WO2009073163A1 - Avian influenza antibodies, compositions, and methods thereof - Google Patents
Avian influenza antibodies, compositions, and methods thereof Download PDFInfo
- Publication number
- WO2009073163A1 WO2009073163A1 PCT/US2008/013259 US2008013259W WO2009073163A1 WO 2009073163 A1 WO2009073163 A1 WO 2009073163A1 US 2008013259 W US2008013259 W US 2008013259W WO 2009073163 A1 WO2009073163 A1 WO 2009073163A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- avian influenza
- antibodies
- viral
- protein
- Prior art date
Links
- 208000002979 Influenza in Birds Diseases 0.000 title claims abstract description 212
- 206010064097 avian influenza Diseases 0.000 title claims abstract description 212
- 238000000034 method Methods 0.000 title claims abstract description 93
- 239000000203 mixture Substances 0.000 title description 66
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 55
- 208000015181 infectious disease Diseases 0.000 claims abstract description 34
- 108090000623 proteins and genes Proteins 0.000 claims description 126
- 239000000427 antigen Substances 0.000 claims description 76
- 108091007433 antigens Proteins 0.000 claims description 75
- 102000036639 antigens Human genes 0.000 claims description 75
- 239000012634 fragment Substances 0.000 claims description 74
- 101710154606 Hemagglutinin Proteins 0.000 claims description 66
- 101710093908 Outer capsid protein VP4 Proteins 0.000 claims description 66
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 claims description 66
- 101710176177 Protein A56 Proteins 0.000 claims description 66
- 230000027455 binding Effects 0.000 claims description 63
- 241000282414 Homo sapiens Species 0.000 claims description 60
- 239000000185 hemagglutinin Substances 0.000 claims description 60
- 102000004169 proteins and genes Human genes 0.000 claims description 57
- 108010067390 Viral Proteins Proteins 0.000 claims description 53
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 50
- 230000003612 virological effect Effects 0.000 claims description 44
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 38
- 108091034117 Oligonucleotide Proteins 0.000 claims description 33
- 108010006232 Neuraminidase Proteins 0.000 claims description 27
- 102000005348 Neuraminidase Human genes 0.000 claims description 27
- 239000000872 buffer Substances 0.000 claims description 27
- 238000001514 detection method Methods 0.000 claims description 27
- 239000003085 diluting agent Substances 0.000 claims description 23
- 241000712461 unidentified influenza virus Species 0.000 claims description 22
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 claims description 20
- 239000002245 particle Substances 0.000 claims description 20
- 239000003153 chemical reaction reagent Substances 0.000 claims description 18
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 17
- 230000003053 immunization Effects 0.000 claims description 13
- 101710144128 Non-structural protein 2 Proteins 0.000 claims description 7
- 101710199667 Nuclear export protein Proteins 0.000 claims description 7
- 108091023037 Aptamer Proteins 0.000 claims description 6
- 101710128560 Initiator protein NS1 Proteins 0.000 claims description 3
- 101710199771 Matrix protein 1 Proteins 0.000 claims description 3
- 101710199769 Matrix protein 2 Proteins 0.000 claims description 3
- 101710144127 Non-structural protein 1 Proteins 0.000 claims description 3
- 108090001074 Nucleocapsid Proteins Proteins 0.000 claims description 3
- 108050000930 Polymerase acidic proteins Proteins 0.000 claims description 3
- 101710093543 Probable non-specific lipid-transfer protein Proteins 0.000 claims description 3
- 108010026228 mRNA guanylyltransferase Proteins 0.000 claims description 3
- 210000004027 cell Anatomy 0.000 description 131
- 235000018102 proteins Nutrition 0.000 description 55
- -1 for example Proteins 0.000 description 54
- 150000007523 nucleic acids Chemical class 0.000 description 44
- 238000009472 formulation Methods 0.000 description 43
- 239000000243 solution Substances 0.000 description 43
- 102000039446 nucleic acids Human genes 0.000 description 40
- 108020004707 nucleic acids Proteins 0.000 description 40
- 239000000523 sample Substances 0.000 description 36
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 34
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 34
- 230000014509 gene expression Effects 0.000 description 33
- 108020004414 DNA Proteins 0.000 description 31
- 150000001413 amino acids Chemical class 0.000 description 30
- 241001529936 Murinae Species 0.000 description 29
- 241000700605 Viruses Species 0.000 description 29
- 238000003556 assay Methods 0.000 description 28
- 210000004408 hybridoma Anatomy 0.000 description 28
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 26
- 239000013612 plasmid Substances 0.000 description 26
- 239000013598 vector Substances 0.000 description 25
- 239000002299 complementary DNA Substances 0.000 description 23
- 239000003795 chemical substances by application Substances 0.000 description 22
- 150000001875 compounds Chemical class 0.000 description 22
- 239000007787 solid Substances 0.000 description 21
- 102000004190 Enzymes Human genes 0.000 description 20
- 108090000790 Enzymes Proteins 0.000 description 20
- 241001465754 Metazoa Species 0.000 description 20
- 229940088598 enzyme Drugs 0.000 description 20
- 239000012530 fluid Substances 0.000 description 20
- 238000004519 manufacturing process Methods 0.000 description 20
- 206010022000 influenza Diseases 0.000 description 19
- 238000002360 preparation method Methods 0.000 description 19
- 239000003755 preservative agent Substances 0.000 description 19
- 108060003951 Immunoglobulin Proteins 0.000 description 18
- 241000699666 Mus <mouse, genus> Species 0.000 description 18
- 102000018358 immunoglobulin Human genes 0.000 description 18
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 17
- 239000000284 extract Substances 0.000 description 17
- 229920001184 polypeptide Polymers 0.000 description 17
- 235000001014 amino acid Nutrition 0.000 description 16
- 229940024606 amino acid Drugs 0.000 description 16
- 150000003839 salts Chemical class 0.000 description 16
- 108020004999 messenger RNA Proteins 0.000 description 15
- 239000011780 sodium chloride Substances 0.000 description 15
- 238000011282 treatment Methods 0.000 description 15
- 230000002335 preservative effect Effects 0.000 description 14
- 238000012360 testing method Methods 0.000 description 14
- 238000002965 ELISA Methods 0.000 description 13
- 239000002773 nucleotide Substances 0.000 description 13
- 125000003729 nucleotide group Chemical group 0.000 description 13
- 239000000047 product Substances 0.000 description 13
- 108091028043 Nucleic acid sequence Proteins 0.000 description 12
- 206010035226 Plasma cell myeloma Diseases 0.000 description 12
- 230000000694 effects Effects 0.000 description 12
- 239000000463 material Substances 0.000 description 12
- 201000000050 myeloid neoplasm Diseases 0.000 description 12
- 241000271566 Aves Species 0.000 description 11
- 210000004962 mammalian cell Anatomy 0.000 description 11
- 230000009257 reactivity Effects 0.000 description 11
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 10
- 241000282412 Homo Species 0.000 description 10
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 10
- 230000001580 bacterial effect Effects 0.000 description 10
- 238000010367 cloning Methods 0.000 description 10
- 238000005516 engineering process Methods 0.000 description 10
- 239000013604 expression vector Substances 0.000 description 10
- 230000006870 function Effects 0.000 description 10
- 238000003018 immunoassay Methods 0.000 description 10
- 238000011534 incubation Methods 0.000 description 10
- 241000894007 species Species 0.000 description 10
- 210000001519 tissue Anatomy 0.000 description 10
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 10
- 241000699670 Mus sp. Species 0.000 description 9
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 9
- 239000002253 acid Substances 0.000 description 9
- 239000000654 additive Substances 0.000 description 9
- 238000006243 chemical reaction Methods 0.000 description 9
- 230000000295 complement effect Effects 0.000 description 9
- 201000010099 disease Diseases 0.000 description 9
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 9
- 239000003937 drug carrier Substances 0.000 description 9
- 210000003527 eukaryotic cell Anatomy 0.000 description 9
- 238000002156 mixing Methods 0.000 description 9
- 229920001223 polyethylene glycol Polymers 0.000 description 9
- 244000144977 poultry Species 0.000 description 9
- 235000013594 poultry meat Nutrition 0.000 description 9
- 102000005962 receptors Human genes 0.000 description 9
- 108020003175 receptors Proteins 0.000 description 9
- 239000000758 substrate Substances 0.000 description 9
- 239000000725 suspension Substances 0.000 description 9
- 239000003981 vehicle Substances 0.000 description 9
- CFKMVGJGLGKFKI-UHFFFAOYSA-N 4-chloro-m-cresol Chemical compound CC1=CC(O)=CC=C1Cl CFKMVGJGLGKFKI-UHFFFAOYSA-N 0.000 description 8
- 239000004365 Protease Substances 0.000 description 8
- 102000004389 Ribonucleoproteins Human genes 0.000 description 8
- 108010081734 Ribonucleoproteins Proteins 0.000 description 8
- 239000004480 active ingredient Substances 0.000 description 8
- 230000009977 dual effect Effects 0.000 description 8
- 239000003623 enhancer Substances 0.000 description 8
- 230000004927 fusion Effects 0.000 description 8
- 230000002068 genetic effect Effects 0.000 description 8
- 208000037797 influenza A Diseases 0.000 description 8
- 239000007924 injection Substances 0.000 description 8
- 238000002347 injection Methods 0.000 description 8
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 8
- QWVGKYWNOKOFNN-UHFFFAOYSA-N o-cresol Chemical compound CC1=CC=CC=C1O QWVGKYWNOKOFNN-UHFFFAOYSA-N 0.000 description 8
- IWDCLRJOBJJRNH-UHFFFAOYSA-N p-cresol Chemical compound CC1=CC=C(O)C=C1 IWDCLRJOBJJRNH-UHFFFAOYSA-N 0.000 description 8
- 238000012216 screening Methods 0.000 description 8
- 208000024891 symptom Diseases 0.000 description 8
- 210000002845 virion Anatomy 0.000 description 8
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 7
- LRFVTYWOQMYALW-UHFFFAOYSA-N 9H-xanthine Chemical compound O=C1NC(=O)NC2=C1NC=N2 LRFVTYWOQMYALW-UHFFFAOYSA-N 0.000 description 7
- 241000894006 Bacteria Species 0.000 description 7
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 7
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 7
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 7
- 239000013543 active substance Substances 0.000 description 7
- 125000000539 amino acid group Chemical group 0.000 description 7
- 230000015572 biosynthetic process Effects 0.000 description 7
- 238000003776 cleavage reaction Methods 0.000 description 7
- 239000003814 drug Substances 0.000 description 7
- 229960001484 edetic acid Drugs 0.000 description 7
- 238000001727 in vivo Methods 0.000 description 7
- 239000005022 packaging material Substances 0.000 description 7
- 230000008488 polyadenylation Effects 0.000 description 7
- 230000007017 scission Effects 0.000 description 7
- 239000002904 solvent Substances 0.000 description 7
- 238000001262 western blot Methods 0.000 description 7
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 6
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 6
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 6
- 241000238631 Hexapoda Species 0.000 description 6
- 241000712431 Influenza A virus Species 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 6
- 239000005557 antagonist Substances 0.000 description 6
- 210000000628 antibody-producing cell Anatomy 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 239000002585 base Substances 0.000 description 6
- 239000000969 carrier Substances 0.000 description 6
- 210000000170 cell membrane Anatomy 0.000 description 6
- 230000002759 chromosomal effect Effects 0.000 description 6
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 6
- 239000000839 emulsion Substances 0.000 description 6
- 238000009396 hybridization Methods 0.000 description 6
- 238000000338 in vitro Methods 0.000 description 6
- 238000011065 in-situ storage Methods 0.000 description 6
- 230000001717 pathogenic effect Effects 0.000 description 6
- 210000001236 prokaryotic cell Anatomy 0.000 description 6
- 230000010076 replication Effects 0.000 description 6
- 210000002966 serum Anatomy 0.000 description 6
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 6
- 239000007790 solid phase Substances 0.000 description 6
- 238000007920 subcutaneous administration Methods 0.000 description 6
- 238000003786 synthesis reaction Methods 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 6
- 229940033663 thimerosal Drugs 0.000 description 6
- 238000001890 transfection Methods 0.000 description 6
- 108091005804 Peptidases Proteins 0.000 description 5
- 239000002202 Polyethylene glycol Substances 0.000 description 5
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 5
- 108010029566 avian influenza A virus hemagglutinin Proteins 0.000 description 5
- 210000003719 b-lymphocyte Anatomy 0.000 description 5
- 230000008859 change Effects 0.000 description 5
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 5
- 230000013595 glycosylation Effects 0.000 description 5
- 239000007943 implant Substances 0.000 description 5
- 239000002502 liposome Substances 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 230000003472 neutralizing effect Effects 0.000 description 5
- 239000003921 oil Substances 0.000 description 5
- 235000019198 oils Nutrition 0.000 description 5
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 5
- 230000008569 process Effects 0.000 description 5
- 239000001509 sodium citrate Substances 0.000 description 5
- 239000003381 stabilizer Substances 0.000 description 5
- 238000010561 standard procedure Methods 0.000 description 5
- 235000000346 sugar Nutrition 0.000 description 5
- 206010003445 Ascites Diseases 0.000 description 4
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- 102000009410 Chemokine receptor Human genes 0.000 description 4
- 108050000299 Chemokine receptor Proteins 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 4
- 102000004127 Cytokines Human genes 0.000 description 4
- 108090000695 Cytokines Proteins 0.000 description 4
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 108090000288 Glycoproteins Proteins 0.000 description 4
- 102000003886 Glycoproteins Human genes 0.000 description 4
- 108091006905 Human Serum Albumin Proteins 0.000 description 4
- 102000008100 Human Serum Albumin Human genes 0.000 description 4
- 229930195725 Mannitol Natural products 0.000 description 4
- 241000283973 Oryctolagus cuniculus Species 0.000 description 4
- 102000035195 Peptidases Human genes 0.000 description 4
- 102100024952 Protein CBFA2T1 Human genes 0.000 description 4
- 239000004288 Sodium dehydroacetate Substances 0.000 description 4
- 101001099217 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) Triosephosphate isomerase Proteins 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 230000000890 antigenic effect Effects 0.000 description 4
- 239000003963 antioxidant agent Substances 0.000 description 4
- 235000006708 antioxidants Nutrition 0.000 description 4
- 239000011324 bead Substances 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 229960000686 benzalkonium chloride Drugs 0.000 description 4
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 4
- 229960001950 benzethonium chloride Drugs 0.000 description 4
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 4
- 239000012472 biological sample Substances 0.000 description 4
- 150000001720 carbohydrates Chemical class 0.000 description 4
- 235000014633 carbohydrates Nutrition 0.000 description 4
- 229960002242 chlorocresol Drugs 0.000 description 4
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 4
- WHBIGIKBNXZKFE-UHFFFAOYSA-N delavirdine Chemical compound CC(C)NC1=CC=CN=C1N1CCN(C(=O)C=2NC3=CC=C(NS(C)(=O)=O)C=C3C=2)CC1 WHBIGIKBNXZKFE-UHFFFAOYSA-N 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 239000000539 dimer Substances 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 210000003722 extracellular fluid Anatomy 0.000 description 4
- 230000002414 glycolytic effect Effects 0.000 description 4
- 238000006206 glycosylation reaction Methods 0.000 description 4
- 210000005260 human cell Anatomy 0.000 description 4
- 238000002649 immunization Methods 0.000 description 4
- 238000010166 immunofluorescence Methods 0.000 description 4
- 229940072221 immunoglobulins Drugs 0.000 description 4
- 238000013198 immunometric assay Methods 0.000 description 4
- 230000001965 increasing effect Effects 0.000 description 4
- 230000002757 inflammatory effect Effects 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 238000001990 intravenous administration Methods 0.000 description 4
- 238000002372 labelling Methods 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- 239000007791 liquid phase Substances 0.000 description 4
- 239000000594 mannitol Substances 0.000 description 4
- 235000010355 mannitol Nutrition 0.000 description 4
- 239000003550 marker Substances 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 210000004379 membrane Anatomy 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 238000010369 molecular cloning Methods 0.000 description 4
- 230000035772 mutation Effects 0.000 description 4
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 4
- 239000008363 phosphate buffer Substances 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 229920001282 polysaccharide Polymers 0.000 description 4
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 4
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 4
- 230000002265 prevention Effects 0.000 description 4
- 230000001105 regulatory effect Effects 0.000 description 4
- 239000003419 rna directed dna polymerase inhibitor Substances 0.000 description 4
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 4
- 235000019259 sodium dehydroacetate Nutrition 0.000 description 4
- 229940079839 sodium dehydroacetate Drugs 0.000 description 4
- DSOWAKKSGYUMTF-GZOLSCHFSA-M sodium;(1e)-1-(6-methyl-2,4-dioxopyran-3-ylidene)ethanolate Chemical compound [Na+].C\C([O-])=C1/C(=O)OC(C)=CC1=O DSOWAKKSGYUMTF-GZOLSCHFSA-M 0.000 description 4
- 210000000952 spleen Anatomy 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 230000009885 systemic effect Effects 0.000 description 4
- 239000003826 tablet Substances 0.000 description 4
- 238000013518 transcription Methods 0.000 description 4
- 230000035897 transcription Effects 0.000 description 4
- 230000002103 transcriptional effect Effects 0.000 description 4
- 230000014616 translation Effects 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- NIXOWILDQLNWCW-UHFFFAOYSA-N Acrylic acid Chemical compound OC(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 description 3
- 229920000936 Agarose Polymers 0.000 description 3
- 108091093088 Amplicon Proteins 0.000 description 3
- KUVIULQEHSCUHY-XYWKZLDCSA-N Beclometasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(Cl)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)COC(=O)CC)(OC(=O)CC)[C@@]1(C)C[C@@H]2O KUVIULQEHSCUHY-XYWKZLDCSA-N 0.000 description 3
- 241000283707 Capra Species 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- 108020004635 Complementary DNA Proteins 0.000 description 3
- 229920002261 Corn starch Polymers 0.000 description 3
- 229920002307 Dextran Polymers 0.000 description 3
- 238000009007 Diagnostic Kit Methods 0.000 description 3
- 241000283073 Equus caballus Species 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 239000001856 Ethyl cellulose Substances 0.000 description 3
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 3
- 108010010803 Gelatin Proteins 0.000 description 3
- 229920002907 Guar gum Polymers 0.000 description 3
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 3
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 3
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 3
- 102000006992 Interferon-alpha Human genes 0.000 description 3
- 108010047761 Interferon-alpha Proteins 0.000 description 3
- 108091092195 Intron Proteins 0.000 description 3
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- FQISKWAFAHGMGT-SGJOWKDISA-M Methylprednisolone sodium succinate Chemical compound [Na+].C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)COC(=O)CCC([O-])=O)CC[C@H]21 FQISKWAFAHGMGT-SGJOWKDISA-M 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 102000007079 Peptide Fragments Human genes 0.000 description 3
- 108010033276 Peptide Fragments Proteins 0.000 description 3
- 102000011755 Phosphoglycerate Kinase Human genes 0.000 description 3
- 229920000954 Polyglycolide Polymers 0.000 description 3
- 229920001213 Polysorbate 20 Polymers 0.000 description 3
- 239000004793 Polystyrene Substances 0.000 description 3
- 241000288906 Primates Species 0.000 description 3
- 102000015433 Prostaglandin Receptors Human genes 0.000 description 3
- 108010050183 Prostaglandin Receptors Proteins 0.000 description 3
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 3
- 241000283984 Rodentia Species 0.000 description 3
- 229920002125 Sokalan® Polymers 0.000 description 3
- 229920002472 Starch Polymers 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 3
- 241000282898 Sus scrofa Species 0.000 description 3
- 108700005077 Viral Genes Proteins 0.000 description 3
- 229960000723 ampicillin Drugs 0.000 description 3
- 239000012491 analyte Substances 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 229950000210 beclometasone dipropionate Drugs 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 229920001400 block copolymer Polymers 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 229960001631 carbomer Drugs 0.000 description 3
- 239000013592 cell lysate Substances 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 239000002738 chelating agent Substances 0.000 description 3
- 238000000576 coating method Methods 0.000 description 3
- 229940075614 colloidal silicon dioxide Drugs 0.000 description 3
- 239000000356 contaminant Substances 0.000 description 3
- 238000013270 controlled release Methods 0.000 description 3
- 239000008120 corn starch Substances 0.000 description 3
- 229940099112 cornstarch Drugs 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- 125000000151 cysteine group Chemical class N[C@@H](CS)C(=O)* 0.000 description 3
- 231100000433 cytotoxic Toxicity 0.000 description 3
- 230000001472 cytotoxic effect Effects 0.000 description 3
- 230000029087 digestion Effects 0.000 description 3
- 238000004520 electroporation Methods 0.000 description 3
- 210000001163 endosome Anatomy 0.000 description 3
- 235000019325 ethyl cellulose Nutrition 0.000 description 3
- 229920001249 ethyl cellulose Polymers 0.000 description 3
- 239000007850 fluorescent dye Substances 0.000 description 3
- 235000003599 food sweetener Nutrition 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- 229920000159 gelatin Polymers 0.000 description 3
- 239000008273 gelatin Substances 0.000 description 3
- 229940014259 gelatin Drugs 0.000 description 3
- 235000019322 gelatine Nutrition 0.000 description 3
- 235000011852 gelatine desserts Nutrition 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 235000011187 glycerol Nutrition 0.000 description 3
- 239000008187 granular material Substances 0.000 description 3
- 239000000665 guar gum Substances 0.000 description 3
- 235000010417 guar gum Nutrition 0.000 description 3
- 229960002154 guar gum Drugs 0.000 description 3
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 3
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 238000003119 immunoblot Methods 0.000 description 3
- 208000037798 influenza B Diseases 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 230000003993 interaction Effects 0.000 description 3
- 238000005304 joining Methods 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 210000001165 lymph node Anatomy 0.000 description 3
- 210000004698 lymphocyte Anatomy 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 210000004779 membrane envelope Anatomy 0.000 description 3
- 229910052751 metal Inorganic materials 0.000 description 3
- 239000002184 metal Substances 0.000 description 3
- 229960000485 methotrexate Drugs 0.000 description 3
- 239000013642 negative control Substances 0.000 description 3
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 3
- 239000000346 nonvolatile oil Substances 0.000 description 3
- 239000008188 pellet Substances 0.000 description 3
- CPJSUEIXXCENMM-UHFFFAOYSA-N phenacetin Chemical compound CCOC1=CC=C(NC(C)=O)C=C1 CPJSUEIXXCENMM-UHFFFAOYSA-N 0.000 description 3
- 235000021317 phosphate Nutrition 0.000 description 3
- 230000026731 phosphorylation Effects 0.000 description 3
- 238000006366 phosphorylation reaction Methods 0.000 description 3
- 239000013600 plasmid vector Substances 0.000 description 3
- 229920000747 poly(lactic acid) Polymers 0.000 description 3
- 239000004633 polyglycolic acid Substances 0.000 description 3
- 239000004626 polylactic acid Substances 0.000 description 3
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 3
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 3
- 239000005017 polysaccharide Substances 0.000 description 3
- 150000004804 polysaccharides Chemical class 0.000 description 3
- 229920000136 polysorbate Polymers 0.000 description 3
- 229920000053 polysorbate 80 Polymers 0.000 description 3
- 229920002223 polystyrene Polymers 0.000 description 3
- 239000013641 positive control Substances 0.000 description 3
- 230000004481 post-translational protein modification Effects 0.000 description 3
- 230000006337 proteolytic cleavage Effects 0.000 description 3
- 230000002285 radioactive effect Effects 0.000 description 3
- 238000003127 radioimmunoassay Methods 0.000 description 3
- 238000010188 recombinant method Methods 0.000 description 3
- 230000000241 respiratory effect Effects 0.000 description 3
- 210000002345 respiratory system Anatomy 0.000 description 3
- QWAXKHKRTORLEM-UGJKXSETSA-N saquinavir Chemical compound C([C@@H]([C@H](O)CN1C[C@H]2CCCC[C@H]2C[C@H]1C(=O)NC(C)(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)C=1N=C2C=CC=CC2=CC=1)C1=CC=CC=C1 QWAXKHKRTORLEM-UGJKXSETSA-N 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 239000001488 sodium phosphate Substances 0.000 description 3
- 229910000162 sodium phosphate Inorganic materials 0.000 description 3
- 210000004989 spleen cell Anatomy 0.000 description 3
- 238000010186 staining Methods 0.000 description 3
- 235000019698 starch Nutrition 0.000 description 3
- 150000003431 steroids Chemical class 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 150000008163 sugars Chemical class 0.000 description 3
- 239000004094 surface-active agent Substances 0.000 description 3
- 239000012730 sustained-release form Substances 0.000 description 3
- 239000003765 sweetening agent Substances 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- 238000011269 treatment regimen Methods 0.000 description 3
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 3
- 241001515965 unidentified phage Species 0.000 description 3
- 229940075420 xanthine Drugs 0.000 description 3
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 2
- VUAFHZCUKUDDBC-SCSAIBSYSA-N (2s)-2-[(2-methyl-2-sulfanylpropanoyl)amino]-3-sulfanylpropanoic acid Chemical compound CC(C)(S)C(=O)N[C@H](CS)C(O)=O VUAFHZCUKUDDBC-SCSAIBSYSA-N 0.000 description 2
- CNPVJJQCETWNEU-CYFREDJKSA-N (4,6-dimethyl-5-pyrimidinyl)-[4-[(3S)-4-[(1R)-2-methoxy-1-[4-(trifluoromethyl)phenyl]ethyl]-3-methyl-1-piperazinyl]-4-methyl-1-piperidinyl]methanone Chemical compound N([C@@H](COC)C=1C=CC(=CC=1)C(F)(F)F)([C@H](C1)C)CCN1C(CC1)(C)CCN1C(=O)C1=C(C)N=CN=C1C CNPVJJQCETWNEU-CYFREDJKSA-N 0.000 description 2
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 2
- RZVAJINKPMORJF-UHFFFAOYSA-N Acetaminophen Chemical compound CC(=O)NC1=CC=C(O)C=C1 RZVAJINKPMORJF-UHFFFAOYSA-N 0.000 description 2
- NIXOWILDQLNWCW-UHFFFAOYSA-M Acrylate Chemical compound [O-]C(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-M 0.000 description 2
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 2
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 2
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 2
- 241000272525 Anas platyrhynchos Species 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 108010011485 Aspartame Proteins 0.000 description 2
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 2
- 208000031504 Asymptomatic Infections Diseases 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 241000972773 Aulopiformes Species 0.000 description 2
- 238000011725 BALB/c mouse Methods 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Chemical compound CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- 108700010070 Codon Usage Proteins 0.000 description 2
- XQSPYNMVSIKCOC-NTSWFWBYSA-N Emtricitabine Chemical compound C1=C(F)C(N)=NC(=O)N1[C@H]1O[C@@H](CO)SC1 XQSPYNMVSIKCOC-NTSWFWBYSA-N 0.000 description 2
- 108010042407 Endonucleases Proteins 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- 229920001917 Ficoll Polymers 0.000 description 2
- 241000233866 Fungi Species 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 2
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 2
- 108090000467 Interferon-beta Proteins 0.000 description 2
- 108010074328 Interferon-gamma Proteins 0.000 description 2
- 102000014150 Interferons Human genes 0.000 description 2
- 108010050904 Interferons Proteins 0.000 description 2
- 102000004889 Interleukin-6 Human genes 0.000 description 2
- 108090001005 Interleukin-6 Proteins 0.000 description 2
- KJHKTHWMRKYKJE-SUGCFTRWSA-N Kaletra Chemical compound N1([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=2C=CC=CC=2)NC(=O)COC=2C(=CC=CC=2C)C)CC=2C=CC=CC=2)CCCNC1=O KJHKTHWMRKYKJE-SUGCFTRWSA-N 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- JVTAAEKCZFNVCJ-REOHCLBHSA-N L-lactic acid Chemical compound C[C@H](O)C(O)=O JVTAAEKCZFNVCJ-REOHCLBHSA-N 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- QPCDCPDFJACHGM-UHFFFAOYSA-N N,N-bis{2-[bis(carboxymethyl)amino]ethyl}glycine Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CC(O)=O QPCDCPDFJACHGM-UHFFFAOYSA-N 0.000 description 2
- WHNWPMSKXPGLAX-UHFFFAOYSA-N N-Vinyl-2-pyrrolidone Chemical compound C=CN1CCCC1=O WHNWPMSKXPGLAX-UHFFFAOYSA-N 0.000 description 2
- 229930193140 Neomycin Natural products 0.000 description 2
- 102000043276 Oncogene Human genes 0.000 description 2
- 108700020796 Oncogene Proteins 0.000 description 2
- 108090000526 Papain Proteins 0.000 description 2
- 241001494479 Pecora Species 0.000 description 2
