, pathogen infection, or infectious disease.
- ceils of the invention are directly injected into an organ of interest (e.g., an organ affected by a neoplasia).
- compositions comprising genetically modified immunoresponsive cells are provided indirectly to the organ of interest, for example, by administration into the circulatory system (e.g. , the tumor vasculature).
- Expansion and differentiation agents can be provided prior to, during or after administration of the cells to increase production of T cells, NK cells, or CTL cells in vitro or in vivo.
- the modified cells can be administered in any physiologically acceptable vehicle, normaily intravascuiarly, although they may also be introduced into bone or other convenient site where the cells may find an appropriate site for regeneration and differentiation (e.g., thymus). Usuaily, at least 1x10 5 cells will be administered, eventually reaching 1x10 10 , or more.
- Genetically modified immunoresponsive cells of the invention can comprise a purified population of celis. Those skilled in the art can readily determine the percentage of genetically modified immunoresponsive cells in a population using various well-known methods, such as fluorescence activated cell sorting (FACS). Preferable ranges of purity in populations comprising genetically modified immunoresponsive ceils are about 50 to about 55%, about 55 to about 60%, and about 65 to about 70%.
- the purity is about 70 to about 75%, about 75 to about 80%, about 80 to about 85%; and still more preferably the purity is about 85 to about 90%, about 90 to about 95%, and about 95 to about 100%. Dosages can be readily adjusted by those skilled in the art (e.g., a decrease in purity may require an increase in dosage).
- the cells can be introduced by injection, catheter, or the like, if desired, factors can also be included, including, but not limited to, interleukins, e.g. IL-2, IL- 3, IL-6, and IL-1 1 , as well as the other interleukins, the colony stimulating factors, such as G-, M- and GM-CSF, interferons, e.g. .gamma. -interferon and erythropoietin.
- interleukins e.g. IL-2, IL- 3, IL-6, and IL-1 1
- the colony stimulating factors such as G-, M- and GM-C
- compositions of the invention include pharmaceutical compositions comprising genetically modified immunoresponsive celis or their progenitors and a pharmaceutically acceptable carrier.
- Administration can be autologous or heterologous.
- immunoresponsive ceils, or progenitors can be obtained from one subject, and administered to the same subject or a different, compatible subject.
- Peripheral blood derived immunoresponsive cells of the invention or their progeny e.g., in vivo, ex vivo or in vitro derived
- a therapeutic composition of the present invention e.g., a pharmaceutical composition containing a genetically modified immunoresponsive cell
- it will generally be formulated in a unit dosage injectable form (solution, suspension, emulsion).
- compositions of the invention comprising genetically modified immunoresponsive cells can be conveniently provided as sterile liquid preparations, e.g., isotonic aqueous solutions, suspensions, emulsions, dispersions, or viscous compositions, which may be buffered to a selected pH.
- sterile liquid preparations e.g., isotonic aqueous solutions, suspensions, emulsions, dispersions, or viscous compositions, which may be buffered to a selected pH.
- Liquid preparations are normally easier to prepare than gels, other viscous compositions, and solid compositions. Additionally, liquid compositions are somewhat more convenient to administer, especially by injection. Viscous compositions, on the other hand, can be formulated within the appropriate viscosity range to provide longer contact periods with specific tissues.
- Liquid or viscous compositions can comprise carriers, which can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyoi (for example, glycerol, propylene glycol, liquid polyethylene glycol, and the like) and suitable mixtures thereof.
- carriers can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyoi (for example, glycerol, propylene glycol, liquid polyethylene glycol, and the like) and suitable mixtures thereof.
- Sterile injectable solutions can be prepared by incorporating the genetically modified immunoresponsive cells utilized in practicing the present invention in the required amount of the appropriate solvent with various amounts of the other ingredients, as desired.
- Such compositions may be in admixture with a suitable carrier, diluent, or excipient such as sterile water, physioiogical saline, glucose, dextrose, or the like.
- a suitable carrier diluent, or excipient
- the compositions can also be lyophiiized.
- compositions can contain auxiliary substances such as wetting, dispersing, or emulsifying agents (e.g., methylcelluiose), pH buffering agents, gelling or viscosity enhancing additives, preservatives, flavoring agents, colors, and the like, depending upon the route of administration and the preparation desired.
- auxiliary substances such as wetting, dispersing, or emulsifying agents (e.g., methylcelluiose), pH buffering agents, gelling or viscosity enhancing additives, preservatives, flavoring agents, colors, and the like, depending upon the route of administration and the preparation desired.
- Standard texts such as "REMINGTON'S PHARMACEUTICAL SCIENCE", 17th edition, 1985, incorporated herein by reference, may be consulted to prepare suitable preparations, without undue experimentation.
- compositions including antimicrobial preservatives, antioxidants, chelating agents, and buffers, can be added.
- Prevention of the action of microorganisms can be ensured by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, and the like.
- Prolonged absorption of the injectable pharmaceutical form can be brought about by the use of agents delaying absorption, for example, aluminum monostearate and gelatin. According to the present invention, however, any vehicle, diluent, or additive used would have to be compatible with the genetically modified
- compositions can be isotonic, i.e., they can have the same osmotic pressure as blood and lacrimal fluid.
- the desired isotonicity of the compositions of this invention may be accomplished using sodium chloride, or other
- Sodium chloride is preferred particularly for buffers containing sodium ions.
- Viscosity of the compositions can be maintained at the selected level using a pharmaceutically acceptable thickening agent.
- Methyiceiluiose is preferred because it is readily and economically available and is easy to work with.
- suitable thickening agents include, for example, xanthan gum, carboxymethyl cellulose, hydroxypropyl cellulose, carbomer, and the like.
- concentration of the thickener will depend upon the agent selected. The important point is to use an amount that will achieve the selected viscosity.
- suitable carriers and other additives will depend on the exact route of administration and the nature of the particular dosage form, e.g., liquid dosage form (e.g., whether the composition is to be formulated into a solution, a suspension, gel or another liquid form, such as a time release form or liquid-filled form).
- compositions should be selected to be chemically inert and will not affect the viability or efficacy of the genetically modified immunoresponsive cells as described in the present invention. This will present no problem to those skilled in chemical and pharmaceutical principies,or problems can be readily avoided by reference to standard texts or by simple experiments (not involving undue experimentation), from this disclosure and the documents cited herein.
- One consideration concerning the therapeutic use of genetically modified immunoresponsive cells of the invention is the quantity of ceils necessary to achieve an optimal effect. The quantity of ceils to be administered will vary for the subject being treated.
- between 10 4 to 10 10 , between 10 5 to 10 9 , or between 10 6 and 10 s genetically modified immunoresponsive cells of the invention are administered to a human subject. More effective ceils may be administered in even smaller numbers. In some embodiments, at least about 1 x 10 8 , 2 x 10 8 , 3 x 10 8 , 4 x 10 8 , and 5 x 10 8 genetically modified immunoresponsive cells of the invention are administered to a human subject. The precise determination of what would be considered an effective dose may be based on factors individual to each subject, including their size, age, sex, weight, and condition of the particular subject. Dosages can be readily ascertained by those skilled in the art from this disclosure and the knowledge in the art.
- any additives in addition to the active ceil(s) and/or agent(s) are present in an amount of 0.001 to 50 % (weight) solution in phosphate buffered saline, and the active ingredient is present in the order of micrograms to milligrams, such as about 0.0001 to about 5 wt %, preferably about 0.0001 to about 1 wt %, still more preferably about 0.0001 to about 0.05 wt % or about 0.001 to about 20 wt %, preferably about 0.01 to about 10 wt %, and still more preferably about 0.05 to about 5 wt %.
- any composition to be administered to an animal or human, and for any particular method of
- toxicity such as by determining the lethal dose (LD) and LD50 in a suitable animal model e.g., rodent such as mouse; and, the dosage of the composition(s), concentration of components therein and timing of administering the composition(s), which elicit a suitable response.
- kits for treating neoplasia in a subject are also contemplated herein.
- methods for treating a pathogen infection or other infectious disease in a subject comprise administering a T cell, NK cell, or CTL cell of the invention in an amount effective to achieve the desired effect, be it palliation of an existing condition or prevention of recurrence.
- the amount administered is an amount effective in producing the desired effect.
- An effective amount can be provided in one or a series of administrations.
- An effective amount can be provided in a bolus or by continuous perfusion.
- an “effective amount” is an amount sufficient to effect a beneficial or desired clinicai result upon treatment.
- An effective amount can be administered to a subject in one or more doses.
- an effective amount is an amount that is sufficient to palliate, ameliorate, stabilize, reverse or slow the progression of the disease, or otherwise reduce the pathological consequences of the disease.
- the effective amount is generally determined by the physician on a case-by-case basis and is within the skill of one in the art. Several factors are typically taken into account when
- determining an appropriate dosage to achieve an effective amount include age, sex and weight of the subject, the condition being treated, the severity of the condition and the form and effective concentration of the antigen-binding fragment administered.
- ceil doses in the range of 10 6 — 10 10 are typically infused.
- T cells are induced that are specifically directed against the specific antigen.
- "Induction" of T cells can include inactivation of antigen-specific T ceils such as by deletion or anergy. inactivation is particularly useful to establish or reestablish tolerance such as in autoimmune disorders.
- the modified cells can be administered by any method known in the art including, but not limited to, intravenous, subcutaneous, intranodal, intratumorai, intrathecal, intrapleural, intraperitoneal and directly to the thymus.
- the invention provides methods for increasing an immune response in a subject in need thereof.
- the invention provides methods for treating or preventing a neoplasia in a subject.
- the invention provides therapies that are particularly useful for the treatment of subjects having prostate cancer, or metastatic prostate cancer that is not amenable to conventional therapeutic interventions.
- Suitabiehuman subjects for therapy typically comprise two treatment groups that can be distinguished by clinical criteria. Subjects with "advanced disease” or "high tumor burden” are those who bear a clinically measurable tumor.
- a clinically measurable tumor is one that can be detected on the basis of tumor mass (e.g., by palpation, CAT scan, sonogram, mammogram or X-ray; positive biochemical or histopathologic markers on their own are insufficient to identify this population).
- composition embodied in this invention is administered to these subjects to elicit an anti-tumor response, with the objective of palliating their condition.
- reduction in tumor mass occurs as a result, but any clinical improvement constitutes a benefit.
- Clinical improvement includes decreased risk or rate of progression or reduction in pathological
- adjuvant group are individuals who have had a history of neoplasia, but have been responsive to another mode of therapy.
- the prior therapy can have included, but is not restricted to, surgical resection, radiotherapy, and traditional chemotherapy. As a result, these individuals have no clinically measurable tumor. However, they are suspected of being at risk for
- This group can be further subdivided into high-risk and iow-risk individuals. The subdivision is made on the basis of features observed before or after the initial treatment. These features are known in the clinical arts, and are suitably defined for each different neoplasia. Features typical of high-risk subgroups are those in which the tumor has invaded neighboring tissues, or who show involvement of lymph nodes.
- Another group have a genetic predisposition to neoplasia but have not yet evidenced clinical signs of neoplasia. For instance, women testing positive for a genetic mutation associated with breast cancer, but still of childbearing age, can wish to receive one or more of the antigen-binding fragments described herein in treatment prophylacticaliy to prevent the occurrence of neoplasia until it is suitable to perform preventive surgery.
- glioblastoma melanoma
- neuroblastoma adenocarcinoma
- glioma soft tissue sarcoma
- various carcinomas including prostate and small cell lung cancer
- Suitable carcinomas further include any known in the field of oncology, including, but not limited to, astrocytoma,
- fibrosarcoma myxosarcoma, liposarcoma, oligodendroglioma, ependymoma, medullobiastoma, primitive neural ectodermal tumor (PNET), chondrosarcoma, osteogenic sarcoma, pancreatic ductal adenocarcinoma, small and large cell lung adenocarcinomas, chordoma, angiosarcoma, endotheliosarcoma, squamous cell carcinoma, bronchoalveolarcarcinoma, epithelial adenocarcinoma, and liver metastases thereof, lymphangiosarcoma, iymphangioendotheliosarcoma, hepatoma, cholangiocarcinoma, synovioma, mesothelioma, Ewing's tumor, rhabdomyosarcoma, colon carcinoma, basal cell carcinoma, sweat gland carcinoma, papillar
- craniopharyngioma ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, meningioma, neuroblastoma, retinoblastoma, leukemia, multiple myeloma, Waldenstrom's macroglobuiinemia, and heavy chain disease
- breast tumors such as ductal and lobular adenocarcinoma, squamous and adenocarcinomas of the uterine cervix, uterine and ovarian epithelial carcinomas, prostatic adenocarcinomas, transitional squamous cell carcinoma of the bladder, B and T cell lymphomas (nodular and diffuse) plasmacytoma, acute and chronic leukemias, malignant melanoma, soft tissue sarcomas and leiomyosarcomas.
- the subjects can have an advanced form of disease, in which case the treatment objective can include mitigation or reversal of disease progression, and/or amelioration of side effects.
- the subjects can have a history of the condition, for which they have already been treated, in which case the therapeutic objective will typically include a decrease or delay in the risk of recurrence.
- the invention provides a method of treating or preventing a neoplasia in a subject, the method comprising administering an effective amount of an immunoresponsive cell comprising a receptor that binds a tumor antigen and activates the immunoresponsive ceil (e.g., TCR, CAR) and a vector encoding a receptor that binds another tumor antigen and stimulates the immunoresponsive cell, in one embodiment, the neoplasia is selected from the group consisting of prostate cancer, breast cancer, blood cancers (e.g.
- leukemias lymphomas, and myelomas
- ovarian cancer bladder cancer, brain cancer, colon cancer, intestinal cancer, liver cancer, lung cancer, pancreatic cancer, prostate cancer, skin cancer, stomach cancer, glioblastoma, and throat cancer.
- the tumor antigen is one or more of carbonic anhydrase IX (CAIX), carcinoembryonic antigen (CEA), CD5, CD7, CD10, CD19, CD20, CD22, CD30, CD33, CD34, CD38, CD41 , CD44, CD49f, CD56, CD74, CD133, CD138, an antigen of a cytomegalovirus (CMV) infected cell (e.g., a cell surface antigen), epithelial giycoprotein-2 (EGP-2), epithelial glycoprotein-40 (EGP-40), epithelial cell adhesion molecule (EpCAM), receptor tyrosine-protein kinases erb-B2,3,4, foiate-binding protein (FBP), fetal acetylcholine receptor (AChR), folate receptor-a, Gangiioside G2 (GD2), Gangiioside G3 (GD3), human Epidermal Growth Factor Receptor 2 (HER-2
- adoptively transferred human T or NK cells are endowed with augmented and selective cytolytic activity at the tumor site.
- a receptor that binds a tumor antigen and activates the immunoresponsive ceil e.g., TCR, CAR
- a vector encoding a receptor that binds another tumor antigen and stimulates the immunoresponsive cell e.g. CCR
- adoptively transferred human T or NK cells are endowed with augmented and selective cytolytic activity at the tumor site.
- co-stimulatory ligandexpressing T ceils turn the tumor or viral infection site into a highly conductive environment for a wide range of immune ceils involved in the physiological anti-tumor or antiviral response (tumor infiltrating lymphocytes, NK-, NKT- cells, dendritic cells, and macrophages).
- the invention provides methods for treating subjects with a pathogen infection (e.g., viral infection, bacterial infection, fungal infection, parasite infection, or protozoa! infection).
- a pathogen infection e.g., viral infection, bacterial infection, fungal infection, parasite infection, or protozoa! infection.
- the invention is particularly useful for enhancing an immune response in an
- Exemplary viral infections susceptible to treatment using a method of the invention include, but are not limited to, Cytomegalovirus (CMV), Epstein Barr Virus (EBV), Human Immunodeficiency Virus (HIV), and influenza virus infections.
- CMV Cytomegalovirus
- EBV Epstein Barr Virus
- HAV Human Immunodeficiency Virus
- influenza virus infections include, but are not limited to, influenza virus infections.
- the invention provides a method of treating or preventing a pathogen infection in a subject, the method comprising administering an effective amount of an immunoresponsive cell as described herein.
- kits for the treatment or prevention of a neoplasia, pathogen infection, immune disorder or allogeneic transplant includes a therapeutic or prophylactic composition containing an effective amount of an immunoresponsive cell comprising an activating antigen receptor and a co-stimulatory antigen receptor in unit dosage form.
- the kit further comprise a co-stimulatory ligand.
- the kit comprises a sterile container which contains a
- Such containers can be boxes, ampules, bottles, vials, tubes, bags, pouches, blister-packs, or other suitable container forms known in the art.
- Such containers can be made of plastic, glass, laminated paper, metal foil, or other materials suitable for holding
- the immunoresponsive cell is provided together with instructions for administering the ceil to a subject having or at risk of developing a neoplasia, pathogen infection, immune disorder or allogeneic transplant.
- the instructions will generally include information about the use of the composition for the treatment or prevention of neoplasia, pathogen infection, immune disorder or allogeneic transplant.
- the instructions include at least one of the foliowing: description of the therapeutic agent; dosage schedule and administration for treatment or prevention of a neoplasia, pathogen infection, immune disorder or allogeneic transplant or symptoms thereof; precautions; warnings; indications; counter-indications; overdosage information; adverse reactions; animal pharmacology; clinical studies; and/or references.
- the instructions may be printed directly on the container (when present), or as a label applied to the container, or as a separate sheet, pamphlet, card, or folder supplied in or with the container.
- Example 1 T cells co-expressing a chimeric antigen receptor (CAR) and a chimeric co-stimulating receptor (CCR) eradicated established tumors.
- CAR chimeric antigen receptor
- CCR chimeric co-stimulating receptor
- the invention provides "tumor-sensing T ceils" that simultaneously engage two antigens co-expressed by a tumor ceil. Importantly, it has been found that the reactivity against tissues expressing either antigen alone should be negligible, only unleashing T cell activation in the presence of both antigens but not either one alone.
- the invention is at least based in part on the discoveries that in combination provide selective T ceil immunoreactivity, and, thus, make this approach clinically relevant.
- the first is to assign T cell activation to one antigen (e.g., CD19 or prostate stem cell antigen, PSCA), which may be mediated by a T cell receptor (TCR) or a chimeric antigen receptor (CAR). Costimulation is independently mediated by a "chimeric costimuiatory receptor" (CCR ), 2,13 which is targeted to a second antigen (e.g., prostate-specific membrane antigen, PSMA).
- TCR T cell receptor
- CAR chimeric antigen receptor
- mice were systemicaily engrafted with 2.0 x 10 6 firefly-!uciferase expressing PC3 tumor cells that expressed both CD19 and PSMA ( Figure 5) and treated 19 days later with a single intravenous infusion of 1 .0 x 10 6 19z1 , 19z1 +P28BB, P28BB or control T cells. Thirty-five days later, mice that received P28BB T cells or control T cells were sacrificed due to tumor burden.
- mice treated with 19z1 T cells had a marked reduction of tumor burden.
- mice treated with 19z1 +P28BB T cells had undetectable tumor burden (Figure 2C).
- the CD19 + tumors eventually relapsed in mice that received 19z1 T cells, while complete remission persisted in ail mice that received 19z1 +P28BB T cells ( Figure 2C). This result strongly indicated that tumor eradication had been achieved.
- mice were administered one of 19z1 , P28BB, or 19z1 +P28BB T cells (1 .0 x 10 6 cells) intravenously. Mice that received P28BB T cells had progression of all three tumors and needed to be sacrificed within 35 days ( Figure 2D).
- the CD19 + PSMA ⁇ and CD19 + PSMA + tumors underwent a substantial reduction compared to their progression in recipients of P28BB T cells, before eventually progressing. Consistent with prior results, mice treated with 19z1 +P28BB T cells showed complete eradication of CD19 + PSMA + tumors.
- mice were inoculated intravenously with 2 x 106 FFLuc-expressing PC3 cells positive for PSMA, PSCA, or both (Figure 5).
- one set of mice received 1 x 106 Mzl+P28BB CAR+ T cells infused intravenously, and another set of received 1 x 106 Lz1 +P28BB CARP T cells.
- Mice bearing PSCA+PSMA tumor cells that were treated with the more efficient Mzl+P28BB T cells exhibited greater tumor regression than mice treated with Lz1 +PBB T cells (Figure 3C). Similar to the CD19 experiment ( Figure 2C), these tumors eventually relapsed and progressed.
- mice bearing PSCA+PSMA+ tumor celis Mzl+P28BB T ceils induced robust and long-term tumor eradication. Consistent with the lesser potency of Lzl+P28BB T ceils, tumor eradication in mice bearing PSCA+PSMA+ tumor cells treated with Lz1 +P28BB T cells was slower but nonetheless equally successful, resulting in strong tumor eradication and long-term survival of ail treated mice ( Figure 3C). Tumor eradication was not enhanced in control mice bearing either PSCAVSMA- or PSCA-PSMA+ tumors ( Figure 3C). A more stringent evaluation of background activity against PSCAVSMA.- tumors was tested in the context of animals also bearing PSCA+PSMA+ and PSCAPSMA+ tumors. Lz1 +P28BB T cells mediated eradication of PSCA+PSMA+ tumors without increasing eradication of PSCA+PSMA tumors ( Figure 3E), which was not different from that induced by Lzl T celis.