- 102000057297 Pepsin A Human genes 0.000 description 2
- 108090000284 Pepsin A Proteins 0.000 description 2
- 241000009328 Perro Species 0.000 description 2
- 229920001710 Polyorthoester Polymers 0.000 description 2
- 206010036790 Productive cough Diseases 0.000 description 2
- 102000009389 Prostaglandin D receptors Human genes 0.000 description 2
- 108050000258 Prostaglandin D receptors Proteins 0.000 description 2
- 241000589516 Pseudomonas Species 0.000 description 2
- 108020005067 RNA Splice Sites Proteins 0.000 description 2
- MUPFEKGTMRGPLJ-RMMQSMQOSA-N Raffinose Natural products O(C[C@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O[C@@]2(CO)[C@H](O)[C@@H](O)[C@@H](CO)O2)O1)[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 MUPFEKGTMRGPLJ-RMMQSMQOSA-N 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 102000006382 Ribonucleases Human genes 0.000 description 2
- 108010083644 Ribonucleases Proteins 0.000 description 2
- ZBVKEHDGYSLCCC-UHFFFAOYSA-N Seratrodast Chemical compound O=C1C(C)=C(C)C(=O)C(C(CCCCCC(O)=O)C=2C=CC=CC=2)=C1C ZBVKEHDGYSLCCC-UHFFFAOYSA-N 0.000 description 2
- 101001039853 Sonchus yellow net virus Matrix protein Proteins 0.000 description 2
- XNKLLVCARDGLGL-JGVFFNPUSA-N Stavudine Chemical compound O=C1NC(=O)C(C)=CN1[C@H]1C=C[C@@H](CO)O1 XNKLLVCARDGLGL-JGVFFNPUSA-N 0.000 description 2
- 241000187747 Streptomyces Species 0.000 description 2
- QJJXYPPXXYFBGM-LFZNUXCKSA-N Tacrolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1\C=C(/C)[C@@H]1[C@H](C)[C@@H](O)CC(=O)[C@H](CC=C)/C=C(C)/C[C@H](C)C[C@H](OC)[C@H]([C@H](C[C@H]2C)OC)O[C@@]2(O)C(=O)C(=O)N2CCCC[C@H]2C(=O)O1 QJJXYPPXXYFBGM-LFZNUXCKSA-N 0.000 description 2
- 108010022394 Threonine synthase Proteins 0.000 description 2
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 2
- MUPFEKGTMRGPLJ-UHFFFAOYSA-N UNPD196149 Natural products OC1C(O)C(CO)OC1(CO)OC1C(O)C(O)C(O)C(COC2C(C(O)C(O)C(CO)O2)O)O1 MUPFEKGTMRGPLJ-UHFFFAOYSA-N 0.000 description 2
- 108091034135 Vault RNA Proteins 0.000 description 2
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 2
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 2
- WREGKURFCTUGRC-POYBYMJQSA-N Zalcitabine Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](CO)CC1 WREGKURFCTUGRC-POYBYMJQSA-N 0.000 description 2
- VGXACJMXDYPFDB-SXMMONRFSA-N [(3r)-1-azabicyclo[2.2.2]octan-3-yl] (2s)-2-(hydroxymethyl)-4-[(r)-methylsulfinyl]-2-phenylbutanoate Chemical compound C1([C@@](CO)(C(=O)O[C@@H]2C3CCN(CC3)C2)CC[S@](=O)C)=CC=CC=C1 VGXACJMXDYPFDB-SXMMONRFSA-N 0.000 description 2
- FPVRUILUEYSIMD-RPRRAYFGSA-N [(8s,9r,10s,11s,13s,14s,16r,17r)-9-fluoro-11-hydroxy-17-(2-hydroxyacetyl)-10,13,16-trimethyl-3-oxo-6,7,8,11,12,14,15,16-octahydrocyclopenta[a]phenanthren-17-yl] acetate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(OC(C)=O)[C@@]1(C)C[C@@H]2O FPVRUILUEYSIMD-RPRRAYFGSA-N 0.000 description 2
- MZVQCMJNVPIDEA-UHFFFAOYSA-N [CH2]CN(CC)CC Chemical group [CH2]CN(CC)CC MZVQCMJNVPIDEA-UHFFFAOYSA-N 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 229960001138 acetylsalicylic acid Drugs 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- WOZSCQDILHKSGG-UHFFFAOYSA-N adefovir depivoxil Chemical compound N1=CN=C2N(CCOCP(=O)(OCOC(=O)C(C)(C)C)OCOC(=O)C(C)(C)C)C=NC2=C1N WOZSCQDILHKSGG-UHFFFAOYSA-N 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 230000002776 aggregation Effects 0.000 description 2
- 238000004220 aggregation Methods 0.000 description 2
- 230000001476 alcoholic effect Effects 0.000 description 2
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 2
- 210000004381 amniotic fluid Anatomy 0.000 description 2
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 2
- 238000000137 annealing Methods 0.000 description 2
- 230000003110 anti-inflammatory effect Effects 0.000 description 2
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 2
- 239000000739 antihistaminic agent Substances 0.000 description 2
- 239000003443 antiviral agent Substances 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 235000009697 arginine Nutrition 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- IAOZJIPTCAWIRG-QWRGUYRKSA-N aspartame Chemical compound OC(=O)C[C@H](N)C(=O)N[C@H](C(=O)OC)CC1=CC=CC=C1 IAOZJIPTCAWIRG-QWRGUYRKSA-N 0.000 description 2
- 239000000605 aspartame Substances 0.000 description 2
- 235000010357 aspartame Nutrition 0.000 description 2
- 229960003438 aspartame Drugs 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- AUJRCFUBUPVWSZ-XTZHGVARSA-M auranofin Chemical compound CCP(CC)(CC)=[Au]S[C@@H]1O[C@H](COC(C)=O)[C@@H](OC(C)=O)[C@H](OC(C)=O)[C@H]1OC(C)=O AUJRCFUBUPVWSZ-XTZHGVARSA-M 0.000 description 2
- 229960005207 auranofin Drugs 0.000 description 2
- 235000019445 benzyl alcohol Nutrition 0.000 description 2
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 229920002988 biodegradable polymer Polymers 0.000 description 2
- 239000004621 biodegradable polymer Substances 0.000 description 2
- 230000008512 biological response Effects 0.000 description 2
- 238000001574 biopsy Methods 0.000 description 2
- QRZAKQDHEVVFRX-UHFFFAOYSA-N biphenyl-4-ylacetic acid Chemical compound C1=CC(CC(=O)O)=CC=C1C1=CC=CC=C1 QRZAKQDHEVVFRX-UHFFFAOYSA-N 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 210000001185 bone marrow Anatomy 0.000 description 2
- 229960004272 bucillamine Drugs 0.000 description 2
- 239000008366 buffered solution Substances 0.000 description 2
- 239000006172 buffering agent Substances 0.000 description 2
- 230000003139 buffering effect Effects 0.000 description 2
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 210000000845 cartilage Anatomy 0.000 description 2
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- CFBUZOUXXHZCFB-OYOVHJISSA-N chembl511115 Chemical compound COC1=CC=C([C@@]2(CC[C@H](CC2)C(O)=O)C#N)C=C1OC1CCCC1 CFBUZOUXXHZCFB-OYOVHJISSA-N 0.000 description 2
- 230000002113 chemopreventative effect Effects 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 235000012000 cholesterol Nutrition 0.000 description 2
- 239000005515 coenzyme Substances 0.000 description 2
- 238000012790 confirmation Methods 0.000 description 2
- 229920001577 copolymer Polymers 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 231100000517 death Toxicity 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 229960003957 dexamethasone Drugs 0.000 description 2
- 229960003657 dexamethasone acetate Drugs 0.000 description 2
- 229950000812 dexamethasone palmitate Drugs 0.000 description 2
- 229960002086 dextran Drugs 0.000 description 2
- 229960000633 dextran sulfate Drugs 0.000 description 2
- 239000008121 dextrose Substances 0.000 description 2
- 238000002405 diagnostic procedure Methods 0.000 description 2
- FLKPEMZONWLCSK-UHFFFAOYSA-N diethyl phthalate Chemical compound CCOC(=O)C1=CC=CC=C1C(=O)OCC FLKPEMZONWLCSK-UHFFFAOYSA-N 0.000 description 2
- 102000004419 dihydrofolate reductase Human genes 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 239000002988 disease modifying antirheumatic drug Substances 0.000 description 2
- 238000004090 dissolution Methods 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- XPOQHMRABVBWPR-ZDUSSCGKSA-N efavirenz Chemical compound C([C@]1(C2=CC(Cl)=CC=C2NC(=O)O1)C(F)(F)F)#CC1CC1 XPOQHMRABVBWPR-ZDUSSCGKSA-N 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- 235000013601 eggs Nutrition 0.000 description 2
- 229960000366 emtricitabine Drugs 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- PEASPLKKXBYDKL-FXEVSJAOSA-N enfuvirtide Chemical compound C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(C)=O)[C@@H](C)O)[C@@H](C)CC)C1=CN=CN1 PEASPLKKXBYDKL-FXEVSJAOSA-N 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 229960004667 ethyl cellulose Drugs 0.000 description 2
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 2
- 239000013613 expression plasmid Substances 0.000 description 2
- 210000000416 exudates and transudate Anatomy 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- 235000013355 food flavoring agent Nutrition 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 210000001035 gastrointestinal tract Anatomy 0.000 description 2
- 210000003731 gingival crevicular fluid Anatomy 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- 102000005396 glutamine synthetase Human genes 0.000 description 2
- 108020002326 glutamine synthetase Proteins 0.000 description 2
- 239000005090 green fluorescent protein Substances 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 2
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 2
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 2
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 2
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 2
- 229940071676 hydroxypropylcellulose Drugs 0.000 description 2
- 230000008105 immune reaction Effects 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 238000001114 immunoprecipitation Methods 0.000 description 2
- 239000003018 immunosuppressive agent Substances 0.000 description 2
- CBVCZFGXHXORBI-PXQQMZJSSA-N indinavir Chemical compound C([C@H](N(CC1)C[C@@H](O)C[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H]2C3=CC=CC=C3C[C@H]2O)C(=O)NC(C)(C)C)N1CC1=CC=CN=C1 CBVCZFGXHXORBI-PXQQMZJSSA-N 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 229940124524 integrase inhibitor Drugs 0.000 description 2
- 239000002850 integrase inhibitor Substances 0.000 description 2
- 229940079322 interferon Drugs 0.000 description 2
- 229940100601 interleukin-6 Drugs 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 229960001361 ipratropium bromide Drugs 0.000 description 2
- KEWHKYJURDBRMN-ZEODDXGYSA-M ipratropium bromide hydrate Chemical compound O.[Br-].O([C@H]1C[C@H]2CC[C@@H](C1)[N@@+]2(C)C(C)C)C(=O)C(CO)C1=CC=CC=C1 KEWHKYJURDBRMN-ZEODDXGYSA-M 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 239000003199 leukotriene receptor blocking agent Substances 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- 238000004020 luminiscence type Methods 0.000 description 2
- 230000001926 lymphatic effect Effects 0.000 description 2
- 239000008176 lyophilized powder Substances 0.000 description 2
- CPLXHLVBOLITMK-UHFFFAOYSA-N magnesium oxide Inorganic materials [Mg]=O CPLXHLVBOLITMK-UHFFFAOYSA-N 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 2
- 150000002739 metals Chemical class 0.000 description 2
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- OSWPMRLSEDHDFF-UHFFFAOYSA-N methyl salicylate Chemical compound COC(=O)C1=CC=CC=C1O OSWPMRLSEDHDFF-UHFFFAOYSA-N 0.000 description 2
- 229960000334 methylprednisolone sodium succinate Drugs 0.000 description 2
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 2
- 229960002744 mometasone furoate Drugs 0.000 description 2
- WOFMFGQZHJDGCX-ZULDAHANSA-N mometasone furoate Chemical compound O([C@]1([C@@]2(C)C[C@H](O)[C@]3(Cl)[C@@]4(C)C=CC(=O)C=C4CC[C@H]3[C@@H]2C[C@H]1C)C(=O)CCl)C(=O)C1=CC=CO1 WOFMFGQZHJDGCX-ZULDAHANSA-N 0.000 description 2
- 150000002772 monosaccharides Chemical class 0.000 description 2
- 229960000951 mycophenolic acid Drugs 0.000 description 2
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 2
- QAGYKUNXZHXKMR-HKWSIXNMSA-N nelfinavir Chemical compound CC1=C(O)C=CC=C1C(=O)N[C@H]([C@H](O)CN1[C@@H](C[C@@H]2CCCC[C@@H]2C1)C(=O)NC(C)(C)C)CSC1=CC=CC=C1 QAGYKUNXZHXKMR-HKWSIXNMSA-N 0.000 description 2
- 229960004927 neomycin Drugs 0.000 description 2
- 239000000041 non-steroidal anti-inflammatory agent Substances 0.000 description 2
- 239000002687 nonaqueous vehicle Substances 0.000 description 2
- 238000007899 nucleic acid hybridization Methods 0.000 description 2
- 230000003204 osmotic effect Effects 0.000 description 2
- 210000001819 pancreatic juice Anatomy 0.000 description 2
- 229940055729 papain Drugs 0.000 description 2
- 235000019834 papain Nutrition 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 229940090048 pen injector Drugs 0.000 description 2
- 229960003330 pentetic acid Drugs 0.000 description 2
- 229940111202 pepsin Drugs 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 210000005259 peripheral blood Anatomy 0.000 description 2
- 239000011886 peripheral blood Substances 0.000 description 2
- 210000003200 peritoneal cavity Anatomy 0.000 description 2
- 229940124531 pharmaceutical excipient Drugs 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 239000002571 phosphodiesterase inhibitor Substances 0.000 description 2
- 239000006187 pill Substances 0.000 description 2
- 210000002381 plasma Anatomy 0.000 description 2
- 239000004014 plasticizer Substances 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- 229920001983 poloxamer Polymers 0.000 description 2
- 229920001993 poloxamer 188 Polymers 0.000 description 2
- 229920002401 polyacrylamide Polymers 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- 230000001323 posttranslational effect Effects 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 229960005205 prednisolone Drugs 0.000 description 2
- OIGNJSKKLXVSLS-VWUMJDOOSA-N prednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OIGNJSKKLXVSLS-VWUMJDOOSA-N 0.000 description 2
- 229960000825 proglumetacin Drugs 0.000 description 2
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 2
- 150000003180 prostaglandins Chemical class 0.000 description 2
- 210000001938 protoplast Anatomy 0.000 description 2
- 230000002685 pulmonary effect Effects 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- MUPFEKGTMRGPLJ-ZQSKZDJDSA-N raffinose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO[C@@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)O)O1 MUPFEKGTMRGPLJ-ZQSKZDJDSA-N 0.000 description 2
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- NCDNCNXCDXHOMX-XGKFQTDJSA-N ritonavir Chemical compound N([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=1C=CC=CC=1)NC(=O)OCC=1SC=NC=1)CC=1C=CC=CC=1)C(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-XGKFQTDJSA-N 0.000 description 2
- 210000003296 saliva Anatomy 0.000 description 2
- 235000019515 salmon Nutrition 0.000 description 2
- 229960001852 saquinavir Drugs 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 229960003090 seratrodast Drugs 0.000 description 2
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 210000003802 sputum Anatomy 0.000 description 2
- 208000024794 sputum Diseases 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 229940032147 starch Drugs 0.000 description 2
- 239000008223 sterile water Substances 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 150000005846 sugar alcohols Chemical class 0.000 description 2
- NCEXYHBECQHGNR-QZQOTICOSA-N sulfasalazine Chemical compound C1=C(O)C(C(=O)O)=CC(\N=N\C=2C=CC(=CC=2)S(=O)(=O)NC=2N=CC=CC=2)=C1 NCEXYHBECQHGNR-QZQOTICOSA-N 0.000 description 2
- 229960001940 sulfasalazine Drugs 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 208000011580 syndromic disease Diseases 0.000 description 2
- 210000001138 tear Anatomy 0.000 description 2
- VCMJCVGFSROFHV-WZGZYPNHSA-N tenofovir disoproxil fumarate Chemical compound OC(=O)\C=C\C(O)=O.N1=CN=C2N(C[C@@H](C)OCP(=O)(OCOC(=O)OC(C)C)OCOC(=O)OC(C)C)C=NC2=C1N VCMJCVGFSROFHV-WZGZYPNHSA-N 0.000 description 2
- ZFXYFBGIUFBOJW-UHFFFAOYSA-N theophylline Chemical compound O=C1N(C)C(=O)N(C)C2=C1NC=N2 ZFXYFBGIUFBOJW-UHFFFAOYSA-N 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 230000005030 transcription termination Effects 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- 229960005294 triamcinolone Drugs 0.000 description 2
- GFNANZIMVAIWHM-OBYCQNJPSA-N triamcinolone Chemical compound O=C1C=C[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@]([C@H](O)C4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 GFNANZIMVAIWHM-OBYCQNJPSA-N 0.000 description 2
- 229960002117 triamcinolone acetonide Drugs 0.000 description 2
- YNDXUCZADRHECN-JNQJZLCISA-N triamcinolone acetonide Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]1(C)C[C@@H]2O YNDXUCZADRHECN-JNQJZLCISA-N 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- 239000002691 unilamellar liposome Substances 0.000 description 2
- 210000002700 urine Anatomy 0.000 description 2
- 238000002255 vaccination Methods 0.000 description 2
- 210000003462 vein Anatomy 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- 230000000007 visual effect Effects 0.000 description 2
- 239000000811 xylitol Substances 0.000 description 2
- 235000010447 xylitol Nutrition 0.000 description 2
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 2
- 229960002675 xylitol Drugs 0.000 description 2
- 229960000523 zalcitabine Drugs 0.000 description 2
- IOVGROKTTNBUGK-SJKOYZFVSA-N (1S,2R)-ritodrine Chemical compound N([C@H](C)[C@@H](O)C=1C=CC(O)=CC=1)CCC1=CC=C(O)C=C1 IOVGROKTTNBUGK-SJKOYZFVSA-N 0.000 description 1
- UHSXRTHJCJGEKG-UQKRIMTDSA-N (1s)-1-[(3,4,5-trimethoxyphenyl)methyl]-1,2,3,4-tetrahydroisoquinolin-2-ium-6,7-diol;chloride Chemical compound Cl.COC1=C(OC)C(OC)=CC(C[C@H]2C3=CC(O)=C(O)C=C3CCN2)=C1 UHSXRTHJCJGEKG-UQKRIMTDSA-N 0.000 description 1
- BRZYSWJRSDMWLG-DJWUNRQOSA-N (2r,3r,4r,5r)-2-[(1s,2s,3r,4s,6r)-4,6-diamino-3-[(2s,3r,4r,5s,6r)-3-amino-4,5-dihydroxy-6-[(1r)-1-hydroxyethyl]oxan-2-yl]oxy-2-hydroxycyclohexyl]oxy-5-methyl-4-(methylamino)oxane-3,5-diol Chemical compound O1C[C@@](O)(C)[C@H](NC)[C@@H](O)[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H]([C@@H](C)O)O2)N)[C@@H](N)C[C@H]1N BRZYSWJRSDMWLG-DJWUNRQOSA-N 0.000 description 1
- MDKGKXOCJGEUJW-VIFPVBQESA-N (2s)-2-[4-(thiophene-2-carbonyl)phenyl]propanoic acid Chemical compound C1=CC([C@@H](C(O)=O)C)=CC=C1C(=O)C1=CC=CS1 MDKGKXOCJGEUJW-VIFPVBQESA-N 0.000 description 1
- QNQBPPQLRODXET-AIMHRHHOSA-N (3e,5s)-3-[[(1s,2r,4as,6r,8ar)-1,6-dimethyl-2-[(e)-prop-1-enyl]-4a,5,6,7,8,8a-hexahydro-2h-naphthalen-1-yl]-hydroxymethylidene]-5-(hydroxymethyl)-1-methylpyrrolidine-2,4-dione Chemical compound O/C([C@@]1(C)[C@@H]2CC[C@@H](C)C[C@H]2C=C[C@H]1/C=C/C)=C1\C(=O)[C@H](CO)N(C)C1=O QNQBPPQLRODXET-AIMHRHHOSA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- UCTWMZQNUQWSLP-VIFPVBQESA-N (R)-adrenaline Chemical compound CNC[C@H](O)C1=CC=C(O)C(O)=C1 UCTWMZQNUQWSLP-VIFPVBQESA-N 0.000 description 1
- 229930182837 (R)-adrenaline Natural products 0.000 description 1
- NDAUXUAQIAJITI-LBPRGKRZSA-N (R)-salbutamol Chemical compound CC(C)(C)NC[C@H](O)C1=CC=C(O)C(CO)=C1 NDAUXUAQIAJITI-LBPRGKRZSA-N 0.000 description 1
- OBRNDARFFFHCGE-PERKLWIXSA-N (S,S)-formoterol fumarate Chemical compound OC(=O)\C=C\C(O)=O.C1=CC(OC)=CC=C1C[C@H](C)NC[C@@H](O)C1=CC=C(O)C(NC=O)=C1.C1=CC(OC)=CC=C1C[C@H](C)NC[C@@H](O)C1=CC=C(O)C(NC=O)=C1 OBRNDARFFFHCGE-PERKLWIXSA-N 0.000 description 1
- GXINKQQWHLIBJA-UCIBKFKQSA-N (z)-but-2-enedioic acid;(4,6-dimethylpyrimidin-5-yl)-[4-[(3s)-4-[(1r)-2-methoxy-1-[4-(trifluoromethyl)phenyl]ethyl]-3-methylpiperazin-1-yl]-4-methylpiperidin-1-yl]methanone Chemical compound OC(=O)\C=C/C(O)=O.N([C@@H](COC)C=1C=CC(=CC=1)C(F)(F)F)([C@H](C1)C)CCN1C(CC1)(C)CCN1C(=O)C1=C(C)N=CN=C1C GXINKQQWHLIBJA-UCIBKFKQSA-N 0.000 description 1
- PXGILEVFPBXLEB-UHFFFAOYSA-N 1,2-dimethyl-3-propan-2-ylazulene Chemical compound C1=CC=CC=C2C(C(C)C)=C(C)C(C)=C21 PXGILEVFPBXLEB-UHFFFAOYSA-N 0.000 description 1
- ASSJTMUEFHUKMJ-UHFFFAOYSA-N 1-acetyl-n-[3-[4-[(4-carbamoylphenyl)methyl]piperidin-1-yl]propyl]-n-(3-chloro-4-methylphenyl)piperidine-4-carboxamide Chemical compound C1CN(C(=O)C)CCC1C(=O)N(C=1C=C(Cl)C(C)=CC=1)CCCN1CCC(CC=2C=CC(=CC=2)C(N)=O)CC1 ASSJTMUEFHUKMJ-UHFFFAOYSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- LITNEAPWQHVPOK-FFSVYQOJSA-N 2(1h)-pyrimidinone, 5-[3-[(1s,2s,4r)-bicyclo[2.2.1]hept-2-yloxy]-4-methoxyphenyl]tetrahydro- Chemical compound C1=C(O[C@@H]2[C@H]3CC[C@H](C3)C2)C(OC)=CC=C1C1CNC(=O)NC1 LITNEAPWQHVPOK-FFSVYQOJSA-N 0.000 description 1
- YREYLAVBNPACJM-UHFFFAOYSA-N 2-(tert-butylamino)-1-(2-chlorophenyl)ethanol Chemical compound CC(C)(C)NCC(O)C1=CC=CC=C1Cl YREYLAVBNPACJM-UHFFFAOYSA-N 0.000 description 1
- AEIOJVGBPVJOLC-BTJKTKAUSA-N 2-[2-(4-benzhydrylpiperazin-1-yl)ethoxy]benzoic acid;(z)-but-2-enedioic acid Chemical compound OC(=O)\C=C/C(O)=O.OC(=O)C1=CC=CC=C1OCCN1CCN(C(C=2C=CC=CC=2)C=2C=CC=CC=2)CC1 AEIOJVGBPVJOLC-BTJKTKAUSA-N 0.000 description 1
- WTBRUSNNZKWTMI-UHFFFAOYSA-N 2-[6-[3-(4-benzhydryloxypiperidin-1-yl)propylamino]imidazo[1,2-b]pyridazin-2-yl]-2-methylpropanoic acid Chemical compound C1=CC2=NC(C(C)(C(O)=O)C)=CN2N=C1NCCCN(CC1)CCC1OC(C=1C=CC=CC=1)C1=CC=CC=C1 WTBRUSNNZKWTMI-UHFFFAOYSA-N 0.000 description 1
- SBUFZXRNKJQHLD-CQSZACIVSA-N 2-[N-[(2R)-1-(1H-imidazol-5-yl)propan-2-yl]-C-phenylcarbonimidoyl]phenol Chemical compound C([C@@H](C)N=C(C=1C=CC=CC=1)C=1C(=CC=CC=1)O)C1=CNC=N1 SBUFZXRNKJQHLD-CQSZACIVSA-N 0.000 description 1
- BYDKEYCXCIVOOV-JTSKRJEESA-N 2-[[(2s)-4-[[(3s)-1-carbamimidoylpiperidin-3-yl]methylamino]-2-(naphthalen-2-ylsulfonylamino)-4-oxobutanoyl]-cyclopropylamino]acetic acid Chemical compound C1N(C(=N)N)CCC[C@H]1CNC(=O)C[C@@H](C(=O)N(CC(O)=O)C1CC1)NS(=O)(=O)C1=CC=C(C=CC=C2)C2=C1 BYDKEYCXCIVOOV-JTSKRJEESA-N 0.000 description 1
- VPCOODFYDJWLHD-YMZXMBPUSA-N 2-[[(7s)-7-[[(2r)-2-hydroxy-2-[4-hydroxy-3-(2-hydroxyethyl)phenyl]ethyl]amino]-5,6,7,8-tetrahydronaphthalen-2-yl]oxy]-n,n-dimethylacetamide;sulfuric acid Chemical compound OS(O)(=O)=O.C1([C@@H](O)CN[C@H]2CCC3=CC=C(C=C3C2)OCC(=O)N(C)C)=CC=C(O)C(CCO)=C1.C1([C@@H](O)CN[C@H]2CCC3=CC=C(C=C3C2)OCC(=O)N(C)C)=CC=C(O)C(CCO)=C1 VPCOODFYDJWLHD-YMZXMBPUSA-N 0.000 description 1
- MSWZFWKMSRAUBD-IVMDWMLBSA-N 2-amino-2-deoxy-D-glucopyranose Chemical compound N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O MSWZFWKMSRAUBD-IVMDWMLBSA-N 0.000 description 1
- BSKHPKMHTQYZBB-UHFFFAOYSA-N 2-methylpyridine Chemical class CC1=CC=CC=N1 BSKHPKMHTQYZBB-UHFFFAOYSA-N 0.000 description 1
- QCDWFXQBSFUVSP-UHFFFAOYSA-N 2-phenoxyethanol Chemical compound OCCOC1=CC=CC=C1 QCDWFXQBSFUVSP-UHFFFAOYSA-N 0.000 description 1
- FAWLNURBQMTKEB-URDPEVQOSA-N 213546-53-3 Chemical compound N([C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N1[C@@H](CCC1)C(O)=O)C(C)C)C(C)C)C(=O)[C@@H]1CCCN1C(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)N)C(C)C FAWLNURBQMTKEB-URDPEVQOSA-N 0.000 description 1
- AWKYSZSJPJUFQS-UHFFFAOYSA-N 3,7-dihydropurine-2,6-dione;phosphoric acid Chemical compound OP(O)(O)=O.O=C1NC(=O)NC2=C1NC=N2 AWKYSZSJPJUFQS-UHFFFAOYSA-N 0.000 description 1
- ULMFXAMQUGLVGA-LJQANCHMSA-N 3-[[2-methoxy-4-[(2-methylphenyl)sulfonylcarbamoyl]phenyl]methyl]-1-methyl-n-[(2r)-4,4,4-trifluoro-2-methylbutyl]indole-5-carboxamide Chemical compound C=1C=C(CC=2C3=CC(=CC=C3N(C)C=2)C(=O)NC[C@H](C)CC(F)(F)F)C(OC)=CC=1C(=O)NS(=O)(=O)C1=CC=CC=C1C ULMFXAMQUGLVGA-LJQANCHMSA-N 0.000 description 1
- YYSCJLLOWOUSHH-UHFFFAOYSA-N 4,4'-disulfanyldibutanoic acid Chemical compound OC(=O)CCCSSCCCC(O)=O YYSCJLLOWOUSHH-UHFFFAOYSA-N 0.000 description 1
- VXEBMQZDPONDFB-UHFFFAOYSA-N 4-(2h-tetrazol-5-yl)-n-[4-(2h-tetrazol-5-yl)phenyl]benzamide Chemical compound C=1C=C(C2=NNN=N2)C=CC=1C(=O)NC(C=C1)=CC=C1C=1N=NNN=1 VXEBMQZDPONDFB-UHFFFAOYSA-N 0.000 description 1
- GMQPELBCDCDDHW-UHFFFAOYSA-N 4-(3,9-diazaspiro[5.5]undecan-3-yl)benzonitrile Chemical compound C1=CC(C#N)=CC=C1N1CCC2(CCNCC2)CC1 GMQPELBCDCDDHW-UHFFFAOYSA-N 0.000 description 1
- ZOLBALGTFCCTJF-UHFFFAOYSA-N 4-[1-hydroxy-2-(propan-2-ylamino)ethyl]benzene-1,2-diol;sulfuric acid Chemical compound OS(O)(=O)=O.CC(C)NCC(O)C1=CC=C(O)C(O)=C1.CC(C)NCC(O)C1=CC=C(O)C(O)=C1 ZOLBALGTFCCTJF-UHFFFAOYSA-N 0.000 description 1
- HUDPLKWXRLNSPC-UHFFFAOYSA-N 4-aminophthalhydrazide Chemical compound O=C1NNC(=O)C=2C1=CC(N)=CC=2 HUDPLKWXRLNSPC-UHFFFAOYSA-N 0.000 description 1
- QTQGHKVYLQBJLO-UHFFFAOYSA-N 4-methylbenzenesulfonate;(4-methyl-1-oxo-1-phenylmethoxypentan-2-yl)azanium Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1.CC(C)CC(N)C(=O)OCC1=CC=CC=C1 QTQGHKVYLQBJLO-UHFFFAOYSA-N 0.000 description 1
- JOPSSWGWLCLPPF-RUDMXATFSA-N 5-[2-(2-carboxyethyl)-3-[(e)-6-(4-methoxyphenyl)hex-5-enoxy]phenoxy]pentanoic acid Chemical compound C1=CC(OC)=CC=C1\C=C\CCCCOC1=CC=CC(OCCCCC(O)=O)=C1CCC(O)=O JOPSSWGWLCLPPF-RUDMXATFSA-N 0.000 description 1
- SQDAZGGFXASXDW-UHFFFAOYSA-N 5-bromo-2-(trifluoromethoxy)pyridine Chemical compound FC(F)(F)OC1=CC=C(Br)C=N1 SQDAZGGFXASXDW-UHFFFAOYSA-N 0.000 description 1
- AWRLZJJDHWCYKN-UHFFFAOYSA-N 5-bromo-2-ethoxy-3-nitropyridine Chemical compound CCOC1=NC=C(Br)C=C1[N+]([O-])=O AWRLZJJDHWCYKN-UHFFFAOYSA-N 0.000 description 1
- SRTBBLNAKMLZTN-UHFFFAOYSA-N 6-amino-2,3-dichlorobenzoic acid Chemical compound NC1=CC=C(Cl)C(Cl)=C1C(O)=O SRTBBLNAKMLZTN-UHFFFAOYSA-N 0.000 description 1
- 102100031126 6-phosphogluconolactonase Human genes 0.000 description 1
- 108010029731 6-phosphogluconolactonase Proteins 0.000 description 1
- 108010022752 Acetylcholinesterase Proteins 0.000 description 1
- 102000012440 Acetylcholinesterase Human genes 0.000 description 1
- TWHZNAUBXFZMCA-UHFFFAOYSA-N Acotiamide Chemical compound C1=C(OC)C(OC)=CC(O)=C1C(=O)NC1=NC(C(=O)NCCN(C(C)C)C(C)C)=CS1 TWHZNAUBXFZMCA-UHFFFAOYSA-N 0.000 description 1
- MROJXXOCABQVEF-UHFFFAOYSA-N Actarit Chemical compound CC(=O)NC1=CC=C(CC(O)=O)C=C1 MROJXXOCABQVEF-UHFFFAOYSA-N 0.000 description 1
- 241000203809 Actinomycetales Species 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- 239000000275 Adrenocorticotropic Hormone Substances 0.000 description 1
- 108010000239 Aequorin Proteins 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000007698 Alcohol dehydrogenase Human genes 0.000 description 1
- 108010021809 Alcohol dehydrogenase Proteins 0.000 description 1
- 229940118148 Aldose reductase inhibitor Drugs 0.000 description 1
- 102000013142 Amylases Human genes 0.000 description 1
- 108010065511 Amylases Proteins 0.000 description 1
- 241000272517 Anseriformes Species 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- 102000015790 Asparaginase Human genes 0.000 description 1
- XHVAWZZCDCWGBK-WYRLRVFGSA-M Aurothioglucose Chemical compound OC[C@H]1O[C@H](S[Au])[C@H](O)[C@@H](O)[C@@H]1O XHVAWZZCDCWGBK-WYRLRVFGSA-M 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 201000001178 Bacterial Pneumonia Diseases 0.000 description 1
- 231100000699 Bacterial toxin Toxicity 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- KWIUHFFTVRNATP-UHFFFAOYSA-N Betaine Natural products C[N+](C)(C)CC([O-])=O KWIUHFFTVRNATP-UHFFFAOYSA-N 0.000 description 1
- LSNNMFCWUKXFEE-UHFFFAOYSA-M Bisulfite Chemical compound OS([O-])=O LSNNMFCWUKXFEE-UHFFFAOYSA-M 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 108010004032 Bromelains Proteins 0.000 description 1
- VOVIALXJUBGFJZ-KWVAZRHASA-N Budesonide Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@H]3OC(CCC)O[C@@]3(C(=O)CO)[C@@]1(C)C[C@@H]2O VOVIALXJUBGFJZ-KWVAZRHASA-N 0.000 description 1
- 239000004255 Butylated hydroxyanisole Substances 0.000 description 1
- 102100031151 C-C chemokine receptor type 2 Human genes 0.000 description 1
- 101710149815 C-C chemokine receptor type 2 Proteins 0.000 description 1
- 102100024167 C-C chemokine receptor type 3 Human genes 0.000 description 1
- 101710149862 C-C chemokine receptor type 3 Proteins 0.000 description 1
- 102100037853 C-C chemokine receptor type 4 Human genes 0.000 description 1
- 101710149863 C-C chemokine receptor type 4 Proteins 0.000 description 1
- 102100035875 C-C chemokine receptor type 5 Human genes 0.000 description 1
- 101710149870 C-C chemokine receptor type 5 Proteins 0.000 description 1
- 102100023702 C-C motif chemokine 13 Human genes 0.000 description 1
- 101710112613 C-C motif chemokine 13 Proteins 0.000 description 1
- 102100032367 C-C motif chemokine 5 Human genes 0.000 description 1
- 102100034871 C-C motif chemokine 8 Human genes 0.000 description 1
- 101710155833 C-C motif chemokine 8 Proteins 0.000 description 1
- QAGYKUNXZHXKMR-UHFFFAOYSA-N CPD000469186 Natural products CC1=C(O)C=CC=C1C(=O)NC(C(O)CN1C(CC2CCCCC2C1)C(=O)NC(C)(C)C)CSC1=CC=CC=C1 QAGYKUNXZHXKMR-UHFFFAOYSA-N 0.000 description 1
- LERNTVKEWCAPOY-VOGVJGKGSA-N C[N+]1(C)[C@H]2C[C@H](C[C@@H]1[C@H]1O[C@@H]21)OC(=O)C(O)(c1cccs1)c1cccs1 Chemical compound C[N+]1(C)[C@H]2C[C@H](C[C@@H]1[C@H]1O[C@@H]21)OC(=O)C(O)(c1cccs1)c1cccs1 LERNTVKEWCAPOY-VOGVJGKGSA-N 0.000 description 1
- 101001120790 Caenorhabditis elegans UDP-N-acetylglucosamine-peptide N-acetylglucosaminyltransferase Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 108010053835 Catalase Proteins 0.000 description 1
- 102100035882 Catalase Human genes 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- ZKLPARSLTMPFCP-UHFFFAOYSA-N Cetirizine Chemical compound C1CN(CCOCC(=O)O)CCN1C(C=1C=CC(Cl)=CC=1)C1=CC=CC=C1 ZKLPARSLTMPFCP-UHFFFAOYSA-N 0.000 description 1
- 108091006146 Channels Proteins 0.000 description 1
- 108010055166 Chemokine CCL5 Proteins 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 229920001287 Chondroitin sulfate Polymers 0.000 description 1
- LUKZNWIVRBCLON-GXOBDPJESA-N Ciclesonide Chemical compound C1([C@H]2O[C@@]3([C@H](O2)C[C@@H]2[C@@]3(C[C@H](O)[C@@H]3[C@@]4(C)C=CC(=O)C=C4CC[C@H]32)C)C(=O)COC(=O)C(C)C)CCCCC1 LUKZNWIVRBCLON-GXOBDPJESA-N 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 102400000739 Corticotropin Human genes 0.000 description 1
- 101800000414 Corticotropin Proteins 0.000 description 1
- ITRJWOMZKQRYTA-RFZYENFJSA-N Cortisone acetate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)C)(O)[C@@]1(C)CC2=O ITRJWOMZKQRYTA-RFZYENFJSA-N 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- 206010011224 Cough Diseases 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 229920002785 Croscarmellose sodium Polymers 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 1
- 108010036949 Cyclosporine Proteins 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- GUBGYTABKSRVRQ-CUHNMECISA-N D-Cellobiose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-CUHNMECISA-N 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- QWIZNVHXZXRPDR-UHFFFAOYSA-N D-melezitose Natural products O1C(CO)C(O)C(O)C(O)C1OC1C(O)C(CO)OC1(CO)OC1OC(CO)C(O)C(O)C1O QWIZNVHXZXRPDR-UHFFFAOYSA-N 0.000 description 1
- VVNCNSJFMMFHPL-VKHMYHEASA-N D-penicillamine Chemical compound CC(C)(S)[C@@H](N)C(O)=O VVNCNSJFMMFHPL-VKHMYHEASA-N 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- DRSFVGQMPYTGJY-GNSLJVCWSA-N Deprodone propionate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)CC)[C@@]1(C)C[C@@H]2O DRSFVGQMPYTGJY-GNSLJVCWSA-N 0.000 description 1
- 108010093668 Deubiquitinating Enzymes Proteins 0.000 description 1
- 102000001477 Deubiquitinating Enzymes Human genes 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- XBPCUCUWBYBCDP-UHFFFAOYSA-N Dicyclohexylamine Chemical class C1CCCCC1NC1CCCCC1 XBPCUCUWBYBCDP-UHFFFAOYSA-N 0.000 description 1
- BXZVVICBKDXVGW-NKWVEPMBSA-N Didanosine Chemical compound O1[C@H](CO)CC[C@@H]1N1C(NC=NC2=O)=C2N=C1 BXZVVICBKDXVGW-NKWVEPMBSA-N 0.000 description 1
- HHJIUUAMYGBVSD-YTFFSALGSA-N Diflucortolone valerate Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@@H](C)[C@H](C(=O)COC(=O)CCCC)[C@@]2(C)C[C@@H]1O HHJIUUAMYGBVSD-YTFFSALGSA-N 0.000 description 1
- WYQPLTPSGFELIB-JTQPXKBDSA-N Difluprednate Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2CC[C@@](C(=O)COC(C)=O)(OC(=O)CCC)[C@@]2(C)C[C@@H]1O WYQPLTPSGFELIB-JTQPXKBDSA-N 0.000 description 1
- 229940123907 Disease modifying antirheumatic drug Drugs 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 102100031107 Disintegrin and metalloproteinase domain-containing protein 11 Human genes 0.000 description 1
- 101710121366 Disintegrin and metalloproteinase domain-containing protein 11 Proteins 0.000 description 1
- XIQVNETUBQGFHX-UHFFFAOYSA-N Ditropan Chemical compound C=1C=CC=CC=1C(O)(C(=O)OCC#CCN(CC)CC)C1CCCCC1 XIQVNETUBQGFHX-UHFFFAOYSA-N 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- XPOQHMRABVBWPR-UHFFFAOYSA-N Efavirenz Natural products O1C(=O)NC2=CC=C(Cl)C=C2C1(C(F)(F)F)C#CC1CC1 XPOQHMRABVBWPR-UHFFFAOYSA-N 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- URJQOOISAKEBKW-UHFFFAOYSA-N Emorfazone Chemical compound C1=NN(C)C(=O)C(OCC)=C1N1CCOCC1 URJQOOISAKEBKW-UHFFFAOYSA-N 0.000 description 1
- 102100031780 Endonuclease Human genes 0.000 description 1
- 102000004533 Endonucleases Human genes 0.000 description 1
- 108010032976 Enfuvirtide Proteins 0.000 description 1
- 241000305071 Enterobacterales Species 0.000 description 1
- 102100023688 Eotaxin Human genes 0.000 description 1
- 101710139422 Eotaxin Proteins 0.000 description 1
- RHAXSHUQNIEUEY-UHFFFAOYSA-N Epirizole Chemical compound COC1=CC(C)=NN1C1=NC(C)=CC(OC)=N1 RHAXSHUQNIEUEY-UHFFFAOYSA-N 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 101001039702 Escherichia coli (strain K12) Methyl-accepting chemotaxis protein I Proteins 0.000 description 1
- 241001302584 Escherichia coli str. K-12 substr. W3110 Species 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- APQPGQGAWABJLN-UHFFFAOYSA-N Floctafenine Chemical compound OCC(O)COC(=O)C1=CC=CC=C1NC1=CC=NC2=C(C(F)(F)F)C=CC=C12 APQPGQGAWABJLN-UHFFFAOYSA-N 0.000 description 1
- WJOHZNCJWYWUJD-IUGZLZTKSA-N Fluocinonide Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)COC(=O)C)[C@@]2(C)C[C@@H]1O WJOHZNCJWYWUJD-IUGZLZTKSA-N 0.000 description 1
- POPFMWWJOGLOIF-XWCQMRHXSA-N Flurandrenolide Chemical compound C1([C@@H](F)C2)=CC(=O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O POPFMWWJOGLOIF-XWCQMRHXSA-N 0.000 description 1
- ALIVXCSEERJYHU-UHFFFAOYSA-N Flurbiprofen axetil Chemical compound FC1=CC(C(C)C(=O)OC(OC(C)=O)C)=CC=C1C1=CC=CC=C1 ALIVXCSEERJYHU-UHFFFAOYSA-N 0.000 description 1
- BDAGIHXWWSANSR-UHFFFAOYSA-M Formate Chemical compound [O-]C=O BDAGIHXWWSANSR-UHFFFAOYSA-M 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- IAJILQKETJEXLJ-UHFFFAOYSA-N Galacturonsaeure Natural products O=CC(O)C(O)C(O)C(O)C(O)=O IAJILQKETJEXLJ-UHFFFAOYSA-N 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 108010073178 Glucan 1,4-alpha-Glucosidase Proteins 0.000 description 1
- 102100022624 Glucoamylase Human genes 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 108010018962 Glucosephosphate Dehydrogenase Proteins 0.000 description 1
- 102000000587 Glycerolphosphate Dehydrogenase Human genes 0.000 description 1
- 108010041921 Glycerolphosphate Dehydrogenase Proteins 0.000 description 1
- 229920002683 Glycosaminoglycan Polymers 0.000 description 1
- WLHKPDQFOBROCS-UHFFFAOYSA-N Gossypetin 3-methyl ether Chemical compound O1C2=C(O)C(O)=CC(O)=C2C(=O)C(OC)=C1C1=CC=C(O)C(O)=C1 WLHKPDQFOBROCS-UHFFFAOYSA-N 0.000 description 1
- 108060003393 Granulin Proteins 0.000 description 1
- MUQNGPZZQDCDFT-JNQJZLCISA-N Halcinonide Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H]3OC(C)(C)O[C@@]3(C(=O)CCl)[C@@]1(C)C[C@@H]2O MUQNGPZZQDCDFT-JNQJZLCISA-N 0.000 description 1
- YCISZOVUHXIOFY-HKXOFBAYSA-N Halopredone acetate Chemical compound C1([C@H](F)C2)=CC(=O)C(Br)=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2CC[C@](OC(C)=O)(C(=O)COC(=O)C)[C@@]2(C)C[C@@H]1O YCISZOVUHXIOFY-HKXOFBAYSA-N 0.000 description 1
- 206010019233 Headaches Diseases 0.000 description 1
- 101001123859 Homo sapiens Sialidase-1 Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- FOGXJPFPZOHSQS-AYVLZSQQSA-N Hydrocortisone butyrate propionate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)CC)(OC(=O)CCC)[C@@]1(C)C[C@@H]2O FOGXJPFPZOHSQS-AYVLZSQQSA-N 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- 229940124790 IL-6 inhibitor Drugs 0.000 description 1
- GRSZFWQUAKGDAV-KQYNXXCUSA-N IMP Chemical compound O[C@@H]1[C@H](O)[C@@H](COP(O)(O)=O)O[C@H]1N1C(NC=NC2=O)=C2N=C1 GRSZFWQUAKGDAV-KQYNXXCUSA-N 0.000 description 1
- ZJVFLBOZORBYFE-UHFFFAOYSA-N Ibudilast Chemical compound C1=CC=CC2=C(C(=O)C(C)C)C(C(C)C)=NN21 ZJVFLBOZORBYFE-UHFFFAOYSA-N 0.000 description 1
- HEFNNWSXXWATRW-UHFFFAOYSA-N Ibuprofen Chemical compound CC(C)CC1=CC=C(C(C)C(O)=O)C=C1 HEFNNWSXXWATRW-UHFFFAOYSA-N 0.000 description 1
- ACEWLPOYLGNNHV-UHFFFAOYSA-N Ibuprofen piconol Chemical compound C1=CC(CC(C)C)=CC=C1C(C)C(=O)OCC1=CC=CC=N1 ACEWLPOYLGNNHV-UHFFFAOYSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 1
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- CFIGYZZVJNJVDQ-LMJOQDENSA-N Indomethacin farnesil Chemical compound CC1=C(CC(=O)OC\C=C(/C)CC\C=C(/C)CCC=C(C)C)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 CFIGYZZVJNJVDQ-LMJOQDENSA-N 0.000 description 1
- 102100026720 Interferon beta Human genes 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 102000003996 Interferon-beta Human genes 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 102000000589 Interleukin-1 Human genes 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 102000013462 Interleukin-12 Human genes 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 108090000862 Ion Channels Proteins 0.000 description 1
- 102000004310 Ion Channels Human genes 0.000 description 1
- 108090000769 Isomerases Proteins 0.000 description 1
- 102000004195 Isomerases Human genes 0.000 description 1
- DHUZAAUGHUHIDS-ONEGZZNKSA-N Isomyristicin Chemical compound COC1=CC(\C=C\C)=CC2=C1OCO2 DHUZAAUGHUHIDS-ONEGZZNKSA-N 0.000 description 1
- 102100027612 Kallikrein-11 Human genes 0.000 description 1
- LKDRXBCSQODPBY-AMVSKUEXSA-N L-(-)-Sorbose Chemical compound OCC1(O)OC[C@H](O)[C@@H](O)[C@@H]1O LKDRXBCSQODPBY-AMVSKUEXSA-N 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 101710180643 Leishmanolysin Proteins 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 239000012097 Lipofectamine 2000 Substances 0.000 description 1
- 241001490312 Lithops pseudotruncatella Species 0.000 description 1
- QPJBONAWFAURGB-UHFFFAOYSA-L Lobenzarit disodium Chemical compound [Na+].[Na+].[O-]C(=O)C1=CC=CC=C1NC1=CC(Cl)=CC=C1C([O-])=O QPJBONAWFAURGB-UHFFFAOYSA-L 0.000 description 1
- 206010024774 Localised infection Diseases 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 108010047357 Luminescent Proteins Proteins 0.000 description 1
- 102000006830 Luminescent Proteins Human genes 0.000 description 1
- 239000006137 Luria-Bertani broth Substances 0.000 description 1
- 101000577064 Lymnaea stagnalis Molluscan insulin-related peptide 1 Proteins 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- MMCDXJOMPMIKGP-UHFFFAOYSA-N Mabuterol hydrochloride Chemical compound [Cl-].CC(C)(C)[NH2+]CC(O)C1=CC(Cl)=C(N)C(C(F)(F)F)=C1 MMCDXJOMPMIKGP-UHFFFAOYSA-N 0.000 description 1
- 102000009571 Macrophage Inflammatory Proteins Human genes 0.000 description 1
- 108010009474 Macrophage Inflammatory Proteins Proteins 0.000 description 1
- 102000013460 Malate Dehydrogenase Human genes 0.000 description 1
- 108010026217 Malate Dehydrogenase Proteins 0.000 description 1
- 229920002774 Maltodextrin Polymers 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- VVIVBRYHTLRZGY-MBANBULQSA-N Meluadrine tartrate Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O.CC(C)(C)NC[C@H](O)C1=CC=C(O)C=C1Cl VVIVBRYHTLRZGY-MBANBULQSA-N 0.000 description 1
- 244000246386 Mentha pulegium Species 0.000 description 1
- 235000016257 Mentha pulegium Nutrition 0.000 description 1
- 235000004357 Mentha x piperita Nutrition 0.000 description 1
- HOKDBMAJZXIPGC-UHFFFAOYSA-N Mequitazine Chemical compound C12=CC=CC=C2SC2=CC=CC=C2N1CC1C(CC2)CCN2C1 HOKDBMAJZXIPGC-UHFFFAOYSA-N 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- DKMVJQCQTCLYIF-UHFFFAOYSA-M Methylbenactyzium bromide Chemical compound [Br-].C=1C=CC=CC=1C(O)(C(=O)OCC[N+](C)(CC)CC)C1=CC=CC=C1 DKMVJQCQTCLYIF-UHFFFAOYSA-M 0.000 description 1
- 108010059724 Micrococcal Nuclease Proteins 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 108020005196 Mitochondrial DNA Proteins 0.000 description 1
- PVLJETXTTWAYEW-UHFFFAOYSA-N Mizolastine Chemical compound N=1C=CC(=O)NC=1N(C)C(CC1)CCN1C1=NC2=CC=CC=C2N1CC1=CC=C(F)C=C1 PVLJETXTTWAYEW-UHFFFAOYSA-N 0.000 description 1
- 229920000881 Modified starch Polymers 0.000 description 1
- DJEIHHYCDCTAAH-UHFFFAOYSA-N Mofezolac (TN) Chemical compound C1=CC(OC)=CC=C1C1=NOC(CC(O)=O)=C1C1=CC=C(OC)C=C1 DJEIHHYCDCTAAH-UHFFFAOYSA-N 0.000 description 1
- 241000713869 Moloney murine leukemia virus Species 0.000 description 1
- UCHDWCPVSPXUMX-TZIWLTJVSA-N Montelukast Chemical compound CC(C)(O)C1=CC=CC=C1CC[C@H](C=1C=C(\C=C\C=2N=C3C=C(Cl)C=CC3=CC=2)C=CC=1)SCC1(CC(O)=O)CC1 UCHDWCPVSPXUMX-TZIWLTJVSA-N 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 229940121948 Muscarinic receptor antagonist Drugs 0.000 description 1
- 208000000112 Myalgia Diseases 0.000 description 1
- 101000737895 Mytilus edulis Contraction-inhibiting peptide 1 Proteins 0.000 description 1
- KWIUHFFTVRNATP-UHFFFAOYSA-O N,N,N-trimethylglycinium Chemical compound C[N+](C)(C)CC(O)=O KWIUHFFTVRNATP-UHFFFAOYSA-O 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- SQVRNKJHWKZAKO-PFQGKNLYSA-N N-acetyl-beta-neuraminic acid Chemical group CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-PFQGKNLYSA-N 0.000 description 1
- 101150080862 NA gene Proteins 0.000 description 1
- BLXXJMDCKKHMKV-UHFFFAOYSA-N Nabumetone Chemical compound C1=C(CCC(C)=O)C=CC2=CC(OC)=CC=C21 BLXXJMDCKKHMKV-UHFFFAOYSA-N 0.000 description 1
- CMWTZPSULFXXJA-UHFFFAOYSA-N Naproxen Natural products C1=C(C(C)C(O)=O)C=CC2=CC(OC)=CC=C21 CMWTZPSULFXXJA-UHFFFAOYSA-N 0.000 description 1
- JAUOIFJMECXRGI-UHFFFAOYSA-N Neoclaritin Chemical compound C=1C(Cl)=CC=C2C=1CCC1=CC=CN=C1C2=C1CCNCC1 JAUOIFJMECXRGI-UHFFFAOYSA-N 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 208000009869 Neu-Laxova syndrome Diseases 0.000 description 1
- IOVCWXUNBOPUCH-UHFFFAOYSA-M Nitrite anion Chemical compound [O-]N=O IOVCWXUNBOPUCH-UHFFFAOYSA-M 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108010077850 Nuclear Localization Signals Proteins 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 102000011931 Nucleoproteins Human genes 0.000 description 1
- 108010061100 Nucleoproteins Proteins 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- REYJJPSVUYRZGE-UHFFFAOYSA-N Octadecylamine Chemical compound CCCCCCCCCCCCCCCCCCN REYJJPSVUYRZGE-UHFFFAOYSA-N 0.000 description 1
- HVRLZEKDTUEKQH-NOILCQHBSA-N Olopatadine hydrochloride Chemical compound Cl.C1OC2=CC=C(CC(O)=O)C=C2C(=C/CCN(C)C)\C2=CC=CC=C21 HVRLZEKDTUEKQH-NOILCQHBSA-N 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 206010068319 Oropharyngeal pain Diseases 0.000 description 1
- 241000712464 Orthomyxoviridae Species 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 238000002944 PCR assay Methods 0.000 description 1
- MKPDWECBUAZOHP-AFYJWTTESA-N Paramethasone Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]2(C)C[C@@H]1O MKPDWECBUAZOHP-AFYJWTTESA-N 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 241000577979 Peromyscus spicilegus Species 0.000 description 1
- 201000007100 Pharyngitis Diseases 0.000 description 1
- 229940123932 Phosphodiesterase 4 inhibitor Drugs 0.000 description 1
- 229940099471 Phosphodiesterase inhibitor Drugs 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 108010053210 Phycocyanin Proteins 0.000 description 1
- 108010004729 Phycoerythrin Proteins 0.000 description 1
- VQDBNKDJNJQRDG-UHFFFAOYSA-N Pirbuterol Chemical compound CC(C)(C)NCC(O)C1=CC=C(O)C(CO)=N1 VQDBNKDJNJQRDG-UHFFFAOYSA-N 0.000 description 1
- 231100000742 Plant toxin Toxicity 0.000 description 1
- 208000007452 Plasmacytoma Diseases 0.000 description 1
- 206010035737 Pneumonia viral Diseases 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 229920002319 Poly(methyl acrylate) Polymers 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- TVQZAMVBTVNYLA-UHFFFAOYSA-N Pranoprofen Chemical compound C1=CC=C2CC3=CC(C(C(O)=O)C)=CC=C3OC2=N1 TVQZAMVBTVNYLA-UHFFFAOYSA-N 0.000 description 1
- LRJOMUJRLNCICJ-JZYPGELDSA-N Prednisolone acetate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)C)(O)[C@@]1(C)C[C@@H]2O LRJOMUJRLNCICJ-JZYPGELDSA-N 0.000 description 1
- HUMXXHTVHHLNRO-KAJVQRHHSA-N Prednisolone tebutate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)CC(C)(C)C)(O)[C@@]1(C)C[C@@H]2O HUMXXHTVHHLNRO-KAJVQRHHSA-N 0.000 description 1
- 108010059712 Pronase Proteins 0.000 description 1
- 102100026476 Prostacyclin receptor Human genes 0.000 description 1
- 101710170814 Prostacyclin receptor Proteins 0.000 description 1
- 102000008866 Prostaglandin E receptors Human genes 0.000 description 1
- 108010088540 Prostaglandin E receptors Proteins 0.000 description 1
- 102000000471 Prostaglandin F receptors Human genes 0.000 description 1
- 108050008995 Prostaglandin F receptors Proteins 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- BPZSYCZIITTYBL-YJYMSZOUSA-N R-Formoterol Chemical compound C1=CC(OC)=CC=C1C[C@@H](C)NC[C@H](O)C1=CC=C(O)C(NC=O)=C1 BPZSYCZIITTYBL-YJYMSZOUSA-N 0.000 description 1
- 239000012083 RIPA buffer Substances 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- LDXDSHIEDAPSSA-OAHLLOKOSA-N Ramatroban Chemical compound N([C@@H]1CCC=2N(C3=CC=CC=C3C=2C1)CCC(=O)O)S(=O)(=O)C1=CC=C(F)C=C1 LDXDSHIEDAPSSA-OAHLLOKOSA-N 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- NFQIAEMCQGTTIR-UHFFFAOYSA-N Repirinast Chemical compound C12=CC=C(C)C(C)=C2NC(=O)C2=C1OC(C(=O)OCCC(C)C)=CC2=O NFQIAEMCQGTTIR-UHFFFAOYSA-N 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- IWUCXVSUMQZMFG-AFCXAGJDSA-N Ribavirin Chemical compound N1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 IWUCXVSUMQZMFG-AFCXAGJDSA-N 0.000 description 1
- NCDNCNXCDXHOMX-UHFFFAOYSA-N Ritonavir Natural products C=1C=CC=CC=1CC(NC(=O)OCC=1SC=NC=1)C(O)CC(CC=1C=CC=CC=1)NC(=O)C(C(C)C)NC(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-UHFFFAOYSA-N 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- RUOGJYKOQBFJIG-UHFFFAOYSA-N SCH-351591 Chemical compound C12=CC=C(C(F)(F)F)N=C2C(OC)=CC=C1C(=O)NC1=C(Cl)C=[N+]([O-])C=C1Cl RUOGJYKOQBFJIG-UHFFFAOYSA-N 0.000 description 1
- 238000011579 SCID mouse model Methods 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- GIIZNNXWQWCKIB-UHFFFAOYSA-N Serevent Chemical compound C1=C(O)C(CO)=CC(C(O)CNCCCCCCOCCCCC=2C=CC=CC=2)=C1 GIIZNNXWQWCKIB-UHFFFAOYSA-N 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 241000607715 Serratia marcescens Species 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 102100028760 Sialidase-1 Human genes 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 1
- 229920002385 Sodium hyaluronate Polymers 0.000 description 1
- ABBQHOQBGMUPJH-UHFFFAOYSA-M Sodium salicylate Chemical compound [Na+].OC1=CC=CC=C1C([O-])=O ABBQHOQBGMUPJH-UHFFFAOYSA-M 0.000 description 1
- RXZMMZZRUPYENV-VROPFNGYSA-N Solifenacin succinate Chemical compound OC(=O)CCC(O)=O.C1([C@H]2C3=CC=CC=C3CCN2C(O[C@@H]2C3CCN(CC3)C2)=O)=CC=CC=C1 RXZMMZZRUPYENV-VROPFNGYSA-N 0.000 description 1
- IYFATESGLOUGBX-YVNJGZBMSA-N Sorbitan monopalmitate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O IYFATESGLOUGBX-YVNJGZBMSA-N 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 235000019486 Sunflower oil Nutrition 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 108010006785 Taq Polymerase Proteins 0.000 description 1
- XQTARQNQIVVBRX-UHFFFAOYSA-N Tazanolast Chemical compound CCCCOC(=O)C(=O)NC1=CC=CC(C2=NNN=N2)=C1 XQTARQNQIVVBRX-UHFFFAOYSA-N 0.000 description 1
- GUGOEEXESWIERI-UHFFFAOYSA-N Terfenadine Chemical compound C1=CC(C(C)(C)C)=CC=C1C(O)CCCN1CCC(C(O)(C=2C=CC=CC=2)C=2C=CC=CC=2)CC1 GUGOEEXESWIERI-UHFFFAOYSA-N 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 229940123987 Thromboxane A2 receptor antagonist Drugs 0.000 description 1
- 229940111979 Thromboxane synthase inhibitor Drugs 0.000 description 1
- KPWYNAGOBXLMSE-UHFFFAOYSA-N Tipelukast Chemical compound CCCC1=C(O)C(C(C)=O)=CC=C1SCCCOC1=CC=C(C(C)=O)C(OCCCC(O)=O)=C1CCC KPWYNAGOBXLMSE-UHFFFAOYSA-N 0.000 description 1
- SUJUHGSWHZTSEU-UHFFFAOYSA-N Tipranavir Natural products C1C(O)=C(C(CC)C=2C=C(NS(=O)(=O)C=3N=CC(=CC=3)C(F)(F)F)C=CC=2)C(=O)OC1(CCC)CCC1=CC=CC=C1 SUJUHGSWHZTSEU-UHFFFAOYSA-N 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- GSEJCLTVZPLZKY-UHFFFAOYSA-N Triethanolamine Chemical class OCCN(CCO)CCO GSEJCLTVZPLZKY-UHFFFAOYSA-N 0.000 description 1
- DOOTYTYQINUNNV-UHFFFAOYSA-N Triethyl citrate Chemical compound CCOC(=O)CC(O)(C(=O)OCC)CC(=O)OCC DOOTYTYQINUNNV-UHFFFAOYSA-N 0.000 description 1
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical class CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 1
- DTQVDTLACAAQTR-UHFFFAOYSA-M Trifluoroacetate Chemical compound [O-]C(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-M 0.000 description 1
- 102000005924 Triose-Phosphate Isomerase Human genes 0.000 description 1
- 108700015934 Triose-phosphate isomerases Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 101710152431 Trypsin-like protease Proteins 0.000 description 1
- RSLNRVYIRDVHLY-UHFFFAOYSA-N Tulobuterol hydrochloride Chemical compound [Cl-].CC(C)(C)[NH2+]CC(O)C1=CC=CC=C1Cl RSLNRVYIRDVHLY-UHFFFAOYSA-N 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- JDLSRXWHEBFHNC-UHFFFAOYSA-N Ufenamate Chemical compound CCCCOC(=O)C1=CC=CC=C1NC1=CC=CC(C(F)(F)F)=C1 JDLSRXWHEBFHNC-UHFFFAOYSA-N 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 101150117115 V gene Proteins 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 108020000999 Viral RNA Proteins 0.000 description 1
- 108010027570 Xanthine phosphoribosyltransferase Proteins 0.000 description 1
- 101000998548 Yersinia ruckeri Alkaline proteinase inhibitor Proteins 0.000 description 1
- YEEZWCHGZNKEEK-UHFFFAOYSA-N Zafirlukast Chemical compound COC1=CC(C(=O)NS(=O)(=O)C=2C(=CC=CC=2)C)=CC=C1CC(C1=C2)=CN(C)C1=CC=C2NC(=O)OC1CCCC1 YEEZWCHGZNKEEK-UHFFFAOYSA-N 0.000 description 1
- MUXFZBHBYYYLTH-UHFFFAOYSA-N Zaltoprofen Chemical compound O=C1CC2=CC(C(C(O)=O)C)=CC=C2SC2=CC=CC=C21 MUXFZBHBYYYLTH-UHFFFAOYSA-N 0.000 description 1
- RVCSYOQWLPPAOA-CVPHZBIISA-M [(5s)-spiro[8-azoniabicyclo[3.2.1]octane-8,1'-azolidin-1-ium]-3-yl] 2-hydroxy-2,2-diphenylacetate;chloride Chemical compound [Cl-].[N+]12([C@H]3CCC2CC(C3)OC(=O)C(O)(C=2C=CC=CC=2)C=2C=CC=CC=2)CCCC1 RVCSYOQWLPPAOA-CVPHZBIISA-M 0.000 description 1
- FBRAWBYQGRLCEK-UHFFFAOYSA-N [17-(2-chloroacetyl)-9-fluoro-10,13,16-trimethyl-3,11-dioxo-7,8,12,14,15,16-hexahydro-6h-cyclopenta[a]phenanthren-17-yl] butanoate Chemical compound C1CC2=CC(=O)C=CC2(C)C2(F)C1C1CC(C)C(C(=O)CCl)(OC(=O)CCC)C1(C)CC2=O FBRAWBYQGRLCEK-UHFFFAOYSA-N 0.000 description 1
- ZGDKVKUWTCGYOA-URGPHPNLSA-N [4-[4-[(z)-c-(4-bromophenyl)-n-ethoxycarbonimidoyl]piperidin-1-yl]-4-methylpiperidin-1-yl]-(2,4-dimethyl-1-oxidopyridin-1-ium-3-yl)methanone Chemical compound C=1C=C(Br)C=CC=1C(=N/OCC)\C(CC1)CCN1C(CC1)(C)CCN1C(=O)C1=C(C)C=C[N+]([O-])=C1C ZGDKVKUWTCGYOA-URGPHPNLSA-N 0.000 description 1
- DMEPDNFRHUGNPT-UHFFFAOYSA-N [5-(diethylamino)-2-methylpent-3-yn-2-yl] 2-cyclohexyl-2-hydroxy-2-phenylacetate Chemical compound C=1C=CC=CC=1C(O)(C(=O)OC(C)(C)C#CCN(CC)CC)C1CCCCC1 DMEPDNFRHUGNPT-UHFFFAOYSA-N 0.000 description 1
- MCGSCOLBFJQGHM-SCZZXKLOSA-N abacavir Chemical compound C=12N=CN([C@H]3C=C[C@@H](CO)C3)C2=NC(N)=NC=1NC1CC1 MCGSCOLBFJQGHM-SCZZXKLOSA-N 0.000 description 1
- 229960004748 abacavir Drugs 0.000 description 1
- WMHSRBZIJNQHKT-FFKFEZPRSA-N abacavir sulfate Chemical compound OS(O)(=O)=O.C=12N=CN([C@H]3C=C[C@@H](CO)C3)C2=NC(N)=NC=1NC1CC1.C=12N=CN([C@H]3C=C[C@@H](CO)C3)C2=NC(N)=NC=1NC1CC1 WMHSRBZIJNQHKT-FFKFEZPRSA-N 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- FSQKKOOTNAMONP-UHFFFAOYSA-N acemetacin Chemical compound CC1=C(CC(=O)OCC(O)=O)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 FSQKKOOTNAMONP-UHFFFAOYSA-N 0.000 description 1
- 229960004892 acemetacin Drugs 0.000 description 1
- 229940022663 acetate Drugs 0.000 description 1
- 150000001242 acetic acid derivatives Chemical class 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 229940022698 acetylcholinesterase Drugs 0.000 description 1
- 229960004150 aciclovir Drugs 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 229950005462 acotiamide Drugs 0.000 description 1
- DZBUGLKDJFMEHC-UHFFFAOYSA-N acridine Chemical class C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 1
- 229960003792 acrivastine Drugs 0.000 description 1
- PWACSDKDOHSSQD-IUTFFREVSA-N acrivastine Chemical compound C1=CC(C)=CC=C1C(\C=1N=C(\C=C\C(O)=O)C=CC=1)=C/CN1CCCC1 PWACSDKDOHSSQD-IUTFFREVSA-N 0.000 description 1
- 150000001252 acrylic acid derivatives Chemical class 0.000 description 1
- 229950003218 actarit Drugs 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 230000003044 adaptive effect Effects 0.000 description 1
- 229960001997 adefovir Drugs 0.000 description 1
- 229960003205 adefovir dipivoxil Drugs 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- BNPSSFBOAGDEEL-UHFFFAOYSA-N albuterol sulfate Chemical compound OS(O)(=O)=O.CC(C)(C)NCC(O)C1=CC=C(O)C(CO)=C1.CC(C)(C)NCC(O)C1=CC=C(O)C(CO)=C1 BNPSSFBOAGDEEL-UHFFFAOYSA-N 0.000 description 1
- 229960004229 alclometasone dipropionate Drugs 0.000 description 1
- DJHCCTTVDRAMEH-DUUJBDRPSA-N alclometasone dipropionate Chemical compound C([C@H]1Cl)C2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)COC(=O)CC)(OC(=O)CC)[C@@]1(C)C[C@@H]2O DJHCCTTVDRAMEH-DUUJBDRPSA-N 0.000 description 1
- IAJILQKETJEXLJ-QTBDOELSSA-N aldehydo-D-glucuronic acid Chemical compound O=C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C(O)=O IAJILQKETJEXLJ-QTBDOELSSA-N 0.000 description 1
- 239000003288 aldose reductase inhibitor Substances 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 229910052783 alkali metal Inorganic materials 0.000 description 1
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 1
- 108010004469 allophycocyanin Proteins 0.000 description 1
- 229960004663 alminoprofen Drugs 0.000 description 1
- FPHLBGOJWPEVME-UHFFFAOYSA-N alminoprofen Chemical compound OC(=O)C(C)C1=CC=C(NCC(C)=C)C=C1 FPHLBGOJWPEVME-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- SQKMCUVJZBDQDL-UHFFFAOYSA-K aluminum;2-(2,3-dimethylanilino)benzoate Chemical compound [Al+3].CC1=CC=CC(NC=2C(=CC=CC=2)C([O-])=O)=C1C.CC1=CC=CC(NC=2C(=CC=CC=2)C([O-])=O)=C1C.CC1=CC=CC(NC=2C(=CC=CC=2)C([O-])=O)=C1C SQKMCUVJZBDQDL-UHFFFAOYSA-K 0.000 description 1
- 229960003805 amantadine Drugs 0.000 description 1
- DKNWSYNQZKUICI-UHFFFAOYSA-N amantadine Chemical compound C1C(C2)CC3CC2CC1(N)C3 DKNWSYNQZKUICI-UHFFFAOYSA-N 0.000 description 1
- 229960003099 amcinonide Drugs 0.000 description 1
- ILKJAFIWWBXGDU-MOGDOJJUSA-N amcinonide Chemical compound O([C@@]1([C@H](O2)C[C@@H]3[C@@]1(C[C@H](O)[C@]1(F)[C@@]4(C)C=CC(=O)C=C4CC[C@H]13)C)C(=O)COC(=O)C)C12CCCC1 ILKJAFIWWBXGDU-MOGDOJJUSA-N 0.000 description 1
- QZNJPJDUBTYMRS-UHFFFAOYSA-M amfenac sodium hydrate Chemical compound O.[Na+].NC1=C(CC([O-])=O)C=CC=C1C(=O)C1=CC=CC=C1 QZNJPJDUBTYMRS-UHFFFAOYSA-M 0.000 description 1
- 108010074587 aminooxypentane-RANTES Proteins 0.000 description 1
- FQPFAHBPWDRTLU-UHFFFAOYSA-N aminophylline Chemical compound NCCN.O=C1N(C)C(=O)N(C)C2=C1NC=N2.O=C1N(C)C(=O)N(C)C2=C1NC=N2 FQPFAHBPWDRTLU-UHFFFAOYSA-N 0.000 description 1
- 229960003556 aminophylline Drugs 0.000 description 1
- 229960003731 amlexanox Drugs 0.000 description 1
- SGRYPYWGNKJSDL-UHFFFAOYSA-N amlexanox Chemical compound NC1=C(C(O)=O)C=C2C(=O)C3=CC(C(C)C)=CC=C3OC2=N1 SGRYPYWGNKJSDL-UHFFFAOYSA-N 0.000 description 1
- 150000003863 ammonium salts Chemical class 0.000 description 1
- 229950011249 ampiroxicam Drugs 0.000 description 1
- LSNWBKACGXCGAJ-UHFFFAOYSA-N ampiroxicam Chemical compound CN1S(=O)(=O)C2=CC=CC=C2C(OC(C)OC(=O)OCC)=C1C(=O)NC1=CC=CC=N1 LSNWBKACGXCGAJ-UHFFFAOYSA-N 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- YMARZQAQMVYCKC-OEMFJLHTSA-N amprenavir Chemical compound C([C@@H]([C@H](O)CN(CC(C)C)S(=O)(=O)C=1C=CC(N)=CC=1)NC(=O)O[C@@H]1COCC1)C1=CC=CC=C1 YMARZQAQMVYCKC-OEMFJLHTSA-N 0.000 description 1
- 235000019418 amylase Nutrition 0.000 description 1
- 229940025131 amylases Drugs 0.000 description 1
- 229950002999 andolast Drugs 0.000 description 1
- 208000022531 anorexia Diseases 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- 239000000043 antiallergic agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000009830 antibody antigen interaction Effects 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 230000027645 antigenic variation Effects 0.000 description 1
- 229940124623 antihistamine drug Drugs 0.000 description 1
- 229940125715 antihistaminic agent Drugs 0.000 description 1
- 239000003435 antirheumatic agent Substances 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 239000002216 antistatic agent Substances 0.000 description 1
- 239000008365 aqueous carrier Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- ZDQSOHOQTUFQEM-PKUCKEGBSA-N ascomycin Chemical compound C/C([C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@]2(O)O[C@@H]([C@H](C[C@H]2C)OC)[C@@H](OC)C[C@@H](C)C\C(C)=C/[C@H](C(C[C@H](O)[C@H]1C)=O)CC)=C\[C@@H]1CC[C@@H](O)[C@H](OC)C1 ZDQSOHOQTUFQEM-PKUCKEGBSA-N 0.000 description 1
- ZDQSOHOQTUFQEM-XCXYXIJFSA-N ascomycin Natural products CC[C@H]1C=C(C)C[C@@H](C)C[C@@H](OC)[C@H]2O[C@@](O)([C@@H](C)C[C@H]2OC)C(=O)C(=O)N3CCCC[C@@H]3C(=O)O[C@H]([C@H](C)[C@@H](O)CC1=O)C(=C[C@@H]4CC[C@@H](O)[C@H](C4)OC)C ZDQSOHOQTUFQEM-XCXYXIJFSA-N 0.000 description 1
- 229960003272 asparaginase Drugs 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-M asparaginate Chemical compound [O-]C(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-M 0.000 description 1
- GXDALQBWZGODGZ-UHFFFAOYSA-N astemizole Chemical compound C1=CC(OC)=CC=C1CCN1CCC(NC=2N(C3=CC=CC=C3N=2)CC=2C=CC(F)=CC=2)CC1 GXDALQBWZGODGZ-UHFFFAOYSA-N 0.000 description 1
- 238000011717 athymic nude mouse Methods 0.000 description 1
- 229950006944 atizoram Drugs 0.000 description 1
- 229960001799 aurothioglucose Drugs 0.000 description 1
- 238000000376 autoradiography Methods 0.000 description 1
- 229960004335 azelastine hydrochloride Drugs 0.000 description 1
- YEJAJYAHJQIWNU-UHFFFAOYSA-N azelastine hydrochloride Chemical compound Cl.C1CN(C)CCCC1N1C(=O)C2=CC=CC=C2C(CC=2C=CC(Cl)=CC=2)=N1 YEJAJYAHJQIWNU-UHFFFAOYSA-N 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- 239000000688 bacterial toxin Substances 0.000 description 1
- 229960003060 bambuterol Drugs 0.000 description 1
- ANZXOIAKUNOVQU-UHFFFAOYSA-N bambuterol Chemical compound CN(C)C(=O)OC1=CC(OC(=O)N(C)C)=CC(C(O)CNC(C)(C)C)=C1 ANZXOIAKUNOVQU-UHFFFAOYSA-N 0.000 description 1
- 229940077388 benzenesulfonate Drugs 0.000 description 1
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 1
- YWGDOWXRIALTES-NRFANRHFSA-N bepotastine Chemical compound C1CN(CCCC(=O)O)CCC1O[C@H](C=1N=CC=CC=1)C1=CC=C(Cl)C=C1 YWGDOWXRIALTES-NRFANRHFSA-N 0.000 description 1
- 229960002071 bepotastine Drugs 0.000 description 1
- MSWZFWKMSRAUBD-UHFFFAOYSA-N beta-D-galactosamine Natural products NC1C(O)OC(CO)C(O)C1O MSWZFWKMSRAUBD-UHFFFAOYSA-N 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 229960003237 betaine Drugs 0.000 description 1
- 229960002537 betamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-DVTGEIKXSA-N betamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-DVTGEIKXSA-N 0.000 description 1
- 229950008408 betamethasone butyrate propionate Drugs 0.000 description 1
- VXOWJCTXWVWLLC-REGDIAEZSA-N betamethasone butyrate propionate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)COC(=O)CC)(OC(=O)CCC)[C@@]1(C)C[C@@H]2O VXOWJCTXWVWLLC-REGDIAEZSA-N 0.000 description 1
- 229960001102 betamethasone dipropionate Drugs 0.000 description 1
- CIWBQSYVNNPZIQ-XYWKZLDCSA-N betamethasone dipropionate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)COC(=O)CC)(OC(=O)CC)[C@@]1(C)C[C@@H]2O CIWBQSYVNNPZIQ-XYWKZLDCSA-N 0.000 description 1
- 229960004311 betamethasone valerate Drugs 0.000 description 1
- SNHRLVCMMWUAJD-SUYDQAKGSA-N betamethasone valerate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CO)(OC(=O)CCCC)[C@@]1(C)C[C@@H]2O SNHRLVCMMWUAJD-SUYDQAKGSA-N 0.000 description 1
- 229960002123 bethanechol chloride Drugs 0.000 description 1
- XXRMYXBSBOVVBH-UHFFFAOYSA-N bethanechol chloride Chemical compound [Cl-].C[N+](C)(C)CC(C)OC(N)=O XXRMYXBSBOVVBH-UHFFFAOYSA-N 0.000 description 1
- 239000003613 bile acid Substances 0.000 description 1
- 229920000249 biocompatible polymer Polymers 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 239000013060 biological fluid Substances 0.000 description 1
- 239000012620 biological material Substances 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 238000005415 bioluminescence Methods 0.000 description 1
- 230000029918 bioluminescence Effects 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 235000019835 bromelain Nutrition 0.000 description 1
- 229940124630 bronchodilator Drugs 0.000 description 1
- 229960004436 budesonide Drugs 0.000 description 1
- 229960000962 bufexamac Drugs 0.000 description 1
- MXJWRABVEGLYDG-UHFFFAOYSA-N bufexamac Chemical compound CCCCOC1=CC=C(CC(=O)NO)C=C1 MXJWRABVEGLYDG-UHFFFAOYSA-N 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- 235000019282 butylated hydroxyanisole Nutrition 0.000 description 1
- 229940043253 butylated hydroxyanisole Drugs 0.000 description 1
- CZBZUDVBLSSABA-UHFFFAOYSA-N butylated hydroxyanisole Chemical compound COC1=CC=C(O)C(C(C)(C)C)=C1.COC1=CC=C(O)C=C1C(C)(C)C CZBZUDVBLSSABA-UHFFFAOYSA-N 0.000 description 1
- HOZOZZFCZRXYEK-GSWUYBTGSA-M butylscopolamine bromide Chemical compound [Br-].C1([C@@H](CO)C(=O)O[C@H]2C[C@@H]3[N+]([C@H](C2)[C@@H]2[C@H]3O2)(C)CCCC)=CC=CC=C1 HOZOZZFCZRXYEK-GSWUYBTGSA-M 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 159000000007 calcium salts Chemical class 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 239000003556 cannabinoid 2 receptor agonist Substances 0.000 description 1
- YQXCVAGCMNFUMQ-UHFFFAOYSA-N capravirine Chemical compound C=1C(Cl)=CC(Cl)=CC=1SC1=C(C(C)C)N=C(COC(N)=O)N1CC1=CC=NC=C1 YQXCVAGCMNFUMQ-UHFFFAOYSA-N 0.000 description 1
- 229950008230 capravirine Drugs 0.000 description 1
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 1
- 229940082638 cardiac stimulant phosphodiesterase inhibitors Drugs 0.000 description 1
- 239000005018 casein Substances 0.000 description 1
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 1
- 235000021240 caseins Nutrition 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 230000034303 cell budding Effects 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 229960004342 cetirizine hydrochloride Drugs 0.000 description 1