- Targeted T ceil therapies have the potential to provide curative treatments but their applicability is limited by the paucity of validated tumor-specific targets. Extra- tumoral expression results indeed in "on-target, off-tumor” effects that 2-4" may be sometimes tolerable but are eventually lethal 11.
- the method described herein provides improved targeting by supplying titrated activation and
- T ceils are primed in lymph nodes by receiving activating and costimuiatory signals and migrate to peripheral sites, where effector functions of the T cells are not as dependent on costimuiation.
- T cells engaged through an antigen receptor and a CCR may recirculate to other peripheral sites and display heightened cytolytic activity against tissues expressing only one of the targeted antigens (Figure 6A). Therefore, the present strategy was developed to address this problem of a potential systemic effect in order to spare cells singly positive for the antigen, including non-tumor cells (Figure 6B).
- PSCA and PSMA are promising targets for the treatment of metastatic prostate cancer 26 ' 27 , although neither is absolutely prostate-specific.
- PSCA expression is found in prostate cancer and within the renal pelvis, ureter, urinary bladder, and urethra.
- Expression of PSMA strongly correlates with primary prostate cancer, metastases, as well as in astrocytes type II, the kidney proximal tubule and the intestinal brush border.
- Dual PSCA/PSMA targeting is thus expected to increase prostate cancer targeting and reduce reactivity against these normal tissues. It is appreciated that this principle can be extended to other tumor types which express a pair of antigens, especially those that confer true tumor-specificity.
- HER2, MUC1 , CD44, CD49f, and/or EpCAM could be used in this manner to treat breast cancer.
- mesothelin, folate receptor-a, CD44, and/or CD133 could be used to treat ovarian cancer.
- 32 ' 33 The targeting of tumor initiating cells or cancer stem cells, for which unique target antigens/structures have not yet been clearly identified34.3s would be particularly attractive using this approach.
- An important aspect of this approach is to constrain and nearly abolish T cell activation in response to a single antigen. CARs with low affinity or low avidity that only provide a poor activation signal were found to be usefui for achieving this effect.
- an endogenous TCR with low affinity or low avidity may be used in combination with a CCR to provide antigen-specific costimulation.
- This backbone construct was used to exchange scFvs to generate SFG-Hzl, SFG-Mzl, and SFG-Lzl by directional cloning utilizing a Ncol site located 5' of the scFv and a Nod site located 3' of the scFv.
- SFG- P28BB the fused CD28 and CD137 domains were PCR amplified from SFG- P28BBz1 and iigated 3' of the PSMA scFv using a 5' Ncol site and a 3' BamHI site to include a stop codon 3' of the BB domain, while the CD3 domain was removed.
- VH variabie heavy
- VL variabie light
- Hzl, Mzl, and Lzl were generated byampiifying the variabie heavy (VH) and variabie light (VL) domains conferring PSCA antigen specificity of non-overlapping epitopes using degenerate primers from hybridomas as previously described. 36 These VH and V
- Peripherai blood leukocytes were isolated using Ficoli gradients and transduced as previously described. Briefly, after 48-hour activation with 2 &g/ml_ phytohemagglutinin, cells were transduced twice via spinocuiation for 1 hour on retronectin coated plates over the next 48 hours and 20 U/mL of lL-2 was added. After allowing 3 days for vector expression, transduction efficiencies were determined via flow cytometry and bulk unsorted ceils were used for various assays or adoptive transfers.
- PC3 human prostate tumor line was obtained from ATCC and retrovirally 16 transduced in order to generate PC3 -GFP/Luc, which was subsequently used to create 10 PC3-CD19, PC3-PSMA, PC3-CD19-PSMA, PC3- PSCA, and PC3-PSCA-PSMA via retroviral transduction.
- Target cells expressing desired antigen were labeled with 5 Cr and co- cultured with T cells at decreasing effector : target ratio's. After 4 hours of culture, supernatant was removed and used to measure radioactivity released from chromium. Specific lysis was determined by subtracting background radioactivity of target celis not cultured with T cells and dividing by the radioactivity measured from target cells completely Iysed by using 0.2% Triton X-100.
- Tumor celis expressing desired antigen were irradiated with 30 Gy prior to co-culture with 1.0 x 10 6 T cells at a 5:1 effector : target ratio. T cells were counted weekly using an Invitrogen Countess cell counter and then re-stimuiated with irradiated tumor celis. No exogenous cytokines were added to these co- cultures.
- PC3 tumor cells were infused into NOD/SCID-IL2Ry mice obtained from either Jackson Laboratories or from in-house breeding under the protocol 04-10- 024 approved by the MSKCC Institutional Animal Care and Use Committee.
- 1.0 x 10 6 tumor cells were injected per tumor site, established for 7 days upon which 1.0 x 10 6 chimeric positive T ceils were infused IV.
- tumor burden quantitativeiy measure tumor burden by correlating the amount of tumor burden to luminescence using an S 100 system (Caliper Life Sciences) as previously described.
- S 100 system Caliper Life Sciences
- Tumor volume was calculated by multiplying the length, width, and height of each tumor.
- Bispecific antibodies containing a PSCA specific scFv fused to a CD3 specific scFv were added at various amounts to untransduced T cells co-cultured with PSCA + PC3 at a 20:1 ratio, respectively in standard 4hr chromium release assay assays.
- Cells were analyzed using an LSRII flow cytometer or sorted using a FACSAria cell sorter (BD Biosciences) as previously described. 16 Detection of chimeric receptor at the cell surface could be achieved directly by using AF647 conjugated goat-anti-mouse antibody (invitrogen). Antibodies for CD4-PE-Cy7, CD8-Pacific Blue, and CD19-APC were obtained from Invitrogen while PSCA antibodies were purified from hybridoma supernatants and PSMA antibodies were obtained from MBL Interantional.
- Ciinicai cancer research an official journal of the American Association for Cancer Research 16, 3533-3538 (2010).
- Ciinicai cancer research an official journal of the American Association for Cancer Research 11 , 2591-2596 (2005).
- Ciinicai cancer research :
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Microbiology (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Oncology (AREA)
- Cell Biology (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Developmental Biology & Embryology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Reproductive Health (AREA)
- Gynecology & Obstetrics (AREA)
- Pregnancy & Childbirth (AREA)
- General Engineering & Computer Science (AREA)
- Hematology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Vascular Medicine (AREA)
- Virology (AREA)
Abstract
Description
Claims
Priority Applications (23)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
JP2015534828A JP6441802B2 (en) | 2012-10-02 | 2013-10-02 | Compositions and methods for immunotherapy |
KR1020157011160A KR102198058B1 (en) | 2012-10-02 | 2013-10-02 | Compositions and methods for immunotherapy |
EP19179456.9A EP3597215A1 (en) | 2012-10-02 | 2013-10-02 | Compositions and methods for immunotherapy |
CN201380063036.8A CN104853766A (en) | 2012-10-02 | 2013-10-02 | Compositions and methods for immunotherapy |
MX2015004287A MX370148B (en) | 2012-10-02 | 2013-10-02 | Compositions and methods for immunotherapy. |
CA2886859A CA2886859C (en) | 2012-10-02 | 2013-10-02 | Compositions and methods for immunotherapy |
EP13844468.2A EP2903637B1 (en) | 2012-10-02 | 2013-10-02 | Compositions and methods for immunotherapy |
SG11201502598SA SG11201502598SA (en) | 2012-10-02 | 2013-10-02 | Compositions and methods for immunotherapy |
RU2015116901A RU2729401C2 (en) | 2012-10-02 | 2013-10-02 | Compositions and methods for immunotherapy |
NZ706541A NZ706541A (en) | 2012-10-02 | 2013-10-02 | Compositions and methods for immunotherapy |
ES13844468T ES2743738T3 (en) | 2012-10-02 | 2013-10-02 | Compositions and methods for immunotherapy |
AU2013327136A AU2013327136A1 (en) | 2012-10-02 | 2013-10-02 | Compositions and methods for immunotherapy |
IL238047A IL238047B (en) | 2012-10-02 | 2015-03-30 | Compositions and methods for immunotherapy |
US14/676,255 US10654928B2 (en) | 2012-10-02 | 2015-04-01 | Compositions and methods for immunotherapy |
PH12015500747A PH12015500747A1 (en) | 2012-10-02 | 2015-04-06 | Compositions and methods for immunotherapy |
ZA201502880A ZA201502880B (en) | 2012-10-02 | 2015-04-28 | Compositions and methods for immunotherapy |
HK15109439.3A HK1208631A1 (en) | 2012-10-02 | 2015-09-24 | Compositions and methods for immunotherapy |
AU2018204297A AU2018204297B2 (en) | 2012-10-02 | 2018-06-15 | Compositions and methods for immunotherapy |
PH12019502424A PH12019502424A1 (en) | 2012-10-02 | 2019-10-25 | Compositions and methods for immunotherapy |
IL272539A IL272539B (en) | 2012-10-02 | 2020-02-07 | Compositions and methods for immunotherapy |
US16/847,059 US11712469B2 (en) | 2012-10-02 | 2020-04-13 | Compositions and methods for immunotherapy |
AU2020294287A AU2020294287B2 (en) | 2012-10-02 | 2020-12-24 | Compositions and methods for immunotherapy |
US18/333,753 US20240091353A1 (en) | 2012-10-02 | 2023-06-13 | Compositions and methods for immunotherapy |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201261709072P | 2012-10-02 | 2012-10-02 | |
US61/709,072 | 2012-10-02 |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/676,255 Continuation US10654928B2 (en) | 2012-10-02 | 2015-04-01 | Compositions and methods for immunotherapy |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2014055668A1 true WO2014055668A1 (en) | 2014-04-10 |
Family
ID=50435409
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2013/063097 WO2014055668A1 (en) | 2012-10-02 | 2013-10-02 | Compositions and methods for immunotherapy |
Country Status (17)
Country | Link |
---|---|
US (3) | US10654928B2 (en) |
EP (2) | EP3597215A1 (en) |
JP (5) | JP6441802B2 (en) |
KR (1) | KR102198058B1 (en) |
CN (3) | CN112430580A (en) |
AU (3) | AU2013327136A1 (en) |
CA (1) | CA2886859C (en) |
ES (1) | ES2743738T3 (en) |
HK (1) | HK1208631A1 (en) |
IL (2) | IL238047B (en) |
MX (1) | MX370148B (en) |
NZ (2) | NZ746914A (en) |
PH (2) | PH12015500747A1 (en) |
RU (2) | RU2020124583A (en) |
SG (1) | SG11201502598SA (en) |
WO (1) | WO2014055668A1 (en) |
ZA (1) | ZA201502880B (en) |
Cited By (259)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2014134165A1 (en) * | 2013-02-26 | 2014-09-04 | Memorial Sloan-Kettering Cancer Center | Compositions and methods for immunotherapy |
WO2015188119A1 (en) * | 2014-06-06 | 2015-12-10 | Bluebird Bio, Inc. | Improved t cell compositions |
WO2015188141A2 (en) | 2014-06-06 | 2015-12-10 | Memorial Sloan-Kettering Cancer Ceneter | Mesothelin-targeted chimeric antigen receptors and uses thereof |
WO2016033570A1 (en) | 2014-08-28 | 2016-03-03 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for cd19 |
WO2016064929A1 (en) | 2014-10-20 | 2016-04-28 | Juno Therapeutics, Inc. | Methods and compositions for dosing in adoptive cell therapy |
WO2016073602A2 (en) | 2014-11-05 | 2016-05-12 | Juno Therapeutics, Inc. | Methods for transduction and cell processing |
WO2016090190A1 (en) | 2014-12-03 | 2016-06-09 | Juno Therapeutics, Inc. | Methods and compositions for adoptive cell therapy |
WO2016115559A1 (en) | 2015-01-16 | 2016-07-21 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for ror1 |
WO2016115177A1 (en) | 2015-01-12 | 2016-07-21 | Juno Therapeutics, Inc. | Modified hepatitis post-transcriptional regulatory elements |
WO2016138034A1 (en) * | 2015-02-24 | 2016-09-01 | The Regents Of The University Of California | Binding-triggered transcriptional switches and methods of use thereof |
WO2016168493A1 (en) * | 2015-04-15 | 2016-10-20 | Prospect CharterCare RWMC, LLC d/b/a Roger Williams Medical Center | Hepatic arterial infusion of car-t cells |
WO2016166568A1 (en) | 2015-04-16 | 2016-10-20 | Juno Therapeutics Gmbh | Methods, kits and apparatus for expanding a population of cells |
WO2016172606A1 (en) * | 2015-04-23 | 2016-10-27 | Baylor College Of Medicine | Cd5 chimeric antigen receptor for adoptive t cell therapy |
WO2016196388A1 (en) | 2015-05-29 | 2016-12-08 | Juno Therapeutics, Inc. | Composition and methods for regulating inhibitory interactions in genetically engineered cells |
US9546206B2 (en) | 2014-08-08 | 2017-01-17 | The Board Of Trustees Of The Leland Stanford Junior University | High affinity PD-1 agents and methods of use |
WO2017021701A1 (en) * | 2015-07-31 | 2017-02-09 | King's College London | Therapeutic agents |
WO2017040945A1 (en) | 2015-09-04 | 2017-03-09 | Memorial Sloan Kettering Cancer Center | Immune cell compositions and methods of use |
WO2017053906A1 (en) | 2015-09-24 | 2017-03-30 | Abvitro Llc | Hiv antibody compositions and methods of use |
CN106574272A (en) * | 2014-08-29 | 2017-04-19 | 哥莫阿波单克隆有限责任公司 | Universal chimeric antigen receptor expressing immune cells for targeting of diverse multiple antigens and method of manufacturing the same and use of the same for treatment of cancer, infections and autoimmune disorders |
WO2017068419A2 (en) | 2015-10-22 | 2017-04-27 | Juno Therapeutics Gmbh | Methods, kits, agents and apparatuses for transduction |
WO2017068421A1 (en) | 2015-10-22 | 2017-04-27 | Juno Therapeutics Gmbh | Methods for culturing cells and kits and apparatus for same |
WO2017068425A1 (en) | 2015-10-22 | 2017-04-27 | Juno Therapeutics Gmbh | Methods for culturing cells and kits and apparatus for same |
WO2017079703A1 (en) | 2015-11-05 | 2017-05-11 | Juno Therapeutics, Inc. | Vectors and genetically engineered immune cells expressing metabolic pathway modulators and uses in adoptive cell therapy |
WO2017079705A1 (en) | 2015-11-05 | 2017-05-11 | Juno Therapeutics, Inc. | Chimeric receptors containing traf-inducing domains and related compositions and methods |
WO2017096327A2 (en) | 2015-12-03 | 2017-06-08 | Juno Therapeutics, Inc. | Compositions and methods for reducing immune responses against cell therapies |
WO2017096329A1 (en) | 2015-12-03 | 2017-06-08 | Juno Therapeutics, Inc. | Modified chimeric receptors and related compositions and methods |
WO2017120501A1 (en) | 2016-01-07 | 2017-07-13 | Mayo Foundation For Medical Education And Research | Methods of treating cancer with interferon |
CN107002045A (en) * | 2014-12-24 | 2017-08-01 | Ucl商务股份有限公司 | Cell |
WO2017161212A1 (en) | 2016-03-16 | 2017-09-21 | Juno Therapeutics, Inc. | Methods for adaptive design of a treatment regimen and related treatments |
WO2017161208A1 (en) | 2016-03-16 | 2017-09-21 | Juno Therapeutics, Inc. | Methods for determining dosing of a therapeutic agent and related treatments |
WO2017165571A1 (en) | 2016-03-22 | 2017-09-28 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Early intervention methods to prevent or ameliorate toxicity |
US9777061B2 (en) | 2014-07-21 | 2017-10-03 | Novartis Ag | Treatment of cancer using a CD33 chimeric antigen receptor |
WO2017173091A1 (en) | 2016-03-30 | 2017-10-05 | Musc Foundation For Research Development | Methods for treatment and diagnosis of cancer by targeting glycoprotein a repetitions predominant (garp) and for providing effective immunotherapy alone or in combination |
WO2017193107A2 (en) | 2016-05-06 | 2017-11-09 | Juno Therapeutics, Inc. | Genetically engineered cells and methods of making the same |
JP2017533706A (en) * | 2014-10-31 | 2017-11-16 | ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア | Methods and compositions for modified T cells |
WO2017205846A1 (en) | 2016-05-27 | 2017-11-30 | Aadigen, Llc | Peptides and nanoparticles for intracellular delivery of genome-editing molecules |
WO2017214207A2 (en) | 2016-06-06 | 2017-12-14 | Juno Therapeutics, Inc. | Methods for the treatment of b cell malignancies using adoptive cell therapy |
WO2018005559A1 (en) | 2016-06-27 | 2018-01-04 | Juno Therapeutics, Inc. | Method of identifying peptide epitopes, molecules that bind such epitopes and related uses |
WO2018005556A1 (en) | 2016-06-27 | 2018-01-04 | Juno Therapeutics, Inc. | Mhc-e restricted epitopes, binding molecules and related methods and uses |
WO2018023093A1 (en) | 2016-07-29 | 2018-02-01 | Juno Therapeutics, Inc. | Immunomodulatory polypeptides and related compositions and methods |
WO2018023100A2 (en) | 2016-07-29 | 2018-02-01 | Juno Therapeutics, Inc. | Anti-idiotypic antibodies and related methods |
WO2018023094A1 (en) | 2016-07-29 | 2018-02-01 | Juno Therapeutics, Inc. | Methods for assessing the presence or absence of replication competent virus |
WO2018027036A1 (en) * | 2016-08-03 | 2018-02-08 | Dipersio John F | Gene editing of car-t cells for the treatment of t cell malignancies with chimeric antigen receptors |
WO2018049420A1 (en) | 2016-09-12 | 2018-03-15 | Juno Therapeutics, Inc. | Perfusion bioreactor bag assemblies |
WO2018063985A1 (en) | 2016-09-28 | 2018-04-05 | Atossa Genetics Inc. | Methods of adoptive cell therapy |
WO2018067618A1 (en) | 2016-10-03 | 2018-04-12 | Juno Therapeutics, Inc. | Hpv-specific binding molecules |
CN107922488A (en) * | 2015-04-02 | 2018-04-17 | 纪念斯隆-凯特琳癌症中心 | TNFRSF14/HVEM albumen and its application method |
WO2018071873A2 (en) | 2016-10-13 | 2018-04-19 | Juno Therapeutics, Inc. | Immunotherapy methods and compositions involving tryptophan metabolic pathway modulators |
WO2018085731A2 (en) | 2016-11-03 | 2018-05-11 | Juno Therapeutics, Inc. | Combination therapy of a t cell therapy and a btk inhibitor |
WO2018093591A1 (en) | 2016-11-03 | 2018-05-24 | Juno Therapeutics, Inc. | Combination therapy of a cell based therapy and a microglia inhibitor |
WO2018102786A1 (en) | 2016-12-03 | 2018-06-07 | Juno Therapeutics, Inc. | Methods for modulation of car-t cells |
WO2018102785A2 (en) | 2016-12-03 | 2018-06-07 | Juno Therapeutics, Inc. | Methods and compositions for use of therapeutic t cells in combination with kinase inhibitors |
WO2018102787A1 (en) | 2016-12-03 | 2018-06-07 | Juno Therapeutics, Inc. | Methods for determining car-t cells dosing |
WO2018102612A1 (en) | 2016-12-02 | 2018-06-07 | Juno Therapeutics, Inc. | Engineered b cells and related compositions and methods |