- 230000005465 channeling Effects 0.000 description 1
- 238000012412 chemical coupling Methods 0.000 description 1
- 239000002559 chemokine receptor antagonist Substances 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 239000000812 cholinergic antagonist Substances 0.000 description 1
- 229940059329 chondroitin sulfate Drugs 0.000 description 1
- 229960003728 ciclesonide Drugs 0.000 description 1
- 229960001265 ciclosporin Drugs 0.000 description 1
- 229950001653 cilomilast Drugs 0.000 description 1
- 229960001380 cimetidine Drugs 0.000 description 1
- CCGSUNCLSOWKJO-UHFFFAOYSA-N cimetidine Chemical compound N#CNC(=N/C)\NCCSCC1=NC=N[C]1C CCGSUNCLSOWKJO-UHFFFAOYSA-N 0.000 description 1
- WDURTRGFUGAJHA-MMQBYREUSA-M cimetropium bromide Chemical compound [Br-].C[N+]1([C@@H]2CC(C[C@H]1[C@@H]1O[C@@H]12)OC(=O)[C@@H](CO)C=1C=CC=CC=1)CC1CC1 WDURTRGFUGAJHA-MMQBYREUSA-M 0.000 description 1
- 229960003705 cimetropium bromide Drugs 0.000 description 1
- 150000001860 citric acid derivatives Chemical class 0.000 description 1
- 229960001399 clenbuterol hydrochloride Drugs 0.000 description 1
- OPXKTCUYRHXSBK-UHFFFAOYSA-N clenbuterol hydrochloride Chemical compound Cl.CC(C)(C)NCC(O)C1=CC(Cl)=C(N)C(Cl)=C1 OPXKTCUYRHXSBK-UHFFFAOYSA-N 0.000 description 1
- 229960004703 clobetasol propionate Drugs 0.000 description 1
- CBGUOGMQLZIXBE-XGQKBEPLSA-N clobetasol propionate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CCl)(OC(=O)CC)[C@@]1(C)C[C@@H]2O CBGUOGMQLZIXBE-XGQKBEPLSA-N 0.000 description 1
- 229960005465 clobetasone butyrate Drugs 0.000 description 1
- 238000012411 cloning technique Methods 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 239000000084 colloidal system Substances 0.000 description 1
- 229940000425 combination drug Drugs 0.000 description 1
- 230000006957 competitive inhibition Effects 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 230000001143 conditioned effect Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000013068 control sample Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- IDLFZVILOHSSID-OVLDLUHVSA-N corticotropin Chemical compound C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)NC(=O)[C@@H](N)CO)C1=CC=C(O)C=C1 IDLFZVILOHSSID-OVLDLUHVSA-N 0.000 description 1
- 229960000258 corticotropin Drugs 0.000 description 1
- BMCQMVFGOVHVNG-TUFAYURCSA-N cortisol 17-butyrate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)CO)(OC(=O)CCC)[C@@]1(C)C[C@@H]2O BMCQMVFGOVHVNG-TUFAYURCSA-N 0.000 description 1
- ALEXXDVDDISNDU-JZYPGELDSA-N cortisol 21-acetate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)C)(O)[C@@]1(C)C[C@@H]2O ALEXXDVDDISNDU-JZYPGELDSA-N 0.000 description 1
- RYJIRNNXCHOUTQ-OJJGEMKLSA-L cortisol sodium phosphate Chemical compound [Na+].[Na+].O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)COP([O-])([O-])=O)[C@@H]4[C@@H]3CCC2=C1 RYJIRNNXCHOUTQ-OJJGEMKLSA-L 0.000 description 1
- 229960003290 cortisone acetate Drugs 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 229940088900 crixivan Drugs 0.000 description 1
- 229960000265 cromoglicic acid Drugs 0.000 description 1
- 229960001681 croscarmellose sodium Drugs 0.000 description 1
- 229960000913 crospovidone Drugs 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 230000005574 cross-species transmission Effects 0.000 description 1
- 235000010947 crosslinked sodium carboxy methyl cellulose Nutrition 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 229940121384 cxc chemokine receptor type 4 (cxcr4) antagonist Drugs 0.000 description 1
- 229940097362 cyclodextrins Drugs 0.000 description 1
- 229930182912 cyclosporin Natural products 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 229960002677 darifenacin Drugs 0.000 description 1
- HXGBXQDTNZMWGS-RUZDIDTESA-N darifenacin Chemical compound C=1C=CC=CC=1C([C@H]1CN(CCC=2C=C3CCOC3=CC=2)CC1)(C(=O)N)C1=CC=CC=C1 HXGBXQDTNZMWGS-RUZDIDTESA-N 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 206010061428 decreased appetite Diseases 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 229960001145 deflazacort Drugs 0.000 description 1
- FBHSPRKOSMHSIF-GRMWVWQJSA-N deflazacort Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@H]3OC(C)=N[C@@]3(C(=O)COC(=O)C)[C@@]1(C)C[C@@H]2O FBHSPRKOSMHSIF-GRMWVWQJSA-N 0.000 description 1
- FMGSKLZLMKYGDP-USOAJAOKSA-N dehydroepiandrosterone Chemical compound C1[C@@H](O)CC[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC=C21 FMGSKLZLMKYGDP-USOAJAOKSA-N 0.000 description 1
- 229960005319 delavirdine Drugs 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 239000007933 dermal patch Substances 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 229960001271 desloratadine Drugs 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- CIWBQSYVNNPZIQ-PKWREOPISA-N dexamethasone dipropionate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)COC(=O)CC)(OC(=O)CC)[C@@]1(C)C[C@@H]2O CIWBQSYVNNPZIQ-PKWREOPISA-N 0.000 description 1
- 229950000250 dexamethasone dipropionate Drugs 0.000 description 1
- 229960002344 dexamethasone sodium phosphate Drugs 0.000 description 1
- PLCQGRYPOISRTQ-FCJDYXGNSA-L dexamethasone sodium phosphate Chemical compound [Na+].[Na+].C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)COP([O-])([O-])=O)(O)[C@@]1(C)C[C@@H]2O PLCQGRYPOISRTQ-FCJDYXGNSA-L 0.000 description 1
- 229950006825 dexamethasone valerate Drugs 0.000 description 1
- 229940096516 dextrates Drugs 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 229960001259 diclofenac Drugs 0.000 description 1
- DCOPUUMXTXDBNB-UHFFFAOYSA-N diclofenac Chemical compound OC(=O)CC1=CC=CC=C1NC1=C(Cl)C=CC=C1Cl DCOPUUMXTXDBNB-UHFFFAOYSA-N 0.000 description 1
- 229960002124 diflorasone diacetate Drugs 0.000 description 1
- BOBLHFUVNSFZPJ-JOYXJVLSSA-N diflorasone diacetate Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@H](C)[C@@](C(=O)COC(C)=O)(OC(C)=O)[C@@]2(C)C[C@@H]1O BOBLHFUVNSFZPJ-JOYXJVLSSA-N 0.000 description 1
- 229960003970 diflucortolone valerate Drugs 0.000 description 1
- 229960000616 diflunisal Drugs 0.000 description 1
- HUPFGZXOMWLGNK-UHFFFAOYSA-N diflunisal Chemical compound C1=C(O)C(C(=O)O)=CC(C=2C(=CC(F)=CC=2)F)=C1 HUPFGZXOMWLGNK-UHFFFAOYSA-N 0.000 description 1
- 229960004875 difluprednate Drugs 0.000 description 1
- 229940079919 digestives enzyme preparation Drugs 0.000 description 1
- JGKVKXPDDVRUKC-UHFFFAOYSA-N dimethothiazine mesylate Chemical compound CS(O)(=O)=O.C1=C(S(=O)(=O)N(C)C)C=C2N(CC(C)N(C)C)C3=CC=CC=C3SC2=C1 JGKVKXPDDVRUKC-UHFFFAOYSA-N 0.000 description 1
- AYXBAIULRDEVAS-UHFFFAOYSA-N dimethyl-[[4-[[3-(4-methylphenyl)-8,9-dihydro-7h-benzo[7]annulene-6-carbonyl]amino]phenyl]methyl]-(oxan-4-yl)azanium;iodide Chemical compound [I-].C1=CC(C)=CC=C1C1=CC=C(CCCC(=C2)C(=O)NC=3C=CC(C[N+](C)(C)C4CCOCC4)=CC=3)C2=C1 AYXBAIULRDEVAS-UHFFFAOYSA-N 0.000 description 1
- 229960002819 diprophylline Drugs 0.000 description 1
- 229940120889 dipyrone Drugs 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 231100000676 disease causative agent Toxicity 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- VLARUOGDXDTHEH-UHFFFAOYSA-L disodium cromoglycate Chemical compound [Na+].[Na+].O1C(C([O-])=O)=CC(=O)C2=C1C=CC=C2OCC(O)COC1=CC=CC2=C1C(=O)C=C(C([O-])=O)O2 VLARUOGDXDTHEH-UHFFFAOYSA-L 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 229950010759 domitroban Drugs 0.000 description 1
- PWTCIBWRMQFJBC-ZEMKZVSASA-N domitroban Chemical compound N([C@H]1[C@H]2CC[C@H](C2)[C@@H]1C\C=C/CCCC(=O)O)S(=O)(=O)C1=CC=CC=C1 PWTCIBWRMQFJBC-ZEMKZVSASA-N 0.000 description 1
- 229960000409 dopexamine hydrochloride Drugs 0.000 description 1
- 229960004483 doxofylline Drugs 0.000 description 1
- HWXIGFIVGWUZAO-UHFFFAOYSA-N doxofylline Chemical compound C1=2C(=O)N(C)C(=O)N(C)C=2N=CN1CC1OCCO1 HWXIGFIVGWUZAO-UHFFFAOYSA-N 0.000 description 1
- KSCFJBIXMNOVSH-UHFFFAOYSA-N dyphylline Chemical compound O=C1N(C)C(=O)N(C)C2=C1N(CC(O)CO)C=N2 KSCFJBIXMNOVSH-UHFFFAOYSA-N 0.000 description 1
- 229960001971 ebastine Drugs 0.000 description 1
- MJJALKDDGIKVBE-UHFFFAOYSA-N ebastine Chemical compound C1=CC(C(C)(C)C)=CC=C1C(=O)CCCN1CCC(OC(C=2C=CC=CC=2)C=2C=CC=CC=2)CC1 MJJALKDDGIKVBE-UHFFFAOYSA-N 0.000 description 1
- 229960003804 efavirenz Drugs 0.000 description 1
- 238000011984 electrochemiluminescence immunoassay Methods 0.000 description 1
- 238000001493 electron microscopy Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 210000002257 embryonic structure Anatomy 0.000 description 1
- FWLKKPKZQYVAFR-SPIKMXEPSA-N emedastine difumarate Chemical compound OC(=O)\C=C/C(O)=O.OC(=O)\C=C/C(O)=O.N=1C2=CC=CC=C2N(CCOCC)C=1N1CCCN(C)CC1 FWLKKPKZQYVAFR-SPIKMXEPSA-N 0.000 description 1
- 229960004677 emedastine difumarate Drugs 0.000 description 1
- 229950010243 emorfazone Drugs 0.000 description 1
- 229960002062 enfuvirtide Drugs 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- WHWZLSFABNNENI-UHFFFAOYSA-N epinastine Chemical compound C1C2=CC=CC=C2C2CN=C(N)N2C2=CC=CC=C21 WHWZLSFABNNENI-UHFFFAOYSA-N 0.000 description 1
- 229960002548 epinastine hydrochloride Drugs 0.000 description 1
- 229960005139 epinephrine Drugs 0.000 description 1
- 229950003801 epirizole Drugs 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- QNQBPPQLRODXET-UHFFFAOYSA-N equisetin Natural products CC=CC1C=CC2CC(C)CCC2C1(C)C(O)=C1C(=O)C(CO)N(C)C1=O QNQBPPQLRODXET-UHFFFAOYSA-N 0.000 description 1
- HQPMKSGTIOYHJT-UHFFFAOYSA-N ethane-1,2-diol;propane-1,2-diol Chemical compound OCCO.CC(O)CO HQPMKSGTIOYHJT-UHFFFAOYSA-N 0.000 description 1
- 150000002169 ethanolamines Chemical class 0.000 description 1
- SBVYURPQULDJTI-UHFFFAOYSA-N ethyl n-[amino-[4-[[3-[[4-[2-(4-hydroxyphenyl)propan-2-yl]phenoxy]methyl]phenyl]methoxy]phenyl]methylidene]carbamate Chemical compound C1=CC(C(=N)NC(=O)OCC)=CC=C1OCC1=CC=CC(COC=2C=CC(=CC=2)C(C)(C)C=2C=CC(O)=CC=2)=C1 SBVYURPQULDJTI-UHFFFAOYSA-N 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- DEFVIWRASFVYLL-UHFFFAOYSA-N ethylene glycol bis(2-aminoethyl)tetraacetic acid Chemical compound OC(=O)CN(CC(O)=O)CCOCCOCCN(CC(O)=O)CC(O)=O DEFVIWRASFVYLL-UHFFFAOYSA-N 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 229960005293 etodolac Drugs 0.000 description 1
- XFBVBWWRPKNWHW-UHFFFAOYSA-N etodolac Chemical compound C1COC(CC)(CC(O)=O)C2=N[C]3C(CC)=CC=CC3=C21 XFBVBWWRPKNWHW-UHFFFAOYSA-N 0.000 description 1
- 230000017188 evasion or tolerance of host immune response Effects 0.000 description 1
- 230000000763 evoking effect Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000002360 explosive Substances 0.000 description 1
- XUFQPHANEAPEMJ-UHFFFAOYSA-N famotidine Chemical compound NC(N)=NC1=NC(CSCCC(N)=NS(N)(=O)=O)=CS1 XUFQPHANEAPEMJ-UHFFFAOYSA-N 0.000 description 1
- 229960001596 famotidine Drugs 0.000 description 1
- 229960000192 felbinac Drugs 0.000 description 1
- ZPAKPRAICRBAOD-UHFFFAOYSA-N fenbufen Chemical compound C1=CC(C(=O)CCC(=O)O)=CC=C1C1=CC=CC=C1 ZPAKPRAICRBAOD-UHFFFAOYSA-N 0.000 description 1
- 229960001395 fenbufen Drugs 0.000 description 1
- 229960005341 fenoprofen calcium Drugs 0.000 description 1
- VHUXSAWXWSTUOD-UHFFFAOYSA-L fenoprofen calcium (anhydrous) Chemical compound [Ca+2].[O-]C(=O)C(C)C1=CC=CC(OC=2C=CC=CC=2)=C1.[O-]C(=O)C(C)C1=CC=CC(OC=2C=CC=CC=2)=C1 VHUXSAWXWSTUOD-UHFFFAOYSA-L 0.000 description 1
- 229960001037 fenoterol hydrobromide Drugs 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 229960003592 fexofenadine Drugs 0.000 description 1
- RWTNPBWLLIMQHL-UHFFFAOYSA-N fexofenadine Chemical compound C1=CC(C(C)(C(O)=O)C)=CC=C1C(O)CCCN1CCC(C(O)(C=2C=CC=CC=2)C=2C=CC=CC=2)CC1 RWTNPBWLLIMQHL-UHFFFAOYSA-N 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 235000019688 fish Nutrition 0.000 description 1
- 229960003240 floctafenine Drugs 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- SYWHXTATXSMDSB-GSLJADNHSA-N fludrocortisone acetate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)C)(O)[C@@]1(C)C[C@@H]2O SYWHXTATXSMDSB-GSLJADNHSA-N 0.000 description 1
- 229960004511 fludroxycortide Drugs 0.000 description 1
- 229940042902 flumethasone pivalate Drugs 0.000 description 1
- JWRMHDSINXPDHB-OJAGFMMFSA-N flumethasone pivalate Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@@H](C)[C@@](C(=O)COC(=O)C(C)(C)C)(O)[C@@]2(C)C[C@@H]1O JWRMHDSINXPDHB-OJAGFMMFSA-N 0.000 description 1
- 229960000676 flunisolide Drugs 0.000 description 1
- 229960001347 fluocinolone acetonide Drugs 0.000 description 1
- FEBLZLNTKCEFIT-VSXGLTOVSA-N fluocinolone acetonide Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O FEBLZLNTKCEFIT-VSXGLTOVSA-N 0.000 description 1
- 229960000785 fluocinonide Drugs 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000001215 fluorescent labelling Methods 0.000 description 1
- 229960003336 fluorocortisol acetate Drugs 0.000 description 1
- 229960002390 flurbiprofen Drugs 0.000 description 1
- SYTBZMRGLBWNTM-UHFFFAOYSA-N flurbiprofen Chemical compound FC1=CC(C(C(O)=O)C)=CC=C1C1=CC=CC=C1 SYTBZMRGLBWNTM-UHFFFAOYSA-N 0.000 description 1
- 229950005941 flurbiprofen axetil Drugs 0.000 description 1
- 229960000289 fluticasone propionate Drugs 0.000 description 1
- WMWTYOKRWGGJOA-CENSZEJFSA-N fluticasone propionate Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@@H](C)[C@@](C(=O)SCF)(OC(=O)CC)[C@@]2(C)C[C@@H]1O WMWTYOKRWGGJOA-CENSZEJFSA-N 0.000 description 1
- 229950008319 flutropium bromide Drugs 0.000 description 1
- FNUZASGZEHGWQM-RJRMRWARSA-M flutropium bromide Chemical compound C[N@+](CCF)([C@H](CC1)C2)[C@@H]1C[C@H]2OC(C(C1=CC=CC=C1)(C1=CC=CC=C1)O)=O.[Br-] FNUZASGZEHGWQM-RJRMRWARSA-M 0.000 description 1
- 229960000193 formoterol fumarate Drugs 0.000 description 1
- 229940125777 fusion inhibitor Drugs 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 238000012252 genetic analysis Methods 0.000 description 1
- 238000011331 genomic analysis Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 229960002442 glucosamine Drugs 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- 229940097043 glucuronic acid Drugs 0.000 description 1
- 150000002337 glycosamines Chemical group 0.000 description 1
- 229940015045 gold sodium thiomalate Drugs 0.000 description 1
- 210000002288 golgi apparatus Anatomy 0.000 description 1
- 101150106093 gpt gene Proteins 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 229960002383 halcinonide Drugs 0.000 description 1
- 229950004611 halopredone acetate Drugs 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 231100000869 headache Toxicity 0.000 description 1
- 230000003067 hemagglutinative effect Effects 0.000 description 1
- POOYFSLWYLDQMD-UHFFFAOYSA-N heptacalcium;zinc Chemical compound [Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Zn+2] POOYFSLWYLDQMD-UHFFFAOYSA-N 0.000 description 1
- 150000004687 hexahydrates Chemical class 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 239000012456 homogeneous solution Substances 0.000 description 1
- 235000001050 hortel pimenta Nutrition 0.000 description 1
- 244000052637 human pathogen Species 0.000 description 1
- 210000004754 hybrid cell Anatomy 0.000 description 1
- 229960000890 hydrocortisone Drugs 0.000 description 1
- 229960001067 hydrocortisone acetate Drugs 0.000 description 1
- 229960001524 hydrocortisone butyrate Drugs 0.000 description 1
- 229960004204 hydrocortisone sodium phosphate Drugs 0.000 description 1
- 229960001401 hydrocortisone sodium succinate Drugs 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- MSYBLBLAMDYKKZ-UHFFFAOYSA-N hydron;pyridine-3-carbonyl chloride;chloride Chemical compound Cl.ClC(=O)C1=CC=CN=C1 MSYBLBLAMDYKKZ-UHFFFAOYSA-N 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- XXSMGPRMXLTPCZ-UHFFFAOYSA-N hydroxychloroquine Chemical compound ClC1=CC=C2C(NC(C)CCCN(CCO)CC)=CC=NC2=C1 XXSMGPRMXLTPCZ-UHFFFAOYSA-N 0.000 description 1
- 229960004171 hydroxychloroquine Drugs 0.000 description 1
- 229960002491 ibudilast Drugs 0.000 description 1
- 229960001680 ibuprofen Drugs 0.000 description 1
- 229950005954 ibuprofen piconol Drugs 0.000 description 1
- SQKXYSGRELMAAU-UHFFFAOYSA-N imidafenacin Chemical compound CC1=NC=CN1CCC(C(N)=O)(C=1C=CC=CC=1)C1=CC=CC=C1 SQKXYSGRELMAAU-UHFFFAOYSA-N 0.000 description 1
- 229950005396 imidafenacin Drugs 0.000 description 1
- 239000012729 immediate-release (IR) formulation Substances 0.000 description 1
- 230000003100 immobilizing effect Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 230000002998 immunogenetic effect Effects 0.000 description 1
- 229960003444 immunosuppressant agent Drugs 0.000 description 1
- 229940124589 immunosuppressive drug Drugs 0.000 description 1
- 238000000126 in silico method Methods 0.000 description 1
- 229960001936 indinavir Drugs 0.000 description 1
- CGIGDMFJXJATDK-UHFFFAOYSA-N indomethacin Chemical compound CC1=C(CC(O)=O)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 CGIGDMFJXJATDK-UHFFFAOYSA-N 0.000 description 1
- 229960000905 indomethacin Drugs 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 235000013902 inosinic acid Nutrition 0.000 description 1
- CDAISMWEOUEBRE-GPIVLXJGSA-N inositol Chemical compound O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H]1O CDAISMWEOUEBRE-GPIVLXJGSA-N 0.000 description 1
- 229960000367 inositol Drugs 0.000 description 1
- 229940117681 interleukin-12 Drugs 0.000 description 1
- 239000000543 intermediate Substances 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 229940088976 invirase Drugs 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- SZVJSHCCFOBDDC-UHFFFAOYSA-N iron(II,III) oxide Inorganic materials O=[Fe]O[Fe]O[Fe]=O SZVJSHCCFOBDDC-UHFFFAOYSA-N 0.000 description 1
- 230000001788 irregular Effects 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 229940018435 isoproterenol sulfate Drugs 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 229940112586 kaletra Drugs 0.000 description 1
- DKYWVDODHFEZIM-UHFFFAOYSA-N ketoprofen Chemical compound OC(=O)C(C)C1=CC=CC(C(=O)C=2C=CC=CC=2)=C1 DKYWVDODHFEZIM-UHFFFAOYSA-N 0.000 description 1
- 229960000991 ketoprofen Drugs 0.000 description 1
- YNQQEYBLVYAWNX-WLHGVMLRSA-N ketotifen fumarate Chemical compound OC(=O)\C=C\C(O)=O.C1CN(C)CCC1=C1C2=CC=CC=C2CC(=O)C2=C1C=CS2 YNQQEYBLVYAWNX-WLHGVMLRSA-N 0.000 description 1
- 229960003630 ketotifen fumarate Drugs 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- 239000000832 lactitol Substances 0.000 description 1
- 235000010448 lactitol Nutrition 0.000 description 1
- VQHSOMBJVWLPSR-JVCRWLNRSA-N lactitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-JVCRWLNRSA-N 0.000 description 1
- 229960003451 lactitol Drugs 0.000 description 1
- JTEGQNOMFQHVDC-NKWVEPMBSA-N lamivudine Chemical compound O=C1N=C(N)C=CN1[C@H]1O[C@@H](CO)SC1 JTEGQNOMFQHVDC-NKWVEPMBSA-N 0.000 description 1
- 229910052747 lanthanoid Inorganic materials 0.000 description 1
- 150000002602 lanthanoids Chemical class 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- VHOGYURTWQBHIL-UHFFFAOYSA-N leflunomide Chemical compound O1N=CC(C(=O)NC=2C=CC(=CC=2)C(F)(F)F)=C1C VHOGYURTWQBHIL-UHFFFAOYSA-N 0.000 description 1
- 229960000681 leflunomide Drugs 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 229940065725 leukotriene receptor antagonists for obstructive airway diseases Drugs 0.000 description 1
- 229950008204 levosalbutamol Drugs 0.000 description 1
- 239000012669 liquid formulation Substances 0.000 description 1
- 229910003002 lithium salt Inorganic materials 0.000 description 1
- 159000000002 lithium salts Chemical class 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 229960004525 lopinavir Drugs 0.000 description 1
- 229960003088 loratadine Drugs 0.000 description 1
- JCCNYMKQOSZNPW-UHFFFAOYSA-N loratadine Chemical compound C1CN(C(=O)OCC)CCC1=C1C2=NC=CC=C2CCC2=CC(Cl)=CC=C21 JCCNYMKQOSZNPW-UHFFFAOYSA-N 0.000 description 1
- 229940083747 low-ceiling diuretics xanthine derivative Drugs 0.000 description 1
- 229960002373 loxoprofen Drugs 0.000 description 1
- WORCCYVLMMTGFR-UHFFFAOYSA-M loxoprofen sodium Chemical compound [Na+].C1=CC(C(C([O-])=O)C)=CC=C1CC1C(=O)CCC1 WORCCYVLMMTGFR-UHFFFAOYSA-M 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 229940073475 lysozyme hydrochloride Drugs 0.000 description 1
- 229950004407 mabuterol Drugs 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 229960002337 magnesium chloride Drugs 0.000 description 1
- 239000000395 magnesium oxide Substances 0.000 description 1
- 159000000003 magnesium salts Chemical class 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- AXZKOIWUVFPNLO-UHFFFAOYSA-N magnesium;oxygen(2-) Chemical compound [O-2].[Mg+2] AXZKOIWUVFPNLO-UHFFFAOYSA-N 0.000 description 1
- 230000005291 magnetic effect Effects 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 206010025482 malaise Diseases 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 239000000845 maltitol Substances 0.000 description 1
- 235000010449 maltitol Nutrition 0.000 description 1
- VQHSOMBJVWLPSR-WUJBLJFYSA-N maltitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-WUJBLJFYSA-N 0.000 description 1
- 229940035436 maltitol Drugs 0.000 description 1
- 229960001855 mannitol Drugs 0.000 description 1
- AEUKDPKXTPNBNY-XEYRWQBLSA-N mcp 2 Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)C(C)C)C1=CC=CC=C1 AEUKDPKXTPNBNY-XEYRWQBLSA-N 0.000 description 1
- 229940127554 medical product Drugs 0.000 description 1
- 229960003464 mefenamic acid Drugs 0.000 description 1
- HYYBABOKPJLUIN-UHFFFAOYSA-N mefenamic acid Chemical compound CC1=CC=CC(NC=2C(=CC=CC=2)C(O)=O)=C1C HYYBABOKPJLUIN-UHFFFAOYSA-N 0.000 description 1
- QWIZNVHXZXRPDR-WSCXOGSTSA-N melezitose Chemical compound O([C@@]1(O[C@@H]([C@H]([C@@H]1O[C@@H]1[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)O)O)CO)CO)[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O QWIZNVHXZXRPDR-WSCXOGSTSA-N 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 230000034217 membrane fusion Effects 0.000 description 1
- 229960003869 mepenzolate bromide Drugs 0.000 description 1
- 229960005042 mequitazine Drugs 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 239000003475 metalloproteinase inhibitor Substances 0.000 description 1
- DJGAAPFSPWAYTJ-UHFFFAOYSA-M metamizole sodium Chemical compound [Na+].O=C1C(N(CS([O-])(=O)=O)C)=C(C)N(C)N1C1=CC=CC=C1 DJGAAPFSPWAYTJ-UHFFFAOYSA-M 0.000 description 1
- LMOINURANNBYCM-UHFFFAOYSA-N metaproterenol Chemical compound CC(C)NCC(O)C1=CC(O)=CC(O)=C1 LMOINURANNBYCM-UHFFFAOYSA-N 0.000 description 1
- WSFSSNUMVMOOMR-NJFSPNSNSA-N methanone Chemical compound O=[14CH2] WSFSSNUMVMOOMR-NJFSPNSNSA-N 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 1
- LZULAZTXJLWELL-UHFFFAOYSA-N methyl hex-5-ynoate Chemical compound COC(=O)CCCC#C LZULAZTXJLWELL-UHFFFAOYSA-N 0.000 description 1
- STZCRXQWRGQSJD-GEEYTBSJSA-M methyl orange Chemical compound [Na+].C1=CC(N(C)C)=CC=C1\N=N\C1=CC=C(S([O-])(=O)=O)C=C1 STZCRXQWRGQSJD-GEEYTBSJSA-M 0.000 description 1
- 229940012189 methyl orange Drugs 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 229960001047 methyl salicylate Drugs 0.000 description 1
- 229950003018 methylbenactyzium bromide Drugs 0.000 description 1
- 229960004584 methylprednisolone Drugs 0.000 description 1
- 229960001293 methylprednisolone acetate Drugs 0.000 description 1
- PLBHSZGDDKCEHR-LFYFAGGJSA-N methylprednisolone acetate Chemical compound C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)COC(C)=O)CC[C@H]21 PLBHSZGDDKCEHR-LFYFAGGJSA-N 0.000 description 1
- CDMLLMOLWUKNEK-AOHDELFNSA-M methylprednisolone suleptanate Chemical compound [Na+].C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)COC(=O)CCCCCCC(=O)N(C)CCS([O-])(=O)=O)CC[C@H]21 CDMLLMOLWUKNEK-AOHDELFNSA-M 0.000 description 1
- 229950010796 methylprednisolone suleptanate Drugs 0.000 description 1
- 238000002493 microarray Methods 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 238000001000 micrograph Methods 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 230000001617 migratory effect Effects 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 108091064355 mitochondrial RNA Proteins 0.000 description 1
- 229960001144 mizolastine Drugs 0.000 description 1
- 229960000429 mofezolac Drugs 0.000 description 1
- 230000009456 molecular mechanism Effects 0.000 description 1
- 229960001664 mometasone Drugs 0.000 description 1
- QLIIKPVHVRXHRI-CXSFZGCWSA-N mometasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(Cl)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CCl)(O)[C@@]1(C)C[C@@H]2O QLIIKPVHVRXHRI-CXSFZGCWSA-N 0.000 description 1
- 229960005127 montelukast Drugs 0.000 description 1
- 229960004866 mycophenolate mofetil Drugs 0.000 description 1
- RTGDFNSFWBGLEC-SYZQJQIISA-N mycophenolate mofetil Chemical compound COC1=C(C)C=2COC(=O)C=2C(O)=C1C\C=C(/C)CCC(=O)OCCN1CCOCC1 RTGDFNSFWBGLEC-SYZQJQIISA-N 0.000 description 1
- NPGREARFJMFTDF-UHFFFAOYSA-N n-(3,5-dichloro-1-hydroxypyridin-4-ylidene)-8-methoxy-2-(trifluoromethyl)quinoline-5-carboxamide Chemical compound C12=CC=C(C(F)(F)F)N=C2C(OC)=CC=C1C(=O)N=C1C(Cl)=CN(O)C=C1Cl NPGREARFJMFTDF-UHFFFAOYSA-N 0.000 description 1
- HWMFFWCDLWDYGX-UHFFFAOYSA-N n-(4-aminophenyl)furan-2-carboxamide Chemical compound C1=CC(N)=CC=C1NC(=O)C1=CC=CO1 HWMFFWCDLWDYGX-UHFFFAOYSA-N 0.000 description 1
- OHDXDNUPVVYWOV-UHFFFAOYSA-N n-methyl-1-(2-naphthalen-1-ylsulfanylphenyl)methanamine Chemical compound CNCC1=CC=CC=C1SC1=CC=CC2=CC=CC=C12 OHDXDNUPVVYWOV-UHFFFAOYSA-N 0.000 description 1
- 229960004270 nabumetone Drugs 0.000 description 1
- 229960002009 naproxen Drugs 0.000 description 1
- CMWTZPSULFXXJA-VIFPVBQESA-N naproxen Chemical compound C1=C([C@H](C)C(O)=O)C=CC2=CC(OC)=CC=C21 CMWTZPSULFXXJA-VIFPVBQESA-N 0.000 description 1
- 230000017128 negative regulation of NF-kappaB transcription factor activity Effects 0.000 description 1
- 229960000884 nelfinavir Drugs 0.000 description 1
- NQDJXKOVJZTUJA-UHFFFAOYSA-N nevirapine Chemical compound C12=NC=CC=C2C(=O)NC=2C(C)=CC=NC=2N1C1CC1 NQDJXKOVJZTUJA-UHFFFAOYSA-N 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 239000012457 nonaqueous media Substances 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 229940072250 norvir Drugs 0.000 description 1
- 230000030147 nuclear export Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 230000030648 nucleus localization Effects 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 150000002482 oligosaccharides Chemical class 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 229960003139 olopatadine hydrochloride Drugs 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 229960002657 orciprenaline Drugs 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 150000002895 organic esters Chemical class 0.000 description 1
- 238000007500 overflow downdraw method Methods 0.000 description 1
- 229960002739 oxaprozin Drugs 0.000 description 1
- OFPXSFXSNFPTHF-UHFFFAOYSA-N oxaprozin Chemical compound O1C(CCC(=O)O)=NC(C=2C=CC=CC=2)=C1C1=CC=CC=C1 OFPXSFXSNFPTHF-UHFFFAOYSA-N 0.000 description 1
- 229960002698 oxatomide Drugs 0.000 description 1
- BAINIUMDFURPJM-UHFFFAOYSA-N oxatomide Chemical compound O=C1NC2=CC=CC=C2N1CCCN(CC1)CCN1C(C=1C=CC=CC=1)C1=CC=CC=C1 BAINIUMDFURPJM-UHFFFAOYSA-N 0.000 description 1
- 229960001609 oxitropium bromide Drugs 0.000 description 1
- LCELQERNWLBPSY-KHSTUMNDSA-M oxitropium bromide Chemical compound [Br-].C1([C@@H](CO)C(=O)O[C@H]2C[C@@H]3[N+]([C@H](C2)[C@@H]2[C@H]3O2)(C)CC)=CC=CC=C1 LCELQERNWLBPSY-KHSTUMNDSA-M 0.000 description 1
- 229960005434 oxybutynin Drugs 0.000 description 1
- 229940094443 oxytocics prostaglandins Drugs 0.000 description 1
- SHZKQBHERIJWAO-AATRIKPKSA-N ozagrel Chemical compound C1=CC(/C=C/C(=O)O)=CC=C1CN1C=NC=C1 SHZKQBHERIJWAO-AATRIKPKSA-N 0.000 description 1
- 229950003837 ozagrel Drugs 0.000 description 1
- 125000001312 palmitoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 229960005489 paracetamol Drugs 0.000 description 1
- 230000005298 paramagnetic effect Effects 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000007918 pathogenicity Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 229960004811 pemirolast potassium Drugs 0.000 description 1
- 229960001639 penicillamine Drugs 0.000 description 1
- 239000003208 petroleum Substances 0.000 description 1
- 239000008024 pharmaceutical diluent Substances 0.000 description 1
- 239000008180 pharmaceutical surfactant Substances 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- 229960003893 phenacetin Drugs 0.000 description 1
- ORMNNUPLFAPCFD-DVLYDCSHSA-M phenethicillin potassium Chemical compound [K+].N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C([O-])=O)=O)C(=O)C(C)OC1=CC=CC=C1 ORMNNUPLFAPCFD-DVLYDCSHSA-M 0.000 description 1
- 229960005323 phenoxyethanol Drugs 0.000 description 1
- RXNXLAHQOVLMIE-UHFFFAOYSA-N phenyl 10-methylacridin-10-ium-9-carboxylate Chemical compound C12=CC=CC=C2[N+](C)=C2C=CC=CC2=C1C(=O)OC1=CC=CC=C1 RXNXLAHQOVLMIE-UHFFFAOYSA-N 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 150000008105 phosphatidylcholines Chemical class 0.000 description 1
- 239000002587 phosphodiesterase IV inhibitor Substances 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- ZWLUXSQADUDCSB-UHFFFAOYSA-N phthalaldehyde Chemical compound O=CC1=CC=CC=C1C=O ZWLUXSQADUDCSB-UHFFFAOYSA-N 0.000 description 1
- 238000013081 phylogenetic analysis Methods 0.000 description 1
- 229960005414 pirbuterol Drugs 0.000 description 1
- 229960002702 piroxicam Drugs 0.000 description 1
- QYSPLQLAKJAUJT-UHFFFAOYSA-N piroxicam Chemical compound OC=1C2=CC=CC=C2S(=O)(=O)N(C)C=1C(=O)NC1=CC=CC=N1 QYSPLQLAKJAUJT-UHFFFAOYSA-N 0.000 description 1
- 239000003123 plant toxin Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- YIQPUIGJQJDJOS-UHFFFAOYSA-N plerixafor Chemical compound C=1C=C(CN2CCNCCCNCCNCCC2)C=CC=1CN1CCCNCCNCCCNCC1 YIQPUIGJQJDJOS-UHFFFAOYSA-N 0.000 description 1
- 229960002169 plerixafor Drugs 0.000 description 1
- 229940116406 poloxamer 184 Drugs 0.000 description 1
- 229940044519 poloxamer 188 Drugs 0.000 description 1
- 229920001987 poloxamine Polymers 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920001610 polycaprolactone Polymers 0.000 description 1
- 229920002721 polycyanoacrylate Polymers 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 229920000656 polylysine Polymers 0.000 description 1
- 229920000193 polymethacrylate Polymers 0.000 description 1
- 102000054765 polymorphisms of proteins Human genes 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 229920002503 polyoxyethylene-polyoxypropylene Polymers 0.000 description 1
- 229920006324 polyoxymethylene Polymers 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920001296 polysiloxane Polymers 0.000 description 1
- 229940068977 polysorbate 20 Drugs 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- 235000013809 polyvinylpolypyrrolidone Nutrition 0.000 description 1
- 229920000523 polyvinylpolypyrrolidone Polymers 0.000 description 1