WO2018106732A1 (en) | 2016-12-05 | 2018-06-14 | Juno Therapeutics, Inc. | Production of engineered cells for adoptive cell therapy |
AU2014214850B2 (en) * | 2013-02-06 | 2018-06-14 | Celgene Corporation | Modified T lymphocytes having improved specificity |
EP3336107A1 (en) | 2016-12-15 | 2018-06-20 | Miltenyi Biotec GmbH | Immune cells expressing an antigen binding receptor and a chimeric costimulatory receptor |
WO2018132518A1 (en) | 2017-01-10 | 2018-07-19 | Juno Therapeutics, Inc. | Epigenetic analysis of cell therapy and related methods |
WO2018134691A2 (en) | 2017-01-20 | 2018-07-26 | Juno Therapeutics Gmbh | Cell surface conjugates and related cell compositions and methods |
JP2018522567A (en) * | 2015-08-07 | 2018-08-16 | シアトル チルドレンズ ホスピタル, ディービーエー シアトル チルドレンズ リサーチ インスティテュート | Bispecific CAR T cells targeting solid tumors |
WO2018157171A2 (en) | 2017-02-27 | 2018-08-30 | Juno Therapeutics, Inc. | Compositions, articles of manufacture and methods related to dosing in cell therapy |
WO2018165228A1 (en) | 2017-03-08 | 2018-09-13 | Memorial Sloan Kettering Cancer Center | Immune cell compositions and methods of use |
WO2018170188A2 (en) | 2017-03-14 | 2018-09-20 | Juno Therapeutics, Inc. | Methods for cryogenic storage |
WO2018167486A1 (en) | 2017-03-15 | 2018-09-20 | Oxford Biomedica (Uk) Limited | Method |
WO2018187791A1 (en) | 2017-04-07 | 2018-10-11 | Juno Therapeutics, Inc | Engineered cells expressing prostate-specific membrane antigen (psma) or a modified form thereof and related methods |
WO2018191723A1 (en) | 2017-04-14 | 2018-10-18 | Juno Therapeutics, Inc. | Methods for assessing cell surface glycosylation |
WO2018195175A1 (en) | 2017-04-18 | 2018-10-25 | FUJIFILM Cellular Dynamics, Inc. | Antigen-specific immune effector cells |
WO2018200583A1 (en) * | 2017-04-26 | 2018-11-01 | Eureka Therapeutics, Inc. | Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof |
WO2018197949A1 (en) | 2017-04-27 | 2018-11-01 | Juno Therapeutics Gmbh | Oligomeric particle reagents and methods of use thereof |
US10117896B2 (en) | 2012-10-05 | 2018-11-06 | The Trustees Of The University Of Pennsylvania | Use of a trans-signaling approach in chimeric antigen receptors |
WO2018204427A1 (en) | 2017-05-01 | 2018-11-08 | Juno Therapeutics, Inc. | Combination of a cell therapy and an immunomodulatory compound |
US20180348227A1 (en) * | 2016-08-04 | 2018-12-06 | Memorial Sloan-Kettering Cancer Center | Cancer antigen targets and uses thereof |
WO2018223101A1 (en) | 2017-06-02 | 2018-12-06 | Juno Therapeutics, Inc. | Articles of manufacture and methods for treatment using adoptive cell therapy |
WO2018223098A1 (en) | 2017-06-02 | 2018-12-06 | Juno Therapeutics, Inc. | Articles of manufacture and methods related to toxicity associated with cell therapy |
WO2018234370A1 (en) | 2017-06-20 | 2018-12-27 | Institut Curie | Immune cells defective for suv39h1 |
WO2019006427A1 (en) | 2017-06-29 | 2019-01-03 | Juno Therapeutics, Inc. | Mouse model for assessing toxicities associated with immunotherapies |
WO2019027850A1 (en) | 2017-07-29 | 2019-02-07 | Juno Therapeutics, Inc. | Reagents for expanding cells expressing recombinant receptors |
WO2019032929A1 (en) | 2017-08-09 | 2019-02-14 | Juno Therapeutics, Inc. | Methods and compositions for preparing genetically engineered cells |
WO2019032927A1 (en) | 2017-08-09 | 2019-02-14 | Juno Therapeutics, Inc. | Methods for producing genetically engineered cell compositions and related compositions |
WO2019046832A1 (en) | 2017-09-01 | 2019-03-07 | Juno Therapeutics, Inc. | Gene expression and assessment of risk of developing toxicity following cell therapy |
WO2019051335A1 (en) | 2017-09-07 | 2019-03-14 | Juno Therapeutics, Inc. | Methods of identifying cellular attributes related to outcomes associated with cell therapy |
WO2019057102A1 (en) | 2017-09-20 | 2019-03-28 | Tsinghua University | A gRNA TARGETING HPK1 AND A METHOD FOR EDITING HPK1 GENE |
EP3307876A4 (en) * | 2015-06-10 | 2019-04-03 | Nantkwest, Inc. | Modified nk-92 cells for treating cancer |
WO2019070541A1 (en) | 2017-10-03 | 2019-04-11 | Juno Therapeutics, Inc. | Hpv-specific binding molecules |
EP3328994A4 (en) * | 2015-07-31 | 2019-04-17 | Memorial Sloan-Kettering Cancer Center | Antigen-binding proteins targeting cd56 and uses thereof |
WO2019090202A1 (en) | 2017-11-06 | 2019-05-09 | Editas Medicine, Inc. | Methods, compositions and components for crispr-cas9 editing of cblb in t cells for immunotherapy |
WO2019089858A2 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Methods of assessing or monitoring a response to a cell therapy |
WO2019087151A1 (en) | 2017-11-03 | 2019-05-09 | Sorrento Therapeutics, Inc. | Cd38-directed chimeric antigen receptor constructs |
WO2019090364A1 (en) | 2017-11-06 | 2019-05-09 | Juno Therapeutics, Inc. | Combination of a cell therapy and a gamma secretase inhibitor |
WO2019089848A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Methods associated with tumor burden for assessing response to a cell therapy |
WO2019089855A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Process for generating therapeutic compositions of engineered cells |
WO2019090004A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Process for producing a t cell composition |
WO2019090003A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for b-cell maturation antigen (bcma) |
WO2019089982A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Method of assessing activity of recombinant antigen receptors |
WO2019089884A2 (en) | 2017-11-01 | 2019-05-09 | Editas Medicine, Inc. | Methods, compositions and components for crispr-cas9 editing of tgfbr2 in t cells for immunotherapy |
WO2019094835A1 (en) | 2017-11-10 | 2019-05-16 | Juno Therapeutics, Inc. | Closed-system cryogenic vessels |
WO2019109053A1 (en) | 2017-12-01 | 2019-06-06 | Juno Therapeutics, Inc. | Methods for dosing and for modulation of genetically engineered cells |
WO2019113557A1 (en) | 2017-12-08 | 2019-06-13 | Juno Therapeutics, Inc. | Process for producing a composition of engineered t cells |
WO2019113556A1 (en) | 2017-12-08 | 2019-06-13 | Juno Therapeutics, Inc. | Serum-free media formulation for culturing cells and methods of use thereof |
WO2019113559A2 (en) | 2017-12-08 | 2019-06-13 | Juno Therapeutics, Inc. | Phenotypic markers for cell therapy and related methods |
WO2019118937A1 (en) | 2017-12-15 | 2019-06-20 | Juno Therapeutics, Inc. | Anti-cct5 binding molecules and methods of use thereof |
WO2019141270A1 (en) * | 2018-01-19 | 2019-07-25 | 科济生物医药(上海)有限公司 | Synnotch receptor-regulated expression of il12 |
WO2019152747A1 (en) | 2018-01-31 | 2019-08-08 | Juno Therapeutics, Inc. | Methods and reagents for assessing the presence or absence of replication competent virus |
WO2019152743A1 (en) | 2018-01-31 | 2019-08-08 | Celgene Corporation | Combination therapy using adoptive cell therapy and checkpoint inhibitor |
WO2019148656A1 (en) * | 2018-02-05 | 2019-08-08 | 深圳市默赛尔生物医学科技发展有限公司 | Multi-signal chimeric antigen receptor and expression gene thereof, nk cells modified thereby and anti-tumor drug |
US10383929B2 (en) | 2014-12-12 | 2019-08-20 | Bluebird Bio, Inc. | BCMA chimeric antigen receptors |
WO2019161133A1 (en) | 2018-02-15 | 2019-08-22 | Memorial Sloan Kettering Cancer Center | Foxp3 targeting agent compositions and methods of use for adoptive cell therapy |
WO2019170845A1 (en) | 2018-03-09 | 2019-09-12 | Ospedale San Raffaele S.R.L. | Il-1 antagonist and toxicity induced by cell therapy |
WO2019170147A1 (en) | 2018-03-09 | 2019-09-12 | 科济生物医药(上海)有限公司 | Method and composition for treating tumors |
US10428305B2 (en) | 2014-05-15 | 2019-10-01 | National University Of Singapore | Modified natural killer cells that express IL15 and uses thereof |
WO2019195486A1 (en) | 2018-04-05 | 2019-10-10 | Juno Therapeutics, Inc. | T cell receptors and engineered cells expressing same |
WO2019195491A1 (en) | 2018-04-05 | 2019-10-10 | Juno Therapeutics, Inc. | T cells expressing a recombinant receptor, related polynucleotides and methods |
WO2019195492A1 (en) | 2018-04-05 | 2019-10-10 | Juno Therapeutics, Inc. | Methods of producing cells expressing a recombinant receptor and related compositions |
US10464988B2 (en) | 2015-10-23 | 2019-11-05 | Eureka Therapeutics, Inc. | Antibody/T-cell receptor chimeric constructs and uses thereof |
WO2019213184A1 (en) | 2018-05-03 | 2019-11-07 | Juno Therapeutics, Inc. | Combination therapy of a chimeric antigen receptor (car) t cell therapy and a kinase inhibitor |
US10538739B2 (en) | 2013-01-28 | 2020-01-21 | St. Jude Children's Research Hospital, Inc. | Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease |
WO2020020210A1 (en) | 2018-07-24 | 2020-01-30 | 科济生物医药(上海)有限公司 | Method for treating tumor using immune effector cell |
WO2020033927A2 (en) | 2018-08-09 | 2020-02-13 | Juno Therapeutics, Inc. | Processes for generating engineered cells and compositions thereof |
WO2020033916A1 (en) | 2018-08-09 | 2020-02-13 | Juno Therapeutics, Inc. | Methods for assessing integrated nucleic acids |
WO2020056047A1 (en) | 2018-09-11 | 2020-03-19 | Juno Therapeutics, Inc. | Methods for mass spectrometry analysis of engineered cell compositions |
WO2020061256A1 (en) | 2018-09-19 | 2020-03-26 | FUJIFILM Cellular Dynamics, Inc. | Protein l for activation and expansion of chimeric antigen receptor-modified immune cells |
WO2020092848A2 (en) | 2018-11-01 | 2020-05-07 | Juno Therapeutics, Inc. | Methods for treatment using chimeric antigen receptors specific for b-cell maturation antigen |
WO2020089343A1 (en) | 2018-10-31 | 2020-05-07 | Juno Therapeutics Gmbh | Methods for selection and stimulation of cells and apparatus for same |
WO2020092854A2 (en) | 2018-11-01 | 2020-05-07 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for g protein-coupled receptor class c group 5 member d (gprc5d) |
WO2020097132A1 (en) | 2018-11-06 | 2020-05-14 | Juno Therapeutics, Inc. | Process for producing genetically engineered t cells |
WO2020097403A1 (en) | 2018-11-08 | 2020-05-14 | Juno Therapeutics, Inc. | Methods and combinations for treatment and t cell modulation |
WO2020102770A1 (en) | 2018-11-16 | 2020-05-22 | Juno Therapeutics, Inc. | Methods of dosing engineered t cells for the treatment of b cell malignancies |
WO2020106621A1 (en) | 2018-11-19 | 2020-05-28 | Board Of Regents, The University Of Texas System | A modular, polycistronic vector for car and tcr transduction |
WO2020113188A2 (en) | 2018-11-30 | 2020-06-04 | Juno Therapeutics, Inc. | Methods for dosing and treatment of b cell malignancies in adoptive cell therapy |
WO2020113194A2 (en) | 2018-11-30 | 2020-06-04 | Juno Therapeutics, Inc. | Methods for treatment using adoptive cell therapy |
WO2020113029A2 (en) | 2018-11-28 | 2020-06-04 | Board Of Regents, The University Of Texas System | Multiplex genome editing of immune cells to enhance functionality and resistance to suppressive environment |
WO2020112493A1 (en) | 2018-11-29 | 2020-06-04 | Board Of Regents, The University Of Texas System | Methods for ex vivo expansion of natural killer cells and use thereof |
WO2020160050A1 (en) | 2019-01-29 | 2020-08-06 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for receptor tyrosine kinase like orphan receptor 1 (ror1) |
US10738278B2 (en) | 2014-07-15 | 2020-08-11 | Juno Therapeutics, Inc. | Engineered cells for adoptive cell therapy |
WO2020169974A1 (en) | 2019-02-19 | 2020-08-27 | King's College London | Hypoxia-responsive chimeric antigen receptors |
US10774343B2 (en) | 2014-04-25 | 2020-09-15 | Bluebird Bio, Inc. | MND promoter chimeric antigen receptors |
US10786533B2 (en) | 2015-07-15 | 2020-09-29 | Juno Therapeutics, Inc. | Engineered cells for adoptive cell therapy |
WO2020223571A1 (en) | 2019-05-01 | 2020-11-05 | Juno Therapeutics, Inc. | Cells expressing a chimeric receptor from a modified cd247 locus, related polynucleotides and methods |
WO2020223535A1 (en) | 2019-05-01 | 2020-11-05 | Juno Therapeutics, Inc. | Cells expressing a recombinant receptor from a modified tgfbr2 locus, related polynucleotides and methods |
US10829735B2 (en) | 2015-07-21 | 2020-11-10 | The Trustees Of The University Of Pennsylvania | Methods for improving the efficacy and expansion of immune cells |
WO2020247832A1 (en) | 2019-06-07 | 2020-12-10 | Juno Therapeutics, Inc. | Automated t cell culture |
WO2020252218A1 (en) | 2019-06-12 | 2020-12-17 | Juno Therapeutics, Inc. | Combination therapy of a cell-mediated cytotoxic therapy and an inhibitor of a prosurvival bcl2 family protein |
WO2021013950A1 (en) | 2019-07-23 | 2021-01-28 | Mnemo Therapeutics | Immune cells defective for suv39h1 |
WO2021035194A1 (en) | 2019-08-22 | 2021-02-25 | Juno Therapeutics, Inc. | Combination therapy of a t cell therapy and an enhancer of zeste homolog 2 (ezh2) inhibitor and related methods |
WO2021038036A1 (en) * | 2019-08-28 | 2021-03-04 | King's College London | B CELL TARGETED PARALLEL CAR (pCAR) THERAPEUTIC AGENTS |
WO2021041994A2 (en) | 2019-08-30 | 2021-03-04 | Juno Therapeutics, Inc. | Machine learning methods for classifying cells |
WO2021043804A1 (en) | 2019-09-02 | 2021-03-11 | Institut Curie | Immunotherapy targeting tumor neoantigenic peptides |
US10967005B2 (en) | 2013-03-15 | 2021-04-06 | Celgene Corporation | Modified T lymphocytes comprising a BAFF antibody-inducible caspase and methods of apoptosis |
WO2021078910A1 (en) | 2019-10-22 | 2021-04-29 | Institut Curie | Immunotherapy targeting tumor neoantigenic peptides |
WO2021084050A1 (en) | 2019-10-30 | 2021-05-06 | Juno Therapeutics Gmbh | Cell selection and/or stimulation devices and methods of use |
WO2021092498A1 (en) | 2019-11-07 | 2021-05-14 | Juno Therapeutics, Inc. | Combination of a t cell therapy and (s)-3-[4-(4-morpholin-4 ylmethyl-benzyloxy)-l-oxo-l,3-dihydro-isoindol-2-yl]- piperidine-2,6-dione |
WO2021092097A1 (en) | 2019-11-05 | 2021-05-14 | Juno Therapeutics, Inc. | Methods of determining attributes of therapeutic t cell compositions |
WO2021113776A1 (en) | 2019-12-06 | 2021-06-10 | Juno Therapeutics, Inc. | Anti-idiotypic antibodies to bcma-targeted binding domains and related compositions and methods |
WO2021113770A1 (en) | 2019-12-06 | 2021-06-10 | Juno Therapeutics, Inc. | Methods related to toxicity and response associated with cell therapy for treating b cell malignancies |
WO2021113780A1 (en) | 2019-12-06 | 2021-06-10 | Juno Therapeutics, Inc. | Anti-idiotypic antibodies to gprc5d-targeted binding domains and related compositions and methods |
WO2021151008A1 (en) | 2020-01-24 | 2021-07-29 | Juno Therapuetics, Inc. | Methods for dosing and treatment of follicular lymphoma and marginal zone lymphoma in adoptive cell therapy |
WO2021154887A1 (en) | 2020-01-28 | 2021-08-05 | Juno Therapeutics, Inc. | Methods for t cell transduction |
WO2021163391A1 (en) | 2020-02-12 | 2021-08-19 | Juno Therapeutics, Inc. | Cd19-directed chimeric antigen receptor t cell compositions and methods and uses thereof |
WO2021163389A1 (en) | 2020-02-12 | 2021-08-19 | Juno Therapeutics, Inc. | Bcma-directed chimeric antigen receptor t cell compositions and methods and uses thereof |
WO2021164959A1 (en) * | 2020-02-17 | 2021-08-26 | Miltenyi Biotec B.V. & Co. KG | Method for providing personalized cells with chimeric antigen receptors (car) against tumor microenvironment cells |
WO2021167908A1 (en) | 2020-02-17 | 2021-08-26 | Board Of Regents, The University Of Texas System | Methods for expansion of tumor infiltrating lymphocytes and use thereof |
US11130820B2 (en) | 2012-12-20 | 2021-09-28 | Celgene Corporation | Chimeric antigen receptors |
US11141436B2 (en) | 2019-03-05 | 2021-10-12 | Nkarta, Inc. | Immune cells engineered to express CD19-directed chimeric antigen receptors and uses thereof in immunotherapy |
WO2021207689A2 (en) | 2020-04-10 | 2021-10-14 | Juno Therapeutics, Inc. | Methods and uses related to cell therapy engineered with a chimeric antigen receptor targeting b-cell maturation antigen |
WO2021222330A2 (en) | 2020-04-28 | 2021-11-04 | Juno Therapeutics, Inc. | Combination of bcma-directed t cell therapy and an immunomodulatory compound |
US11173179B2 (en) | 2015-06-25 | 2021-11-16 | Icell Gene Therapeutics Llc | Chimeric antigen receptor (CAR) targeting multiple antigens, compositions and methods of use thereof |
WO2021231661A2 (en) | 2020-05-13 | 2021-11-18 | Juno Therapeutics, Inc. | Process for producing donor-batched cells expressing a recombinant receptor |
WO2021228999A1 (en) | 2020-05-12 | 2021-11-18 | Institut Curie | Neoantigenic epitopes associated with sf3b1 mutations |
WO2021231657A1 (en) | 2020-05-13 | 2021-11-18 | Juno Therapeutics, Inc. | Methods of identifying features associated with clinical response and uses thereof |
WO2021237068A2 (en) | 2020-05-21 | 2021-11-25 | Board Of Regents, The University Of Texas System | T cell receptors with vgll1 specificity and uses thereof |
WO2021260186A1 (en) | 2020-06-26 | 2021-12-30 | Juno Therapeutics Gmbh | Engineered t cells conditionally expressing a recombinant receptor, related polynucleotides and methods |
WO2022016119A1 (en) | 2020-07-17 | 2022-01-20 | Simurx, Inc. | Chimeric myd88 receptors for redirecting immunosuppressive signaling and related compositions and methods |
US11229669B2 (en) | 2018-02-11 | 2022-01-25 | Memorial Sloan-Kettering Cancer Center | Cells comprising non-HLA restricted T cell receptors |
WO2022023576A1 (en) | 2020-07-30 | 2022-02-03 | Institut Curie | Immune cells defective for socs1 |
WO2022029660A1 (en) | 2020-08-05 | 2022-02-10 | Juno Therapeutics, Inc. | Anti-idiotypic antibodies to ror1-targeted binding domains and related compositions and methods |
US11305017B2 (en) | 2015-04-25 | 2022-04-19 | The General Hospital Corporation | Anti-fugetactic agent and anti-cancer agent combination therapy and compositions for the treatment of cancer |
WO2022098787A1 (en) | 2020-11-04 | 2022-05-12 | Juno Therapeutics, Inc. | Cells expressing a chimeric receptor from a modified invariant cd3 immunoglobulin superfamily chain locus and related polynucleotides and methods |
WO2022104109A1 (en) | 2020-11-13 | 2022-05-19 | Catamaran Bio, Inc. | Genetically modified natural killer cells and methods of use thereof |
WO2022115611A1 (en) | 2020-11-25 | 2022-06-02 | Catamaran Bio, Inc. | Cellular therapeutics engineered with signal modulators and methods of use thereof |
EP4012415A2 (en) | 2015-12-04 | 2022-06-15 | Juno Therapeutics, Inc. | Methods and compositions related to toxicity associated with cell therapy |
EP4011381A1 (en) | 2016-06-03 | 2022-06-15 | Memorial Sloan-Kettering Cancer Center | Adoptive cell therapies as early treatment options |
US11365236B2 (en) | 2017-03-27 | 2022-06-21 | Nkarta, Inc. | Truncated NKG2D chimeric receptors and uses thereof in natural killer cell immunotherapy |
WO2022133030A1 (en) | 2020-12-16 | 2022-06-23 | Juno Therapeutics, Inc. | Combination therapy of a cell therapy and a bcl2 inhibitor |
WO2022150731A1 (en) | 2021-01-11 | 2022-07-14 | Sana Biotechnology, Inc. | Use of cd8-targeted viral vectors |
US11400116B2 (en) | 2016-05-06 | 2022-08-02 | The Regents Of The University Of California | Systems and methods for targeting cancer cells |
US11401332B2 (en) | 2016-08-23 | 2022-08-02 | The Regents Of The University Of California | Proteolytically cleavable chimeric polypeptides and methods of use thereof |
US11408005B2 (en) | 2016-12-12 | 2022-08-09 | Seattle Children's Hospital | Chimeric transcription factor variants with augmented sensitivity to drug ligand induction of transgene expression in mammalian cells |
WO2022187406A1 (en) | 2021-03-03 | 2022-09-09 | Juno Therapeutics, Inc. | Combination of a t cell therapy and a dgk inhibitor |
WO2022189639A1 (en) | 2021-03-11 | 2022-09-15 | Mnemo Therapeutics | Tumor neoantigenic peptides and uses thereof |
WO2022189620A1 (en) | 2021-03-11 | 2022-09-15 | Institut Curie | Transmembrane neoantigenic peptides |
WO2022189626A2 (en) | 2021-03-11 | 2022-09-15 | Mnemo Therapeutics | Tumor neoantigenic peptides |
RU2780020C2 (en) * | 2017-04-26 | 2022-09-19 | Еурека Терапьютикс, Инк. | Cells expressing chimeric activating receptors and chimeric stimulating receptors and their use |
WO2022204071A1 (en) | 2021-03-22 | 2022-09-29 | Juno Therapeutics, Inc. | Method to assess potency of viral vector particles |
WO2022204070A1 (en) | 2021-03-22 | 2022-09-29 | Juno Therapeutics, Inc. | Methods of determining potency of a therapeutic cell composition |
WO2022212400A1 (en) | 2021-03-29 | 2022-10-06 | Juno Therapeutics, Inc. | Methods for dosing and treatment with a combination of a checkpoint inhibitor therapy and a car t cell therapy |
WO2022212384A1 (en) | 2021-03-29 | 2022-10-06 | Juno Therapeutics, Inc. | Combination of a car t cell therapy and an immunomodulatory compound for treatment of lymphoma |
WO2022221726A2 (en) | 2021-04-16 | 2022-10-20 | Juno Therapeutics, Inc. | Combination therapies with bcma-directed t cell therapy |
WO2022221737A1 (en) | 2021-04-16 | 2022-10-20 | Juno Therapeutics, Inc. | T cell therapy in patients who have had prior stem cell transplant |
US11479755B2 (en) | 2015-12-07 | 2022-10-25 | 2Seventy Bio, Inc. | T cell compositions |
WO2022234009A2 (en) | 2021-05-06 | 2022-11-10 | Juno Therapeutics Gmbh | Methods for stimulating and transducing t cells |
WO2022238386A1 (en) | 2021-05-10 | 2022-11-17 | Institut Curie | Methods for the treatment of cancer, inflammatory diseases and autoimmune diseases |
WO2022248602A1 (en) | 2021-05-25 | 2022-12-01 | Institut Curie | Myeloid cells overexpressing bcl2 |
US11517589B2 (en) | 2015-02-19 | 2022-12-06 | Myeloid Therapeutics, Inc. | Chimeric antigen receptor dendritic cell (CAR-DC) for treatment of cancer |
US11547694B2 (en) | 2017-03-23 | 2023-01-10 | The General Hospital Corporation | CXCR4/CXCR7 blockade and treatment of human papilloma virus-associated disease |
WO2023014922A1 (en) | 2021-08-04 | 2023-02-09 | The Regents Of The University Of Colorado, A Body Corporate | Lat activating chimeric antigen receptor t cells and methods of use thereof |
WO2023015217A1 (en) | 2021-08-04 | 2023-02-09 | Sana Biotechnology, Inc. | Use of cd4-targeted viral vectors |
US11623961B2 (en) | 2017-11-01 | 2023-04-11 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for B-cell maturation antigen |
US11628218B2 (en) | 2020-11-04 | 2023-04-18 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
WO2023081735A1 (en) | 2021-11-03 | 2023-05-11 | Celgene Corporation | Chimeric antigen receptors specific for b-cell maturation antigen for use in treating myeloma |
WO2023081715A1 (en) | 2021-11-03 | 2023-05-11 | Viracta Therapeutics, Inc. | Combination of car t-cell therapy with btk inhibitors and methods of use thereof |
WO2023081900A1 (en) | 2021-11-08 | 2023-05-11 | Juno Therapeutics, Inc. | Engineered t cells expressing a recombinant t cell receptor (tcr) and related systems and methods |
US11655452B2 (en) | 2015-06-25 | 2023-05-23 | Icell Gene Therapeutics Inc. | Chimeric antigen receptors (CARs), compositions and methods of use thereof |
WO2023105000A1 (en) | 2021-12-09 | 2023-06-15 | Zygosity Limited | Vector |
WO2023115039A2 (en) | 2021-12-17 | 2023-06-22 | Sana Biotechnology, Inc. | Modified paramyxoviridae fusion glycoproteins |
WO2023115041A1 (en) | 2021-12-17 | 2023-06-22 | Sana Biotechnology, Inc. | Modified paramyxoviridae attachment glycoproteins |
WO2023126458A1 (en) | 2021-12-28 | 2023-07-06 | Mnemo Therapeutics | Immune cells with inactivated suv39h1 and modified tcr |
WO2023139269A1 (en) | 2022-01-21 | 2023-07-27 | Mnemo Therapeutics | Modulation of suv39h1 expression by rnas |
WO2023147515A1 (en) | 2022-01-28 | 2023-08-03 | Juno Therapeutics, Inc. | Methods of manufacturing cellular compositions |
WO2023150518A1 (en) | 2022-02-01 | 2023-08-10 | Sana Biotechnology, Inc. | Cd3-targeted lentiviral vectors and uses thereof |
US11738048B2 (en) | 2016-08-30 | 2023-08-29 | Memorial Sloan Kettering Cancer Center | Immune cell compositions and methods of use for treating viral and other infections |
WO2023164440A1 (en) | 2022-02-22 | 2023-08-31 | Juno Therapeutics, Inc. | Proteinase 3 (pr3) chimeric autoantibody receptor t cells and related methods and uses |
US11759480B2 (en) | 2017-02-28 | 2023-09-19 | Endocyte, Inc. | Compositions and methods for CAR T cell therapy |
WO2023178348A1 (en) | 2022-03-18 | 2023-09-21 | The Regents Of The University Of Colorado, A Body Corporate | Genetically engineered t-cell co-receptors and methods of use thereof |
WO2023180552A1 (en) | 2022-03-24 | 2023-09-28 | Institut Curie | Immunotherapy targeting tumor transposable element derived neoantigenic peptides in glioblastoma |
WO2023193015A1 (en) | 2022-04-01 | 2023-10-05 | Sana Biotechnology, Inc. | Cytokine receptor agonist and viral vector combination therapies |
WO2023187024A1 (en) | 2022-03-31 | 2023-10-05 | Institut Curie | Modified rela protein for inducing interferon expression and engineered immune cells with improved interferon expression |
US11779602B2 (en) | 2018-01-22 | 2023-10-10 | Endocyte, Inc. | Methods of use for CAR T cells |
WO2023196921A1 (en) | 2022-04-06 | 2023-10-12 | The Regents Of The University Of Colorado, A Body Corporate | Granzyme expressing t cells and methods of use |
WO2023196933A1 (en) | 2022-04-06 | 2023-10-12 | The Regents Of The University Of Colorado, A Body Corporate | Chimeric antigen receptor t cells and methods of use thereof |
WO2023211972A1 (en) | 2022-04-28 | 2023-11-02 | Medical University Of South Carolina | Chimeric antigen receptor modified regulatory t cells for treating cancer |
WO2023213969A1 (en) | 2022-05-05 | 2023-11-09 | Juno Therapeutics Gmbh | Viral-binding protein and related reagents, articles, and methods of use |
WO2023220655A1 (en) | 2022-05-11 | 2023-11-16 | Celgene Corporation | Methods to overcome drug resistance by re-sensitizing cancer cells to treatment with a prior therapy via treatment with a t cell therapy |
WO2023220641A2 (en) | 2022-05-11 | 2023-11-16 | Juno Therapeutics, Inc. | Methods and uses related to t cell therapy and production of same |
US11820819B2 (en) | 2016-06-24 | 2023-11-21 | Icell Gene Therapeutics Inc. | Chimeric antigen receptors (CARs), compositions and methods thereof |
EP4279085A1 (en) | 2022-05-20 | 2023-11-22 | Mnemo Therapeutics | Compositions and methods for treating a refractory or relapsed cancer or a chronic infectious disease |
WO2023222617A1 (en) | 2022-05-16 | 2023-11-23 | Miltenyi Biotec B.V. & Co. KG | Endogenous signaling molecule activating chimeric antigen receptors and methods of generation thereof |
WO2023230548A1 (en) | 2022-05-25 | 2023-11-30 | Celgene Corporation | Method for predicting response to a t cell therapy |
WO2023230581A1 (en) | 2022-05-25 | 2023-11-30 | Celgene Corporation | Methods of manufacturing t cell therapies |
US11845803B2 (en) | 2017-02-17 | 2023-12-19 | Fred Hutchinson Cancer Center | Combination therapies for treatment of BCMA-related cancers and autoimmune disorders |
US11851659B2 (en) | 2017-03-22 | 2023-12-26 | Novartis Ag | Compositions and methods for immunooncology |
WO2023250400A1 (en) | 2022-06-22 | 2023-12-28 | Juno Therapeutics, Inc. | Treatment methods for second line therapy of cd19-targeted car t cells |
WO2024006960A1 (en) | 2022-06-29 | 2024-01-04 | Juno Therapeutics, Inc. | Lipid nanoparticles for delivery of nucleic acids |
EP4302768A2 (en) | 2017-06-22 | 2024-01-10 | Board Of Regents, The University Of Texas System | Methods for producing regulatory immune cells and uses thereof |
US11890348B2 (en) | 2015-09-18 | 2024-02-06 | The General Hospital Corporation | Localized delivery of anti-fugetactic agent for treatment of cancer |
WO2024031091A2 (en) | 2022-08-05 | 2024-02-08 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for gprc5d and bcma |
US11896616B2 (en) | 2017-03-27 | 2024-02-13 | National University Of Singapore | Stimulatory cell lines for ex vivo expansion and activation of natural killer cells |
US11896614B2 (en) | 2015-04-17 | 2024-02-13 | Novartis Ag | Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells |
WO2024044779A2 (en) | 2022-08-26 | 2024-02-29 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for delta-like ligand 3 (dll3) |
US11919937B2 (en) | 2018-01-09 | 2024-03-05 | Board Of Regents, The University Of Texas System | T cell receptors for immunotherapy |
WO2024054944A1 (en) | 2022-09-08 | 2024-03-14 | Juno Therapeutics, Inc. | Combination of a t cell therapy and continuous or intermittent dgk inhibitor dosing |
US11939389B2 (en) | 2018-06-13 | 2024-03-26 | Novartis Ag | BCMA chimeric antigen receptors and uses thereof |
WO2024062138A1 (en) | 2022-09-23 | 2024-03-28 | Mnemo Therapeutics | Immune cells comprising a modified suv39h1 gene |
US11944644B2 (en) | 2017-12-05 | 2024-04-02 | The Medical Research Infrastructure And Health Services Fund Of The Tel Aviv Medical Center | T-cells comprising anti-CD38 and anti-CD138 chimeric antigen receptors and uses thereof |
WO2024081820A1 (en) | 2022-10-13 | 2024-04-18 | Sana Biotechnology, Inc. | Viral particles targeting hematopoietic stem cells |
US11975026B2 (en) | 2019-11-26 | 2024-05-07 | Novartis Ag | CD19 and CD22 chimeric antigen receptors and uses thereof |
WO2024097905A1 (en) | 2022-11-02 | 2024-05-10 | Celgene Corporation | Methods of treatment with t cell therapy and immunomodulatory agent maintenance therapy |
WO2024102948A1 (en) | 2022-11-11 | 2024-05-16 | Celgene Corporation | Fc receptor-homolog 5 (fcrh5) specific binding molecules and bispecific t-cell engaging antibodies including same and related methods |
WO2024100604A1 (en) | 2022-11-09 | 2024-05-16 | Juno Therapeutics Gmbh | Methods for manufacturing engineered immune cells |
US11993661B2 (en) | 2018-06-18 | 2024-05-28 | Eureka Therapeutics, Inc. | Constructs targeting prostate-specific membrane antigen (PSMA) and uses thereof |
Families Citing this family (35)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
ES2959443T3 (en) * | 2012-02-22 | 2024-02-26 | Univ Pennsylvania | Use of the CD2 signaling domain in second-generation chimeric antigen receptors |
CN112430580A (en) * | 2012-10-02 | 2021-03-02 | 纪念斯隆-凯特琳癌症中心 | Compositions and methods for immunotherapy |
AU2014248119B2 (en) * | 2013-04-03 | 2019-06-20 | Memorial Sloan-Kettering Cancer Center | Effective generation of tumor-targeted T-cells derived from pluripotent stem cells |
EP3105333B1 (en) * | 2014-02-10 | 2020-04-08 | Emory University | Expression of chimeric polypeptide with variable lymphocyte receptors on immune cells and uses for treating cancer |
AU2016211671B2 (en) | 2015-01-26 | 2022-05-26 | Fate Therapeutics, Inc. | Methods and compositions for inducing hematopoietic cell differentiation |
AU2016225012B2 (en) | 2015-02-27 | 2020-09-03 | Kevin Chen | Chimeric antigen receptors (CARS) targeting hematologic malignancies, compositions and methods of use thereof |
EP3466967A1 (en) | 2015-05-18 | 2019-04-10 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
CN105087495B (en) * | 2015-08-21 | 2016-04-27 | 深圳市茵冠生物科技有限公司 | T lymphocyte that two Chimeric antigen receptor is modified and preparation method thereof |
CN105924529B (en) * | 2015-10-13 | 2019-08-06 | 中国人民解放军总医院 | Chimeric antigen receptor and its gene and recombinant expression carrier, CAR138-NKT cell and its preparation method and application |
CA3003150A1 (en) | 2015-11-04 | 2017-05-11 | Fate Therapeutics, Inc. | Genomic engineering of pluripotent cells |
CN108473961B (en) | 2015-11-04 | 2022-11-29 | 菲特治疗公司 | Methods and compositions for inducing hematopoietic cell differentiation |
WO2017112877A1 (en) * | 2015-12-22 | 2017-06-29 | Icell Gene Therapeutics, Llc | Chimeric antigen receptors and enhancement of anti-tumor activity |
RU2756276C2 (en) * | 2016-05-25 | 2021-09-29 | Дзе Каунсил Оф Дзе Квинсленд Инститьют Оф Медикал Рисерч | Immunotherapy methods |
CN109844099B (en) * | 2016-07-25 | 2024-01-02 | 美国政府(由卫生和人类服务部的部长所代表) | Methods of producing modified natural killer cells and methods of use |
CN109715668A (en) | 2016-08-02 | 2019-05-03 | T细胞受体治疗公司 | For using fusion protein to carry out the composition and method of TCR reprogramming |
PT3445787T (en) | 2016-10-07 | 2021-03-15 | Tcr2 Therapeutics Inc | Compositions and methods for t-cell receptors reprogramming using fusion proteins |
CN110177803A (en) | 2016-11-22 | 2019-08-27 | T细胞受体治疗公司 | For using fusion protein to carry out the composition and method that TCR is reprogramed |
CN106749677B (en) * | 2017-01-04 | 2020-06-12 | 上海交通大学医学院附属瑞金医院 | Bispecific chimeric antigen receptor gene targeting MLL leukemia and application thereof |
CN110573529A (en) | 2017-04-05 | 2019-12-13 | 韩国生命工学研究院 | Fusion protein activating NK cells, NK cells and pharmaceutical composition comprising the same |
CN107326014B (en) * | 2017-07-31 | 2019-09-24 | 时力生物科技(北京)有限公司 | A kind of T lymphocyte and its preparation method and application of bispecific chimeric antigen receptor modification |
AU2018367452A1 (en) * | 2017-11-14 | 2020-06-11 | Memorial Sloan-Kettering Cancer Center | IL-36 secreting immunoresponsive cells and uses thereof |
WO2019111250A1 (en) * | 2017-12-05 | 2019-06-13 | The Medical Research Infrastructure And Health Services Fund Of The Tel Aviv Medical Center | T-cells comprising two different chimeric antigen receptors and uses thereof |
CN109988242A (en) * | 2018-01-02 | 2019-07-09 | 武汉波睿达生物科技有限公司 | Joint Chimeric antigen receptor, expression vector, slow virus and T cell |
US11827672B2 (en) * | 2018-03-30 | 2023-11-28 | Eureka Therapeutics, Inc. | Constructs trageting CD22 and uses thereof |
CN108864288A (en) * | 2018-04-26 | 2018-11-23 | 上海怡豪生物科技有限公司 | The double target spot CAR-T therapy vectors and its construction method of breast cancer and application |
CN110615843B (en) * | 2018-06-20 | 2023-05-09 | 上海隆耀生物科技有限公司 | Chimeric antigen receptor containing third signal receptor and application thereof |
WO2020049496A1 (en) * | 2018-09-05 | 2020-03-12 | Glaxosmithkline Intellectual Property Development Limited | T cell modification |
EP3941493A4 (en) * | 2019-03-22 | 2022-12-28 | The Regents of the University of California | Switchable chimeric antigen receptor-engineered human natural killer cells |
US11661459B2 (en) | 2020-12-03 | 2023-05-30 | Century Therapeutics, Inc. | Artificial cell death polypeptide for chimeric antigen receptor and uses thereof |
CN116635064A (en) | 2020-12-18 | 2023-08-22 | 世纪治疗股份有限公司 | Chimeric antigen receptor systems with adaptive receptor specificity |
US11945876B2 (en) | 2021-06-16 | 2024-04-02 | Instil Bio (Uk) Limited | Receptors providing targeted costimulation for adoptive cell therapy |
EP4370213A1 (en) | 2021-07-16 | 2024-05-22 | Instil Bio (Uk) Limited | Chimeric molecules providing targeted costimulation for adoptive cell therapy |
CN117836405A (en) * | 2021-08-13 | 2024-04-05 | 先声创新公司 | Three-dimensional culture of pluripotent stem cells to produce hematopoietic stem cells |
CN115058387B (en) * | 2022-06-11 | 2023-12-01 | 重庆医科大学 | Method for preparing anti-prostate cancer medicine by co-culturing human embryonic stem cells and prostate cancer cells |
CN117736335A (en) * | 2022-09-20 | 2024-03-22 | 深圳先进技术研究院 | Double-targeting CAR-T cell targeting mesothelin and NKG2D ligand and application thereof |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5399346A (en) | 1989-06-14 | 1995-03-21 | The United States Of America As Represented By The Department Of Health And Human Services | Gene therapy |
WO2008121420A1 (en) * | 2007-03-30 | 2008-10-09 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred t lymphocytes |
WO2012109624A2 (en) * | 2011-02-11 | 2012-08-16 | Zyngenia, Inc. | Monovalent and multivalent multispecific complexes and uses thereof |
Family Cites Families (14)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5712149A (en) | 1995-02-03 | 1998-01-27 | Cell Genesys, Inc. | Chimeric receptor molecules for delivery of co-stimulatory signals |
GB9605515D0 (en) | 1996-03-15 | 1996-05-15 | Medical Res Council | Improvements in or relating to cell stimulation |
US7446190B2 (en) * | 2002-05-28 | 2008-11-04 | Sloan-Kettering Institute For Cancer Research | Nucleic acids encoding chimeric T cell receptors |
US7629440B2 (en) * | 2002-08-20 | 2009-12-08 | Genitrix, Llc | Lectin compositions and methods for modulating an immune response to an antigen |
US20050129671A1 (en) | 2003-03-11 | 2005-06-16 | City Of Hope | Mammalian antigen-presenting T cells and bi-specific T cells |
US20050113564A1 (en) * | 2003-11-05 | 2005-05-26 | St. Jude Children's Research Hospital | Chimeric receptors with 4-1BB stimulatory signaling domain |
US8315214B2 (en) * | 2007-05-18 | 2012-11-20 | Research In Motion Limited | Method and system for discontinuous reception de-synchronization detection |
GB201108236D0 (en) * | 2011-05-17 | 2011-06-29 | Ucl Business Plc | Method |