- 230000002516 postimmunization Effects 0.000 description 1
- XAEFZNCEHLXOMS-UHFFFAOYSA-M potassium benzoate Chemical compound [K+].[O-]C(=O)C1=CC=CC=C1 XAEFZNCEHLXOMS-UHFFFAOYSA-M 0.000 description 1
- NMMVKSMGBDRONO-UHFFFAOYSA-N potassium;9-methyl-3-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)pyrido[1,2-a]pyrimidin-4-one Chemical compound [K+].CC1=CC=CN(C2=O)C1=NC=C2C1=NN=N[N-]1 NMMVKSMGBDRONO-UHFFFAOYSA-N 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 229940116317 potato starch Drugs 0.000 description 1
- 235000013613 poultry product Nutrition 0.000 description 1
- 229940069328 povidone Drugs 0.000 description 1
- 229960004583 pranlukast Drugs 0.000 description 1
- UAJUXJSXCLUTNU-UHFFFAOYSA-N pranlukast Chemical compound C=1C=C(OCCCCC=2C=CC=CC=2)C=CC=1C(=O)NC(C=1)=CC=C(C(C=2)=O)C=1OC=2C=1N=NNN=1 UAJUXJSXCLUTNU-UHFFFAOYSA-N 0.000 description 1
- 229960003101 pranoprofen Drugs 0.000 description 1
- 229960002847 prasterone Drugs 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 229960002800 prednisolone acetate Drugs 0.000 description 1
- 229960002943 prednisolone sodium phosphate Drugs 0.000 description 1
- VJZLQIPZNBPASX-OJJGEMKLSA-L prednisolone sodium phosphate Chemical compound [Na+].[Na+].O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)COP([O-])([O-])=O)[C@@H]4[C@@H]3CCC2=C1 VJZLQIPZNBPASX-OJJGEMKLSA-L 0.000 description 1
- 229960002176 prednisolone sodium succinate Drugs 0.000 description 1
- FKKAEMQFOIDZNY-CODXZCKSSA-M prednisolone sodium succinate Chemical compound [Na+].O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)COC(=O)CCC([O-])=O)[C@@H]4[C@@H]3CCC2=C1 FKKAEMQFOIDZNY-CODXZCKSSA-M 0.000 description 1
- 229960004259 prednisolone tebutate Drugs 0.000 description 1
- DGYSDXLCLKPUBR-SLPNHVECSA-N prednisolone valerate acetate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(C)=O)(OC(=O)CCCC)[C@@]1(C)C[C@@H]2O DGYSDXLCLKPUBR-SLPNHVECSA-N 0.000 description 1
- 229950008480 prednisolone valerate acetate Drugs 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 229960002789 procaterol hydrochloride Drugs 0.000 description 1
- PTXGHCGBYMQQIG-UHFFFAOYSA-N proglumetacin Chemical compound C=1C=CC=CC=1C(=O)NC(C(=O)N(CCC)CCC)CCC(=O)OCCCN(CC1)CCN1CCOC(=O)CC(C1=CC(OC)=CC=C11)=C(C)N1C(=O)C1=CC=C(Cl)C=C1 PTXGHCGBYMQQIG-UHFFFAOYSA-N 0.000 description 1
- MKFWBVKQDGNXDW-SPIKMXEPSA-N proglumetacin dimaleate Chemical compound OC(=O)\C=C/C(O)=O.OC(=O)\C=C/C(O)=O.C=1C=CC=CC=1C(=O)NC(C(=O)N(CCC)CCC)CCC(=O)OCCCN(CC1)CCN1CCOC(=O)CC(C1=CC(OC)=CC=C11)=C(C)N1C(=O)C1=CC=C(Cl)C=C1 MKFWBVKQDGNXDW-SPIKMXEPSA-N 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 229960005439 propantheline bromide Drugs 0.000 description 1
- 229960001187 propiverine hydrochloride Drugs 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 239000011251 protective drug Substances 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 229940112971 protopic Drugs 0.000 description 1
- 239000002213 purine nucleotide Substances 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 150000003222 pyridines Chemical class 0.000 description 1
- MIXMJCQRHVAJIO-TZHJZOAOSA-N qk4dys664x Chemical compound O.C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O.C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O MIXMJCQRHVAJIO-TZHJZOAOSA-N 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 239000002096 quantum dot Substances 0.000 description 1
- 150000003254 radicals Chemical class 0.000 description 1
- 229950004496 ramatroban Drugs 0.000 description 1
- VMXUWOKSQNHOCA-LCYFTJDESA-N ranitidine Chemical compound [O-][N+](=O)/C=C(/NC)NCCSCC1=CC=C(CN(C)C)O1 VMXUWOKSQNHOCA-LCYFTJDESA-N 0.000 description 1
- 229960000620 ranitidine Drugs 0.000 description 1
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 1
- 229940044601 receptor agonist Drugs 0.000 description 1
- 239000000018 receptor agonist Substances 0.000 description 1
- 229940044551 receptor antagonist Drugs 0.000 description 1
- 239000002464 receptor antagonist Substances 0.000 description 1
- 230000010837 receptor-mediated endocytosis Effects 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 229950009147 repirinast Drugs 0.000 description 1
- 229940063627 rescriptor Drugs 0.000 description 1
- 229950000915 revatropate Drugs 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 229960000329 ribavirin Drugs 0.000 description 1
- HZCAHMRRMINHDJ-DBRKOABJSA-N ribavirin Natural products O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1N=CN=C1 HZCAHMRRMINHDJ-DBRKOABJSA-N 0.000 description 1
- 238000002702 ribosome display Methods 0.000 description 1
- 229960000720 ritodrine hydrochloride Drugs 0.000 description 1
- 229960000311 ritonavir Drugs 0.000 description 1
- 229960002586 roflumilast Drugs 0.000 description 1
- MNDBXUUTURYVHR-UHFFFAOYSA-N roflumilast Chemical compound FC(F)OC1=CC=C(C(=O)NC=2C(=CN=CC=2Cl)Cl)C=C1OCC1CC1 MNDBXUUTURYVHR-UHFFFAOYSA-N 0.000 description 1
- HJORMJIFDVBMOB-UHFFFAOYSA-N rolipram Chemical compound COC1=CC=C(C2CC(=O)NC2)C=C1OC1CCCC1 HJORMJIFDVBMOB-UHFFFAOYSA-N 0.000 description 1
- 229950005741 rolipram Drugs 0.000 description 1
- 210000003935 rough endoplasmic reticulum Anatomy 0.000 description 1
- 229960005018 salmeterol xinafoate Drugs 0.000 description 1
- WVYADZUPLLSGPU-UHFFFAOYSA-N salsalate Chemical compound OC(=O)C1=CC=CC=C1OC(=O)C1=CC=CC=C1O WVYADZUPLLSGPU-UHFFFAOYSA-N 0.000 description 1
- 229960000953 salsalate Drugs 0.000 description 1
- 238000003118 sandwich ELISA Methods 0.000 description 1
- 229950009846 scopolamine butylbromide Drugs 0.000 description 1
- CDAISMWEOUEBRE-UHFFFAOYSA-N scyllo-inosotol Natural products OC1C(O)C(O)C(O)C(O)C1O CDAISMWEOUEBRE-UHFFFAOYSA-N 0.000 description 1
- 230000001932 seasonal effect Effects 0.000 description 1
- 238000010187 selection method Methods 0.000 description 1
- 239000006152 selective media Substances 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 229950000112 serrapeptase Drugs 0.000 description 1
- 108010038132 serratiopeptidase Proteins 0.000 description 1
- 238000010008 shearing Methods 0.000 description 1
- 229920000260 silastic Polymers 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 235000012239 silicon dioxide Nutrition 0.000 description 1
- 229960001866 silicon dioxide Drugs 0.000 description 1
- 229920002379 silicone rubber Polymers 0.000 description 1
- 239000004945 silicone rubber Substances 0.000 description 1
- IMOLVSPMDGCLMB-UHFFFAOYSA-N simetride Chemical compound COC1=CC(CCC)=CC=C1OCC(=O)N1CCN(C(=O)COC=2C(=CC(CCC)=CC=2)OC)CC1 IMOLVSPMDGCLMB-UHFFFAOYSA-N 0.000 description 1
- 229950007670 simetride Drugs 0.000 description 1
- 229960002930 sirolimus Drugs 0.000 description 1
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 229940083542 sodium Drugs 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- FQENQNTWSFEDLI-UHFFFAOYSA-J sodium diphosphate Chemical compound [Na+].[Na+].[Na+].[Na+].[O-]P([O-])(=O)OP([O-])([O-])=O FQENQNTWSFEDLI-UHFFFAOYSA-J 0.000 description 1
- 229940010747 sodium hyaluronate Drugs 0.000 description 1
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 1
- 239000012064 sodium phosphate buffer Substances 0.000 description 1
- 229940048086 sodium pyrophosphate Drugs 0.000 description 1
- 229960004025 sodium salicylate Drugs 0.000 description 1
- 159000000000 sodium salts Chemical class 0.000 description 1
- 239000008109 sodium starch glycolate Substances 0.000 description 1
- 229920003109 sodium starch glycolate Polymers 0.000 description 1
- 229940079832 sodium starch glycolate Drugs 0.000 description 1
- YWIVKILSMZOHHF-QJZPQSOGSA-N sodium;(2s,3s,4s,5r,6r)-6-[(2s,3r,4r,5s,6r)-3-acetamido-2-[(2s,3s,4r,5r,6r)-6-[(2r,3r,4r,5s,6r)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2- Chemical compound [Na+].CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 YWIVKILSMZOHHF-QJZPQSOGSA-N 0.000 description 1
- BGXXYHIWOXFRLF-UHFFFAOYSA-M sodium;2-(imidazol-1-ylmethyl)-4,5-dihydro-1-benzothiophene-6-carboxylate Chemical compound [Na+].C=1C=2CCC(C(=O)[O-])=CC=2SC=1CN1C=CN=C1 BGXXYHIWOXFRLF-UHFFFAOYSA-M 0.000 description 1
- RMLUKZWYIKEASN-UHFFFAOYSA-M sodium;2-amino-9-(2-hydroxyethoxymethyl)purin-6-olate Chemical compound [Na+].O=C1[N-]C(N)=NC2=C1N=CN2COCCO RMLUKZWYIKEASN-UHFFFAOYSA-M 0.000 description 1
- QIBQVFYOTMPEIP-UHFFFAOYSA-M sodium;3-[4-[(4-chlorophenyl)sulfonylamino]butyl]-6-propan-2-ylazulene-1-sulfonate Chemical compound [Na+].C=1C(S([O-])(=O)=O)=C2C=CC(C(C)C)=CC=C2C=1CCCCNS(=O)(=O)C1=CC=C(Cl)C=C1 QIBQVFYOTMPEIP-UHFFFAOYSA-M 0.000 description 1
- AGHLUVOCTHWMJV-UHFFFAOYSA-J sodium;gold(3+);2-sulfanylbutanedioate Chemical compound [Na+].[Au+3].[O-]C(=O)CC(S)C([O-])=O.[O-]C(=O)CC(S)C([O-])=O AGHLUVOCTHWMJV-UHFFFAOYSA-J 0.000 description 1
- 229960003855 solifenacin Drugs 0.000 description 1
- 235000011071 sorbitan monopalmitate Nutrition 0.000 description 1
- 239000001570 sorbitan monopalmitate Substances 0.000 description 1
- 229940031953 sorbitan monopalmitate Drugs 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 230000007480 spreading Effects 0.000 description 1
- 238000003892 spreading Methods 0.000 description 1
- 229960001203 stavudine Drugs 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 239000008174 sterile solution Substances 0.000 description 1
- 239000000021 stimulant Substances 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 229960004533 streptodornase Drugs 0.000 description 1
- BDHFUVZGWQCTTF-UHFFFAOYSA-M sulfonate Chemical compound [O-]S(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-M 0.000 description 1
- MLKXDPUZXIRXEP-MFOYZWKCSA-N sulindac Chemical compound CC1=C(CC(O)=O)C2=CC(F)=CC=C2\C1=C/C1=CC=C(S(C)=O)C=C1 MLKXDPUZXIRXEP-MFOYZWKCSA-N 0.000 description 1
- 229960000894 sulindac Drugs 0.000 description 1
- 239000002600 sunflower oil Substances 0.000 description 1
- 229960004492 suprofen Drugs 0.000 description 1
- 229940054565 sustiva Drugs 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 229940037128 systemic glucocorticoids Drugs 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 229940095064 tartrate Drugs 0.000 description 1
- 229950011558 tazanolast Drugs 0.000 description 1
- BESDYXOPYOAWRZ-UHFFFAOYSA-N temacrazine Chemical compound C12=C3C(=O)C4=CC=CC=C4N1N=NC2=CC=C3NCCCN(CC1)CCN1CCCNC1=CC=C2N=NN3C4=CC=CC=C4C(=O)C1=C32 BESDYXOPYOAWRZ-UHFFFAOYSA-N 0.000 description 1
- 229950000334 temiverine Drugs 0.000 description 1
- 229960004556 tenofovir Drugs 0.000 description 1
- 229960002871 tenoxicam Drugs 0.000 description 1
- WZWYJBNHTWCXIM-UHFFFAOYSA-N tenoxicam Chemical compound O=C1C=2SC=CC=2S(=O)(=O)N(C)C1=C(O)NC1=CC=CC=N1 WZWYJBNHTWCXIM-UHFFFAOYSA-N 0.000 description 1
- 229960005105 terbutaline sulfate Drugs 0.000 description 1
- KFVSLSTULZVNPG-UHFFFAOYSA-N terbutaline sulfate Chemical compound [O-]S([O-])(=O)=O.CC(C)(C)[NH2+]CC(O)C1=CC(O)=CC(O)=C1.CC(C)(C)[NH2+]CC(O)C1=CC(O)=CC(O)=C1 KFVSLSTULZVNPG-UHFFFAOYSA-N 0.000 description 1
- 229960000351 terfenadine Drugs 0.000 description 1
- 150000004044 tetrasaccharides Chemical class 0.000 description 1
- 235000019818 tetrasodium diphosphate Nutrition 0.000 description 1
- 239000001577 tetrasodium phosphonato phosphate Substances 0.000 description 1
- 229960000278 theophylline Drugs 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 239000003769 thromboxane A2 receptor blocking agent Substances 0.000 description 1
- 239000003768 thromboxane synthase inhibitor Substances 0.000 description 1
- HTJXMOGUGMSZOG-UHFFFAOYSA-N tiaramide Chemical compound C1CN(CCO)CCN1C(=O)CN1C(=O)SC2=CC=C(Cl)C=C21 HTJXMOGUGMSZOG-UHFFFAOYSA-N 0.000 description 1
- 229950010302 tiaramide Drugs 0.000 description 1
- PFENFDGYVLAFBR-UHFFFAOYSA-N tinoridine Chemical compound C1CC=2C(C(=O)OCC)=C(N)SC=2CN1CC1=CC=CC=C1 PFENFDGYVLAFBR-UHFFFAOYSA-N 0.000 description 1
- 229950010298 tinoridine Drugs 0.000 description 1
- 229960000257 tiotropium bromide Drugs 0.000 description 1
- 229960000838 tipranavir Drugs 0.000 description 1
- SUJUHGSWHZTSEU-FYBSXPHGSA-N tipranavir Chemical compound C([C@@]1(CCC)OC(=O)C([C@H](CC)C=2C=C(NS(=O)(=O)C=3N=CC(=CC=3)C(F)(F)F)C=CC=2)=C(O)C1)CC1=CC=CC=C1 SUJUHGSWHZTSEU-FYBSXPHGSA-N 0.000 description 1
- 230000005100 tissue tropism Effects 0.000 description 1
- YEZNLOUZAIOMLT-UHFFFAOYSA-N tolfenamic acid Chemical compound CC1=C(Cl)C=CC=C1NC1=CC=CC=C1C(O)=O YEZNLOUZAIOMLT-UHFFFAOYSA-N 0.000 description 1
- 229960002905 tolfenamic acid Drugs 0.000 description 1
- 229960002044 tolmetin sodium Drugs 0.000 description 1
- 229960003553 tolterodine tartrate Drugs 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 1
- 229960005342 tranilast Drugs 0.000 description 1
- NZHGWWWHIYHZNX-CSKARUKUSA-N tranilast Chemical compound C1=C(OC)C(OC)=CC=C1\C=C\C(=O)NC1=CC=CC=C1C(O)=O NZHGWWWHIYHZNX-CSKARUKUSA-N 0.000 description 1
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 1
- 230000037317 transdermal delivery Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- ODLHGICHYURWBS-LKONHMLTSA-N trappsol cyclo Chemical compound CC(O)COC[C@H]([C@H]([C@@H]([C@H]1O)O)O[C@H]2O[C@@H]([C@@H](O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O3)[C@H](O)[C@H]2O)COCC(O)C)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H]3O[C@@H]1COCC(C)O ODLHGICHYURWBS-LKONHMLTSA-N 0.000 description 1
- 229940126307 triamcinolone acetate Drugs 0.000 description 1
- 239000001069 triethyl citrate Substances 0.000 description 1
- VMYFZRTXGLUXMZ-UHFFFAOYSA-N triethyl citrate Natural products CCOC(=O)C(O)(C(=O)OCC)C(=O)OCC VMYFZRTXGLUXMZ-UHFFFAOYSA-N 0.000 description 1
- 235000013769 triethyl citrate Nutrition 0.000 description 1
- 239000013638 trimer Substances 0.000 description 1
- 150000004043 trisaccharides Chemical class 0.000 description 1
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 1
- 229940038773 trisodium citrate Drugs 0.000 description 1
- 229960000281 trometamol Drugs 0.000 description 1
- 229960001530 trospium chloride Drugs 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 229960000859 tulobuterol Drugs 0.000 description 1
- 229960004846 tulobuterol hydrochloride Drugs 0.000 description 1
- 229940046728 tumor necrosis factor alpha inhibitor Drugs 0.000 description 1
- 239000002452 tumor necrosis factor alpha inhibitor Substances 0.000 description 1
- 238000000539 two dimensional gel electrophoresis Methods 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 229950010121 ufenamate Drugs 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 229940023080 viracept Drugs 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 208000009421 viral pneumonia Diseases 0.000 description 1
- 210000000605 viral structure Anatomy 0.000 description 1
- 230000006490 viral transcription Effects 0.000 description 1
- 230000029302 virus maturation Effects 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 229960004764 zafirlukast Drugs 0.000 description 1
- 229950004227 zaltoprofen Drugs 0.000 description 1
- ARAIBEBZBOPLMB-UFGQHTETSA-N zanamivir Chemical compound CC(=O)N[C@@H]1[C@@H](N=C(N)N)C=C(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO ARAIBEBZBOPLMB-UFGQHTETSA-N 0.000 description 1
- 229960001028 zanamivir Drugs 0.000 description 1
- 229940087450 zerit Drugs 0.000 description 1
- 229940052255 ziagen Drugs 0.000 description 1
- HBOMLICNUCNMMY-XLPZGREQSA-N zidovudine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](N=[N+]=[N-])C1 HBOMLICNUCNMMY-XLPZGREQSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1018—Orthomyxoviridae, e.g. influenza virus
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
Definitions
- the present invention relates generally to the fields of immunology and cell biology.
- the present invention relates to isolated avian influenza antibodies, isolated cells and pharmaceutical compositions, and methods of immunizing subjects using such antibodies.
- Influenza is a seasonal epidemic disease in humans, occurring during the colder months in temperate climates and occasionally accompanied by mortality in older adults. In tropical and subtropical climates, infections occur throughout the year, often with one or two peaks of increased activity. Periodically, and at irregular intervals, severe worldwide pandemic outbreaks occur. Historical evidence suggests that pandemics have occurred at 10 to 40-year intervals since the 1600s, originating mainly in Asia. Three pandemics occurred in the past century: the Spanish influenza pandemic in 1918-1919, which claimed an estimated 50 million lives and the Asian (1957) and Hong Kong (1968-1969) pandemics, which each resulted in 1-2 million deaths.
- influenza viruses Three types have been recognized, termed types "A,” “B,” and “C” and are distinguished by their antigenically distinct nucleoprotein and matrix protein. These viruses are classified as members of the genus Orthomyxovirus in the family Orthomyxoviridae, and are named according to their type, location where isolated, the successive isolate number from that location, and year of isolation. Only influenza A and B are responsible for major outbreaks and severe disease. Influenza A and B viruses have two major surface glycoprotein antigens hemagglutinin (HA), responsible for cell attachment, and an enzymatically active neuraminidase (NA), which assists virus maturation and release.
- HA hemagglutinin
- NA enzymatically active neuraminidase
- influenza A and B undergo post-translational cleavage into two peptides, HAl and HA2.
- antigenic drift This two surface antigens of both influenza A and B undergo gradual, progressive antigenic variation, referred to as "antigenic drift", which allows the viruses to escape immunity acquired through infection or vaccination and to cause further outbreaks and epidemics.
- antigenic drift This changes can also be seen by phylogenetic analysis of the HA and NA gene sequences.
- influenza A viruses with three antigenically distinct HAs and two distinct NAs have circulated in the human population since laboratory studies commenced, and the influenza A viruses are now divided into subtypes based on their HA proteins.
- Influenza viruses have evolved in an avian host and aquatic birds are the major reservoir of influenza A viruses.
- influenza A sixteen antigenically distinct HAs and nine NAs have been recognized, all of which can be found asymptomatically circulating in aquatic birds.
- Some subtypes are capable of infecting and even becoming established in certain mammals, including horses, swine and humans, and some have been able to infect and cause disease in domestic poultry.
- Influenza viruses display host specificity, and avian viruses do not usually infect humans.
- a major determinant of this specificity is the difference in cell receptor binding requirements of the HA molecule via differing conformations of carbohydrate (N-acetylneuraminic acid) residues on cell surfaces of different species.
- carbohydrate N-acetylneuraminic acid residues on cell surfaces of different species.
- a significant change in receptor preference can occur with as little as a single amino acid mutation at the HA receptor site, and during evolution of new subtypes in humans, the binding preference for mammalian cell receptors increases with further mutations as a subtype continues to emerge.
- influenza viruses are usually non-pathogenic in their natural waterfowl hosts, two subtypes in particular, H5 and H7 may become highly pathogenic once introduced into domestic poultry.
- the transition of these subtypes to a highly pathogenic form is associated with acquisition of additional basic amino acids at the cleavage site of the HA molecule. This transforms the virus from one in which cleavage activation of the HA is restricted to the respiratory and intestinal tract, where there are trypsin-like proteases, into one that can be activated by cell-associated proteases that are found throughout the body, resulting in a generalized infection referred to as "pantropism".
- influenza A/H5N1 has developed into an epizootic of domestic poultry with associated human infections, observed first in Hong Kong in 1997, spreading throughout South-East Asia over the following 7 years, and then extending to Russia, Europe, Africa, the Indian subcontinent and the Middle East during the latter part of 2005 and early 2006. The first indication of this outbreak was a fatal human case of H5N1 infection in Hong Kong in May 1997.
- the present invention meets this need by providing novel antibodies, compositions containing such antibodies, and methods of using such antibodies.
- the present invention relates to novel isolated avian influenza antibodies, methods of using such avian influenza antibodies to diagnose or identify subjects having avian influenza or suffering from an avian influenza infection, methods of treating subjects who have an avian influenza infection, or who are suspected of having an avian influenza infection, and pharmaceutical compositions/formulations comprising such avian influenza antibodies.
- the subject matter of the present invention is particularly useful in detecting, treating, and immunizing subjects against the highly pathogenic avian influenza strain H5N1.
- the invention provides an isolated avian influenza antibody comprising a fragment crystallizable (Fc) constant region and an antigen-binding region, wherein the antigen-binding region binds one or more avian influenza viral proteins or a peptide, fragment or derivative thereof with high affinity.
- the avian influenza proteins or peptide, fragment, or derivative thereof can be derived from, for example, avian influenza strain H5N1, but is not limited to this particular strain.
- the one or more avian influenza viral proteins can comprise, for example, hemagglutinin, neuraminidase, polymerase basic protein, RNA-directed RNA polymerase, polymerase acidic protein, matrix protein 1, matrix protein 2, nucleocapsid, non-structural protein 1 , or non-structural protein 2.
- the hemagglutinin is hemagglutinin H5.
- the antibodies described by the present invention can be recombinant.
- the antibodies described by the present invention can be recombinant.
- the antibodies described by the present invention can be recombinant.
- the antibodies described by the present invention can be recombinant.
- the antibodies described by the present invention can be recombinant.
- the antibodies described by the present invention can be recombinant.
- the antibodies described by the present invention can be recombinant.
- the antibodies described by the present invention can be recombinant.
- the antibodies described by the present invention can be recomb
- Fc constant region of the antibodies of the invention comprises sequences derived from a human.
- the present invention also provides an isolated avian influenza H5N1 antibody, comprising a human fragment crystallizable region and an antigen-binding region, wherein the antigen-binding region binds avian influenza hemagglutinin H5 with high affinity.
- a pharmaceutical composition comprising the isolated antibody of the present invention is also provided, along with one or more pharmaceutically acceptable buffers, excipients, and/or diluents.
- the present invention also provides a kit for detecting the presence of avian influenza virus, viral particles, viral proteins, or viral peptides in a sample from a subject, comprising one or more detection reagents, a sample from a subject who has not been diagnosed as having avian influenza, and optionally instructions for use, wherein the detection reagents comprise isolated antibody described herein.
- the kit can comprise detection reagents such as, but not limited to, one or more aptamers, one or more oligonucleotides, or combinations thereof.
- the present invention also provides a method of diagnosing or identifying one or more subjects having an avian influenza infection, comprising contacting one or more cells from the subject with the isolated antibody of claim 1, and detecting the presence of avian influenza viral protein bound to the antibody.
- a method of treating a subject having an avian influenza infection comprising administering a therapeutically effective amount of the pharmaceutical composition of the invention to the subject, and detecting changes in the amount of avian influenza viral proteins in a sample from the subject.
- Also provided by the present invention is a method of immunizing a subject against avian influenza infection, comprising administering a prophylactically effective amount of the pharmaceutical composition described herein to the subject, and detecting changes in the amount of avian influenza viral proteins in a sample from the subject.
- Figure 1 is a Western blot detecting recombinant hemagglutinin H5 protein in pCI- HK483 transfected HEK 293 cell lysates using a commercial polyclonal anti-serum against H5 HA.
- Lane 1 corresponds to MagicMark XP ladder
- Lanes 2-5 correspond to 50 ⁇ g, 75 ⁇ g, 100 ⁇ g, and 125 ⁇ g of pCI-HK483 transfected HEK 293 cell extracts
- Lane 6 corresponds to 125 ⁇ g of untransfected HEK 293 cell extract
- Lane 7 corresponds to 30 ⁇ g of ether split A/mallard duck/Pennsylvania 10218/84 (H5N2) infected allantoic fluid.
- Figure 2 is a graph depicting the ELISA data for mouse polyclonal anti-serum following repeated hydrodynamic injection of Balb/c mice. Mouse 795 demonstrated the highest ELISA reactivity post-immunization against pCI-HK483 transfected cell extracts.
- Figures 3 A and 3B are Western blots of pCI-HK483 transfected ( Figure 3A) and untransfected ( Figure 3B) HEK 293 cell extracts using murine polyclonal anti-serum obtained following hydrodynamic immunization of Balb/c mice with pCI-HK483 plasmid.
- Lane 1 corresponds to SeeBlue Marker
- Lane 2 corresponds to cell extracts from Mouse 794
- Lane 3 corresponds to cell extracts from Mouse 795
- Lane 4 corresponds to cell extracts from Mouse 796.
- Figures 4A and 4B depict Western blotting profiles in an experiment comparing the commercial Immune Technologies H5 polyclonal antiserum (Figure 4A) and murine polyclonal anti-serum produced by the inventors using hydrodynamic injection of mice with pCI-HK483 ( Figure 4B).
- the murine polyclonal anti-serum reacts more specifically and with greater intensity than the commercial preparation. Additionally, the murine polyclonal antiserum preparation recognizes the HA 2 region of the HA protein, whereas the commercial preparation does not.
- Figures 5 A and 5B are graphs showing an ELISA screening of murine hybridomas against pCI-HK483 transfected HEK 293 whole cell extracts. The hybridoma supernatants exhibiting the greatest reactivity with the antigen preparation are shown in rank order.
- Figures 6A and 6B are graphs depicting secondary screening of hybridoma clones for reactivity with HPAI H5 hemagglutinin. The ratio of optical density (OD) readings for positive and negative antigen preparations is shown for the HPAI strain and the LPAI strain. Two hybridomas (clones 6D5-F5 and 1F7-F2) exhibited elevated reactivity with the HK483 HPAI hemagglutinin and demonstrated no cross-reactivity with the protein from the LAPI H5N2 strain.
- Figures 7A and 7B depict Western blots showing confirmation of specificity of clones
- Figure 8 are immunofluorescence micrographs showing the detection of HK483 hemagglutinin. Strong reactivity of murine polyclonal anti-serum and monoclonal antibodies 6D5-F5 and 1F7-F2 can be seen in pCI-HK483 transfected HEK 293 cells. No reactivity is noted for untransfected HEK 293 cells (top panel). Staining with Immune Tech anti-H5 polyclonal antibody and SP-2/0-Agl4 murine myeloma supernatant was included as positive and negative controls, respectively (lower panel).
- the present invention relates to isolated avian influenza antibodies, in particular avian influenza strain H5N1, that are capable of binding to an epitope of one or more avian influenza viral proteins, such as, for example, hemagglutinin H5 or neuraminidase Nl.
- the present invention also concerns cell lines and hybridomas expressing the isolated avian influenza antibodies described herein, as well as pharmaceutical compositions comprising such isolated antibodies, and methods of immunizing subjects using such isolated antibodies.
- the antibodies, compositions, cell lines, and methods provided herein can be used to therapeutically treat existing avian influenza infections occurring in subjects, or alternatively, can be used to prophylactically prevent avian influenza infections in subjects.
- an active agent or "a pharmacologically active agent” includes a single active agent as well as two or more different active agents in combination
- reference to “a carrier” includes mixtures of two or more carriers as well as a single carrier, and the like.
- antibody is meant to include polyclonal antibodies, monoclonal antibodies
- mAbs chimeric antibodies, neutralizing antibodies, anti-idiotypic (anti-Id) antibodies to antibodies that can be labeled in soluble or bound form, as well as fragments, regions or derivatives thereof, provided by any known technique, such as, but not limited to, enzymatic cleavage, peptide synthesis or recombinant techniques.
- antigen binding region refers to that portion of an antibody molecule which contains the amino acid residues that bind and interact with an antigen and confer on the antibody its specificity and affinity for the antigen.
- the antibody region includes the "framework" amino acid residues necessary to maintain the proper conformation of the antigen-binding residues.
- an "antigen” is a molecule or a portion of a molecule capable of being bound by an antibody which is additionally capable of inducing an animal to produce antibody capable of binding to an epitope of that antigen.
- An antigen can have one or more than one epitope. The specific reaction referred to above is meant to indicate that the antigen will react, in a highly selective manner, with its corresponding antibody and not with the multitude of other antibodies which can be evoked by other antigens.
- Preferred antigens that bind antibodies, fragments and regions of antibodies of the present invention include at least one, preferably two, three, four, five, six, seven, eight, nine, ten or more amino acid residues of one or more avian influenza viral proteins, such as but not limited to, hemagglutinin, neuraminidase, polymerase basic proteins, RNA-directed RNA polymerase, polymerase acidic proteins, matrix protein 1, matrix protein 2, nucleocapsid, non-structural protein 1, and non-structural protein 2.
- avian influenza viral proteins such as but not limited to, hemagglutinin, neuraminidase, polymerase basic proteins, RNA-directed RNA polymerase, polymerase acidic proteins, matrix protein 1, matrix protein 2, nucleocapsid, non-structural protein 1, and non-structural protein 2.