CN107266584B (en) * | 2011-07-29 | 2022-05-13 | 宾夕法尼亚大学董事会 | Transducible co-stimulatory receptors |
CN112430580A (en) * | 2012-10-02 | 2021-03-02 | 纪念斯隆-凯特琳癌症中心 | Compositions and methods for immunotherapy |
WO2014055657A1 (en) * | 2012-10-05 | 2014-04-10 | The Trustees Of The University Of Pennsylvania | Use of a trans-signaling approach in chimeric antigen receptors |
CA2888332C (en) | 2012-11-09 | 2021-01-19 | Dsm Ip Assets B.V. | Process for enzymatic hydrolysis of lignocellulosic material and fermentation of sugars |
CA2904014C (en) | 2013-02-06 | 2021-06-15 | Anthrogenesis Corporation | Modified t lymphocytes having improved specificity |
EP3623380A1 (en) | 2013-03-15 | 2020-03-18 | Michael C. Milone | Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy |
-
2013
- 2013-10-02 CN CN202011102703.7A patent/CN112430580A/en active Pending
- 2013-10-02 CA CA2886859A patent/CA2886859C/en active Active
- 2013-10-02 KR KR1020157011160A patent/KR102198058B1/en active IP Right Grant
- 2013-10-02 ES ES13844468T patent/ES2743738T3/en active Active
- 2013-10-02 EP EP19179456.9A patent/EP3597215A1/en active Pending
- 2013-10-02 RU RU2020124583A patent/RU2020124583A/en unknown
- 2013-10-02 MX MX2015004287A patent/MX370148B/en active IP Right Grant
- 2013-10-02 WO PCT/US2013/063097 patent/WO2014055668A1/en active Application Filing
- 2013-10-02 NZ NZ746914A patent/NZ746914A/en unknown
- 2013-10-02 JP JP2015534828A patent/JP6441802B2/en active Active
- 2013-10-02 NZ NZ706541A patent/NZ706541A/en unknown
- 2013-10-02 AU AU2013327136A patent/AU2013327136A1/en not_active Abandoned
- 2013-10-02 CN CN202011103486.3A patent/CN112458057A/en active Pending
- 2013-10-02 CN CN201380063036.8A patent/CN104853766A/en active Pending
- 2013-10-02 EP EP13844468.2A patent/EP2903637B1/en active Active
- 2013-10-02 RU RU2015116901A patent/RU2729401C2/en active
- 2013-10-02 SG SG11201502598SA patent/SG11201502598SA/en unknown
-
2015
- 2015-03-30 IL IL238047A patent/IL238047B/en active IP Right Grant
- 2015-04-01 US US14/676,255 patent/US10654928B2/en active Active
- 2015-04-06 PH PH12015500747A patent/PH12015500747A1/en unknown
- 2015-04-28 ZA ZA201502880A patent/ZA201502880B/en unknown
- 2015-09-24 HK HK15109439.3A patent/HK1208631A1/en unknown
-
2018
- 2018-03-15 JP JP2018047734A patent/JP2018108111A/en not_active Withdrawn
- 2018-06-15 AU AU2018204297A patent/AU2018204297B2/en active Active
-
2019
- 2019-10-25 PH PH12019502424A patent/PH12019502424A1/en unknown
-
2020
- 2020-02-07 IL IL272539A patent/IL272539B/en active IP Right Grant
- 2020-02-17 JP JP2020024520A patent/JP6963051B2/en active Active
- 2020-02-17 JP JP2020024521A patent/JP2020096625A/en not_active Withdrawn
- 2020-04-13 US US16/847,059 patent/US11712469B2/en active Active
- 2020-12-24 AU AU2020294287A patent/AU2020294287B2/en active Active
-
2021
- 2021-12-01 JP JP2021195401A patent/JP2022024161A/en not_active Withdrawn
-
2023
- 2023-06-13 US US18/333,753 patent/US20240091353A1/en active Pending
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5399346A (en) | 1989-06-14 | 1995-03-21 | The United States Of America As Represented By The Department Of Health And Human Services | Gene therapy |
WO2008121420A1 (en) * | 2007-03-30 | 2008-10-09 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred t lymphocytes |
WO2012109624A2 (en) * | 2011-02-11 | 2012-08-16 | Zyngenia, Inc. | Monovalent and multivalent multispecific complexes and uses thereof |
Non-Patent Citations (96)
Title |
---|
"REMINGTON'S PHARMACEUTICAL SCIENCE", 1985 |
"Sequence Analysis Software Package of the Genetics Computer Group", UNIVERSITY OF WISCONSIN BIOTECHNOLOGY CENTER |
"The Cambridge Dictionary of Science and Technology", 1988 |
"The Glossary of Genetics", 1991, SPRINGER VERLAG |
ANDERSON, SCIENCE, vol. 226, 1984, pages 401 - 409 |
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 2001, WILEY INTERSCIENCE |
AUSUBEL, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, 1987 |
BENTON; DAVIS, SCIENCE, vol. 196, 1977, pages 180 |
BERGER; KIMMEL: "Guide to Molecular Cloning Techniques", 1987, ACADEMIC PRESS |
BLOOMER ET AL., JOURNAL OF VIROLOGY, vol. 71, 1997, pages 6641 - 6649 |
BREGNI ET AL., BLOOD, vol. 80, 1992, pages 1418 - 1422 |
BRENTJENS, R.J. ET AL.: "Eradication of systemic B-ce!l tumors by genetically targeted human T lymphocytes co-stimulated by CD80 and interleukin-15", NATURE MEDICINE, vol. 9, 2003, pages 279 - 286, XP002389127, DOI: doi:10.1038/nm827 |
BRENTJENS, R.J. ET AL.: "Safety and persistence of adoptively transferred autologous CD19- ta rgeted T cells in patients with relapsed or chemotherapy refractory B-cell leukemias", BLOOD, vol. 118, 2011, pages 4817 - 4828, XP055169039, DOI: doi:10.1182/blood-2011-04-348540 |
BRIGHAM ET AL., AM. J. MED. SCI., vol. 298, 1989, pages 278 |
CA RPE N ITO, C . ET AL.: "Control of large, established tumor xenografts with genetically retargeted human T cells containing CD28 and CD137 domains", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 106, 2009, pages 3360 - 3365 |
CAYOUETTE ET AL., HUMAN GENE THERAPY, vol. 8, 1997, pages 423 - 430 |
COLIGAN, CURRENT PROTOCOLS IN IMMUNOLOGY, 1991 |
CORNETTA ET AL., NUCLEIC ACID RESEARCH AND MOLECULAR BIOLOGY, vol. 36, 1987, pages 311 - 322 |
DANOS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 6460 - 6464 |
DUPONT, J. ET AL., CANCERRES, vol. 65, 2005, pages 5417 - 5427 |
EGLITIS ET AL., BIOTECHNIQUES, vol. 6, 1988, pages 608 - 614 |
FEIGNER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 84, 1987, pages 7413 |
FRESHNEY: "Animal Cell Culture", 1987 |
FRIEDMAN, SCIENCE, vol. 244, 1989, pages 1275 - 1281 |
GAIT: "Oligonucleotide Synthesis", 1984 |
GRUNSTEIN; HOGNESS, PROC. NATL. ACAD.SCI., USA, vol. 72, 1975, pages 3961 |
HALE; MARHAM, THE HARPER COLLINS DICTIONARY OF BIOLOGY, 1991 |
HO, W.Y.; BLATTMAN, J.N.; DOSSETT, M.L.; YEE, C.; GREENBERG, P.O.: "Adoptive immunotherapy: engineering T cell responses as biologic weapons for tumor mass destruction", CANCER CELL, vol. 3, 2003, pages 431 - 437, XP002409705, DOI: doi:10.1016/S1535-6108(03)00113-2 |
HUGHES ET AL., J. CLIN. INVEST., vol. 89, 1992, pages 1817 |
JOHNSON, CHEST, vol. 107, 1995, pages 77S - 83S |
JOHNSON, L.A. ET AL.: "Gene therapy with human and mouse T, cell receptors mediates cancer regression and targets normal tissues expressing cognate antigen", BLOOD, vol. 114, 2009, pages 535 - 546 |
JORRITSMA, A.; SCHOTTE, R.; COCCORIS, M.; DE WITTE, M.A.; SCHUMACHER, T.N.: "Prospects and limitations of T cell receptor gene therapy", CURRENT GENE THERAPY, vol. 11, 2011, pages 276 - 287 |
KALOS, M. ET AL.: "T cells with chimeric antigen receptors have potent antitumor effects and can establish memory in patients with advanced leukemia", SCI TRANSL MED, vol. 3, 2011, pages 95ra73, XP002667262, DOI: doi:10.1126/scitranslmed.3002842 |
KIDO ET AL., CURRENT EYE RESEARCH, vol. 15, 1996, pages 833 - 844 |
KIMMEL, A. R., METHODS ENZYMOL., vol. 152, 1987, pages 507 |
KOCHENDERFER, J.N. ET AL.: "B-cell depletion and remissions of malignancy along with cytokine-associated toxicity in a clinical trial of anti-CD19 chimeric-antigen-receptor- transduced T cells", BLOOD, vol. 119, 2012, pages 2709 - 2720, XP055145503, DOI: doi:10.1182/blood-2011-10-384388 |
KOWOLIK, C ET AL.: "CD28 Costimulation Provided Through A CD19-Specific Chimeric Antigen Receptor Enhances In Vivo Persistence And Antitumor Efficacy Of Adoptively Transferred T Cells.", CANCER RESEARCH., vol. 66, 15 November 2006 (2006-11-15), pages 10995 - 11004, XP055044266 * |
KRAUSE, A. ET AL.: "Antigen-dependent CD28 signaling selectively enhances survival and proliferation in genetically modified activated human primary T lymphocytes", J EXP MED, vol. 188, 1998, pages 619 - 626, XP001240431, DOI: doi:10.1084/jem.188.4.619 |
LAM, J.S. ET AL.: "Prostate stem cell antigen is overexpressed in prostate cancer metastases", CLINICAL CANCER RESEARCH : AN OFFICIAL JOURNAL OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH, vol. 11, 2005, pages 2591 - 2596, XP002494615, DOI: doi:10.1158/1078-0432.CCR-04-1842 |
LE GAL LA SALLE ET AL., SCIENCE, vol. 259, 1993, pages 988 - 990 |
LIAO, W.; LIN, J .X; LEONARD, W.J: "I L-2 family cytokines: new insights into the complex roles of IL-2 as a broad regulator of T helper cell differentiation", CURRENT OPINION IN IMMUNOLOGY, vol. 23, 2011, pages 598 - 604, XP028309071, DOI: doi:10.1016/j.coi.2011.08.003 |
LIU, J.C. ET AL.: "Seventeen-gene signature from enriched Her2/Neu mammary tumor- initiating cells predicts clinical outcome for human HER2+:ERalpha- breast cancer", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 109, 2012, pages 58325837 |
MAGEE, J.A.; PISKOUNOVA, E.; MORRISON, S.J.: "Cancer stem cells: impact, heterogeneity, and uncertainty", CANCER CELL, vol. 21, 2012, pages 283 - 296, XP055023489, DOI: doi:10.1016/j.ccr.2012.03.003 |
MAHER, J.; BRENTJENS, R.J.; GUNSET, G.; RIVIERE, I.; SADELAIN, M.: "Human T-lymphocyte cytotoxicity and proliferation directed by a single chimeric TCRzeta /CD28 receptor", NAT BIO TECHNOL, vol. 20, 2002, pages 70 - 75, XP002588277 |
MATSUI, K ET AL.: "Low Affinity Interaction Of Peptide-MHC Complexes With T Cell Receptors.", SCIENCE., vol. 254, 20 December 1991 (1991-12-20), pages 1788 - 1791, XP001094133 * |
MEYER, M.J. ET AL.: "CD44posCD49fhiCD133/2hi defines xenograft-initiating cells in estrogen receptor-negative breast cancer", CANCER RESEARCH, vol. 70, 2010, pages 4624 - 4633 |
MILLER ET AL., BIOTECHNOLOGY, vol. 7, 1989, pages 980 - 990 |
MILLER ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 431 - 437 |
MILLER ET AL., MOL. CELL. BIOL., vol. 6, 1986, pages 2895 - 2902 |
MILLER, HUMAN GENE THERAPY, 1990, pages 15 - 14 |
MILLER; CALES, GENE TRANSFER VECTORS FOR MAMMALIAN CELLS, 1987 |
MIYOSHI ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 94, 1997, pages 10319 |
MOEN, BLOOD CELLS, vol. 17, 1991, pages 407 - 416 |
MORGAN, R.A. ET AL., SCIENCE, vol. 314, 2006, pages 126 - 129 |
MORGAN, R.A. ET AL.: "Case report of a serious adverse event following the administration of T cells transduced with a chimeric antigen receptor recognizing ERBB2", MOLECULAR THERAPY: THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 18, 2010, pages 843 - 851, XP055023624, DOI: doi:10.1038/mt.2010.24 |
MULLIS, PCR: THE POLYMERASE CHAIN REACTION, 1994 |
NALDINI ET AL., SCIENCE, vol. 272, 1996, pages 263 - 267 |
NAM, K. 0 .; SHIN, S . M .; LEE, H.W.: "Cross-linking of 4-IBB up-regulates IL-13 expression in CDS(+) T lymphocytes", CYTOKINE, vol. 33, 2006, pages 87 - 94 |
NGUYEN, L.V.; VANNER, R.; DIRKS, P.; EAVES, C.J.: "Cancer stem cells: an evolving concept. Nature reviews", CANCER, vol. 12, 2012, pages 133 - 143 |
OLSON, W.C.; HESTON, W.D.; RAJASEKARAN, A.K.: "Clinical trials of cancer therapies targeting prostate-specific membrane antigen", REVIEWS ON RECENT CLINICAL TRIALS, vol. 2, no. 30, 2007, pages 182 - 190, XP007922264, DOI: doi:10.2174/157488707781662724 |
ONO ET AL., NEUROSCIENCE LETTERS, vol. 17, 1990, pages 259 |
ORLANDI, R.; GUSSOW, D.H.; JONES, P.T.; WINTER, G.: "Cloning immunoglobulin variable domains for expression by the polymerase chain reaction", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 86, 1989, pages 3833 - 3837, XP000026475, DOI: doi:10.1073/pnas.86.10.3833 |
PANELLI, M.C. ET AL., J IMMUNO, vol. 164, 2000, pages 4382 - 4392 |
PANELLI, M.C. ET AL., J IMMUNOL, vol. 164, 2000, pages 495 - 504 |
PAPANICOLAOU, G.A. ET AL., BLOOD, vol. 102, 2003, pages 2498 - 2505 |
ROBBINS, P.F. ET AL.: "Tumor regression in patients with metastatic synovial cell sarcoma and melanoma using genetically engineered lymphocytes reactive with NY-ESO-1", JOURNAL OF CLINICAL ONCOLOGY: OFFICIAL JOURNAL OF THE AMERICAN SOCIETY OF CLINICAL ONCOLOGY, vol. 29, 2011, pages 917 - 924, XP002705979, DOI: doi:10.1200/JCO.2010.32.2537 |
ROSENBERG ET AL., N. ENGL. J. MED, vol. 323, 1990, pages 370 |
ROSENBERG, S.A.; RESTIFO, N.P.; YANG, J.C.; MORGAN, R.A.; DUDLEY, M.E.: "Adoptive cell transfer: a clinical path to effective cancer immunotherapy. Nature reviews", CANCER, vol. 8, 2008, pages 299 - 308 |
SADELAIN, M. ET AL., NAT REV CANCER, vol. 3, 2003, pages 35 - 45 |
SADELAIN, M.; BRENTJENS, R.; RIVIERE, I.: "The promise and potential pitfalls of chimeric antigen receptors", CURR OPIN IMMUNOL, vol. 21, 2009, pages 215 - 223, XP026058399, DOI: doi:10.1016/j.coi.2009.02.009 |
SADELAIN, M.; RIVIERE, I.; BRENTJENS, R.: "Targeting tumours with genetically enhanced T lymphocytes", NAT REV CANCER, vol. 3, 2003, pages 35 - 45, XP009026020, DOI: doi:10.1038/nrc971 |
SAEKI, N.; GU, J.; YOSHIDA, T.; WU, X.: "Prostate stem cell antigen: a Jekyll and Hyde molecule?", CLINICAL CANCER RESEARCH :AN OFFICIAL JOURNAL OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH, vol. 16, 2010, pages 3533 - 3538 |
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", COLD SPRING HARBOR LABORATORY PRESS |
SAMBROOK: "Molecular Cloning: A Laboratory Manual", 1989 |
SAMBROOK; FRITSCH; MANIATIS: "Molecular Cloning: A Laboratory Manual", 1989, CSH PRESS |
SCHWARTZ, R . H . T: "cell a n e rgy", ANNUAL REVIEW OF IMMUNOLOGY, vol. 21, 2003, pages 305 - 334 |
SHARP, THE LANCET, vol. 337, 1991, pages 1277 - 1278 |
SHIHLE, M .; DAVIDSON, B.: "Pathogenesis of ovarian cancer: clues from selected overexpressed genes", FUTURE ONCOL, vol. 5, 2009, pages 1641 - 1657 |
SHIN, S M: "1.4- IBB triggers IL-13 production from T cells to limit the polarized, Thl-mediated inflammation", JOURNAL OF LEUKOCYTE BIOLOGY, vol. 81, 2007, pages 1455 - 1465 |
SILVER, D.A.; PELLICER, I.; FAIR, W.R.; HESTON, W.D.; CORDON-CARDO, C.: "Prostate-specific membrane antigen expression in normal and malignant human tissues", CLINICAL CANCER RESEARCH : AN OFFICIAL JOURNAL OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH, vol. 3, 1997, pages 81 - 85, XP000941663 |
SINGLETON ET AL.: "Dictionary of Microbiology and Molecular Biology", 1994 |
STAUBINGER ET AL., METHODS IN ENZYMOLOGY, vol. 101, 1983, pages 512 |
STEPHAN, M .T. ET AL.: "T cell-encoded CD80 and 4-1 BBL induce auto-and transcostimulation, resulting in potent tumor rejection", NATURE MEDICINE, vol. 13, 2007, pages 1440 - 1449, XP002571429, DOI: doi:10.1038/nm1676 |
STRAUSS, R. ET AL.: "Analysis of epithelial and mesenchymal markers in ovarian cancer reveals phenotypic heterogeneity and plasticity", PLOS ONE, vol. 6, 2011, pages el 6186 |
TAMMANA, S.: "1. 4-1 BB and CD28 signaling plays a synergistic role in redirecting umbilical cord blood T cells against B-cell malignancies", HUM GENE THER, vol. 2, no. 1, 2000, pages 75 - 86 |
TOLSTOSHEV ET AL., CURRENT OPINION IN BIOTECHNOLOGY, vol. 1, 1990, pages 55 - 61 |
WAHL, G. M.; S. L. BERGER, METHODS ENZYMOL., vol. 152, 1987, pages 399 |
WANG, J. ET AL.: "Optimizing adoptive polyclonal T cell immunotherapy of lymphomas, using a chimeric T cell receptor possessing CD28 and CD137 costimulatory domains", HUMAN GENE THERAPY, vol. 18, 2007, pages 712 - 725, XP002605938, DOI: doi:10.1089/HUM.2007.028 |
WATTS, T.H.: "TNF/TNFR family members in costimulation of T cell responses", ANNUAL REVIEW OF IMMUNOLOGY, vol. 23, 2005, pages 23 - 68, XP008051583, DOI: doi:10.1146/annurev.immunol.23.021704.115839 |
WEIR: "Handbook of Experimental Immunology", 1996, article "Methods in Enzymology" |
WILKIE, S. ET AL.: "Dual Targeting of ErbB2 and MUC1 in Breast Cancer Using Chimeric Antigen Receptors Engineered to Provide Complementary Signaling", JOURNAL OF CLINICAL IMMUNOLOGY, 2012 |
WOLFF ET AL., SCIENCE, vol. 247, 1990, pages 1465 |
WU ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 263, 1988, pages 14621 |
WU ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 264, 1989, pages 16985 |
XU ET AL., EXP. HEMAT., vol. 22, 1994, pages 223 - 230 |
ZHONG, X.S.; MATSUSHITA, M.; PLOTKIN, J.; RIVIERE, I.; SADELAIN, M.: "Chimeric antigen receptors combining 4-1 BB and CD28 signaling domains augment PI3kinase/AKT/Bc1-X L activation and C D8+ T cell-mediated tumor eradication", MOLECULAR THERAPY: THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 18, 2010, pages 413 - 420, XP055023623, DOI: doi:10.1038/mt.2009.210 |
Cited By (400)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10117896B2 (en) | 2012-10-05 | 2018-11-06 | The Trustees Of The University Of Pennsylvania | Use of a trans-signaling approach in chimeric antigen receptors |
US11484552B2 (en) | 2012-10-05 | 2022-11-01 | The Trustees Of The University Of Pennsylvania | Use of trans-signaling approach in chimeric antigen receptors |
US11130820B2 (en) | 2012-12-20 | 2021-09-28 | Celgene Corporation | Chimeric antigen receptors |
US10774309B2 (en) | 2013-01-28 | 2020-09-15 | St. Jude Children's Research Hospital, Inc. | Natural killer cell immunotherapy for treating cancer |
US11873512B2 (en) | 2013-01-28 | 2024-01-16 | St. Jude Children's Research Hospital, Inc. | Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease |
US10836999B2 (en) | 2013-01-28 | 2020-11-17 | St. Jude Children's Research Hospital, Inc. | Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease |
US10801012B2 (en) | 2013-01-28 | 2020-10-13 | St. Jude Children's Research Hospital, Inc. | Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease |
US10829737B2 (en) | 2013-01-28 | 2020-11-10 | St. Jude Children's Research Hospital, Inc. | Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease |
US10538739B2 (en) | 2013-01-28 | 2020-01-21 | St. Jude Children's Research Hospital, Inc. | Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease |
AU2014214850C1 (en) * | 2013-02-06 | 2018-12-06 | Celgene Corporation | Modified T lymphocytes having improved specificity |
AU2014214850B2 (en) * | 2013-02-06 | 2018-06-14 | Celgene Corporation | Modified T lymphocytes having improved specificity |
US10124023B2 (en) | 2013-02-26 | 2018-11-13 | Memorial Sloan-Kettering Cancer Center | Compositions and methods for immunotherapy |
US11103531B2 (en) | 2013-02-26 | 2021-08-31 | Memorial Sloan-Kettering Cancer Center | Compositions and methods for immunotherapy |
WO2014134165A1 (en) * | 2013-02-26 | 2014-09-04 | Memorial Sloan-Kettering Cancer Center | Compositions and methods for immunotherapy |
US10967005B2 (en) | 2013-03-15 | 2021-04-06 | Celgene Corporation | Modified T lymphocytes comprising a BAFF antibody-inducible caspase and methods of apoptosis |
US11806365B2 (en) | 2013-03-15 | 2023-11-07 | Celgene Corporation | Modified T lymphocytes comprising a CD52 antibody-inducible caspase and methods of apoptosis |
US10774343B2 (en) | 2014-04-25 | 2020-09-15 | Bluebird Bio, Inc. | MND promoter chimeric antigen receptors |
US11560548B2 (en) | 2014-05-15 | 2023-01-24 | National University Of Singapore | Immune cells expressing membrane-bound interleukin 15 (mbIL15) and uses thereof |
US10428305B2 (en) | 2014-05-15 | 2019-10-01 | National University Of Singapore | Modified natural killer cells that express IL15 and uses thereof |
US10774311B2 (en) | 2014-05-15 | 2020-09-15 | National University Of Singapore | Natural killer cells modified to express membrane-bound interleukin 15 and uses thereof |
EP4166148A1 (en) | 2014-06-06 | 2023-04-19 | Memorial Sloan-Kettering Cancer Center | Mesothelin-targeted chimeric antigen receptors and uses thereof |
CN111394317A (en) * | 2014-06-06 | 2020-07-10 | 蓝鸟生物公司 | Improved T cell compositions |
WO2015188119A1 (en) * | 2014-06-06 | 2015-12-10 | Bluebird Bio, Inc. | Improved t cell compositions |
WO2015188141A2 (en) | 2014-06-06 | 2015-12-10 | Memorial Sloan-Kettering Cancer Ceneter | Mesothelin-targeted chimeric antigen receptors and uses thereof |
EP3685842A1 (en) | 2014-06-06 | 2020-07-29 | Memorial Sloan-Kettering Cancer Center | Mesothelin-targeted chimeric antigen receptors and uses thereof |
CN106793780A (en) * | 2014-06-06 | 2017-05-31 | 蓝鸟生物公司 | The T cell composition of improvement |
US10479975B2 (en) | 2014-06-06 | 2019-11-19 | Bluebird Bio, Inc. | Methods of making T cell compositions |
JP2020072756A (en) * | 2014-06-06 | 2020-05-14 | ブルーバード バイオ, インコーポレイテッド | Improved t-cell composition |
US11560547B2 (en) | 2014-06-06 | 2023-01-24 | 2Seventy Bio, Inc. | Methods of making T cell compositions |
JP2017518052A (en) * | 2014-06-06 | 2017-07-06 | ブルーバード バイオ, インコーポレイテッド | Improved T cell composition |
AU2015269197B2 (en) * | 2014-06-06 | 2018-10-04 | 2Seventy Bio, Inc. | Improved T cell compositions |
US10738278B2 (en) | 2014-07-15 | 2020-08-11 | Juno Therapeutics, Inc. | Engineered cells for adoptive cell therapy |
US9777061B2 (en) | 2014-07-21 | 2017-10-03 | Novartis Ag | Treatment of cancer using a CD33 chimeric antigen receptor |
US10851166B2 (en) | 2014-07-21 | 2020-12-01 | Novartis Ag | Treatment of cancer using a CD33 chimeric antigen receptor |
US9546206B2 (en) | 2014-08-08 | 2017-01-17 | The Board Of Trustees Of The Leland Stanford Junior University | High affinity PD-1 agents and methods of use |
US11814419B2 (en) | 2014-08-08 | 2023-11-14 | The Board Of Trustees Of The Leland Stanford Junior University | High affinity PD-1 agents and methods of use |
US9562087B2 (en) | 2014-08-08 | 2017-02-07 | The Board Of Trustees Of The Leland Stanford Junior University | High affinity PD-1 agents and methods of use |
US10533055B2 (en) | 2014-08-28 | 2020-01-14 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for CD19 |
EP3805267A1 (en) | 2014-08-28 | 2021-04-14 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for cd19 |
WO2016033570A1 (en) | 2014-08-28 | 2016-03-03 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for cd19 |
US11827714B2 (en) | 2014-08-28 | 2023-11-28 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for CD19 |
CN106574272A (en) * | 2014-08-29 | 2017-04-19 | 哥莫阿波单克隆有限责任公司 | Universal chimeric antigen receptor expressing immune cells for targeting of diverse multiple antigens and method of manufacturing the same and use of the same for treatment of cancer, infections and autoimmune disorders |
CN106574272B (en) * | 2014-08-29 | 2022-04-29 | 哥莫阿波有限责任公司 | Universal chimeric antigen receptor expressing immune cells targeting diverse antigens, methods of making and use thereof in the treatment of cancer, infection and autoimmune disease |
US11633426B2 (en) | 2014-10-20 | 2023-04-25 | Juno Therapeutics, Inc. | Methods and compositions for dosing in adoptive cell therapy |
EP3932950A1 (en) | 2014-10-20 | 2022-01-05 | Juno Therapeutics, Inc. | Methods and compositions for dosing in adoptive cell therapy |
WO2016064929A1 (en) | 2014-10-20 | 2016-04-28 | Juno Therapeutics, Inc. | Methods and compositions for dosing in adoptive cell therapy |
US10507219B2 (en) | 2014-10-20 | 2019-12-17 | Juno Therapeutics, Inc. | Methods and compositions for dosing in adoptive cell therapy |
JP2017533706A (en) * | 2014-10-31 | 2017-11-16 | ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア | Methods and compositions for modified T cells |
JP7372728B2 (en) | 2014-10-31 | 2023-11-01 | ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア | Methods and compositions related to modified T cells |
EP3757206A1 (en) | 2014-11-05 | 2020-12-30 | Juno Therapeutics, Inc. | Methods for transduction and cell processing |
US10428351B2 (en) | 2014-11-05 | 2019-10-01 | Juno Therapeutics, Inc. | Methods for transduction and cell processing |
US11802295B2 (en) | 2014-11-05 | 2023-10-31 | Juno Therapeutics, Inc. | Methods for transduction and cell processing |
WO2016073602A2 (en) | 2014-11-05 | 2016-05-12 | Juno Therapeutics, Inc. | Methods for transduction and cell processing |
EP3766895A1 (en) | 2014-12-03 | 2021-01-20 | Juno Therapeutics, Inc. | Methods and compositions for adoptive cell therapy |
US11266739B2 (en) | 2014-12-03 | 2022-03-08 | Juno Therapeutics, Inc. | Methods and compositions for adoptive cell therapy |
WO2016090190A1 (en) | 2014-12-03 | 2016-06-09 | Juno Therapeutics, Inc. | Methods and compositions for adoptive cell therapy |
US10639358B2 (en) | 2014-12-12 | 2020-05-05 | Bluebird Bio, Inc. | BCMA chimeric antigen receptors |
US10646558B2 (en) | 2014-12-12 | 2020-05-12 | Bluebird Bio, Inc. | BCMA chimeric antigen receptors |
US10383929B2 (en) | 2014-12-12 | 2019-08-20 | Bluebird Bio, Inc. | BCMA chimeric antigen receptors |
US11351236B2 (en) | 2014-12-12 | 2022-06-07 | 2Seventy Bio, Inc. | BCMA chimeric antigen receptors |
US11382965B2 (en) | 2014-12-12 | 2022-07-12 | 2Seventy Bio, Inc. | BCMA chimeric antigen receptors |
US10624960B2 (en) | 2014-12-12 | 2020-04-21 | Bluebird Bio, Inc. | BCMA chimeric antigen receptors |
US10639359B2 (en) | 2014-12-12 | 2020-05-05 | Bluebird Bio, Inc. | BCMA chimeric antigen receptors |
US11633463B2 (en) | 2014-12-12 | 2023-04-25 | 2Seventy Bio, Inc. | BCMA chimeric antigen receptors |
US11020466B2 (en) | 2014-12-12 | 2021-06-01 | Bluebird Bio, Inc. | BCMA chimeric antigen receptors |
US10981970B2 (en) | 2014-12-24 | 2021-04-20 | Autolus Limited | Chimeric antigen receptor (CAR) comprising a CD22-binding domain |
US11034750B2 (en) | 2014-12-24 | 2021-06-15 | Autolus Limited | Chimeric antigen receptor (CAR) comprising a CD19-binding domain |
EP3237442B1 (en) | 2014-12-24 | 2019-07-10 | UCL Business PLC | Cell |
RU2768019C2 (en) * | 2014-12-24 | 2022-03-23 | Отолус Лимитед | Cell |
US11091532B2 (en) | 2014-12-24 | 2021-08-17 | Autolus Limited | T cell which co-expresses a CD19 chimeric antigen receptor and a CD22 chimeric antigen receptor |
CN107002045A (en) * | 2014-12-24 | 2017-08-01 | Ucl商务股份有限公司 | Cell |
US10363269B2 (en) | 2015-01-12 | 2019-07-30 | Juno Therapeutics, Inc. | Modified hepatitis post-transcriptional regulatory elements |
WO2016115177A1 (en) | 2015-01-12 | 2016-07-21 | Juno Therapeutics, Inc. | Modified hepatitis post-transcriptional regulatory elements |
US10889652B2 (en) | 2015-01-16 | 2021-01-12 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for ROR1 |
EP3760644A1 (en) | 2015-01-16 | 2021-01-06 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for ror1 |
WO2016115559A1 (en) | 2015-01-16 | 2016-07-21 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for ror1 |
US11919970B2 (en) | 2015-01-16 | 2024-03-05 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for ROR1 |
US11918604B2 (en) | 2015-02-19 | 2024-03-05 | Myeloid Therapeutics, Inc. | Chimeric antigen receptor dendritic cell (CAR-DC) for treatment of cancer |
US11918605B1 (en) | 2015-02-19 | 2024-03-05 | Myeloid Therapeutics, Inc. | Chimeric antigen receptor dendritic cell (CAR-DC) for treatment of cancer |
US11517589B2 (en) | 2015-02-19 | 2022-12-06 | Myeloid Therapeutics, Inc. | Chimeric antigen receptor dendritic cell (CAR-DC) for treatment of cancer |
WO2016138034A1 (en) * | 2015-02-24 | 2016-09-01 | The Regents Of The University Of California | Binding-triggered transcriptional switches and methods of use thereof |
US10822387B2 (en) | 2015-02-24 | 2020-11-03 | The Regents Of The University Of California | Binding-triggered transcriptional switches and methods of use thereof |
US10836808B2 (en) | 2015-02-24 | 2020-11-17 | The Regents Of The University Of California | Binding-triggered transcriptional switches and methods of use thereof |
US9834608B2 (en) | 2015-02-24 | 2017-12-05 | The Regents Of The University Of California | Binding-triggered transcriptional switches and methods of use thereof |
US9670281B2 (en) | 2015-02-24 | 2017-06-06 | The Regents Of The University Of California | Binding-triggered transcriptional switches and methods of use thereof |
US10590182B2 (en) | 2015-02-24 | 2020-03-17 | The Regents Of The University Of California | Binding-triggered transcriptional switches and methods of use thereof |
CN107922488A (en) * | 2015-04-02 | 2018-04-17 | 纪念斯隆-凯特琳癌症中心 | TNFRSF14/HVEM albumen and its application method |
US10471098B2 (en) | 2015-04-15 | 2019-11-12 | Prospect Chartercare Rwmc, Llc | Hepatic arterial infusion of CAR-T cells |
WO2016168493A1 (en) * | 2015-04-15 | 2016-10-20 | Prospect CharterCare RWMC, LLC d/b/a Roger Williams Medical Center | Hepatic arterial infusion of car-t cells |
WO2016166568A1 (en) | 2015-04-16 | 2016-10-20 | Juno Therapeutics Gmbh | Methods, kits and apparatus for expanding a population of cells |
US11896614B2 (en) | 2015-04-17 | 2024-02-13 | Novartis Ag | Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells |
US10786549B2 (en) | 2015-04-23 | 2020-09-29 | Baylor College Of Medicine | CD5 chimeric antigen receptor for adoptive T cell therapy |
WO2016172606A1 (en) * | 2015-04-23 | 2016-10-27 | Baylor College Of Medicine | Cd5 chimeric antigen receptor for adoptive t cell therapy |
US11305017B2 (en) | 2015-04-25 | 2022-04-19 | The General Hospital Corporation | Anti-fugetactic agent and anti-cancer agent combination therapy and compositions for the treatment of cancer |
WO2016196388A1 (en) | 2015-05-29 | 2016-12-08 | Juno Therapeutics, Inc. | Composition and methods for regulating inhibitory interactions in genetically engineered cells |
EP3307876A4 (en) * | 2015-06-10 | 2019-04-03 | Nantkwest, Inc. | Modified nk-92 cells for treating cancer |
IL255884B1 (en) * | 2015-06-10 | 2024-01-01 | Immunitybio Inc | Modified nk-92 cells for treating cancer |
IL255884B2 (en) * | 2015-06-10 | 2024-05-01 | Immunitybio Inc | Modified nk-92 cells for treating cancer |
EP4272757A3 (en) * | 2015-06-10 | 2023-12-27 | ImmunityBio, Inc. | Modified nk-92 cells for treating cancer |
US11788059B2 (en) | 2015-06-10 | 2023-10-17 | Immunity Bio, Inc. | Modified NK-92 cells for treating cancer |
US10738279B2 (en) | 2015-06-10 | 2020-08-11 | Nantkwest, Inc. | Modified NK-92 cells for treating cancer |
US11655452B2 (en) | 2015-06-25 | 2023-05-23 | Icell Gene Therapeutics Inc. | Chimeric antigen receptors (CARs), compositions and methods of use thereof |
US11173179B2 (en) | 2015-06-25 | 2021-11-16 | Icell Gene Therapeutics Llc | Chimeric antigen receptor (CAR) targeting multiple antigens, compositions and methods of use thereof |
US10786533B2 (en) | 2015-07-15 | 2020-09-29 | Juno Therapeutics, Inc. | Engineered cells for adoptive cell therapy |
US10829735B2 (en) | 2015-07-21 | 2020-11-10 | The Trustees Of The University Of Pennsylvania | Methods for improving the efficacy and expansion of immune cells |
JP2018521663A (en) * | 2015-07-31 | 2018-08-09 | キングス カレッジ ロンドンKings College London | Remedy |
US10730941B2 (en) | 2015-07-31 | 2020-08-04 | Memorial Sloan-Kettering Cancer Center | Antigen-binding proteins targeting CD56 and uses thereof |
US10899818B2 (en) | 2015-07-31 | 2021-01-26 | King's College London | Therapeutic agents |
RU2747733C1 (en) * | 2015-07-31 | 2021-05-13 | Кинг'С Колледж Лондон | Therapeutic agents |
CN107735407A (en) * | 2015-07-31 | 2018-02-23 | 伦敦国王学院 | therapeutic agent |
US10865231B2 (en) | 2015-07-31 | 2020-12-15 | King's College London | Therapeutic agents |
US11802143B2 (en) | 2015-07-31 | 2023-10-31 | King's College London | Therapeutic agents |
EP3328994A4 (en) * | 2015-07-31 | 2019-04-17 | Memorial Sloan-Kettering Cancer Center | Antigen-binding proteins targeting cd56 and uses thereof |
JP7053037B2 (en) | 2015-07-31 | 2022-04-12 | キングス カレッジ ロンドン | Therapeutic drug |
EP3939992A1 (en) * | 2015-07-31 | 2022-01-19 | King's College London | Therapeutic agents |
US10703794B2 (en) | 2015-07-31 | 2020-07-07 | King's College London | Therapeutic agents |
WO2017021701A1 (en) * | 2015-07-31 | 2017-02-09 | King's College London | Therapeutic agents |
CN107735407B (en) * | 2015-07-31 | 2022-08-16 | 伦敦国王学院 | Therapeutic agents |
JP2021168675A (en) * | 2015-07-31 | 2021-10-28 | キングス カレッジ ロンドンKings College London | Therapeutic agent |
US11123369B2 (en) | 2015-08-07 | 2021-09-21 | Seattle Children's Hospital | Bispecific CAR T-cells for solid tumor targeting |
US11458167B2 (en) | 2015-08-07 | 2022-10-04 | Seattle Children's Hospital | Bispecific CAR T-cells for solid tumor targeting |
JP7162530B2 (en) | 2015-08-07 | 2022-10-28 | シアトル チルドレンズ ホスピタル (ディービーエイ シアトル チルドレンズ リサーチ インスティテュート) | Bispecific CAR T cells targeting solid tumors |
JP2018522567A (en) * | 2015-08-07 | 2018-08-16 | シアトル チルドレンズ ホスピタル, ディービーエー シアトル チルドレンズ リサーチ インスティテュート | Bispecific CAR T cells targeting solid tumors |
WO2017040945A1 (en) | 2015-09-04 | 2017-03-09 | Memorial Sloan Kettering Cancer Center | Immune cell compositions and methods of use |
US11242375B2 (en) | 2015-09-04 | 2022-02-08 | Memorial Sloan Kettering Cancer Center | Immune cell compositions and methods of use |
US11890348B2 (en) | 2015-09-18 | 2024-02-06 | The General Hospital Corporation | Localized delivery of anti-fugetactic agent for treatment of cancer |
WO2017053906A1 (en) | 2015-09-24 | 2017-03-30 | Abvitro Llc | Hiv antibody compositions and methods of use |
EP3662930A1 (en) | 2015-09-24 | 2020-06-10 | AbVitro LLC | Hiv antibody compositions and methods of use |
WO2017068419A2 (en) | 2015-10-22 | 2017-04-27 | Juno Therapeutics Gmbh | Methods, kits, agents and apparatuses for transduction |
US11466253B2 (en) | 2015-10-22 | 2022-10-11 | Juno Therapeutics Gmbh | Methods for culturing cells and kits and apparatus for same |
WO2017068425A1 (en) | 2015-10-22 | 2017-04-27 | Juno Therapeutics Gmbh | Methods for culturing cells and kits and apparatus for same |
WO2017068421A1 (en) | 2015-10-22 | 2017-04-27 | Juno Therapeutics Gmbh | Methods for culturing cells and kits and apparatus for same |
US11913024B2 (en) | 2015-10-22 | 2024-02-27 | Juno Therapeutics Gmbh | Methods for culturing cells and kits and apparatus for same |
US11248238B2 (en) | 2015-10-22 | 2022-02-15 | Juno Therapeutics Gmbh | Methods, kits, agents and apparatuses for transduction |
US10464988B2 (en) | 2015-10-23 | 2019-11-05 | Eureka Therapeutics, Inc. | Antibody/T-cell receptor chimeric constructs and uses thereof |
US11421013B2 (en) | 2015-10-23 | 2022-08-23 | Eureka Therapeutics, Inc. | Antibody/T-cell receptor chimeric constructs and uses thereof |
US10822389B2 (en) | 2015-10-23 | 2020-11-03 | Eureka Therapeutics, Inc. | Antibody/T-cell receptor chimeric constructs and uses thereof |
US11976105B2 (en) | 2015-10-23 | 2024-05-07 | Eureka Therapeutics, Inc. | Antibody/T-cell receptor chimeric constructs and uses thereof |
US11020429B2 (en) | 2015-11-05 | 2021-06-01 | Juno Therapeutics, Inc. | Vectors and genetically engineered immune cells expressing metabolic pathway modulators and uses in adoptive cell therapy |
WO2017079705A1 (en) | 2015-11-05 | 2017-05-11 | Juno Therapeutics, Inc. | Chimeric receptors containing traf-inducing domains and related compositions and methods |
WO2017079703A1 (en) | 2015-11-05 | 2017-05-11 | Juno Therapeutics, Inc. | Vectors and genetically engineered immune cells expressing metabolic pathway modulators and uses in adoptive cell therapy |
WO2017096329A1 (en) | 2015-12-03 | 2017-06-08 | Juno Therapeutics, Inc. | Modified chimeric receptors and related compositions and methods |
EP4212166A1 (en) | 2015-12-03 | 2023-07-19 | Juno Therapeutics, Inc. | Compositions and methods for reducing immune responses against cell therapies |
EP4212547A1 (en) | 2015-12-03 | 2023-07-19 | Juno Therapeutics, Inc. | Modified chimeric receptors and related compositions and methods |
WO2017096327A2 (en) | 2015-12-03 | 2017-06-08 | Juno Therapeutics, Inc. | Compositions and methods for reducing immune responses against cell therapies |
US11815514B2 (en) | 2015-12-04 | 2023-11-14 | Juno Therapeutics, Inc. | Methods and compositions related to toxicity associated with cell therapy |
EP4012415A2 (en) | 2015-12-04 | 2022-06-15 | Juno Therapeutics, Inc. | Methods and compositions related to toxicity associated with cell therapy |
US11479755B2 (en) | 2015-12-07 | 2022-10-25 | 2Seventy Bio, Inc. | T cell compositions |
WO2017120501A1 (en) | 2016-01-07 | 2017-07-13 | Mayo Foundation For Medical Education And Research | Methods of treating cancer with interferon |
WO2017161212A1 (en) | 2016-03-16 | 2017-09-21 | Juno Therapeutics, Inc. | Methods for adaptive design of a treatment regimen and related treatments |
WO2017161208A1 (en) | 2016-03-16 | 2017-09-21 | Juno Therapeutics, Inc. | Methods for determining dosing of a therapeutic agent and related treatments |
US11518814B2 (en) | 2016-03-22 | 2022-12-06 | Seattle Children's Hospital | Early intervention methods to prevent or ameliorate toxicity |
EP4015536A1 (en) | 2016-03-22 | 2022-06-22 | Seattle Children's Hospital (DBA Seattle Children's Research Institute) | Early intervention methods to prevent or ameliorate toxicity |
US11760804B2 (en) | 2016-03-22 | 2023-09-19 | Seattle Children's Hospital | Early intervention methods to prevent or ameliorate toxicity |
WO2017165571A1 (en) | 2016-03-22 | 2017-09-28 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Early intervention methods to prevent or ameliorate toxicity |
WO2017173091A1 (en) | 2016-03-30 | 2017-10-05 | Musc Foundation For Research Development | Methods for treatment and diagnosis of cancer by targeting glycoprotein a repetitions predominant (garp) and for providing effective immunotherapy alone or in combination |