- epipe is meant to refer to that portion of any molecule capable of being recognized by and bound by an antibody at one or more of the antibody's antigen binding regions
- Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and have specific three dimensional structural characteristics as well as specific charge characteristics.
- An epitope can comprise the antibody binding region of any one or more avian influenza viral proteins disclosed herein (such as, for example, hemagglutinin or neuraminidase), or a metabolite thereof.
- An epitope can also comprise at least one, preferably two, three, four, five, six, seven, eight, nine, ten or more amino acid residues of avian influenza hemagglutinin H5 or neuraminidase Nl. The amino acid residues of the epitope that are recognized by the isolated antibodies of the invention need not be contiguous.
- Isolated when used to describe the various avian influenza antibodies, antibody fragments, proteins, and polypeptides disclosed herein, means polypeptide that has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials that would typically interfere with diagnostic or therapeutic uses for the polypeptide, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. Ordinarily, the isolated antibody, fragment, protein, or polypeptide will be prepared by at least one purification step.
- an "isolated” avian influenza antibody-encoding nucleic acid or other polypeptide- encoding nucleic acid is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the natural source of the polypeptide-encoding nucleic acid.
- An isolated nucleic acid molecule is other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from the corresponding nucleic acid molecule as it exists in natural cells.
- an isolated nucleic acid molecule includes nucleic acid molecules contained in cells that ordinarily express the polypeptide where, for example, the nucleic acid molecule is in a chromosomal location different from that of natural cells.
- sample in the context of the present invention is a biological sample isolated from a subject and can include, for example, serum, blood plasma, blood cells, endothelial cells, tissue biopsies or extracts or homogenates, lymphatic fluid, pancreatic juice, ascites fluid, interstitial fluid (also known as "extracellular fluid” and encompasses the fluid found in spaces between cells, including, inter alia, gingival crevicular fluid), bone marrow, sputum, saliva, tears, or urine, inflammatory exudate, cerebrospinal fluid, amniotic fluid, and the like.
- “Stringency” of hybridization reactions is readily determinable by one of ordinary skill in the art, and generally is an empirical calculation dependent upon probe length, washing temperature, and salt concentration. In general, longer probes require higher temperatures for proper annealing, while shorter probes need lower temperatures. Hybridization generally depends on the ability of denatured DNA to reanneal when complementary strands are present in an environment below their melting temperature. The higher the degree of desired homology between the probe and hybridizable sequence, the higher the relative temperature which can be used. As a result, it follows that higher relative temperatures would tend to make the reaction conditions more stringent, while lower temperatures less so. For additional details and explanation of stringency of hybridization reactions, see Ausubel et al., Current Protocols in Molecular Biology, Wiley Interscience Publishers, (1995).
- “Stringent conditions” or “high stringency conditions”, as defined herein, may be identified by those that: (1) employ low ionic strength and high temperature for washing, for example 0.015 M sodium chloride/0.0015 M sodium citrate/0.1% sodium dodecyl sulfate at 50 0 C; (2) employ during hybridization a denaturing agent, such as formamide, for example, 50% (v/v) formamide with 0.1% bovine serum albumin/0.1% Ficoll/0.1% polyvinylpyrrolidone/50 mM sodium phosphate buffer at pH 6.5 with 750 mM sodium chloride, 75 mM sodium citrate at 42°C; or (3) employ 50% formamide, 5x SSC (0.75 M NaCl, 0.075 M sodium citrate), 50 mM sodium phosphate (pH 6.8), 0.1% sodium pyrophosphate, 5x Denhardt's solution, sonicated salmon sperm DNA (50 ⁇ g/ml), 0.1% SDS, and 10% dextran sul
- Modely stringent conditions may be identified as described by Sambrook et al., Molecular Cloning: A Laboratory Manual, New York: Cold Spring Harbor Press, 1989, and include the use of washing solution and hybridization conditions (e.g., temperature, ionic strength and %SDS) less stringent that those described above.
- washing solution and hybridization conditions e.g., temperature, ionic strength and %SDS
- moderately stringent conditions is overnight incubation at 37°C in a solution comprising: 20% formamide, 5x SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5x Denhardt's solution, 10% dextran sulfate, and 20 mg/ml denatured sheared salmon sperm DNA, followed by washing the filters in Ix SSC at about 37-50°C.
- 5x SSC 150 mM NaCl, 15 mM trisodium citrate
- 50 mM sodium phosphate pH 7.6
- 5x Denhardt's solution 10% dextran sulfate
- 20 mg/ml denatured sheared salmon sperm DNA followed by washing the filters in Ix SSC at about 37-50°C.
- the skilled artisan will recognize how to adjust the temperature, ionic strength, etc. as necessary to accommodate factors such as probe length and the like.
- a "subject" in the context of the present invention is preferably a mammal.
- the mammal can be a human, non-human primate, mouse, rat, dog, cat, horse, pig, bird, or cow, but are not limited to these examples.
- a subject can be male or female.
- Influenza virus is shed into respiratory secretions, which are then coughed or sneezed into the air and transmitted to the next host. Infection occurs in the cells of the tracheobronchial epithelium, where the first cycle of replication takes 4-6 hours. Very high titres of virus are shed during the initial infection period. This, combined with the short incubation period, produces the characteristically explosive nature of influenza outbreaks. Estimates of attack rates in outbreaks vary from 10% to nearly 100%, depending on the type of community, age of individuals, vaccination rates and methods of diagnosis.
- Influenza infection ranges in severity from asymptomatic infection to serious illness with systemic features.
- the potential sequelae of influenza infection include viral and bacterial pneumonia and contribute to the overall burden of the disease.
- Acute infection is characterized by abrupt onset of symptoms that include fever (in the region of 38-40 0 C) or feverishness, chills, cough, headache, myalgia, sore throat, malaise, anorexia and many other non-specific symptoms.
- the total extent of sites of influenza replication is heretofore unknown. Although the disease is associated with many systemic symptoms, it appears unlikely that the virus replicates to any great extent outside the respiratory tract in uncomplicated infections. Induction of inflammatory cytokines has been cited as a potential explanation of the systemic features of influenza infection.
- influenza A viruses Infection of peripheral blood leukocytes with a variety of virulent and avirulent influenza viruses resulted in the production of inflammatory cytokines including interleukin-l ⁇ , interleukin-6, interferon- ⁇ , and macrophage inflammatory protein- lot.
- the structures of influenza A viruses are quite similar. By electron microscopy, the viruses are pleomorphic, including virions that are roughly spherical (approximately 120 nm in diameter) and filamentous. Two distinct types of spikes (approximately 16 nm in length), corresponding to the hemagglutinin (HA) and neuraminidase (NA) molecules, reside on the surface of the virions.
- HA hemagglutinin
- NA neuraminidase
- the HA spike appears rod shaped and protrudes from the envelope as a trimer; the NA spike is a mushroom-shaped tetramer.
- These two glycoproteins are anchored to the lipid envelope derived from the plasma membrane of host cells by short sequences of hydrophobic amino acids (transmembrane region).
- HA is a type I glycoprotein (containing an N-terminal ectodomain and a C-terminal anchor), while NA is a type II glycoprotein (containing an N-proximal anchor and a C-terminal ectodomain).
- HA enables the virion to attach to cell surface sialyloligosaccharides and is responsible for its hemagglutinating activity.
- HA elicits virus-neutralizing antibodies that are important in protection against infection.
- NA is a sialidase that prevents virion aggregation by removing cell and virion surface sialic acid (the primary moiety in sialyloligosaccharides recognized by HA).
- Antibodies to NA are also important in protecting hosts.
- M2 proteins are integrated into the virions. They form tetramers, have Hl ion channel activity, and, when activated by the low pH in endosomes, acidify the inside of the virion, facilitating its uncoating. Ml protein that lies within the envelope is thought to function in assembly and budding.
- RNA molecules (negative sense, or complementary to mRNA) are contained within the viral envelope, in association with NP and three subunits of viral polymerase (PB 1 , PB2, and PA), which together form a ribonucleoprotein (RNP) complex that participates in RNA replication and transcription.
- RNP ribonucleoprotein
- NS2 protein now known to exist in virions, is thought to play a role in the export of RNP from the nucleus through interaction with Ml protein.
- NSl protein the only nonstructural protein of influenza A viruses, has multiple functions, including regulation of splicing and nuclear export of cellular mRNAs as well as stimulation of translation. Its major function seems to be to counteract the interferon activity of the host, since an NS 1 knockout virus was viable although it grew less efficiently than the parent virus in interferon non- defective cells.
- the virus After binding to sialic acid-containing receptors on the membrane surface, the virus enters the cell by receptor-mediated endocytosis.
- a low pH in the endosome induces a conformational change in HA, resulting in membrane fusion between the viral envelope and the endosomal membrane.
- the M2 proton channel exposes the viral core to low pH, resulting in dissociation of Ml from RNP and leading to a release of RNP to the cytoplasm.
- RNP is then transported to the nucleus, most probably by nuclear localization signals in proteins composed of the RNP complex PBl, PB2, and NP.
- RNA transcription The mechanism of viral RNA transcription is unique.
- the 5' cap from cellular mRNAs is cleaved by a viral endonucleases and used as a primer for transcription by the viral transcriptase.
- Six of eight RNA segments are transcribed into mRNAs in a monocistronic manner and translated into HA, NA, NP, PBl, PB2, and PA.
- two RNA segments are each transcribed to two mRNAs by splicing.
- these mRNAs are translated in different reading frames, generating Ml and M2 proteins and NSl and NS2 proteins, respectively.
- Ml, HA, and NA are glycosylated in the rough endoplasmic reticulum, further processed in the Golgi apparatus, and then transported to the cell surface, where they integrate into the cell membrane.
- Nuclear localization of Ml and NS2 proteins is essential for the migration of RNP out of the nucleus for assembly into progeny viral particles in the cytoplasm.
- the RNP- Ml complex presumably interacts with Ml proteins that are associated with the plasma membrane and then buds outward through the cell membrane, enclosing itself within a bubble of membrane (envelope) studded with both the HA and NA glycoproteins.
- HA plays a critical role in the pathogenesis of influenza.
- HA is one of the two major antigenic determinants that are recognized by the host's neutralizing antibodies and its susceptibility to cleavage by host protease determines the range of tissues in which the virus can replicate.
- HA is a 550 amino acid polypeptide that forms homotrimers (spikes) on the exterior of the influenza virus particle. The nascent HA is directed to the cell membrane in an infected host cell and is anchored to the cell membrane by a short transmembrane region at the C-terminus. In this form, HA is referred to as HA 0 and has not yet undergone the final modification that allows it to acquire full biological activity.
- This final step involves proteolytic cleavage of a specific region by host enzymes, resulting in two subunits, HAi and HA 2 , which are linked by a disulfide bridge.
- the cleavage of HA 0 occurs close to the point of insertion of HA into the viral membrane.
- the nascent HA is also subject to extensive post- translational glycosylation, which may also act as a mechanism for immune evasion.
- the HAs of avirulent avian influenza viruses are usually cleaved only in a limited number of cell types, so that the viruses cause only localized infections in the respiratory or intestinal tract, or both, resulting in mild or asymptomatic infections.
- the HAs of virulent avian viruses are cleaved in a broad range of different host cells and therefore are capable of causing lethal systemic infection in poultry and in humans.
- tissue culture the HAs of virulent viruses are cleaved in the absence of exogenous proteases, such as trypsin, whereas those of avirulent viruses are not, indicating a difference in sensitivity of the two HAs to endogenous cellular proteases.
- the present invention provides antibodies, antibody fragments, and antibody derivatives directed to avian influenza A viruses, such as the HPAI strain H5N1 , but also encompasses any influenza A strain, such as but not limited to subtypes HlONl, H10N2, H10N3, H10N4, H10N5, H10N6, H10N7, H10N8, H10N9, HI lNl, H1 1N2, H11N3, H11N4, Hl 1N5, Hl 1N6, Hl 1N7, Hl 1N8, Hl 1N9, H12N1, H12N2, H12N4, H12N5, H12N6, H12N8, H12N9, H13N2, H13N3, H13N6, H13N9, H14N5, H14N6, H15N2, H15N6, H15N8, H15N9, H16N3, HlNl, H1N2, H1N3, H1N5, H1N6, H1N8, H1N9, H2N1 , H2N
- the present invention provides avian influenza antibodies (such as, for example, avian influenza strain H5N1 antibodies) that are capable of binding to one or more avian influenza viral proteins, and preferably, antibodies that are capable of binding to one or more amino acids of avian influenza hemagglutinin H5.
- antibody as used in the context of the present invention includes polyclonal antibodies, monoclonal antibodies (mAbs), chimeric antibodies, neutralizing antibodies, anti-idiotypic (anti-Id) antibodies, that can be labeled in soluble or bound form, as well as fragments, regions, or derivatives thereof, provided by any known technique, such as, but not limited to, enzymatic cleavage, peptide synthesis, or recombinant techniques.
- Antibody fragments comprise a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody.
- antibody fragments include Fab, Fab', F(ab') 2 , and Fv fragments; diabodies; linear antibodies (Zapata et al., Protein Eng. 8(10): 1057-1062 (1995); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
- Papain digestion of antibodies produces two identical antigen-binding regions or fragments, called “Fab” fragments, each with a single antigen- binding site, and a residual "Fc” or "fragment crystallizable constant region” fragment, a designation reflecting the ability to crystallize readily.
- the fragment crystallizable constant region is derived from a human, but can be derived from other species, such as, for example, mouse, rat, rabbit, goat, or monkey.
- Pepsin treatment yields an F(ab') 2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen.
- the antigen-binding fragments/regions bind to one or more avian influenza viral proteins, such as, for example, hemagglutinin H5.
- Fv is the minimun antibody fragment which contains a complete antigen- recognition and -binding site. This region consists of a dimer of one heavy- and one light- chain variable domain in tight, non-covalent association. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the V H -V L dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
- the Fab fragment also contains the constant domain of the light chain and the first constant domain (CHl) of the heavy chain.
- Fab fragments differ from Fab' fragments by the addition of a few residues at the carboxy terminus of the heavy chain CHl domain including one or more cysteines from the antibody hinge region.
- Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
- F(ab') 2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
- immunoglobulins The "light chains" of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa (K) and lambda ( ⁇ ), based on the amino acid sequences of their constant domains. Depending on the amino acid sequence of the constant domain of their heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgGl, IgG2, IgG3, IgG4, IgA, and IgA2.
- Single-chain Fv or “sFv” antibody fragments comprise the V H and V L domains of antibody, wherein these domains are present in a single polypeptide chain.
- the Fv polypeptide further comprises a polypeptide linker between the V H and V L domains which enables the sFv to form the desired structure for antigen binding.
- diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (V H ) connected to a light- chain variable domain (VL) in the same polypeptide chain (V H -V L ).
- V H heavy-chain variable domain
- VL light- chain variable domain
- the domains are forced to pair with the complementary domains of another chain and create two antigen- binding sites.
- Diabodies are described more fully in, for example, EP 404,097; WO 93/11 161 ; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
- Isolated antibody is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes. Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
- Polyclonal antibodies are heterogeneous populations of antibody molecules derived from the sera of animals immunized with an antigen.
- a monoclonal antibody contains a substantially homogeneous population of antibodies specific to antigens, which population contains substantially similar epitope binding sites.
- MAbs may be obtained by methods known to those skilled in the art. See, for example Kohler and Milstein, Nature 256:495-497 (1975); U.S. Pat. No. 4,376,1 10; Ausubel et al., eds., Current Protocols in Molecular Biology, Greene Publishing Assoc, and Wiley Interscience, N. Y., (1987, 1992); and Harlow and Lane, ANTIBODIES.
- Such antibodies may be of any immunoglobulin class including IgG, IgM, IgE, IgA, GILD and any subclass thereof.
- a hybridoma producing a mAb of the present invention may be cultivated in vitro, in situ or in vivo. Production of high titers of mAbs in vivo or in situ makes this a preferred method of production.
- the present invention also concerns hybridomas and cell lines expressing the avian influenza antibodies described herein.
- Chimeric antibodies are molecules different portions of which are derived from different animal species, such as those having variable region derived from a murine mAb and a human immunoglobulin constant region, which are primarily used to reduce immunogenicity in application and to increase yields in production, for example, where murine mAbs have higher yields from hybridomas but higher immunogenicity in humans, such that human/murine chimeric mAbs are used.
- Chimeric antibodies and methods for their production are known in the art (Cabilly et al., Proc. Natl. Acad. Sci. USA 81:3273-3277 (1984); Morrison et al., Proc. Natl. Acad. Sci.
- neutralizing antibody refers to an antibody that can inhibit an avian influenza infection by about 20-100%, preferably by at least about 10, 20, 30, 40, 50, 55, 60, 65, 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100% or more depending on the assay.
- the capacity of an avian influenza neutralizing antibody to inhibit an avian influenza infection As preferably assessed by at least one suitable assay, as described herein and/or as known in the art.
- An anti-idiotypic (anti-Id) antibody is an antibody which recognizes unique determinants generally associated with the antigen-binding site of an antibody.
- An Id antibody can be prepared by immunizing an animal of the same species and genetic type (e.g., mouse strain) as the source of the mAb with the mAb to which an anti-Id is being prepared. The immunized animal will recognize and respond to the idiotypic determinants of the immunizing antibody by producing an antibody to these idiotypic determinants (the anti-Id antibody). See, for example, U.S. Pat. No. 4,699,880, which is herein entirely incorporated by reference.
- the anti-Id antibody may also be used as an "immunogen" to induce an immune response in yet another animal, producing a so-called anti-anti-Id antibody.
- the anti-anti-Id may be epitopically identical to the original mAb which induced the anti-Id.
- antibodies to the idiotypic determinants of a mAb it is possible to identify other clones expressing antibodies of identical specificity.
- Antibodies of the present invention can include at least one of a heavy chain constant region (H c ), a heavy chain variable region (H v ), a light chain variable region (L v ) and a light chain constant region (L c ), wherein a polyclonal Ab, monoclonal Ab, fragment and/or regions thereof include at least one heavy chain variable region (H v ) or light chain variable region (Ly) which binds a portion of an avian influenza viral protein, such as, for example, hemagglutinin H5 or neuraminidase Nl.
- H c heavy chain constant region
- H v heavy chain variable region
- L v light chain variable region
- L c light chain constant region
- antibodies of the present invention to small peptide sequences that recognize and bind to those sequences in the free or conjugated form or when presented as a native sequence in the context of a large protein are well known in the art.
- Such antibodies include murine, murine-human and human-human antibodies produced by hybridoma or recombinant techniques known in the art.
- antigen binding region refers to that portion of an antibody molecule which contains the amino acid residues that interact with an antigen and confer on the antibody its specificity and affinity for the antigen.
- the antibody region includes the "framework" amino acid residues necessary to maintain the proper conformation of the antigen-binding residues.
- chimeric antibody includes monovalent, divalent or polyvalent antibodies.
- a monovalent chimeric antibody is a dimer (HL) formed by a chimeric H chain associated through disulfide bridges with a chimeric L chain.
- a divalent chimeric antibody is tetramer (H 2 L 2 ) formed by two HL dimers associated through at least one disulfide bridge.
- a polyvalent chimeric antibody can also be produced, for example, by employing a C H region that aggregates (e.g., from an IgM H chain, or ⁇ chain).
- Murine and chimeric antibodies, fragments and regions of the present invention comprise individual heavy (H) and/or light (L) immunoglobulin chains.
- a chimeric H chain comprises an antigen binding region derived from the H chain of a non-human antibody specific for one or more avian influenza viral proteins or preferably, avian influenza hemagglutinin H5 or neuraminidase Nl, which is linked to at least a portion of a human H chain C region (C H ), such as CHi or CH 2 .
- C H human H chain C region
- a chimeric L chain according to the present invention comprises an antigen binding region derived from the L chain of a non-human antibody specific for one or more avian influenza viral proteins or preferably, avian influenza hemagglutinin H5 or neuraminidase 1, linked to at least a portion of a human L chain C region (C L ).
- Antibodies, fragments or derivatives having chimeric H chains and L chains of the same or different variable region binding specificity can also be prepared by appropriate association of the individual polypeptide chains, according to known method steps, e.g., according to Ausubel, Harlow, and Colligan, the contents of which references are incorporated entirely herein by reference.
- hosts expressing chimeric H chains (or their derivatives) are separately cultured from hosts expressing chimeric L chains (or their derivatives), and the antibody chains are separately recovered and then associated.
- the hosts can be co- cultured and the chains allowed to associate spontaneously in the culture medium, followed by recovery of the assembled antibody, fragment or derivative.
- the hybrid cells are formed by the fusion of an anti-avian influenza viral protein- producing cell, or in particular, anti -hemagglutinin H5 or anti-neuraminidase Nl antibody- producing cell, typically a spleen cell of an animal immunized against either natural or recombinant avian influenza viral proteins, or a peptide fragment of any one or more avian influenza viral proteins.
- the non-human antibody-producing cell can be a B lymphocyte obtained from the blood, spleen, lymph nodes or other tissue of an animal immunized with one or more avian influenza viral proteins, or the full or partial amino acid sequence of one or more avian influenza viral proteins, such as, but not limited to, hemagglutinin H5 or neuraminidase Nl .
- the second fusion partner which provides the immortalizing function, can be a lymphoblastoid cell or a plasmacytoma or myeloma cell, which is not itself an antibody producing cell, but is malignant.
- Preferred fusion partner cells include the hybridoma SP2/0- AgH, abbreviated as SP2/0 (ATCC CRL1581) and the myeloma P3X63Ag8 (ATCC TIB9), or its derivatives.
- Hybridomas can also be produced by fusing other suitable immortal cell line (e.g., a myeloma cell line such as, but not limited to, NSO, NSl, NS2, AEl, L.5, >243, Sp2 SA3, Sp2 MAI, Sp2 SSl, Sp2 SA5, U937, MLA 144, ACT IV, M0LT4, DA-I, JURKAT, WEHI, K-562, COS, RAJI, NIH 3T3, HL-60, MLA 144, NAMAIWA, NEURO 2A, or the like, or heteromyelomas, fusion products thereof, or any cell or fusion cell derived therefrom, or any other suitable cell line as known in the art, with cells, such as, but not limited to, isolated or cloned spleen cells, or any other cells expressing heavy or light chain constant or variable or framework or CDR sequences, either as endogenous or heterologous nucleic acid, as recombinant or end
- Antibody producing cells can be obtained from the peripheral blood or, preferably the spleen or lymph nodes, of humans or other suitable animals that have been immunized with the antigen of interest. Any other suitable host cell can also be used for expressing heterologous or endogenous nucleic acid encoding an Ig derived protein, specified fragment or variant thereof, of the present invention.
- the fused cells (hybridomas) or recombinant cells can be isolated using selective culture conditions or other suitable known methods, and cloned by limiting dilution or cell sorting, or other known methods. Cells which produce Ig derived proteins with the desired specificity can be selected by a suitable assay (e.g., ELISA).
- the antibody-producing cell contributing the nucleotide sequences encoding the antigen-binding region of the avian influenza antibodies of the present invention can also be produced by transformation of a non-human, such as a primate, or a human cell.
- a B lymphocyte which produces an antibody of the invention can be infected and transformed with a virus such as Epstein-Barr virus to yield an immortal antibody producing cell (Kozbor et al., Immunol. Today 4:72-79 (1983)).
- the B lymphocyte can be transformed by providing a transforming gene or transforming gene product, as is well-known in the art. See, e.g, Ausubel infra, Harlow infra, and Colligan infra, the contents of which references are incorporated entirely herein by reference.
- Monoclonal antibodies obtained by cell fusions and hybridomas are accomplished by standard procedures well known to those skilled in the field of immunology. Fusion partner cell lines and methods for fusing and selecting hybridomas and screening for mAbs are well known in the art. See, e.g, Ausubel, Harlow, and Colligan, the contents of which are incorporated entirely herein by reference.
- the mAbs of the present invention can be produced in large quantities by injecting hybridoma or transfectoma cells secreting the antibody into the peritoneal cavity of mice and, after appropriate time, harvesting the ascites fluid which contains a high titer of the mAb, and isolating the mAb therefrom.
- hybridoma cells are preferably grown in irradiated or athymic nude mice.
- the antibodies can be produced by culturing hybridoma or transfectoma cells in vitro and isolating secreted mAb from the cell culture medium or recombinantly, in eukaryotic or prokaryotic cells.
- Suitable methods of producing or isolating antibodies of the requisite specificity can be used, including, but not limited to, methods that select recombinant antibody from a peptide or protein library (e.g., but not limited to, a bacteriophage, ribosome, oligonucleotide, RNA, cDNA, or the like, display library; e.g., as available from Cambridge antibody Technologies, Cambridgeshire, UK; MorphoSys, Martinsreid/Planegg, Del.; Biovation, Aberdeen, Scotland, UK; Biolnvent, Lund, Sweden; Dyax Corp., Enzon, Affymax/Biosite; Xoma, Berkeley, Calif; Ixsys.
- a peptide or protein library e.g., but not limited to, a bacteriophage, ribosome, oligonucleotide, RNA, cDNA, or the like, display library; e.g., as available from Cambridge antibody Technologies, Cambridgeshire
- ribosome display Hanes et al., Proc. Natl. Acad. Sci. USA, 94:4937-4942 (May 1997); Hanes et al., Proc. Natl. Acad. Sci. USA, 95:14130-14135 (November 1998)); single cell antibody producing technologies (e.g., selected lymphocyte antibody method ("SLAM”) (U.S. Pat. No. 5,627,052, Wen et al., J. Immunol.
- SAM selected lymphocyte antibody method
- the invention also provides for "derivatives" of the murine or chimeric antibodies, fragments, regions or derivatives thereof, which term includes those proteins encoded by truncated or modified genes to yield molecular species functionally resembling the antibody fragments.
- the modifications include, but are not limited to, addition of genetic sequences coding for cytotoxic proteins such as plant and bacterial toxins.
- the fragments and derivatives can be produced from any of the hosts of this invention.
- antibodies, fragments and regions can be bound to cytotoxic proteins or compounds in vitro, to provide cytotoxic antibodies which would selectively kill cells expressing one or more avian influenza viral proteins.
- Fragments include, for example, Fab, Fab', F(ab') 2 and Fv. These fragments lack the Fc fragment of intact antibody, clear more rapidly from the circulation, and can have less non-specific tissue binding than an intact antibody (Wahl et al., J. Nucl. Med. 24:316-325 (1983)). These fragments are produced from intact antibodies using methods well known in the art, for example by proteolytic cleavage with enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab') 2 fragments).
- Recombinant murine or chimeric murine-human or human-human antibodies that bind an epitope included in the amino acid sequences of one or more avian influenza viral proteins can be provided according to the present invention using known techniques based on the teaching provided herein. See, e.g., Ausubel et al., eds. Current Protocols in Molecular Biology, Wiley Interscience, N. Y. (1987, 1992, 1993); and Sambrook et al. Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press (1989), the entire contents of which are incorporated herein by reference.
- the DNA encoding an antibody of the present invention can be genomic DNA or cDNA which encodes at least one of the heavy chain constant region (H c ), the heavy chain variable region (H v ), the light chain variable region (L v ) and the light chain constant regions (L c ).
- a convenient alternative to the use of chromosomal gene fragments as the source of DNA encoding the murine V region antigen-binding segment is the use of cDNA for the construction of chimeric immunoglobulin or antibody genes, e.g., as reported by Liu et al. (Proc. Natl. Acad. ScL, USA 84:3439 (1987) and J. Immunology 139:3521 (1987), which references are hereby entirely incorporated herein by reference.
- cDNA requires that gene expression elements appropriate for the host cell be combined with the gene in order to achieve synthesis of the desired protein.
- the use of cDNA sequences is advantageous over genomic sequences (which contain introns), in that cDNA sequences can be expressed in bacteria or other hosts which lack appropriate RNA splicing systems.
- a cDNA encoding a murine V region antigen-binding segment capable of binding to one or more avian influenza viral proteins, for example, hemagglutinin H5 or neuraminidase N 1 can be provided using known methods.
- Probes that bind a portion of a DNA sequence encoding the antibodies of the present invention can be used to isolate DNA from hybridomas expressing antibodies, fragments or regions, as presented herein, according to the present invention, by known methods.
- Oligonucleotides representing a portion of the variable region are useful for screening for the presence of homologous genes and for the cloning of such genes encoding variable or constant regions of antibodies according to the invention.
- Such probes preferably bind to portions of sequences which encode light chain or heavy chain variable regions which bind an epitope of one or more avian influenza viral proteins, especially an epitope of at least 5 amino acids of hemagglutinin H5 or neuraminidase Nl .
- Such techniques for synthesizing such oligonucleotides are well known and disclosed by, for example, Wu, et al., Prog. Nucl. Acid. Res. Molec. Biol. 21 :101-141 (1978), and Ausubel et al., eds. Current Protocols in Molecular Biology, Wiley Interscience (1987, 1993), the entire contents of which are herein incorporated by reference.
- the genetic code is degenerate, more than one codon can be used to encode a particular amino acid (Watson, et al.).
- one or more different oligonucleotides can be identified, each of which would be capable of encoding the amino acid.
- the probability that a particular oligonucleotide will, in fact, constitute the actual XXX- encoding sequence can be estimated by considering abnormal base pairing relationships and the frequency with which a particular codon is actually used (to encode a particular amino acid) in eukaryotic or prokaryotic cells expressing an antibody of the invention or a fragment thereof.
- Such "codon usage rules" are disclosed by Lathe, et al., J. Molec. Biol.
- amino acid sequence can be encoded by only a single oligonucleotide
- amino acid sequence can be encoded by any of a set of similar oligonucleotides.
- all of the members of this set contain oligonucleotides which are capable of encoding the peptide fragment and, thus, potentially contain the same oligonucleotide sequence as the gene which encodes the peptide fragment
- only one member of the set contains the nucleotide sequence that is identical to the nucleotide sequence of the gene.
- this member is present within the set, and is capable of hybridizing to DNA even in the presence of the other members of the set, it is possible to employ the unfractionated set of oligonucleotides in the same manner in which one would employ a single oligonucleotide to clone the gene that encodes the protein.
- the oligonucleotide, or set of oligonucleotides, containing the theoretical "most probable" sequence capable of encoding an antibody of the present invention or fragment including a variable or constant region is used to identify the sequence of a complementary oligonucleotide or set of oligonucleotides which is capable of hybridizing to the "most probable" sequence, or set of sequences.
- An oligonucleotide containing such a complementary sequence can be employed as a probe to identify and isolate the variable or constant region gene (Sambrook et al., infra).
- a suitable oligonucleotide, or set of oligonucleotides, which is capable of encoding a fragment of the variable or constant region (or which is complementary to such an oligonucleotide, or set of oligonucleotides) is identified (using the above-described procedure), synthesized, and hybridized by means well known in the art, against a DNA or, more preferably, a cDNA preparation derived from cells which are capable of expressing antibodies or variable or constant regions thereof.
- Single stranded oligonucleotide molecules complementary to the "most probable" variable or constant anti-avian influenza viral protein region peptide coding sequences can be synthesized using procedures which are well known to those of ordinary skill in the art (Belagaje, et al., J. Biol. Chem. 254:5765-5780 (1979); Maniatis, et al., In: Molecular Mechanisms in the Control of Gene Expression, Nierlich, et al., Eds., Acad. Press, NY (1976); Wu, et al., Prog. Nucl. Acid Res. Molec. Biol. 21 : 101-141 (1978); Khorana, Science 203:614-625 (1979)).
- DNA synthesis can be achieved through the use of automated synthesizers. Techniques of nucleic acid hybridization are disclosed by Sambrook et al. (infra), and by Hayrnes, et al. (In: Nucleic Acid Hybridization, A Practical Approach, IRL Press, Washington, DC (1985)), which references are herein incorporated by reference.
- a library of expression vectors is prepared by cloning DNA or, more preferably, cDNA (from a cell capable of expressing an antibody or variable or constant region) into an expression vector.
- the library can then be screened for members capable of expressing a protein which competitively inhibits the binding of an antibody, and which has a nucleotide sequence that is capable of encoding polypeptides that have the same amino acid sequence as the antibodies of the present invention or fragments thereof.
- DNA, or more preferably cDNA is extracted and purified from a cell which is capable of expressing an antibody or fragment.
- the purified cDNA is fragmented (by shearing, endonuclease digestion, etc.) to produce a pool of DNA or cDNA fragments.
- DNA or cDNA fragments from this pool are then cloned into an expression vector in order to produce a genomic library of expression vectors whose members each contain a unique cloned DNA or cDNA fragment such as in a lambda phage library, expression in prokaryotic cell (e.g., bacteria) or eukaryotic cells, (e.g., mammalian, yeast, insect or, fungus). See, e.g., Ausubel, Harlow, Colligan; Nyyssonen et al.
- nucleic acid encoding such variable or constant regions
- the nucleic acid can be appropriately expressed in a host cell, along with other constant or variable heavy or light chain encoding nucleic acid.
- Such antibodies preferably include a murine or human variable region which contains a framework residue having complementarity determining residues which are responsible for antigen binding.
- variable light or heavy chain encoded by a nucleic acid as described above binds an epitope of at least 5 amino acids included in one or more avian influenza viral proteins, such as for example hemagglutinin H5 or neuraminidase Nl .
- Human genes which encode the constant (C) regions of the murine and chimeric antibodies, fragments and regions of the present invention can be derived from a human fetal liver library, by known methods.
- Human C regions genes can be derived from any human cell including those which express and produce human immunoglobulins or human antibodies.
- the human C H region can be derived from any of the known classes or isotypes of human H chains, including ⁇ , ⁇ , ⁇ , ⁇ or ⁇ , and subtypes thereof, such as Gl, G2, G3 and G4. Since the H chain isotype is responsible for the various effector functions of an antibody, the choice of C H region will be guided by the desired effector functions, such as complement fixation, or activity in antibody-dependent cellular cytotoxicity (ADCC).
- ADCC antibody-dependent cellular cytotoxicity
- the C H region is derived from gamma 1 (IgGl), gamma 3 (IgG3), gamma 4 (IgG4), or ⁇ (IgM).
- the human C L region can be derived from either human L chain isotype, kappa or lambda.
- Human immunoglobulin C regions are obtained from human cells by standard cloning techniques (Sambrook, et al. (Molecular Cloning: A Laboratory Manual, 2nd Edition, Cold Spring Harbor Press, Cold Spring Harbor, N. Y. (1989) and Ausubel et al., eds. Current Protocols in Molecular Biology (1987-1993)).
- Human C region genes are readily available from known clones containing genes representing the two classes of L chains, the five classes of H chains and subclasses thereof.
- Chimeric antibody fragments, such as F(ab') 2 and Fab can be prepared by designing a chimeric H chain gene which is appropriately truncated.
- a chimeric gene encoding an H chain portion of an F(ab') 2 fragment would include DNA sequences encoding the CHi domain and hinge region of the H chain, followed by a translational stop codon to yield the truncated molecule.
- the murine, human or murine and chimeric antibodies, fragments and regions of the present invention are produced by cloning DNA segments encoding the H and L chain antigen-binding regions of an antibody, and joining these DNA segments to DNA segments encoding C H and C L regions, respectively, to produce antibody-encoding genes.
- a fused chimeric gene can be created which comprises a first DNA segment that encodes at least the antigen-binding region of non-human origin, such as a functionally rearranged V region with joining (J) segment, linked to a second DNA segment encoding at least a part of a human C region.
- cDNA encoding the antibody V and C regions the method of producing the chimeric antibody according to the present invention involves several steps, involving isolation of messenger RNA (mRNA) from the cell line producing an antibody of the invention and from optional additional antibodies supplying heavy and light constant regions; cloning and cDNA production therefrom; preparation of a full length cDNA library from purified mRNA from which the appropriate V and/or C region gene segments of the L and H chain genes can be identified with appropriate probes, sequenced, and made compatible with a C or V gene segment from another antibody for a chimeric antibody; constructing complete H or L chain coding sequences by linkage of the cloned specific V region gene segments to cloned C region gene; expressing and producing L and H chains in selected hosts, including prokaryotic and eukaryotic cells to provide murine-murine, human- murine, human-human or human murine antibodies.
- mRNA messenger RNA
- H and L chain J regions have different sequences, but a high degree of sequence homology exists (greater than 80%) among each group, especially near the C region. This homology is exploited in this method and consensus sequences of H and L chain J regions can be used to design oligonucleotides for use as primers for introducing useful restriction sites into the J region for subsequent linkage of V region segments to human C region segments.
- C region cDNA vectors prepared from human cells can be modified by site-directed mutagenesis to place a restriction site at the analogous position in the human sequence.
- C.sub.k complete human kappa chain C
- C ⁇ i complete human gamma- 1 C region
- the alternative method based upon genomic C region clones as the source for C region vectors would not allow these genes to be expressed in bacterial systems where enzymes needed to remove intervening sequences are absent.
- Cloned V region segments are excised and ligated to L or H chain C region vectors.
- the human C ⁇ i region can be modified by introducing a termination codon thereby generating a gene sequence which encodes the H chain portion of an Fab molecule.
- the coding sequences with linked V and C regions are then transferred into appropriate expression vehicles for expression in appropriate hosts, prokaryotic or eukaryotic.
- Two coding DNA sequences are said to be "operably linked” if the linkage results in a continuously translatable sequence without alteration or interruption of the triplet reading frame.
- a DNA coding sequence is operably linked to a gene expression element if the linkage results in the proper function of that gene expression element to result in expression of the coding sequence.
- Expression vehicles include plasmids or other vectors, which are used for carrying a functionally complete human C H or CL chain sequence having appropriate restriction sites engineered so that any V H or V L chain sequence with appropriate cohesive ends can be easily inserted therein.
- Human C H or C L chain sequence-containing vehicles thus serve as intermediates for the expression of any desired complete H or L chain in any appropriate host.
- a chimeric antibody such as a mouse-human or human-human, will typically be synthesized from genes driven by the chromosomal gene promoters native to the mouse H and L chain V regions used in the constructs; splicing usually occurs between the splice donor site in the mouse J region and the splice acceptor site preceding the human C region and also at the splice regions that occur within the human C region; polyadenylation and transcription termination occur at native chromosomal sites downstream of the human coding regions.
- a nucleic acid sequence encoding at least one antibody or Ab fragment of the present invention may be recombined with vector DNA in accordance with conventional techniques, including blunt-ended or staggered-ended termini for ligation, restriction enzyme digestion to provide appropriate termini, filling in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and ligation with appropriate ligases. Techniques for such manipulations are disclosed, e.g., by Ausubel, infra, Sambrook, infra, entirely incorporated herein by reference, and are well known in the art.
- a nucleic acid molecule such as DNA, is said to be "capable of expressing" a polypeptide if it contains nucleotide sequences which contain transcriptional and translational regulatory information and such sequences are “operably linked” to nucleotide sequences which encode the polypeptide.
- An operable linkage is a linkage in which the regulatory DNA sequences and the DNA sequence sought to be expressed are connected in such a way as to permit gene expression of antibodies or Ab fragments in recoverable amounts.
- the precise nature of the regulatory regions needed for gene expression may vary from organism to organism, as is well known in the analogous art. See, e.g., Sambrook, supra and Ausubel supra.
- the present invention accordingly encompasses the expression of antibodies or Ab fragments, in either prokaryotic or eukaryotic cells, although eukaryotic expression is preferred.
- Preferred hosts are bacterial or eukaryotic hosts including bacteria, yeast, insects, fungi, bird and mammalian cells either in vivo, or in situ, or host cells of mammalian, insect, bird or yeast origin. It is preferable that the mammalian cell or tissue is of human, primate, hamster, rabbit, rodent, cow, pig, sheep, horse, goat, dog or cat origin, but any other mammalian cell may be used.
- yeast ubiquitin hydrolase system in vivo synthesis of ubiquitin-transmembrane polypeptide fusion proteins can be achieved.
- the fusion proteins produced thereby may be processed in vivo or purified and processed in vitro, allowing synthesis of an antibody or Ab fragment of the present invention with a specified amino terminus sequence.
- problems associated with retention of initiation codon-derived methionine residues in direct yeast (or bacterial) expression may be avoided.
- Any of a series of yeast gene expression systems incorporating promoter and termination elements from the actively expressed genes coding for glycolytic enzymes produced in large quantities when yeast are grown in mediums rich in glucose can be utilized to obtain the antibodies or Ab fragments of the present invention.
- Known glycolytic genes can also provide very efficient transcriptional control signals.
- the promoter and terminator signals of the phosphoglycerate kinase gene can be utilized.
- Production of antibodies or Ab fragments or functional derivatives thereof in insects can be achieved, for example, by infecting the insect host with a baculovirus engineered to express a transmembrane polypeptide by methods known to those of skill. See Ausubel et al., eds. Current Protocols in Molecular Biology Wiley Interscience, 16.8-16.1 1 (1987, 1993).
- the introduced nucleotide sequence will be incorporated into a plasmid or viral vector capable of autonomous replication in the recipient host. Any of a wide variety of vectors may be employed for this purpose.
- Factors of importance in selecting a particular plasmid or viral vector include: the ease with which recipient cells that contain the vector may be recognized and selected from those recipient cells which do not contain the vector; the number of copies of the vector which are desired in a particular host; and whether it is desirable to be able to "shuttle" the vector between host cells of different species.
- Preferred prokaryotic vectors known in the art include plasmids such as those capable of replication in E. coli (such as, for example, pBR322, CoIEl, pSClOl, pACYC
- plasmids are, for example, disclosed by Maniatis, T., et al. (Molecular Cloning, A Laboratory Manual, Second Edition, Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (1989); Ausubel, infra.
- Bacillus plasmids include pC194, pC221, pT127, etc. Such plasmids are disclosed by Gryczan, T. (In: The Molecular Biology of the Bacilli, Academic Press, NY (1982), pp. 307-329).
- Suitable Streptomyces plasmids include pi Jl 01 (Kendall, K. J., et al., J. Bacteriol.
- gene expression elements useful for the expression of cDNA encoding antibodies, antibody fragments, or peptides include, but are not limited to (a) viral transcription promoters and their enhancer elements, such as the SV40 early promoter (Okayama, et al., MoI. Cell. Biol. 3:280 (1983)), Rous sarcoma virus LTR (Gorman, et al., Proc. Natl. Acad.
- Antibody cDNAs can be expressed as described by Liu et al., infra, and Weidle et al., Gene 51 :21 (1987), using as expression elements the SV40 early promoter and its enhancer, the mouse immunoglobulin H chain promoter enhancers, SV40 late region mRNA splicing, rabbit S-globin intervening sequence, immunoglobulin and rabbit S-globin polyadenylation sites, and SV40 polyadenylation elements.
- the transcriptional promoter can be human cytomegalovirus
- the promoter enhancers can be cytomegalovirus and mouse/human immunoglobulin
- mRNA splicing and polyadenylation regions can be the native chromosomal immunoglobulin sequences.
- the transcriptional promoter is a viral LTR sequence
- the transcriptional promoter enhancers are either or both the mouse immunoglobulin heavy chain enhancer and the viral LTR enhancer
- the splice region contains an intron of greater than 31 bp
- the polyadenylation and transcription termination regions are derived from the native chromosomal sequence corresponding to the immunoglobulin chain being synthesized.
- cDNA sequences encoding other proteins can also be combined with the above-recited expression elements to achieve expression of the proteins in mammalian cells.
- Each fused gene can be assembled in, or inserted into, an expression vector.
- Recipient cells capable of expressing the chimeric antibody chain gene product are then transfected singly with the sequence encoding the antibody, or chimeric H or chimeric L chain-encoding gene, or are co -transfected with a chimeric H and a chimeric L chain gene.
- the transfected recipient cells are cultured under conditions that permit expression of the incorporated genes and the expressed antibody chains or intact antibodies or fragments are recovered from the culture.
- the fused genes encoding the antibodies or chimeric H and L chains, or portions thereof can be assembled in separate expression vectors that are then used to co-transfect a recipient cell.
- Each vector can contain two selectable genes, a first selectable gene designed for selection in a bacterial system and a second selectable gene designed for selection in a eukaryotic system, wherein each vector has a different pair of genes.
- This strategy results in vectors which first direct the production, and permit amplification, of the fused genes in a bacterial system.
- the genes so produced and amplified in a bacterial host are subsequently used to co-transfect a eukaryotic cell, and allow selection of a co-transfected cell carrying the desired transfected genes.
- selectable genes for use in a bacterial system are the gene that confers resistance to ampicillin and the gene that confers resistance to chloramphenicol.
- Preferred selectable genes for use in eukaryotic transfectants include the xanthine guanine phosphoribosyl transferase gene (designated gpt) and the phosphotransferase genes from Tn5 (designated neo). Selection of cells expressing gpt is based on the fact that the enzyme encoded by this gene utilizes xanthine as a substrate for purine nucleotide synthesis, whereas the analogous endogenous enzyme cannot.
- the preferred recipient cell line is a myeloma cell.
- Myeloma cells can synthesize, assemble and secrete antibodies encoded by transfected antibody genes and possess the mechanism for glycosylation of the antibody.
- a particularly preferred recipient cell is the recombinant antibody-producing myeloma cell SP2/0 (ATCC #CRL 8287). SP2/0 cells produce only antibodies encoded by the transfected genes.
- Myeloma cells can be grown in culture or in the peritoneal cavity of a mouse, where secreted antibodies can be obtained from ascites fluid.
- Other suitable recipient cells include lymphoid cells such as B lymphocytes of human or non-human origin, hybridoma cells of human or non-human origin, or interspecies heterohybridoma cells.
- the expression vector carrying an antibody construct, antibody, or antibody fragment of the present invention can be introduced into an appropriate host cell by any of a variety of suitable means, including such biochemical means as transformation, transfection, conjugation, protoplast fusion, calcium phosphate-precipitation, and application with polycations such as diethylaminoethyl (DEAE) dextran, and such mechanical means as electroporation, direct microinjection, and microprojectile bombardment (Johnston et al., Science 240:1538 (1988)).
- a preferred way of introducing DNA into lymphoid cells is by electroporation (Potter et al., Proc. Natl. Acad. Sci.
- recipient cells are subjected to an electric pulse in the presence of the DNA to be incorporated.
- cells are allowed to recover in complete medium for about 24 hours, and are then seeded in 96-well culture plates in the presence of the selective medium.
- G418 selection is performed using about 0.4 to 0.8 mg/ml G418.
- Mycophenolic acid selection utilizes about 6 ⁇ g/ml plus about 0.25 mg/ml xanthine.
- the electroporation technique is expected to yield transfection frequencies of about 10 "5 to about 10 "4 for Sp2/0 cells.
- lysozyme is used to strip cell walls from catarrhal harboring the recombinant plasmid containing the chimeric antibody gene.
- the resulting spheroplasts can then be fused with myeloma cells with polyethylene glycol.
- the antibody-encoding nucleic acids of the present invention can also be expressed in non-lymphoid mammalian cells or in other eukaryotic cells, such as yeast, or in prokaryotic cells, in particular bacteria.
- Yeast provides substantial advantages over bacteria for the production of, for example, immunoglobulin H and L chains. Yeasts carry out post- translational peptide modifications including glycosylation. A number of recombinant DNA strategies now exist which utilize strong promoter sequences and high copy number plasmids which can be used for production of the desired proteins in yeast.
- Yeast recognizes leader sequences of cloned mammalian gene products and secretes peptides bearing leader sequences (i.e., pre-peptides) (Hitzman, et al., 1 lth International Conference on Yeast Genetics and Molecular Biology, Montpelier, France, Sep. 13-17, 1982).
- Yeast gene expression systems can be routinely evaluated for the levels of production, secretion and the stability of antibody fragments and regions thereof. Any of a series of yeast gene expression systems incorporating promoter and termination elements from the actively expressed genes coding for glycolytic enzymes produced in large quantities when yeasts are grown in media rich in glucose can be utilized. Known glycolytic genes can also provide very efficient transcription control signals. For example, the promoter and terminator signals of the phosphoglycerate kinase (PGK) gene can be utilized. A number of approaches can be taken for evaluating optimal expression plasmids for the expression of cloned antibody cDNAs in yeast (see Glover, ed., DNA Cloning, Vol. II, pp 45-66, IRL Press, 1985).
- PGK phosphoglycerate kinase
- Bacterial strains can also be utilized as hosts for the production of antibody molecules or peptides described by this invention, E. coli Kl 2 strains such as E. coli W3110 (ATCC 27325), and other enterobacteria such as Salmonella typhimu ⁇ um or Serratia marcescens, and various Pseudomonas species can be used.
- Plasmid vectors containing replicon and control sequences which are derived from species compatible with a host cell are used in connection with these bacterial hosts.
- the vector carries a replication site, as well as specific genes which are capable of providing phenotypic selection in transformed cells.
- a number of approaches can be taken for evaluating the expression plasmids for the production of antibodies, fragments and regions or antibody chains encoded by the cloned antibody- encoding cDNAs in bacteria (see Glover, ed., DNA Cloning, Vol. I, IRL Press, 1985, Ausubel, infra, Sambrook, infra, Colligan, infra).
- Preferred hosts are mammalian cells, grown in vitro or in vivo. Mammalian cells provide post-translational modifications to antibody molecules including leader peptide removal, folding and assembly of H and L chains, glycosylation of the antibody molecules, and secretion of functional antibody protein.
- Mammalian cells which can be useful as hosts for the production of antibody proteins include cells of fibroblast origin, such as Vero (ATCC CRL 81) or CHO-Kl (ATCC CRL 61).
- H and L chain genes are available for the expression of cloned antibodies, H and L chain genes, or antibody fragments in mammalian cells (see Glover, ed., DNA Cloning, Vol. II, pp 143-238, IRL Press, 1985). Different approaches can be followed to obtain complete H 2 L 2 antibodies. As discussed above, it is possible to co-express H and L chains in the same cells to achieve intracellular association and linkage of H and L chains into complete tetrameric H 2 L 2 antibodies and/or antibodies and/or antibody fragments of the invention. The co-expression can occur by using either the same or different plasmids in the same host.
- Genes for both H and L chains and/or antibodies and/or antibody fragments can be placed into the same plasmid, which can then be transfected into cells, thereby selecting directly for cells that express both chains.
- cells can be transfected first with a plasmid encoding one chain, for example the L chain, followed by transfection of the resulting cell line with an H chain plasmid containing a second selectable marker.
- Cell lines producing antibodies and/or H 2 L 2 molecules and/or antibody fragments via either route could be transfected with plasmids encoding additional copies of peptides, H, L, or H plus L chains in conjunction with additional selectable markers to generate cell lines with enhanced properties, such as higher production of assembled H 2 L 2 antibody molecules or enhanced stability of the transfected cell lines.
- the present invention is also directed to an anti-idiotypic (anti-Id) antibody specific for the antibodies of the invention.
- An anti-Id antibody is an antibody which recognizes unique determinants generally associated with the antigen-binding region of another antibody.
- the antibody specific for one or more avian influenza viral proteins is termed the idiotypic or Id antibody.
- the anti-Id can be prepared by immunizing an animal of the same species and genetic type (e.g. mouse strain) as the source of the Id antibody with the Id antibody or the antigen-binding region thereof.
- the immunized animal will recognize and respond to the idiotypic determinants of the immunizing antibody and produce an anti-Id antibody.
- the anti-Id antibody can also be used as an "immunogen" to induce an immune response in yet another animal, producing a so-called anti-anti-Id antibody.
- the anti-anti-Id can be epitopically identical to the original antibody which induced the anti-Id.
- mAbs generated against one or more avian influenza viral proteins according to the present invention can be used to induce anti-Id antibodies in suitable animals, such as BALB/c mice.
- Spleen cells from such immunized mice can be used to produce anti-Id hybridomas secreting anti-Id mAbs.
- the anti-Id InAbs can be coupled to a carrier such as keyhole limpet hemocyanin (KLH) and used to immunize additional BALB/c mice.
- KLH keyhole limpet hemocyanin
- Sera from these mice will contain anti-anti-Id antibodies that have the binding properties of the original mAb specific for an epitope of an avian influenza viral protein, or preferably, an epitope containing within amino acid sequences of hemagglutinin H5 or neuraminidase Nl.
- the avian influenza antibodies of the invention bind one or more avian influenza viral proteins with high affinity, such as of at least 10 '9 M, at least 10 " '° M, at least 10 ' " M, or at least 10 '12 M.
- the avian influenza antibodies substantially neutralize at least one activity or proteolytic cleavage of at least one avian influenza viral protein.
- the avian influenza antibodies of the invention can bind avian influenza viral proteins or fragments with a wide range of affinities (K D ).
- at least one antibody of the present invention can optionally bind avian influenza viral proteins or fragments with high affinity.
- the avian influenza antibodies of the invention can bind avian influenza viral proteins or fragments with a K D equal to or less than about 10 "9 M or, more preferably, with a K D equal to or less than about 0.1-9.9 (or any range or value therein) X 10 '10 M, 10 '11 , 10 "12 , 10 '13 or any range or value therein.
- the affinity or avidity of an antibody for an antigen can be determined experimentally using any suitable method.
- any suitable method See, for example, Berzofsky, et al., "Ig derived protein-Antigen Interactions," In Fundamental Immunology, Paul, W. E., Ed., Raven Press: New York, N. Y. (1984); Kuby, Janis Immunology, W. H. Freeman and Company: New York, N. Y. (1992); and methods described herein).
- the measured affinity of a particular antibody-antigen interaction can vary if measured under different conditions (e.g., salt concentration, pH).
- affinity and other antigen-binding parameters e.g., K D , K a , K d
- K D , K a , K d are preferably made with standardized solutions of antibody and antigen, and a standardized buffer, such as the buffer described herein.
- the invention also provides at least one isolated avian influenza antibody-encoding nucleic acid, comprising a nucleic acid that hybridizes under stringent conditions, or has at least 95% identity, to a nucleic acid encoding an avian influenza antibody protein.
- the invention further provides a vector expressing an avian influenza antibody of the invention, comprising such a nucleic acid, wherein the vector optionally further comprises at least one promoter selected from the group consisting of a late or early SV40 promoter, a CMV promoter, an HSV tk promoter, a pgk (phosphoglycerate kinase) promoter, a human immunoglobulin promoter, or an EF-I alpha promoter.
- a promoter selected from the group consisting of a late or early SV40 promoter, a CMV promoter, an HSV tk promoter, a pgk (phosphoglycerate kinase) promoter, a human immunoglobulin promoter, or an EF-I alpha promoter.
- Such a vector can optionally further comprise at least one selection gene or portion thereof selected from at least one of methotrexate (MTX), dihydrofolate reductase (DHFR), green fluorescent protein (GFP), neomycin (G418), or glutamine synthetase (GS).
- the invention further comprises a mammalian host cell comprising such an isolated nucleic acid, optionally, wherein said host cell is at least one selected from COS-I, COS-7, HEK293, BHK21, CHO, BSC-I, Hep G2, 653, SP2/0, 293, HeLa, myeloma, or lymphoma cells, or any derivative, immortalized or transformed cell thereof.
- Avian influenza viral load or seroconversion can be determined at the protein or nucleic acid level using any method known in the art.
- Virus, viral particles, viral protein, or viral nucleic acid amounts can be detected, inter alia, electrophoretically (such as by agarose gel electrophoresis, sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), Tris-HCl polyacrylamide gels, non-denaturing protein gels, two-dimensional gel electrophoresis (2DE), and the like), immunochemically (i.e., radioimmunoassay, immunoblotting, immunoprecipitation, immunofluorescence, enzyme-linked immunosorbent assay), by "proteomics technology", or by "genomic analysis.”
- Northern and Southern hybridization analysis as well as ribonuclease protection assays using probes which specifically recognize one or more of these sequences can be used to determine avian influenza gene expression.
- expression can be measured using reverse-transcription-based PCR assays (RT-PCR), e.g., using primers specific for the differentially expressed sequence of genes.
- RT-PCR reverse-transcription-based PCR assays
- Expression can also be determined at the protein level, e.g., by measuring the levels of peptides encoded by the gene products described herein, or activities thereof.
- Such methods are well known in the art and include, e.g., immunoassays based on antibodies to proteins encoded by the genes, aptamers or molecular imprints. Any biological material can be used for the detection/quantification of the protein or its activity.
- a suitable method can be selected to determine the activity of proteins encoded by the marker genes according to the activity of each protein analyzed.
- Immunoassays carried out in accordance with the present invention may be homogeneous assays or heterogeneous assays.
- the immunological reaction usually involves the specific antibody (e.g., the isolated avian influenza antibodies of the present invention), a labeled analyte, and the sample of interest.
- the signal arising from the label is modified, directly or indirectly, upon the binding of the antibody to the labeled analyte. Both the immunological reaction and detection of the extent thereof can be carried out in a homogeneous solution.
- Immunochemical labels which may be employed include free radicals, radioisotopes, fluorescent dyes, enzymes, bacteriophages, or coenzymes.
- the reagents are usually the sample, the antibody, and means for producing a detectable signal.
- Samples as described above may be used.
- the antibody can be immobilized on a support, such as a bead (such as protein A agarose, protein G agarose, latex, polystyrene, magnetic or paramagnetic beads), plate or slide, and contacted with the specimen suspected of containing the antigen in a liquid phase.
- the support is then separated from the liquid phase and either the support phase or the liquid phase is examined for a detectable signal employing means for producing such signal.
- the signal is related to the presence of the analyte in the sample.
- Means for producing a detectable signal include the use of radioactive labels, fluorescent labels, or enzyme labels.
- an antibody which binds to that site can be conjugated to a detectable group and added to the liquid phase reaction solution before the separation step.
- the presence of the detectable group on the solid support indicates the presence of the antigen in the test sample.
- suitable immunoassays are oligonucleotides, immunoblotting, immunoprecipitation, immunofluorescence methods, chemiluminescence methods, electrochemiluminescence or enzyme-linked immunoassays.
- the present invention also provides avian influenza antibodies, detectably labeled, as described below, for use in diagnostic methods for detecting avian influenza virus, viral particles, or viral proteins in subjects known to be or suspected of having an avian influenza infection.
- Avian influenza antibodies of the present invention are useful for immunoassays which detect or quantitate avian influenza viral proteins, viral particles, viral peptides, or other avian influenza antibodies, in a sample from a subject.
- An immunoassay for avian influenza viral proteins, viral particles, or viral peptides typically comprises incubating a biological sample in the presence of a detectably labeled high affinity avian influenza antibody of the present invention capable of selectively binding to one or more avian influenza viral proteins, viral particles, or viral peptides, and detecting the labeled avian influenza antibody which is bound in a sample.
- a detectably labeled high affinity avian influenza antibody of the present invention capable of selectively binding to one or more avian influenza viral proteins, viral particles, or viral peptides, and detecting the labeled avian influenza antibody which is bound in a sample.
- Various clinical assay procedures are well known in the art, e.g., as described in Immunoassays for the 80's, A. Voller et al., eds., University Park, 1981.
- an avian influenza antibody as provided by the present invention can be added to nitrocellulose, or another solid support which is capable of immobilizing cells, cell particles or soluble proteins.
- the support can then be washed with suitable buffers followed by treatment with the detectably labeled avian influenza antibody.
- the solid phase support can then be washed with the buffer a second time to remove unbound antibody.
- the amount of bound label on the solid support can then be detected by methods known in the art.
- solid phase support or “carrier” is intended any support capable of binding peptide, antigen or antibody.
- supports or carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, agaroses, and magnetite.
- the nature of the carrier can be either soluble to some extent or insoluble for the purposes of the present invention.
- the support material can have virtually any possible structural configuration so long as the coupled molecule is capable of binding to one or more avian influenza viral proteins or peptides, or an avian influenza antibody such as those provided by the present invention.
- the support configuration can be spherical, as in a bead, or cylindrical, as in the inside surface of a test tube, or the external surface of a rod.
- the surface can be flat, such as a sheet, culture dish, test strip, etc.
- Preferred supports include polystyrene beads.
- Detectably labeling the avian influenza antibodies of the invention can be accomplished by linking to an enzyme for use in an enzyme immunoassay (EIA), or enzyme-linked immunosorbent assay (ELISA).
- EIA enzyme immunoassay
- ELISA enzyme-linked immunosorbent assay
- Enzymes which can be used to detectably label the avian influenza antibodies of the present invention include, but are not limited to, malate dehydrogenase, staphylococcal nuclease, delta-5- steroid isomerase, yeast alcohol dehydrogenase, ⁇ -glycerophosphate dehydrogenase, triose phosphate isomerase, horseradish peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, ⁇ -galactosidase, ribonuclease, urease, catalase, glucose-6-phosphate dehydrogenase, glucoamylase and acetylcholinesterase.
- radioactively labeling the avian influenza antibodies By radioactively labeling the avian influenza antibodies, it is possible to detect avian influenza virus, viral particles, viral proteins, and/or viral peptides through the use of a radioimmunoassay (RIA) (see, for example, Work, et al., Laboratory Techniques and Biochemistry in Molecular Biology, North Holland Publishing Company, N. Y. (1978)).
- the radioactive isotope can be detected by such means as the use of a gamma counter or a scintillation counter or by autoradiography.
- Isotopes which are particularly useful for the purpose of the present invention are: 3 H, 131 1, 35 S, 14 C, and, preferably, 125 I.
- the avian influenza antibodies can also be labeled with a fluorescent compound.
- fluorescent labeled antibody When the fluorescent labeled antibody is exposed to light of the proper wave length, its presence can then be detected due to fluorescence.
- fluorescent labelling compounds are fluorescein isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, o-phthaldehyde and fluorescaamine.
- the avian influenza antibodies of the invention can also be detectably labeled using fluorescence-emitting metals such as 125 Eu, or others of the lanthanide series.
- metals can be attached to the avian influenza antibody using such metal chelating groups as diethylenetriaminepentaacetic acid (DTPA) or ethylenediamine-tetraacetic acid (EDTA).
- DTPA diethylenetriaminepentaacetic acid
- EDTA ethylenediamine-tetraacetic acid
- the avian influenza antibodies also can be detectably labeled by coupling to a chemiluminescent compound. The presence of the chemiluminescently labeled antibody is then determined by detecting the presence of luminescence that arises during the course of a chemical reaction.
- chemiluminescent labeling compounds are luminol, isoluminol, theromatic acridinium ester, imidazole, acridinium salt and oxalate ester.
- a bioluminescent compound can be used to label the avian influenza antibody, fragment or derivative of the present invention.
- Bioluminescence is a type of chemiluminescence found in biological systems in which a catalytic protein increases the efficiency of the chemiluminescent reaction. The presence of a bioluminescent protein is determined by detecting the presence of luminescence.
- Important bioluminescent compounds for purposes of labeling are luciferin, luciferase and aequorin.
- Detection of the avian influenza antibody, fragment or derivative can be accomplished by a scintillation counter, for example, if the detectable label is a radioactive gamma emitter, or by a fluorometer, for example, if the label is a fluorescent material.
- the detection can be accomplished by colorometric methods which employ a substrate for the enzyme. Detection can also be accomplished by visual comparison of the extent of enzymatic reaction of a substrate in comparison with similarly prepared standards.
- the avian influenza virus, viral particles, viral proteins, and/or viral peptides which can be detected by the above assays can be present in a biological sample. Any sample containing or suspected of containing avian influenza virus, viral particles, viral proteins, and/or viral peptides can be used.
- the sample is a biological fluid such as, for example, serum, blood plasma, blood cells, endothelial cells, tissue biopsies or extracts or homogenates, lymphatic fluid, pancreatic juice, ascites fluid, interstitial fluid (also known as "extracellular fluid” and encompasses the fluid found in spaces between cells, including, inter alia, gingival crevicular fluid), bone marrow, sputum, saliva, tears, or urine, inflammatory exudate, cerebrospinal fluid, amniotic fluid, and the like.
- the invention is not limited to assays using only these samples, it being possible for one of ordinary skill in the art to determine suitable conditions which allow the use of other samples.
- In situ detection can be accomplished by removing a histological specimen from a subject, and providing the combination of labeled antibodies of the present invention to such a specimen.
- the antibody (or fragment or derivative) is preferably provided by applying or by overlaying the labeled antibody (or fragment or derivative) to a biological sample.
- the antibody, fragment or derivative of the present invention can be adapted for utilization in an immunometric assay, also known as a "two-site” or “sandwich” assay.
- an immunometric assay also known as a "two-site” or “sandwich” assay.
- a quantity of unlabeled antibody (or fragment of antibody) is bound to a solid support that is insoluble in the fluid being tested and a quantity of detectably labeled soluble antibody is added to permit detection and/or quantitation of the ternary complex formed between solid-phase antibody, antigen, and labeled antibody.
- Typical, and preferred, immunometric assays include "forward" assays in which the antibody bound to the solid phase is first contacted with the sample being tested to extract the avian influenza virus, viral particles, viral proteins, or viral peptides from the sample by formation of a binary solid phase antibody-avian influenza antigen complex. After a suitable incubation period, the solid support is washed to remove the residue of the fluid sample, including unreacted avian influenza antigen, if any, and then contacted with the solution containing a known quantity of labeled antibody (which functions as a "reporter molecule").
- This type of forward sandwich assay can be a simple "yes/no” assay to determine whether avian influenza antigen is present or can be made quantitative by comparing the measure of labeled antibody with that obtained for a standard sample containing known quantities of avian influenza antigen.
- avian influenza antigen i.e., avian influenza virus, viral particle, viral protein, or viral peptide
- This type of forward sandwich assay can be a simple "yes/no" assay to determine whether avian influenza antigen is present or can be made quantitative by comparing the measure of labeled antibody with that obtained for a standard sample containing known quantities of avian influenza antigen.
- Such "two-site” or “sandwich” assays are described by Wide (Radioimmune Assay Method, Kirkham, ed., Livingstone, Edinburgh, 1970, pp. 199-206).
- a simultaneous assay involves a single incubation step wherein the antibody bound to the solid support and labeled antibody are both added to the sample being tested at the same time. After the incubation is completed, the solid support is washed to remove the residue of fluid sample and uncomplexed labeled antibody. The presence of labeled antibody associated with the solid support is then determined as it would be in a conventional "forward" sandwich assay.
- stepwise addition first of a solution of labeled antibody to the fluid sample followed by the addition of unlabeled antibody bound to a solid support after a suitable incubation period, is utilized. After a second incubation, the solid phase is washed in conventional fashion to free it of the residue of the sample being tested and the solution of unreacted labeled antibody. The determination of labeled antibody associated with a solid support is then determined as in the "simultaneous" and "forward” assays.
- a combination of antibodies of the present invention specific for separate epitopes can be used to construct a sensitive three-site immunoradiometric assay.
- the isolated avian influenza antibodies can also be useful for detecting post- translational modifications of avian influenza proteins, polypeptides, mutations, and polymorphisms, such as tyrosine phosphorylation, threonine phosphorylation, serine phosphorylation, glycosylation (e.g., O-GlcNAc).
- Such antibodies specifically detect the phosphorylated amino acids in a protein or proteins of interest, and can be used in immunoblotting, immunofluorescence, and ELISA assays described herein. These antibodies are well-known to those skilled in the art, and commercially available.
- Post-translational modifications can also be determined using metastable ions in reflector matrix-assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF) (Wirth, U. et al. (2002) Proteomics 2(10): 1445-51).
- MALDI-TOF reflector matrix-assisted laser desorption ionization-time of flight mass spectrometry
- Kits The invention also includes an avian influenza viral-detection reagent, e.g., nucleic acids that specifically identify one or more avian influenza nucleic acids by having homologous nucleic acid sequences, such as oligonucleotide sequences, complementary to a portion of known avian influenza nucleic acids or antibodies to proteins encoded by avian influenza nucleic acids packaged together in the form of a kit.
- an avian influenza viral-detection reagent e.g., nucleic acids that specifically identify one or more avian influenza nucleic acids by having homologous nucleic acid sequences, such as oligonucleotide sequences, complementary to a portion of known avian influenza nucleic acids or antibodies to proteins encoded by avian influenza nucleic acids packaged together in the form of a kit.
- the kits of the present invention can allow one of skill in the art to, inter alia, diagnostically detect the presence of the avian influenza virus in a subject,
- kits of the invention can also be used to advantageously carry out any of the methods provided in this disclosure.
- the oligonucleotides can be fragments of avian influenza viral genes.
- the oligonucleotides can be 200, 150, 100, 50, 25, 10 or less nucleotides in length.
- the oligonucleotides are capable of binding or annealing to the avian influenza antibody- encoding nucleic acid under stringent conditions defined herein, or to one or more avian influenza viral proteins.
- the avian influenza-detection reagents can also comprise, inter alia, antibodies or fragments of antibodies (such as the isolated antibodies or antibody fragments described herein), and aptamers.
- the kit may contain in separate containers a nucleic acid or antibody (either already bound to a solid matrix or packaged separately with reagents for binding them to the matrix), control formulations (positive and/or negative), and/or a detectable label.
- Instructions e.g., written, tape, VCR, CD-ROM, etc.
- the assay may for example be in the form of a Northern blot hybridization or a sandwich ELISA as known in the art.
- the kit can be in the form of a microarray as known in the art.
- kits of the present invention comprise a control (or reference) sample derived from a subject who has not been infected with avian influenza.
- the kits can comprise a control sample derived from a subject who has been diagnosed with or identified as suffering from avian influenza.
- the diagnostic kit comprises (a) an antibody (e.g., the isolated avian influenza antibodies of the present invention) conjugated to a solid support and (b) a second antibody of the invention conjugated to a detectable group.
- the reagents may also include ancillary agents such as buffering agents and protein stabilizing agents, e.g., polysaccharides and the like.
- the diagnostic kit may further include, where necessary, other members of the signal-producing system of which system the detectable group is a member (e.g., enzyme substrates), agents for reducing background interference in a test, control reagents, apparatus for conducting a test, and the like.
- a test kit contains (a) an antibody of the invention, and (b) a specific binding partner for the antibody conjugated to a detectable group.
- the test kit may be packaged in any suitable manner, typically with all elements in a single container, optionally with a sheet of printed instructions for carrying out the test.
- avian influenza detection reagents can be immobilized on a solid matrix such as a porous strip to form at least one avian influenza virus detection site.
- the measurement or detection region of the porous strip may include a plurality of sites containing a nucleic acid.
- a test strip may also contain sites for negative and/or positive controls. Alternatively, control sites can be located on a separate strip from the test strip.
- the different detection sites may contain different amounts of immobilized nucleic acids, e.g., a higher amount in the first detection site and lesser amounts in subsequent sites.
- the number of sites displaying a detectable signal provides a quantitative indication of the amount of avian influenza virus present in the sample.
- the detection sites may be configured in any suitably detectable shape and are typically in the shape of a bar or dot spanning the width of a test strip.
- the kit contains a nucleic acid substrate array comprising one or more nucleic acid sequences.
- the nucleic acids on the array specifically identify one or more nucleic acid sequences representing avian influenza viral genes by binding or hybridizing to one or more avian influenza viral genes under stringent conditions.
- the expression of 2, 3, 4, 5, 6, 7, or all 8 avian influenza open reading frames can be identified by virtue of binding to the array.
- the substrate array can be on, e.g., a solid substrate, e.g., a "chip" as described in U.S. Patent No.5,744,305.
- the substrate array can be a solution array, e.g., xMAP (Luminex, Austin, TX), Cyvera (Illumina, San Diego, CA), CellCard (Vitra Bioscience, Mountain View, CA) and Quantum Dots' Mosaic (Invitrogen, Carlsbad, CA).