WO2017193107A2 (en) | 2016-05-06 | 2017-11-09 | Juno Therapeutics, Inc. | Genetically engineered cells and methods of making the same |
US11400116B2 (en) | 2016-05-06 | 2022-08-02 | The Regents Of The University Of California | Systems and methods for targeting cancer cells |
WO2017205846A1 (en) | 2016-05-27 | 2017-11-30 | Aadigen, Llc | Peptides and nanoparticles for intracellular delivery of genome-editing molecules |
EP3910059A1 (en) | 2016-05-27 | 2021-11-17 | Aadigen, Llc | Peptides and nanoparticles for intracellular delivery of genome-editing molecules |
EP4011381A1 (en) | 2016-06-03 | 2022-06-15 | Memorial Sloan-Kettering Cancer Center | Adoptive cell therapies as early treatment options |
WO2017214207A2 (en) | 2016-06-06 | 2017-12-14 | Juno Therapeutics, Inc. | Methods for the treatment of b cell malignancies using adoptive cell therapy |
US11820819B2 (en) | 2016-06-24 | 2023-11-21 | Icell Gene Therapeutics Inc. | Chimeric antigen receptors (CARs), compositions and methods thereof |
EP3992632A1 (en) | 2016-06-27 | 2022-05-04 | Juno Therapeutics, Inc. | Mhc-e restricted epitopes, binding molecules and related methods and uses |
WO2018005559A1 (en) | 2016-06-27 | 2018-01-04 | Juno Therapeutics, Inc. | Method of identifying peptide epitopes, molecules that bind such epitopes and related uses |
WO2018005556A1 (en) | 2016-06-27 | 2018-01-04 | Juno Therapeutics, Inc. | Mhc-e restricted epitopes, binding molecules and related methods and uses |
WO2018023100A2 (en) | 2016-07-29 | 2018-02-01 | Juno Therapeutics, Inc. | Anti-idiotypic antibodies and related methods |
US11421287B2 (en) | 2016-07-29 | 2022-08-23 | Juno Therapeutics, Inc. | Methods for assessing the presence or absence of replication competent virus |
WO2018023093A1 (en) | 2016-07-29 | 2018-02-01 | Juno Therapeutics, Inc. | Immunomodulatory polypeptides and related compositions and methods |
WO2018023094A1 (en) | 2016-07-29 | 2018-02-01 | Juno Therapeutics, Inc. | Methods for assessing the presence or absence of replication competent virus |
WO2018027036A1 (en) * | 2016-08-03 | 2018-02-08 | Dipersio John F | Gene editing of car-t cells for the treatment of t cell malignancies with chimeric antigen receptors |
US20180348227A1 (en) * | 2016-08-04 | 2018-12-06 | Memorial Sloan-Kettering Cancer Center | Cancer antigen targets and uses thereof |
US11193938B2 (en) * | 2016-08-04 | 2021-12-07 | Memorial Sloan-Kettering Cancer Center | Cancer antigen targets and uses thereof |
US11401332B2 (en) | 2016-08-23 | 2022-08-02 | The Regents Of The University Of California | Proteolytically cleavable chimeric polypeptides and methods of use thereof |
US11738048B2 (en) | 2016-08-30 | 2023-08-29 | Memorial Sloan Kettering Cancer Center | Immune cell compositions and methods of use for treating viral and other infections |
WO2018049420A1 (en) | 2016-09-12 | 2018-03-15 | Juno Therapeutics, Inc. | Perfusion bioreactor bag assemblies |
EP4353319A2 (en) | 2016-09-28 | 2024-04-17 | Atossa Therapeutics, Inc. | Methods of adoptive cell therapy |
WO2018063985A1 (en) | 2016-09-28 | 2018-04-05 | Atossa Genetics Inc. | Methods of adoptive cell therapy |
US11072660B2 (en) | 2016-10-03 | 2021-07-27 | Juno Therapeutics, Inc. | HPV-specific binding molecules |
WO2018067618A1 (en) | 2016-10-03 | 2018-04-12 | Juno Therapeutics, Inc. | Hpv-specific binding molecules |
WO2018071873A2 (en) | 2016-10-13 | 2018-04-19 | Juno Therapeutics, Inc. | Immunotherapy methods and compositions involving tryptophan metabolic pathway modulators |
US11896615B2 (en) | 2016-10-13 | 2024-02-13 | Juno Therapeutics, Inc. | Immunotherapy methods and compositions involving tryptophan metabolic pathway modulators |
EP4190335A1 (en) | 2016-10-13 | 2023-06-07 | Juno Therapeutics, Inc. | Immunotherapy methods and compositions involving tryptophan metabolic pathway modulators |
WO2018085731A2 (en) | 2016-11-03 | 2018-05-11 | Juno Therapeutics, Inc. | Combination therapy of a t cell therapy and a btk inhibitor |
WO2018093591A1 (en) | 2016-11-03 | 2018-05-24 | Juno Therapeutics, Inc. | Combination therapy of a cell based therapy and a microglia inhibitor |
WO2018102612A1 (en) | 2016-12-02 | 2018-06-07 | Juno Therapeutics, Inc. | Engineered b cells and related compositions and methods |
US11793833B2 (en) | 2016-12-02 | 2023-10-24 | Juno Therapeutics, Inc. | Engineered B cells and related compositions and methods |
EP4279136A2 (en) | 2016-12-03 | 2023-11-22 | Juno Therapeutics, Inc. | Methods for determining car-t cells dosing |
WO2018102786A1 (en) | 2016-12-03 | 2018-06-07 | Juno Therapeutics, Inc. | Methods for modulation of car-t cells |
US11590167B2 (en) | 2016-12-03 | 2023-02-28 | Juno Therapeutic, Inc. | Methods and compositions for use of therapeutic T cells in combination with kinase inhibitors |
WO2018102785A2 (en) | 2016-12-03 | 2018-06-07 | Juno Therapeutics, Inc. | Methods and compositions for use of therapeutic t cells in combination with kinase inhibitors |
WO2018102787A1 (en) | 2016-12-03 | 2018-06-07 | Juno Therapeutics, Inc. | Methods for determining car-t cells dosing |
WO2018106732A1 (en) | 2016-12-05 | 2018-06-14 | Juno Therapeutics, Inc. | Production of engineered cells for adoptive cell therapy |
US11408005B2 (en) | 2016-12-12 | 2022-08-09 | Seattle Children's Hospital | Chimeric transcription factor variants with augmented sensitivity to drug ligand induction of transgene expression in mammalian cells |
EP3336107A1 (en) | 2016-12-15 | 2018-06-20 | Miltenyi Biotec GmbH | Immune cells expressing an antigen binding receptor and a chimeric costimulatory receptor |
WO2018108766A1 (en) | 2016-12-15 | 2018-06-21 | Miltenyi Biotec Gmbh | Immune cells expressing an antigen binding receptor and a chimeric costimulatory receptor |
WO2018132518A1 (en) | 2017-01-10 | 2018-07-19 | Juno Therapeutics, Inc. | Epigenetic analysis of cell therapy and related methods |
US11821027B2 (en) | 2017-01-10 | 2023-11-21 | Juno Therapeutics, Inc. | Epigenetic analysis of cell therapy and related methods |
US11517627B2 (en) | 2017-01-20 | 2022-12-06 | Juno Therapeutics Gmbh | Cell surface conjugates and related cell compositions and methods |
WO2018134691A2 (en) | 2017-01-20 | 2018-07-26 | Juno Therapeutics Gmbh | Cell surface conjugates and related cell compositions and methods |
US11845803B2 (en) | 2017-02-17 | 2023-12-19 | Fred Hutchinson Cancer Center | Combination therapies for treatment of BCMA-related cancers and autoimmune disorders |
WO2018157171A2 (en) | 2017-02-27 | 2018-08-30 | Juno Therapeutics, Inc. | Compositions, articles of manufacture and methods related to dosing in cell therapy |
EP4353818A2 (en) | 2017-02-27 | 2024-04-17 | Juno Therapeutics, Inc. | Compositions, articles of manufacture and methods related to dosing in cell therapy |
US11759480B2 (en) | 2017-02-28 | 2023-09-19 | Endocyte, Inc. | Compositions and methods for CAR T cell therapy |
US11850262B2 (en) | 2017-02-28 | 2023-12-26 | Purdue Research Foundation | Compositions and methods for CAR T cell therapy |
WO2018165228A1 (en) | 2017-03-08 | 2018-09-13 | Memorial Sloan Kettering Cancer Center | Immune cell compositions and methods of use |
WO2018170188A2 (en) | 2017-03-14 | 2018-09-20 | Juno Therapeutics, Inc. | Methods for cryogenic storage |
US11427645B2 (en) | 2017-03-15 | 2022-08-30 | Oxford Biomedica (Uk) Limited | 5T4-targeting agents and methods |
WO2018167486A1 (en) | 2017-03-15 | 2018-09-20 | Oxford Biomedica (Uk) Limited | Method |
US11851659B2 (en) | 2017-03-22 | 2023-12-26 | Novartis Ag | Compositions and methods for immunooncology |
US11547694B2 (en) | 2017-03-23 | 2023-01-10 | The General Hospital Corporation | CXCR4/CXCR7 blockade and treatment of human papilloma virus-associated disease |
US11896616B2 (en) | 2017-03-27 | 2024-02-13 | National University Of Singapore | Stimulatory cell lines for ex vivo expansion and activation of natural killer cells |
US11365236B2 (en) | 2017-03-27 | 2022-06-21 | Nkarta, Inc. | Truncated NKG2D chimeric receptors and uses thereof in natural killer cell immunotherapy |
WO2018187791A1 (en) | 2017-04-07 | 2018-10-11 | Juno Therapeutics, Inc | Engineered cells expressing prostate-specific membrane antigen (psma) or a modified form thereof and related methods |
US11796534B2 (en) | 2017-04-14 | 2023-10-24 | Juno Therapeutics, Inc. | Methods for assessing cell surface glycosylation |
WO2018191723A1 (en) | 2017-04-14 | 2018-10-18 | Juno Therapeutics, Inc. | Methods for assessing cell surface glycosylation |
EP4083063A2 (en) | 2017-04-18 | 2022-11-02 | FUJIFILM Cellular Dynamics, Inc. | Antigen-specific immune effector cells |
WO2018195175A1 (en) | 2017-04-18 | 2018-10-25 | FUJIFILM Cellular Dynamics, Inc. | Antigen-specific immune effector cells |
WO2018200583A1 (en) * | 2017-04-26 | 2018-11-01 | Eureka Therapeutics, Inc. | Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof |
US11965021B2 (en) | 2017-04-26 | 2024-04-23 | Eureka Therapeutics, Inc. | Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof |
RU2780020C2 (en) * | 2017-04-26 | 2022-09-19 | Еурека Терапьютикс, Инк. | Cells expressing chimeric activating receptors and chimeric stimulating receptors and their use |
US20200115448A1 (en) * | 2017-04-26 | 2020-04-16 | Eureka Therapeutics, Inc. | Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof |
US11613573B2 (en) | 2017-04-26 | 2023-03-28 | Eureka Therapeutics, Inc. | Chimeric antibody/T-cell receptor constructs and uses thereof |
US10822413B2 (en) | 2017-04-26 | 2020-11-03 | Eureka Therapeutics, Inc. | Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof |
US11866465B2 (en) | 2017-04-27 | 2024-01-09 | Juno Therapeutics Gmbh | Oligomeric particle reagents and methods of use thereof |
WO2018197949A1 (en) | 2017-04-27 | 2018-11-01 | Juno Therapeutics Gmbh | Oligomeric particle reagents and methods of use thereof |
EP4327878A2 (en) | 2017-05-01 | 2024-02-28 | Juno Therapeutics, Inc. | Combination of a cell therapy and an immunomodulatory compound |
WO2018204427A1 (en) | 2017-05-01 | 2018-11-08 | Juno Therapeutics, Inc. | Combination of a cell therapy and an immunomodulatory compound |
US11413310B2 (en) | 2017-06-02 | 2022-08-16 | Juno Therapeutics, Inc. | Articles of manufacture and methods for treatment using adoptive cell therapy |
US11740231B2 (en) | 2017-06-02 | 2023-08-29 | Juno Therapeutics, Inc. | Articles of manufacture and methods related to toxicity associated with cell therapy |
WO2018223098A1 (en) | 2017-06-02 | 2018-12-06 | Juno Therapeutics, Inc. | Articles of manufacture and methods related to toxicity associated with cell therapy |
WO2018223101A1 (en) | 2017-06-02 | 2018-12-06 | Juno Therapeutics, Inc. | Articles of manufacture and methods for treatment using adoptive cell therapy |
US11944647B2 (en) | 2017-06-02 | 2024-04-02 | Juno Therapeutics, Inc. | Articles of manufacture and methods for treatment using adoptive cell therapy |
WO2018234370A1 (en) | 2017-06-20 | 2018-12-27 | Institut Curie | Immune cells defective for suv39h1 |
EP3828264A1 (en) | 2017-06-20 | 2021-06-02 | Institut Curie | Immune cells defective for suv39h1 |
EP4302768A2 (en) | 2017-06-22 | 2024-01-10 | Board Of Regents, The University Of Texas System | Methods for producing regulatory immune cells and uses thereof |
WO2019006427A1 (en) | 2017-06-29 | 2019-01-03 | Juno Therapeutics, Inc. | Mouse model for assessing toxicities associated with immunotherapies |
WO2019027850A1 (en) | 2017-07-29 | 2019-02-07 | Juno Therapeutics, Inc. | Reagents for expanding cells expressing recombinant receptors |
WO2019032927A1 (en) | 2017-08-09 | 2019-02-14 | Juno Therapeutics, Inc. | Methods for producing genetically engineered cell compositions and related compositions |
WO2019032929A1 (en) | 2017-08-09 | 2019-02-14 | Juno Therapeutics, Inc. | Methods and compositions for preparing genetically engineered cells |
US11851678B2 (en) | 2017-08-09 | 2023-12-26 | Juno Therapeutics, Inc. | Methods for producing genetically engineered cell compositions and related compositions |
WO2019046832A1 (en) | 2017-09-01 | 2019-03-07 | Juno Therapeutics, Inc. | Gene expression and assessment of risk of developing toxicity following cell therapy |
WO2019051335A1 (en) | 2017-09-07 | 2019-03-14 | Juno Therapeutics, Inc. | Methods of identifying cellular attributes related to outcomes associated with cell therapy |
WO2019057102A1 (en) | 2017-09-20 | 2019-03-28 | Tsinghua University | A gRNA TARGETING HPK1 AND A METHOD FOR EDITING HPK1 GENE |
US11952408B2 (en) | 2017-10-03 | 2024-04-09 | Juno Therapeutics, Inc. | HPV-specific binding molecules |
WO2019070541A1 (en) | 2017-10-03 | 2019-04-11 | Juno Therapeutics, Inc. | Hpv-specific binding molecules |
EP4215543A2 (en) | 2017-10-03 | 2023-07-26 | Juno Therapeutics, Inc. | Hpv-specific binding molecules |
WO2019089855A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Process for generating therapeutic compositions of engineered cells |
US11851679B2 (en) | 2017-11-01 | 2023-12-26 | Juno Therapeutics, Inc. | Method of assessing activity of recombinant antigen receptors |
US11066475B2 (en) | 2017-11-01 | 2021-07-20 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for B-cell maturation antigen and encoding polynucleotides |
WO2019089884A2 (en) | 2017-11-01 | 2019-05-09 | Editas Medicine, Inc. | Methods, compositions and components for crispr-cas9 editing of tgfbr2 in t cells for immunotherapy |
WO2019089858A2 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Methods of assessing or monitoring a response to a cell therapy |
WO2019089982A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Method of assessing activity of recombinant antigen receptors |
WO2019090003A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for b-cell maturation antigen (bcma) |
US11623961B2 (en) | 2017-11-01 | 2023-04-11 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for B-cell maturation antigen |
WO2019089848A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Methods associated with tumor burden for assessing response to a cell therapy |
WO2019090004A1 (en) | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Process for producing a t cell composition |
US11564946B2 (en) | 2017-11-01 | 2023-01-31 | Juno Therapeutics, Inc. | Methods associated with tumor burden for assessing response to a cell therapy |
WO2019087151A1 (en) | 2017-11-03 | 2019-05-09 | Sorrento Therapeutics, Inc. | Cd38-directed chimeric antigen receptor constructs |
WO2019090364A1 (en) | 2017-11-06 | 2019-05-09 | Juno Therapeutics, Inc. | Combination of a cell therapy and a gamma secretase inhibitor |
WO2019090202A1 (en) | 2017-11-06 | 2019-05-09 | Editas Medicine, Inc. | Methods, compositions and components for crispr-cas9 editing of cblb in t cells for immunotherapy |
WO2019094835A1 (en) | 2017-11-10 | 2019-05-16 | Juno Therapeutics, Inc. | Closed-system cryogenic vessels |
WO2019109053A1 (en) | 2017-12-01 | 2019-06-06 | Juno Therapeutics, Inc. | Methods for dosing and for modulation of genetically engineered cells |
US11944644B2 (en) | 2017-12-05 | 2024-04-02 | The Medical Research Infrastructure And Health Services Fund Of The Tel Aviv Medical Center | T-cells comprising anti-CD38 and anti-CD138 chimeric antigen receptors and uses thereof |
WO2019113556A1 (en) | 2017-12-08 | 2019-06-13 | Juno Therapeutics, Inc. | Serum-free media formulation for culturing cells and methods of use thereof |
WO2019113559A2 (en) | 2017-12-08 | 2019-06-13 | Juno Therapeutics, Inc. | Phenotypic markers for cell therapy and related methods |
WO2019113557A1 (en) | 2017-12-08 | 2019-06-13 | Juno Therapeutics, Inc. | Process for producing a composition of engineered t cells |
WO2019118937A1 (en) | 2017-12-15 | 2019-06-20 | Juno Therapeutics, Inc. | Anti-cct5 binding molecules and methods of use thereof |
US11919937B2 (en) | 2018-01-09 | 2024-03-05 | Board Of Regents, The University Of Texas System | T cell receptors for immunotherapy |
WO2019141270A1 (en) * | 2018-01-19 | 2019-07-25 | 科济生物医药(上海)有限公司 | Synnotch receptor-regulated expression of il12 |
US11779602B2 (en) | 2018-01-22 | 2023-10-10 | Endocyte, Inc. | Methods of use for CAR T cells |
US11535903B2 (en) | 2018-01-31 | 2022-12-27 | Juno Therapeutics, Inc. | Methods and reagents for assessing the presence or absence of replication competent virus |
WO2019152747A1 (en) | 2018-01-31 | 2019-08-08 | Juno Therapeutics, Inc. | Methods and reagents for assessing the presence or absence of replication competent virus |
WO2019152743A1 (en) | 2018-01-31 | 2019-08-08 | Celgene Corporation | Combination therapy using adoptive cell therapy and checkpoint inhibitor |
WO2019148656A1 (en) * | 2018-02-05 | 2019-08-08 | 深圳市默赛尔生物医学科技发展有限公司 | Multi-signal chimeric antigen receptor and expression gene thereof, nk cells modified thereby and anti-tumor drug |
US11229669B2 (en) | 2018-02-11 | 2022-01-25 | Memorial Sloan-Kettering Cancer Center | Cells comprising non-HLA restricted T cell receptors |
WO2019161133A1 (en) | 2018-02-15 | 2019-08-22 | Memorial Sloan Kettering Cancer Center | Foxp3 targeting agent compositions and methods of use for adoptive cell therapy |
WO2019170845A1 (en) | 2018-03-09 | 2019-09-12 | Ospedale San Raffaele S.R.L. | Il-1 antagonist and toxicity induced by cell therapy |
WO2019170147A1 (en) | 2018-03-09 | 2019-09-12 | 科济生物医药(上海)有限公司 | Method and composition for treating tumors |
WO2019195486A1 (en) | 2018-04-05 | 2019-10-10 | Juno Therapeutics, Inc. | T cell receptors and engineered cells expressing same |
WO2019195492A1 (en) | 2018-04-05 | 2019-10-10 | Juno Therapeutics, Inc. | Methods of producing cells expressing a recombinant receptor and related compositions |
US11471489B2 (en) | 2018-04-05 | 2022-10-18 | Juno Therapeutics, Inc. | T cell receptors and engineered cells expressing same |
WO2019195491A1 (en) | 2018-04-05 | 2019-10-10 | Juno Therapeutics, Inc. | T cells expressing a recombinant receptor, related polynucleotides and methods |
WO2019213184A1 (en) | 2018-05-03 | 2019-11-07 | Juno Therapeutics, Inc. | Combination therapy of a chimeric antigen receptor (car) t cell therapy and a kinase inhibitor |
US11939389B2 (en) | 2018-06-13 | 2024-03-26 | Novartis Ag | BCMA chimeric antigen receptors and uses thereof |
US11952428B2 (en) | 2018-06-13 | 2024-04-09 | Novartis Ag | BCMA chimeric antigen receptors and uses thereof |
US11993661B2 (en) | 2018-06-18 | 2024-05-28 | Eureka Therapeutics, Inc. | Constructs targeting prostate-specific membrane antigen (PSMA) and uses thereof |
WO2020020210A1 (en) | 2018-07-24 | 2020-01-30 | 科济生物医药(上海)有限公司 | Method for treating tumor using immune effector cell |
WO2020033916A1 (en) | 2018-08-09 | 2020-02-13 | Juno Therapeutics, Inc. | Methods for assessing integrated nucleic acids |
WO2020033927A2 (en) | 2018-08-09 | 2020-02-13 | Juno Therapeutics, Inc. | Processes for generating engineered cells and compositions thereof |
WO2020056047A1 (en) | 2018-09-11 | 2020-03-19 | Juno Therapeutics, Inc. | Methods for mass spectrometry analysis of engineered cell compositions |
WO2020061256A1 (en) | 2018-09-19 | 2020-03-26 | FUJIFILM Cellular Dynamics, Inc. | Protein l for activation and expansion of chimeric antigen receptor-modified immune cells |
WO2020089343A1 (en) | 2018-10-31 | 2020-05-07 | Juno Therapeutics Gmbh | Methods for selection and stimulation of cells and apparatus for same |
WO2020092848A2 (en) | 2018-11-01 | 2020-05-07 | Juno Therapeutics, Inc. | Methods for treatment using chimeric antigen receptors specific for b-cell maturation antigen |
WO2020092854A2 (en) | 2018-11-01 | 2020-05-07 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for g protein-coupled receptor class c group 5 member d (gprc5d) |
WO2020097132A1 (en) | 2018-11-06 | 2020-05-14 | Juno Therapeutics, Inc. | Process for producing genetically engineered t cells |
WO2020097403A1 (en) | 2018-11-08 | 2020-05-14 | Juno Therapeutics, Inc. | Methods and combinations for treatment and t cell modulation |
WO2020102770A1 (en) | 2018-11-16 | 2020-05-22 | Juno Therapeutics, Inc. | Methods of dosing engineered t cells for the treatment of b cell malignancies |
WO2020106621A1 (en) | 2018-11-19 | 2020-05-28 | Board Of Regents, The University Of Texas System | A modular, polycistronic vector for car and tcr transduction |
WO2020113029A2 (en) | 2018-11-28 | 2020-06-04 | Board Of Regents, The University Of Texas System | Multiplex genome editing of immune cells to enhance functionality and resistance to suppressive environment |
WO2020112493A1 (en) | 2018-11-29 | 2020-06-04 | Board Of Regents, The University Of Texas System | Methods for ex vivo expansion of natural killer cells and use thereof |
WO2020113194A2 (en) | 2018-11-30 | 2020-06-04 | Juno Therapeutics, Inc. | Methods for treatment using adoptive cell therapy |
WO2020113188A2 (en) | 2018-11-30 | 2020-06-04 | Juno Therapeutics, Inc. | Methods for dosing and treatment of b cell malignancies in adoptive cell therapy |
US12006356B2 (en) | 2018-12-14 | 2024-06-11 | Juno Therapeutics, Inc. | Anti-CCT5 binding molecules and chimeric antigen receptors comprising the same |
WO2020160050A1 (en) | 2019-01-29 | 2020-08-06 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for receptor tyrosine kinase like orphan receptor 1 (ror1) |
WO2020169974A1 (en) | 2019-02-19 | 2020-08-27 | King's College London | Hypoxia-responsive chimeric antigen receptors |
US11154575B2 (en) | 2019-03-05 | 2021-10-26 | Nkarta, Inc. | Cancer immunotherapy using CD19-directed chimeric antigen receptors |
US11253547B2 (en) | 2019-03-05 | 2022-02-22 | Nkarta, Inc. | CD19-directed chimeric antigen receptors and uses thereof in immunotherapy |
US11141436B2 (en) | 2019-03-05 | 2021-10-12 | Nkarta, Inc. | Immune cells engineered to express CD19-directed chimeric antigen receptors and uses thereof in immunotherapy |
WO2020223571A1 (en) | 2019-05-01 | 2020-11-05 | Juno Therapeutics, Inc. | Cells expressing a chimeric receptor from a modified cd247 locus, related polynucleotides and methods |
WO2020223535A1 (en) | 2019-05-01 | 2020-11-05 | Juno Therapeutics, Inc. | Cells expressing a recombinant receptor from a modified tgfbr2 locus, related polynucleotides and methods |
WO2020247832A1 (en) | 2019-06-07 | 2020-12-10 | Juno Therapeutics, Inc. | Automated t cell culture |
WO2020252218A1 (en) | 2019-06-12 | 2020-12-17 | Juno Therapeutics, Inc. | Combination therapy of a cell-mediated cytotoxic therapy and an inhibitor of a prosurvival bcl2 family protein |
US12006369B2 (en) | 2019-07-18 | 2024-06-11 | 2Seventy Bio, Inc. | BCMA chimeric antigen receptors |
WO2021013950A1 (en) | 2019-07-23 | 2021-01-28 | Mnemo Therapeutics | Immune cells defective for suv39h1 |
WO2021035194A1 (en) | 2019-08-22 | 2021-02-25 | Juno Therapeutics, Inc. | Combination therapy of a t cell therapy and an enhancer of zeste homolog 2 (ezh2) inhibitor and related methods |
WO2021038036A1 (en) * | 2019-08-28 | 2021-03-04 | King's College London | B CELL TARGETED PARALLEL CAR (pCAR) THERAPEUTIC AGENTS |
WO2021041994A2 (en) | 2019-08-30 | 2021-03-04 | Juno Therapeutics, Inc. | Machine learning methods for classifying cells |
WO2021043804A1 (en) | 2019-09-02 | 2021-03-11 | Institut Curie | Immunotherapy targeting tumor neoantigenic peptides |
WO2021078910A1 (en) | 2019-10-22 | 2021-04-29 | Institut Curie | Immunotherapy targeting tumor neoantigenic peptides |
WO2021084050A1 (en) | 2019-10-30 | 2021-05-06 | Juno Therapeutics Gmbh | Cell selection and/or stimulation devices and methods of use |
WO2021092097A1 (en) | 2019-11-05 | 2021-05-14 | Juno Therapeutics, Inc. | Methods of determining attributes of therapeutic t cell compositions |
WO2021092498A1 (en) | 2019-11-07 | 2021-05-14 | Juno Therapeutics, Inc. | Combination of a t cell therapy and (s)-3-[4-(4-morpholin-4 ylmethyl-benzyloxy)-l-oxo-l,3-dihydro-isoindol-2-yl]- piperidine-2,6-dione |
US11975026B2 (en) | 2019-11-26 | 2024-05-07 | Novartis Ag | CD19 and CD22 chimeric antigen receptors and uses thereof |
WO2021113780A1 (en) | 2019-12-06 | 2021-06-10 | Juno Therapeutics, Inc. | Anti-idiotypic antibodies to gprc5d-targeted binding domains and related compositions and methods |
WO2021113770A1 (en) | 2019-12-06 | 2021-06-10 | Juno Therapeutics, Inc. | Methods related to toxicity and response associated with cell therapy for treating b cell malignancies |
WO2021113776A1 (en) | 2019-12-06 | 2021-06-10 | Juno Therapeutics, Inc. | Anti-idiotypic antibodies to bcma-targeted binding domains and related compositions and methods |
WO2021151008A1 (en) | 2020-01-24 | 2021-07-29 | Juno Therapuetics, Inc. | Methods for dosing and treatment of follicular lymphoma and marginal zone lymphoma in adoptive cell therapy |
WO2021154887A1 (en) | 2020-01-28 | 2021-08-05 | Juno Therapeutics, Inc. | Methods for t cell transduction |
WO2021163391A1 (en) | 2020-02-12 | 2021-08-19 | Juno Therapeutics, Inc. | Cd19-directed chimeric antigen receptor t cell compositions and methods and uses thereof |
WO2021163389A1 (en) | 2020-02-12 | 2021-08-19 | Juno Therapeutics, Inc. | Bcma-directed chimeric antigen receptor t cell compositions and methods and uses thereof |
WO2021164959A1 (en) * | 2020-02-17 | 2021-08-26 | Miltenyi Biotec B.V. & Co. KG | Method for providing personalized cells with chimeric antigen receptors (car) against tumor microenvironment cells |
WO2021167908A1 (en) | 2020-02-17 | 2021-08-26 | Board Of Regents, The University Of Texas System | Methods for expansion of tumor infiltrating lymphocytes and use thereof |
WO2021207689A2 (en) | 2020-04-10 | 2021-10-14 | Juno Therapeutics, Inc. | Methods and uses related to cell therapy engineered with a chimeric antigen receptor targeting b-cell maturation antigen |
WO2021222330A2 (en) | 2020-04-28 | 2021-11-04 | Juno Therapeutics, Inc. | Combination of bcma-directed t cell therapy and an immunomodulatory compound |
WO2021228999A1 (en) | 2020-05-12 | 2021-11-18 | Institut Curie | Neoantigenic epitopes associated with sf3b1 mutations |
WO2021231657A1 (en) | 2020-05-13 | 2021-11-18 | Juno Therapeutics, Inc. | Methods of identifying features associated with clinical response and uses thereof |
WO2021231661A2 (en) | 2020-05-13 | 2021-11-18 | Juno Therapeutics, Inc. | Process for producing donor-batched cells expressing a recombinant receptor |
WO2021237068A2 (en) | 2020-05-21 | 2021-11-25 | Board Of Regents, The University Of Texas System | T cell receptors with vgll1 specificity and uses thereof |
WO2021260186A1 (en) | 2020-06-26 | 2021-12-30 | Juno Therapeutics Gmbh | Engineered t cells conditionally expressing a recombinant receptor, related polynucleotides and methods |
WO2022016119A1 (en) | 2020-07-17 | 2022-01-20 | Simurx, Inc. | Chimeric myd88 receptors for redirecting immunosuppressive signaling and related compositions and methods |
WO2022023576A1 (en) | 2020-07-30 | 2022-02-03 | Institut Curie | Immune cells defective for socs1 |
WO2022029660A1 (en) | 2020-08-05 | 2022-02-10 | Juno Therapeutics, Inc. | Anti-idiotypic antibodies to ror1-targeted binding domains and related compositions and methods |
US11628218B2 (en) | 2020-11-04 | 2023-04-18 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
WO2022098787A1 (en) | 2020-11-04 | 2022-05-12 | Juno Therapeutics, Inc. | Cells expressing a chimeric receptor from a modified invariant cd3 immunoglobulin superfamily chain locus and related polynucleotides and methods |
WO2022104109A1 (en) | 2020-11-13 | 2022-05-19 | Catamaran Bio, Inc. | Genetically modified natural killer cells and methods of use thereof |
WO2022115611A1 (en) | 2020-11-25 | 2022-06-02 | Catamaran Bio, Inc. | Cellular therapeutics engineered with signal modulators and methods of use thereof |
WO2022133030A1 (en) | 2020-12-16 | 2022-06-23 | Juno Therapeutics, Inc. | Combination therapy of a cell therapy and a bcl2 inhibitor |
WO2022150731A1 (en) | 2021-01-11 | 2022-07-14 | Sana Biotechnology, Inc. | Use of cd8-targeted viral vectors |
WO2022187406A1 (en) | 2021-03-03 | 2022-09-09 | Juno Therapeutics, Inc. | Combination of a t cell therapy and a dgk inhibitor |
WO2022189620A1 (en) | 2021-03-11 | 2022-09-15 | Institut Curie | Transmembrane neoantigenic peptides |
WO2022189639A1 (en) | 2021-03-11 | 2022-09-15 | Mnemo Therapeutics | Tumor neoantigenic peptides and uses thereof |
WO2022189626A2 (en) | 2021-03-11 | 2022-09-15 | Mnemo Therapeutics | Tumor neoantigenic peptides |
WO2022204070A1 (en) | 2021-03-22 | 2022-09-29 | Juno Therapeutics, Inc. | Methods of determining potency of a therapeutic cell composition |
WO2022204071A1 (en) | 2021-03-22 | 2022-09-29 | Juno Therapeutics, Inc. | Method to assess potency of viral vector particles |
WO2022212384A1 (en) | 2021-03-29 | 2022-10-06 | Juno Therapeutics, Inc. | Combination of a car t cell therapy and an immunomodulatory compound for treatment of lymphoma |
WO2022212400A1 (en) | 2021-03-29 | 2022-10-06 | Juno Therapeutics, Inc. | Methods for dosing and treatment with a combination of a checkpoint inhibitor therapy and a car t cell therapy |
WO2022221737A1 (en) | 2021-04-16 | 2022-10-20 | Juno Therapeutics, Inc. | T cell therapy in patients who have had prior stem cell transplant |
WO2022221726A2 (en) | 2021-04-16 | 2022-10-20 | Juno Therapeutics, Inc. | Combination therapies with bcma-directed t cell therapy |
WO2022234009A2 (en) | 2021-05-06 | 2022-11-10 | Juno Therapeutics Gmbh | Methods for stimulating and transducing t cells |
WO2022238386A1 (en) | 2021-05-10 | 2022-11-17 | Institut Curie | Methods for the treatment of cancer, inflammatory diseases and autoimmune diseases |
WO2022248602A1 (en) | 2021-05-25 | 2022-12-01 | Institut Curie | Myeloid cells overexpressing bcl2 |
WO2023014922A1 (en) | 2021-08-04 | 2023-02-09 | The Regents Of The University Of Colorado, A Body Corporate | Lat activating chimeric antigen receptor t cells and methods of use thereof |
WO2023015217A1 (en) | 2021-08-04 | 2023-02-09 | Sana Biotechnology, Inc. | Use of cd4-targeted viral vectors |
WO2023081715A1 (en) | 2021-11-03 | 2023-05-11 | Viracta Therapeutics, Inc. | Combination of car t-cell therapy with btk inhibitors and methods of use thereof |
WO2023081735A1 (en) | 2021-11-03 | 2023-05-11 | Celgene Corporation | Chimeric antigen receptors specific for b-cell maturation antigen for use in treating myeloma |
WO2023081900A1 (en) | 2021-11-08 | 2023-05-11 | Juno Therapeutics, Inc. | Engineered t cells expressing a recombinant t cell receptor (tcr) and related systems and methods |
WO2023105000A1 (en) | 2021-12-09 | 2023-06-15 | Zygosity Limited | Vector |
WO2023115041A1 (en) | 2021-12-17 | 2023-06-22 | Sana Biotechnology, Inc. | Modified paramyxoviridae attachment glycoproteins |
WO2023115039A2 (en) | 2021-12-17 | 2023-06-22 | Sana Biotechnology, Inc. | Modified paramyxoviridae fusion glycoproteins |
WO2023126458A1 (en) | 2021-12-28 | 2023-07-06 | Mnemo Therapeutics | Immune cells with inactivated suv39h1 and modified tcr |
WO2023139269A1 (en) | 2022-01-21 | 2023-07-27 | Mnemo Therapeutics | Modulation of suv39h1 expression by rnas |
WO2023147515A1 (en) | 2022-01-28 | 2023-08-03 | Juno Therapeutics, Inc. | Methods of manufacturing cellular compositions |
WO2023150518A1 (en) | 2022-02-01 | 2023-08-10 | Sana Biotechnology, Inc. | Cd3-targeted lentiviral vectors and uses thereof |
WO2023164440A1 (en) | 2022-02-22 | 2023-08-31 | Juno Therapeutics, Inc. | Proteinase 3 (pr3) chimeric autoantibody receptor t cells and related methods and uses |
WO2023178348A1 (en) | 2022-03-18 | 2023-09-21 | The Regents Of The University Of Colorado, A Body Corporate | Genetically engineered t-cell co-receptors and methods of use thereof |
WO2023180552A1 (en) | 2022-03-24 | 2023-09-28 | Institut Curie | Immunotherapy targeting tumor transposable element derived neoantigenic peptides in glioblastoma |
WO2023187024A1 (en) | 2022-03-31 | 2023-10-05 | Institut Curie | Modified rela protein for inducing interferon expression and engineered immune cells with improved interferon expression |
WO2023193015A1 (en) | 2022-04-01 | 2023-10-05 | Sana Biotechnology, Inc. | Cytokine receptor agonist and viral vector combination therapies |
WO2023196921A1 (en) | 2022-04-06 | 2023-10-12 | The Regents Of The University Of Colorado, A Body Corporate | Granzyme expressing t cells and methods of use |
WO2023196933A1 (en) | 2022-04-06 | 2023-10-12 | The Regents Of The University Of Colorado, A Body Corporate | Chimeric antigen receptor t cells and methods of use thereof |
WO2023211972A1 (en) | 2022-04-28 | 2023-11-02 | Medical University Of South Carolina | Chimeric antigen receptor modified regulatory t cells for treating cancer |
WO2023213969A1 (en) | 2022-05-05 | 2023-11-09 | Juno Therapeutics Gmbh | Viral-binding protein and related reagents, articles, and methods of use |
WO2023220655A1 (en) | 2022-05-11 | 2023-11-16 | Celgene Corporation | Methods to overcome drug resistance by re-sensitizing cancer cells to treatment with a prior therapy via treatment with a t cell therapy |
WO2023220641A2 (en) | 2022-05-11 | 2023-11-16 | Juno Therapeutics, Inc. | Methods and uses related to t cell therapy and production of same |
WO2023222617A1 (en) | 2022-05-16 | 2023-11-23 | Miltenyi Biotec B.V. & Co. KG | Endogenous signaling molecule activating chimeric antigen receptors and methods of generation thereof |
WO2023222928A2 (en) | 2022-05-20 | 2023-11-23 | Mnemo Therapeutics | Compositions and methods for treating a refractory or relapsed cancer or a chronic infectious disease |
EP4279085A1 (en) | 2022-05-20 | 2023-11-22 | Mnemo Therapeutics | Compositions and methods for treating a refractory or relapsed cancer or a chronic infectious disease |
WO2023230548A1 (en) | 2022-05-25 | 2023-11-30 | Celgene Corporation | Method for predicting response to a t cell therapy |
WO2023230581A1 (en) | 2022-05-25 | 2023-11-30 | Celgene Corporation | Methods of manufacturing t cell therapies |
WO2023250400A1 (en) | 2022-06-22 | 2023-12-28 | Juno Therapeutics, Inc. | Treatment methods for second line therapy of cd19-targeted car t cells |
WO2024006960A1 (en) | 2022-06-29 | 2024-01-04 | Juno Therapeutics, Inc. | Lipid nanoparticles for delivery of nucleic acids |
WO2024031091A2 (en) | 2022-08-05 | 2024-02-08 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for gprc5d and bcma |
WO2024044779A2 (en) | 2022-08-26 | 2024-02-29 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for delta-like ligand 3 (dll3) |
WO2024054944A1 (en) | 2022-09-08 | 2024-03-14 | Juno Therapeutics, Inc. | Combination of a t cell therapy and continuous or intermittent dgk inhibitor dosing |
WO2024062138A1 (en) | 2022-09-23 | 2024-03-28 | Mnemo Therapeutics | Immune cells comprising a modified suv39h1 gene |
WO2024081820A1 (en) | 2022-10-13 | 2024-04-18 | Sana Biotechnology, Inc. | Viral particles targeting hematopoietic stem cells |
WO2024097905A1 (en) | 2022-11-02 | 2024-05-10 | Celgene Corporation | Methods of treatment with t cell therapy and immunomodulatory agent maintenance therapy |
WO2024100604A1 (en) | 2022-11-09 | 2024-05-16 | Juno Therapeutics Gmbh | Methods for manufacturing engineered immune cells |
WO2024102948A1 (en) | 2022-11-11 | 2024-05-16 | Celgene Corporation | Fc receptor-homolog 5 (fcrh5) specific binding molecules and bispecific t-cell engaging antibodies including same and related methods |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2020294287B2 (en) | Compositions and methods for immunotherapy | |
US11103531B2 (en) | Compositions and methods for immunotherapy | |
WO2015142314A1 (en) | Compositions and methods for immunotherapy |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13844468 Country of ref document: EP Kind code of ref document: A1 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 238047 Country of ref document: IL |
|
ENP | Entry into the national phase |
Ref document number: 2886859 Country of ref document: CA Ref document number: 2015534828 Country of ref document: JP Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2015/004287 Country of ref document: MX |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 12015500747 Country of ref document: PH |
|
ENP | Entry into the national phase |
Ref document number: 2013327136 Country of ref document: AU Date of ref document: 20131002 Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2013844468 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: IDP00201502523 Country of ref document: ID |
|
ENP | Entry into the national phase |
Ref document number: 20157011160 Country of ref document: KR Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 2015116901 Country of ref document: RU Kind code of ref document: A |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112015007432 Country of ref document: BR |
|
ENP | Entry into the national phase |
Ref document number: 112015007432 Country of ref document: BR Kind code of ref document: A2 Effective date: 20150401 |