- xMAP Luminex, Austin, TX
- Cyvera Illumina, San Diego, CA
- CellCard Vitra Bioscience, Mountain View, CA
- Quantum Dots' Mosaic Invitrogen, Carlsbad, CA.
- nucleic acid probes e.g., oligonucleotides, aptamers, siRNAs, antisense oligonucleotides, against any of the avian influenza genes and proteins described herein.
- the Examples presented herein describe generation of monoclonal antibodies in mice. Such techniques are well-known to those of ordinary skill in the art.
- the isolated avian influenza antibodies preferably included as part of a pharmaceutical composition or formulation as described herein, can be administered by any administration method known to a person skilled in the art.
- routes of administration include but are not limited to oral, parenteral, intraperitoneal, intravenous, intraarterial, transdermal, topical, sublingual, intramuscular, rectal, transbuccal, intranasal, liposomal, via inhalation, pulmonary, transmucosal, vaginal, intraocular, via local delivery by catheter or stent, implant, osmotic pump, cartridge, micro pump, subcutaneous, intraadiposal, intraarticular, intrathecal, or in a slow release dosage form.
- the isolated avian influenza antibodies or pharmaceutical compositions comprising the isolated avian influenza antibodies can be administered in accordance with any dose and dosing schedule that achieves a dose effective to treat disease.
- this invention also encompasses pharmaceutical compositions comprising any solid or liquid physical form of one or more of the isolated avian influenza antibodies of the invention.
- the isolated avian influenza antibodies can be prepared in a crystalline form, in amorphous form, and have any particle size.
- the isolated antibody particles may be micronized, or may be agglomerated, particulate granules, powders, oils, oily suspensions or any other form of solid or liquid physical form.
- isolated avian influenza antibodies or pharmaceutical compositions comprising isolated avian influenza antibodies of the invention can be administered in such oral forms as tablets, capsules (each of which includes sustained release or timed release formulations), pills, powders, granules, elixirs, tinctures, suspensions, syrups, and emulsions.
- the isolated avian influenza antibodies or pharmaceutical compositions comprising isolated avian influenza antibodies can be administered by intravenous (e.g., bolus or infusion), intraperitoneal, subcutaneous, intramuscular, or other routes using forms described herein and well known to those of ordinary skill in the pharmaceutical arts.
- the present invention also provides at least one avian influenza antibody, fragment, or derivative composition (preferably a pharmaceutical composition) comprising at least one, at least two, at least three, at least four, at least five, at least six or more avian influenza antibodies, fragments, or derivatives thereof, as described herein and/or as known in the art that are provided in a non-naturally occurring composition, mixture or form.
- Such compositions comprise non-naturally occurring compositions comprising at least one or two full length, C- and/or N-terminally deleted variants, domains, fragments, or specified variants, of the avian influenza antibodies described herein.
- Such composition percentages are by weight, volume, concentration, molarity, or molality as liquid or dry solutions, mixtures, suspension, emulsions or colloids, as known in the art or as described herein.
- the at least one avian influenza antibody, antibody fragment, or antibody derivative used in accordance with the present invention can be produced by recombinant means, including from mammalian cell or transgenic preparations, or can be purified from other biological sources, as described herein or as known in the art.
- Suitable pharmaceutically acceptable salts of the agents described herein and suitable for use in the method of the invention are conventional non-toxic salts and can include a salt with a base or an acid addition salt such as a salt with an inorganic base, for example, an alkali metal salt (e.g., lithium salt, sodium salt, potassium salt, etc.), an alkaline earth metal salt (e.g., calcium salt, magnesium salt, etc.), an ammonium salt; a salt with an organic base, for example, an organic amine salt (e.g., triethylamine salt, pyridine salt, picoline salt, ethanolamine salt, triethanolamine salt, dicyclohexylamine salt, N 5 N'- dibenzylethylenediamine salt, etc.) etc.; an inorganic acid addition salt (e.g., hydrochloride, hydrobromide, sulfate, phosphate, etc.); an organic carboxylic or sulfonic acid addition salt (e.g., formate, a
- the range of at least one avian influenza antibody, antibody fragment, or antibody derivative in the pharmaceutical compositions and formulations of the present invention includes amounts yielding upon reconstitution, if in a wet/dry system, concentrations from about 1.0 ⁇ g/ml to about 1000 mg/ml, although lower and higher concentrations are operable and are dependent on the intended delivery vehicle, e.g., solution formulations will differ from transdermal patch, pulmonary, transmucosal, or osmotic or micro pump methods.
- treating in its various grammatical forms in relation to the present invention refers to preventing (i.e. chemoprevention), curing, reversing, attenuating, alleviating, minimizing, suppressing or halting the deleterious effects of a disease state, disease progression, disease causative agent (e.g., bacteria or viruses) or other abnormal condition.
- treatment may involve alleviating a symptom (i.e., not necessarily all symptoms) of a disease or attenuating the progression of a disease.
- therapeutically effective amount is intended to qualify the amount or amounts of the isolated antibodies of the invention, or pharmaceutical compositions comprising the isolated antibodies of the invention, that will achieve a desired biological response.
- the desired biological response can be partial or total inhibition, delay or prevention of the progression of avian influenza infections; or inhibition, delay or prevention of the recurrence of avian influenza infections.
- prophylactically effective amount is intended to qualify the amount or amounts of the isolated antibodies of the invention, or pharmaceutical compositions comprising the isolated antibodies of the invention that will achieve the prevention of the onset or development of avian influenza infections (chemoprevention) in a subject, for example a human.
- Such a method can comprise administering an effective amount of a composition or a pharmaceutical composition comprising at least one avian influenza antibody or specified portion or variant to a cell, tissue, organ, animal or subject in need of such modulation, treatment, alleviation, prevention, or reduction in symptoms, effects or mechanisms.
- the effective amount can comprise an amount of about 0.001 to 500 mg/kg per single or multiple administration, or to achieve a serum concentration of 0.01-5000 .mu./ml serum concentration per single or multiple administration, or any effective range or value therein, as done and determined using known methods, as described herein or known in the relevant arts.
- the effective amount can be a "therapeutically effective amount” or a "prophylactically effective amount” as defined herein.
- the dosage administered will, of course, vary depending upon known factors. such as the pharmacodynamic characteristics of the particular agent, and its mode and route of administration; age, health, and weight of the recipient; nature and extent of symptoms, kind of concurrent treatment, frequency of treatment, and the effect desired.
- a daily dosage of active ingredient can be about 0.01 to 100 milligrams per kilogram of body weight. Ordinarily 1.0 to 5, and preferably 1 to 10 milligrams per kilogram per day given in divided doses 1 to 6 times a day or in sustained release form is effective to obtain desired results.
- avian influenza antibodies of the present invention can be provided as a daily dosage of the avian influenza antibodies of the present invention of anywhere between 0.1 to 100 mg/kg, such as 0.5, 0.9, 1.0, 1.1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 40, 45, 50, 60, 70, 80, 90 or 100 mg/kg, per day, on at least one of day 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40, or alternatively, at least one of week 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20, or any combination thereof, using single or divided doses of every 24, 12, 8, 6, 4, or 2 hours, or any combination thereof.
- Such antibodies, fragments, or regions will preferably have an affinity for one or more avian influenza viral proteins, viral particles, or viral peptides, expressed as K a , of at least 10 "8 M, more preferably, at least 10 '9 M, such as 10 "8 to 10 '10 M, 5 x 10 "8 M, 8 x 10-8M, 2 x 10 "9 M, 4 x 10 "9 M, 6 x 10 "9 M, 8 x 10 "9 M, or any range or value therein.
- Dosage forms (composition) suitable for internal administration generally contain from about 0.1 milligram to about 500 milligrams of active ingredient per unit.
- the active ingredient will ordinarily be present in an amount of about 0.5-95% by weight based on the total weight of the composition.
- suitable pharmaceutical diluents, excipients or carriers collectively referred to herein as "carrier” materials or “pharmaceutically acceptable carriers" suitably selected with respect to the intended form of administration.
- pharmaceutically acceptable carrier or diluent is intended to include any and all solvents, stabilizers, buffers, salts, lipids, steroids (e.g., cholesterol), chelating agents (e.g., EDTA), lipophilic solvents, preservatives, adjuvants, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, polymeric excipients/additives such as polyvinylpyrrolidones, Ficolls, dextrates (e.g., cyclodextrins, such as 2-hydroxypropyl- ⁇ -cyclodextrin), polyethylene glycols, flavoring agents, sweeteners, antioxidants, anti-static agents, surfactants or solubilizers, and the like, compatible with pharmaceutical administration.
- solvents stabilizers, buffers, salts, lipids, steroids (e.g., cholesterol), chelating agents (e.g., EDTA), lipophilic solvents, preserv
- any inert excipient that is commonly used as a carrier or diluent may be used in the formulations of the present invention, such as for example, a gum, a starch, a sugar, a cellulosic material, an acrylate, or mixtures thereof.
- the compositions may further comprise a disintegrating agent and a lubricant, and in addition may comprise one or more additives selected from a binder, a buffer, a protease inhibitor, a surfactant, a solubilizing agent, a plasticizer, an emulsifier, a stabilizing agent, a viscosity increasing agent, a sweetener, a film forming agent, or any combination thereof.
- compositions of the present invention may be in the form of controlled release or immediate release formulations.
- Suitable carriers are described in the most recent edition of Remington's Pharmaceutical Sciences, a standard reference text in the field, which is incorporated herein by reference.
- Non-limiting examples of, and methods of preparing such sterile solutions are well known in the art, such as, but limited to, Gennaro, Ed., Remington's Pharmaceutical Sciences, 18th Edition, Mack Publishing Co. (Easton, Pa.) 1990.
- Pharmaceutically acceptable carriers can be routinely selected that are suitable for the mode of administration, solubility and/or stability of the avian influenza antibody compositions as well known in the art or as described herein.
- Preferred preservatives include those selected from the group consisting of phenol, m- cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol, alkylparaben (methyl, ethyl, propyl, butyl and the like), benzalkonium chloride, benzethonium chloride, sodium dehydroacetate and thimerosal, or mixtures thereof.
- concentration of preservative used in the formulation is a concentration sufficient to yield an anti-microbial effect. Such concentrations are dependent on the preservative selected and are readily determined by the skilled artisan.
- excipients e.g., isotonicity agents, buffers, antioxidants, and preservative enhancers
- An isotonicity agent such as glycerin, is commonly used at known concentrations.
- a physiologically tolerated buffer is preferably added to provide improved pH control.
- the formulations can cover a wide range of pHs, such as from about pH 4 to about pH 10, and preferred ranges from about pH 5 to about pH 9, and a most preferred range of about 6.0 to about 8.0.
- the formulations of the present invention have pH between about 6.8 and about 7.8.
- Preferred buffers include organic acid salts, such as salts of citric, ascorbic, gluconic, carbonic, tartaric, succinic, acetic, phthalic, Tris, tromethamine hydrochlorine, and phosphate buffers, most preferably, sodium phosphate, particularly phosphate buffered saline (PBS).
- organic acid salts such as salts of citric, ascorbic, gluconic, carbonic, tartaric, succinic, acetic, phthalic, Tris, tromethamine hydrochlorine
- phosphate buffers most preferably, sodium phosphate, particularly phosphate buffered saline (PBS).
- additives such as a pharmaceutically acceptable solubilizers like Tween® 20 (polyoxyethylene (20) sorbitan monolaurate), Tween® 40 (polyoxyethylefle (20) sorbitan monopalmitate), Tween® 80 (polyoxyethylene (20) sorbitan monooleate), Pluronic® F68 (polyoxyethylene polyoxypropylene block copolymers), and PEG (polyethylene glycol) or non-ionic surfactants, such as polysorbate 20 or 80 or poloxamer 184 or 188, Pluronic® polyls, other block co-polymers, and chelators, such as EDTA and EGTA, can optionally be added to the formulations or compositions to reduce aggregation. These additives are particularly useful if a pump or plastic container is used to administer the formulation. The presence of pharmaceutically acceptable surfactant mitigates the propensity for the protein to aggregate.
- compositions include, but are not limited to, proteins, peptides, amino acids, lipids, and carbohydrates (e.g., sugars, including monosaccharides, di-, tri-, tetra-, and oligosaccharides; derivatized sugars, such as alditols, aldonic acids, esterified sugars and the like; and polysaccharides or sugar polymers), which can be present singly or in combination, comprising alone or in combination 1 -99.99% by weight or volume.
- Exemplary protein excipients include serum albumin, such as human serum albumin (HSA), recombinant human albumin (rHA), gelatin, casein, and the like.
- amino acid components which can also function in a buffering capacity, include alanine, glycine, arginine, betaine, histidine, glutamic acid, aspartic acid, cysteine, lysine, leucine, isoleucine, valine, methionine, phenylalanine, aspartame, and the like.
- One preferred amino acid is glycine.
- Carbohydrate excipients suitable for use in the pharmaceutical compositions and formulations of the invention include, for example, monosaccharides, such as fructose, maltose, galactose, glucose, D-mannose, sorbose, and the like; disaccharides, such as lactose, sucrose, trehalose, cellobiose, and the like; polysaccharides, such as raffinose, melezitose, maltodextrins, dextrans, starches, and the like; and alditols, such as mannitol, xylitol, maltitol, lactitol, xylitol sorbitol (glucitol), myoinositol and the like.
- Preferred carbohydrate excipients for use in the present invention are mannitol, trehalose, and raffinose.
- Isolated avian influenza antibodies or pharmaceutical compositions comprising isolated avian influenza antibodies can also be prepared with soluble polymers as targetable drug carriers.
- soluble polymers can include polyvinylpyrrolidone, pyran copolymer, polyhydroxy-propyl-methacrylamide-phenol, polyhydroxyethyl-aspartamide-phenol, or polyethyleneoxide-polylysine substituted with palmitoyl residues.
- the isolated avian influenza antibodies or pharmaceutical compositions comprising the isolated avian influenza antibodies can be prepared with biodegradable polymers useful in achieving controlled release of a drug, for example, polylactic acid, polyglycolic acid, copolymers of polylactic and polyglycolic acid, polyepsilon caprolactone, polyhydroxy butyric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanoacrylates and cross linked or amphipathic block copolymers of hydrogels.
- biodegradable polymers useful in achieving controlled release of a drug, for example, polylactic acid, polyglycolic acid, copolymers of polylactic and polyglycolic acid, polyepsilon caprolactone, polyhydroxy butyric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanoacrylates and cross linked or amphipathic block copolymers of hydrogels.
- Solid carriers/diluents include, but are not limited to, a gum, a starch (e.g., corn starch, pregelatinized starch), a sugar (e.g., lactose, mannitol, sucrose, dextrose), a cellulosic material (e.g., microcrystalline cellulose), an acrylate (e.g., polymethylacrylate), calcium carbonate, magnesium oxide, talc, or mixtures thereof.
- a gum e.g., corn starch, pregelatinized starch
- a sugar e.g., lactose, mannitol, sucrose, dextrose
- a cellulosic material e.g., microcrystalline cellulose
- an acrylate e.g., polymethylacrylate
- calcium carbonate e.g., magnesium oxide, talc, or mixtures thereof.
- compositions may further comprise binders (e.g., acacia, cornstarch, gelatin, carbomer, ethyl cellulose, guar gum, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, povidone), disintegrating agents (e.g., cornstarch, potato starch, alginic acid, silicon dioxide, croscarmellose sodium, crospovidone, guar gum, sodium starch glycolate, Primogel), buffers (e.g., tris-HCl, acetate, phosphate) of various pH and ionic strength, additives such as albumin or gelatin to prevent absorption to surfaces, detergents (e.g., Tween 20, Tween 80, Pluronic F68, bile acid salts), protease inhibitors, surfactants (e.g., sodium lauryl sulfate), permeation enhancers, solubilizing agents (e.g., glycerol, polyethylene g
- the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
- a controlled release formulation including implants and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc.
- Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Patent No. 4,522,811.
- avian influenza antibodies can be formulated as a solution, suspension, emulsion or lyophilized powder in association with a pharmaceutically acceptable parenteral vehicle.
- a pharmaceutically acceptable parenteral vehicle examples include water, saline, Ringer's solution, dextrose solution, and 5% human serum albumin. Liposomes and nonaqueous vehicles such as fixed oils can also be used.
- the vehicle or lyophilized powder can contain additives that maintain isotonicity (e.g., sodium chloride, mannitol) and chemical stability (e.g., buffers and preservatives).
- the formulation is sterilized by commonly used techniques. Suitable pharmaceutical carriers are described in the most recent edition of Remington's
- compositions suitable for administration by injection are prepared by dissolving 1.5% by weight of active ingredient in 0.9% sodium chloride solution.
- Isolated avian influenza antibodies and pharmaceutical compositions comprising isolated avian influenza antibodies can also be administered in the form of a depot injection or implant preparation, which may be formulated in such a manner as to permit a sustained release of the active ingredient.
- the active ingredient can be compressed into pellets or small cylinders and implanted subcutaneously or intramuscularly as depot injections or implants.
- Implants may employ inert materials such as biodegradable polymers or synthetic silicones, for example, Silastic, silicone rubber or other polymers manufactured by the Dow-Corning Corporation.
- Isolated avian influenza antibodies or pharmaceutical compositions comprising isolated avian influenza antibodies can also be administered in the form of liposome delivery systems, such as small unilamellar vesicles, large unilamellar vesicles and multilamellar vesicles.
- Liposomes can be formed from a variety of phospholipids, such as cholesterol, stearylamine, or phosphatidylcholines. Liposomal preparations of diabetes-modulating agents may also be used in the methods of the invention.
- the pharmaceutical compositions can be liquid or solid. Suitable solid oral formulations include tablets, capsules, pills, granules, pellets, and the like.
- Suitable liquid oral formulations include solutions, suspensions, dispersions, emulsions, oils, and the like.
- pharmaceutically acceptable carriers may be aqueous or nonaqueous solutions, suspensions, emulsions or oils.
- non-aqueous solvents are propylene glycol, polyethylene glycol, and injectable organic esters such as ethyl oleate.
- Aqueous carriers include water, alcoholic/aqueous solutions, emulsions, or suspensions, including saline and buffered media.
- oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, mineral oil, olive oil, sunflower oil, and fish-liver oil.
- Solutions or suspensions can also include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose.
- the pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
- Liposomes and non-aqueous vehicles such as fixed oils may also be used.
- the use of such media and agents for pharmaceutically active substances is well known in the art.
- compositions Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
- glucuronic acid L-lactic acid, acetic acid, citric acid or any pharmaceutically acceptable acid/conjugate base with reasonable buffering capacity in the pH range acceptable for intravenous administration can be used as buffers.
- Sodium chloride solution wherein the pH has been adjusted to the desired range with either acid or base, for example, hydrochloric acid or sodium hydroxide, can also be employed.
- a pH range for the intravenous formulation can be in the range of from about 5 to about 12.
- Subcutaneous formulations can be prepared according to procedures well known in the art at a pH in the range between about 5 and about 12, which include suitable buffers and isotonicity agents. They can be formulated to deliver a daily dose of the active agent in one or more daily subcutaneous administrations.
- Sodium chloride solution wherein the pH has been adjusted to the desired range with either acid or base, for example, hydrochloric acid or sodium hydroxide, can also be employed in the subcutaneous formulation.
- a pH range for the subcutaneous formulation can be in the range of from about 5 to about 12.
- compositions of the present invention can also be administered in intranasal form via topical use of suitable intranasal vehicles, or via transdermal routes, using those forms of transdermal skin patches well known to those of ordinary skill in that art.
- suitable intranasal vehicles or via transdermal routes, using those forms of transdermal skin patches well known to those of ordinary skill in that art.
- the dosage administration will, or course, be continuous rather than intermittent throughout the dosage regime.
- the invention provides for stable formulations, which preferably comprise a phosphate buffer with saline or a chosen salt, preserved solutions and formulations containing a preservative, as well as multi-use preserved formulations suitable for pharmaceutical or veterinary use, comprising at least one avian influenza antibody, antibody fragment, or antibody derivative in a pharmaceutically acceptable formulation.
- Preserved formulations contain at least one known preservative or optionally selected from the group consisting of at least one phenol, m-cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol, phenylmercuric nitrite, phenoxyethanol, formaldehyde, chlorobutanol, magnesium chloride (e.g., hexahydrate), alkylparaben (methyl, ethyl, propyl, butyl and the like), benzalkonium chloride, benzethonium chloride, sodium dehydroacetate and thimerosal, or mixtures thereof in an aqueous diluent.
- Any suitable concentration or mixture can be used as known in the art, such as 0.001-5%, or any range or value therein, such as, but not limited to 0.001, 0.003, 0.005, 0.009, 0.01, 0.02, 0.03, 0.05, 0.09, 0.1, 0.2, 0.3, 0.4., 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.3, 4.5, 4.6, 4.7, 4.8, 4.9, or any range or value therein.
- Non-limiting examples include, no preservative, 0.1-2% m-cresol (e.g., 0.2, 0.3. 0.4, 0.5, 0.9, 1.0%), 0.1-3% benzyl alcohol (e.g., 0.5, 0.9, 1.1., 1.5, 1.9, 2.0, 2.5%), 0.001-0.5% thimerosal (e.g., 0.005, 0.01), 0.001-2.0% phenol (e.g., 0.05, 0.25, 0.28, 0.5, 0.9, 1.0%), 0.0005-1.0% alkylparaben(s) (e.g., 0.00075, 0.0009, 0.001, 0.002, 0.005, 0.0075, 0.009, 0.01, 0.02, 0.05, 0.075, 0.09, 0.1, 0.2, 0.3, 0.5, 0.75, 0.9, 1.0%), and the like.
- 0.1-2% m-cresol e.g., 0.2, 0.3. 0.4, 0.5, 0.9
- Dosage unit form refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
- the pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.
- the stable or preserved pharmaceutical compositions and formulations of the invention can be provided to subjects as clear solutions or as dual vials comprising a vial of lyophilized at least one avian influenza antibody, antibody fragment, or antibody derivative that is reconstituted with a second vial containing a preservative or buffer and excipients in an aqueous diluent.
- a single solution vial or dual vial requiring reconstitution can be reused multiple times and can suffice for a single or multiple cycles of subject treatment and thus provides a more convenient treatment regimen than currently available.
- the invention also provides pharmaceutical compositions and formulations comprising at least one avian influenza antibody, fragment, or derivative, and at least one selected from sterile water, sterile buffered water, or at least one preservative selected from the group consisting of phenol, m-cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol, alkylparaben, benzalkonium chloride, benzethonium chloride, sodium dehydroacetate and thimerosal, or mixtures thereof in an aqueous diluent, optionally, wherein the concentration of avian influenza antibody can be about 0.1 mg/ml to about 100 mg/ml, further comprising at least one isotonicity agent or at least one physiologically acceptable buffer.
- the invention also includes pharmaceutical compositions and formulations comprising at least one avian influenza antibody, fragment, or derivative in lyophilized form in a first container, and an optional second container comprising at least one of sterile water, sterile buffered water, or at least one preservative selected from the group consisting of phenol, m- cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol, alkylparaben, benzalkonium chloride, benzethonium chloride, sodium dehydroacetate and thimerosal, or mixtures thereof in an aqueous diluent, optionally further wherein the concentration of avian influenza antibody is reconsitituted to a concentration of about 0.1 mg/ml to about 500 mg/ml, further comprising an isotonicity agent, or further comprising a physiologically acceptable buffer.
- kits comprising packaging material and at least one vial comprising a solution of at least one avian influenza antibody, antibody fragment, or antibody derivative with the prescribed buffers and/or preservatives, optionally, in an aqueous diluent, wherein said packaging material comprises a label that indicates that such solution can be held over a period of 1, 2, 3, 4, 5, 6, 9, 12, 18, 20, 24, 30, 36, 40, 48, 54, 60, 66, 72 hours or greater.
- the invention further comprises a kit comprising packaging material, a first vial comprising lyophilized at least one avian influenza antibody, antibody fragment, or antibody derivative, and a second vial comprising an aqueous diluent of prescribed buffer or preservative, wherein said packaging material comprises a label that instructs a subject to reconstitute the at least one avian influenza antibody, antibody fragment, or antibody derivative in the aqueous diluent to form a solution that can be held over a period of twenty- four hours or greater.
- the pharmaceutical compositions and formulations of the present invention are useful for administration over a period of immediately to twenty-four hours or greater. Accordingly, the presently claimed articles of manufacture offer significant advantages to the subject.
- compositions and formulations of the invention can optionally be safely stored at temperatures of from about 2°C to about 40°C and retain the biologically activity of the protein for extended periods of time, thus allowing a package label indicating that the solution can be held and/or used over a period of 6, 12, 18, 24, 36, 48, 72, or 96 hours or greater. If preserved diluent is used, such label can include use up to 1 to 12 months, one- half, one and a half, and/or two years.
- compositions and formulations of the invention can be provided to subjects as clear solutions or as dual vials comprising a vial of lyophilized (at least one) avian influenza antibody, antibody fragment, or antibody derivative that is reconstituted with a second vial containing the aqueous diluent.
- a single solution vial or dual vial requiring reconstitution can be reused multiple times and can suffice for a single or multiple cycles of subject treatment and thus provides a more convenient treatment regimen than currently available.
- the claimed products can be provided indirectly to subjects by providing to pharmacies, climes, or other such institutions and facilities, clear solutions or dual vials comprising a vial of lyophilized (at least one) avian influenza antibody, antibody fragment, or antibody derivative that is reconstituted with a second vial containing the aqueous diluent.
- the clear solution in this case can be up to one liter or even larger in size, providing a large reservoir from which smaller portions of the at least one avian influenza antibody solution can be retrieved one or multiple times for transfer into smaller vials and provided by the pharmacy or clinic to their customers and/or subjects.
- Recognized devices comprising these single vial systems include those pen-injector devices for delivery of a solution such as BD Pens, BD Autojector®, Humaject®,
- the pharmaceutical compositions, formulations, and kits of the present invention can include packaging material.
- the packaging material provides, in addition to the information required by the regulatory agencies, the conditions under which the product can be used.
- the packaging material of the present invention provides instructions to the subject to reconstitute the at least one avian influenza antibody in the aqueous diluent to form a solution and to use the solution over a period of 2 to 24 hours or greater for the two vial, wet/dry, product.
- the label indicates that such solution can be used over a period of 2 to 24 hours or greater.
- the presently claimed products are useful for human pharmaceutical use.
- the solutions of at least one avian influenza antibody, antibody fragments, or antibody derivatives of the invention can be prepared by a process that comprises mixing at least one avian influenza antibody, fragment, or derivative in an aqueous diluent.
- Mixing the at least one avian influenza antibody and preservative in an aqueous diluent is carried out using conventional dissolution and mixing procedures.
- a suitable formulation for example, a measured amount of at least one avian influenza antibody in buffered solution is combined with the desired preservative in a buffered solution in quantities sufficient to provide the protein and preservative at the desired concentrations. Variations of this process would be recognized by one of ordinary skill in the art.
- compositions and formulations described herein can be provided to subjects as clear solutions or as dual vials comprising a vial of lyophilized (at least one) avian influenza antibody, antibody fragment, or antibody derivative that is reconstituted with a second vial containing water, a preservative and/or excipients, preferably, a phosphate buffer and/or saline and a chosen salt, in an aqueous diluent.
- a single solution vial or dual vial requiring reconstitution can be reused multiple times and can suffice for a single or multiple cycles of subject treatment and thus can provide a more convenient treatment regimen than currently available.
- compositions and formulations of the present invention can be prepared by a process that comprises mixing at least one avian influenza antibody, antibody fragment, or antibody derivative, and a selected buffer, preferably, a phosphate buffer containing saline or a chosen salt.
- a selected buffer preferably, a phosphate buffer containing saline or a chosen salt.
- Mixing the at least one avian influenza antibody, fragment, or derivative and buffer in an aqueous diluent is carried out using conventional dissolution and mixing procedures.
- a suitable formulation for example, a measured amount of at least one avian influenza antibody, antibody fragment, or antibody derivative in water or buffer is combined with the desired buffering agent in water in quantities sufficient to provide the protein and buffer at the desired concentrations. Variations of this process would be recognized by one of ordinary skill in the art. For example, the order the components are added, whether additional additives are used, the temperature and pH at which the formulation is prepared, are all factors that can be optimized for the concentration and means of administration used.
- compositions that contain an active component are well understood in the art, for example, by mixing, granulating, or tablet-forming processes.
- the active therapeutic ingredient is often mixed with excipients that are pharmaceutically acceptable and compatible with the active ingredient.
- the active agents are mixed with additives customary for this purpose, such as vehicles, stabilizers, or inert diluents, and converted by customary methods into suitable forms for administration, such as tablets, coated tablets, hard or soft gelatin capsules, aqueous, alcoholic, or oily solutions and the like as detailed above.
- the isolated avian influenza antibodies, pharmaceutical compositions and formulations containing such isolated avian influenza antibodies can optionally be administered in combination with one or more additional drugs or agents for treatment of avian influenza or sequelae/symptoms related to avian influenza, such as a combination of one or two or more of selected from the group consisting of bronchodilator, cytokine, steroid, non-steroidal anti-inflammatory drug (NSAID), leukotriene receptor antagonist, phosphodiesterase inhibitor, anti-viral drug, immunosuppressive drug, anti-allergic drug, mediator release inhibitor, antihistamine drug, metabolism accelerator, protease inhibitor, reverse transcriptase inhibitor, integrase inhibitor, fusion inhibitor, aldose reductase inhibitor, cannabinoid-2 receptor stimulator, adrenocorticotropic hormone, metalloprotease inhibitor, prostaglandin, disease modifying anti-rheumatic drug, anti-inflammatory enzyme drug, cartilage protective drug, T-cell suppressor, TNF- ⁇ inhibitor, IL-
- Steroids, glucocorticoids, and corticosteroids include, for example, clobetasol propionate, diflorasone diacetate, fluocinonide, mometasone furcate, betamethasone dipropionate, betamethasone butyrate propionate, betamethasone valerate, difluprednate, butesonid, diflucortolone valerate, amcinonide, halcinonide, dexamethasone, dexamethasone propionate, dexamethasone valerate, dexamethasone acetate, hydrocortisone acetate, hydrocortisone butyrate, hydrocortisone butyrate propionate, deprodone propionate, prednisolone valerate acetate, fluocinolone acetonide, beclometasone dipropionate, triamcinolone acetonide, flumetasone pivalate, alclometa
- non-steroidal anti-inflammatory drugs include, for example, sasapyrine, sodium salicylate, aspirin, aspirin.cndot.di-aluminate composition, diflunisal, indometacin, suprofen, ufenamate, dimethyl isopropylazulene, bufexamac, felbinac, diclofenac, tolmetin sodium, Clinoril, fenbufen, nabumetone, proglumetacin, indometacin farnesil, acemetacin, proglumetacin maleate, amfenac sodium, mofezolac, etodolac, ibuprofen, ibuprofen piconol, naproxen, flurbiprofen, flurbiprofenaxetil, ketoprofen, fenoprofen calcium, thiaprofen, oxaprozin, pranoprofen, loxopro
- immunosuppressants include, for example, Protopic (FK-506), methotrexate, cyclosporine, ascomycin, leflunomide, bucillamine, salazosulfapyridine, sirolimus, mycophenolate mofetil, and the like.
- Prostaglandins include PG receptor agonist, PG receptor antagonist, and the like.
- Examples of PG receptor include PGE receptor (EPl, EP2, EP3, EP4), PGD receptor (DP, CRTH2), PGF receptor (FP), PGI receptor (IP), TX receptor (TP), and the like.
- Mediator release inhibitor include, for example, tranilast, sodium cromoglicate, amlexanox, repirinast, ibudilast, tazanolast, pemirolast potassium, and the like.
- antihistamines include, for example, ketotifen fumarate, mequitazine, azelastine hydrochloride, oxatomide, terfenadine, emedastine difumarate, epinastine hydrochloride, astemizole, ebastine, cetirizine hydrochloride, bepotastine, fexofenadine, loratadine, desloratadine, olopatadine hydrochloride, TAK-427, ZCR-2060, NIP-530, mometasone furoate, mizolastine, BP-294, andolast, auranofin, acrivastine, famotidine, ranitidine, cimetidine, and the like.
- Phosphodiesterase inhibitors include, for example, the PDE4 inhibitors such as rolipram, cilomilast (also known in the art as Ariflo), Bay 19-8004, NIK-616, roflumilast (BY-217), cipamphylline (BRL-61063), atizoram (CP-80633), SCH-351591, YM-976, V- 1 1294A, PD-168787, D-4396, IC-485, and the like.
- the PDE4 inhibitors such as rolipram, cilomilast (also known in the art as Ariflo), Bay 19-8004, NIK-616, roflumilast (BY-217), cipamphylline (BRL-61063), atizoram (CP-80633), SCH-351591, YM-976, V- 1 1294A, PD-168787, D-4396, IC-485, and the like.
- leukotriene receptor antagonists include, for example, pranlukast hydrate, montelukast, zafirlukast, seratrodast, MCC-847, KCA-757, CS-615, YM-158, L-740515, CP- 195494, LM-1484, RS-635, A-93178, S-36496, BIIL-284, ONO-4057, and the like.
- Thromboxane A2 receptor antagonist include, for example, seratrodast, ramatroban, domitroban calcium hydrate, KT-2-962, and the like.
- thromboxane synthase inhibitor examples include, for example, ozagrel hydrochloride, imitrodast sodium, and the like.
- Xanthine derivatives include, for example, aminophylline, theophylline, doxophylline, cipamphylline, diprophylline, and the like.
- Anticholinergic agents include, for example, ipratropium bromide, oxitropium bromide, flutropium bromide, cimetropium bromide, temiverine, tiotropium bromide, revatropate (UK-112166), oxybutynin hydrochloride, bethanechol chloride, propiverine hydrochloride, propantheline bromide, methylbenactyzium bromide, scopolamine butylbromide, tolterodine tartrate, trospium chloride, Z-338, UK-
- ⁇ 2-adrenaline receptor stimulants include, for example, fenoterol hydrobromide, salbutamol sulfate, terbutaline sulfate, formoterol fumarate, salmeterol xinafoate, isoproterenol sulfate, orciprenaline sulfate, chlorprenaline sulfate, epinephrine, trimetoquinol hydrochloride, hexoprenalinemesyl sulfate, procaterol hydrochloride, tulobuterol hydrochloride, tulobuterol, pirbuterol hydrochloride, clenbuterol hydrochloride, mabuterol hydrochloride, ritodrine hydrochloride, bambuterol, dopexamine hydrochloride, meluadrine tartrate, AR-C68397, levosalbutamol, R,R-formoterol,
- cytokines examples include TNF- ⁇ , IFN- ⁇ , IFN- ⁇ and IFN- ⁇ , interleukin- 1 , interleukin-6, interleukin-12, and the like.
- Reverse transcriptase inhibitors include, without limitation, (1) nucleic-acid reverse transcriptase inhibitors: zidovudine (Retrovir), didanosine (Videx), zalcitabine (HIVID), stavudine (Zerit), lamivudine (Epivir), abacavir (Ziagen), adefovir, adefovir dipivoxil, emtricitabine (Coviracil), PMPA (Tenofovir), and the like, (2) nonnucleic-acid reverse transcriptase inhibitors: nevirapine (Viramune), delavirdine (Rescriptor), efavirenz (Sustiva, Stocklin), capravirine (AGl 549), and the like.
- nucleic-acid reverse transcriptase inhibitors zidovudine (Retrovir), didanosine (Videx), zalcitabine (HIVID), stavudine (Zer
- protease inhibitor examples include, but are not limited to, indinavir (Crixivan), ritonavir (Norvir), nelfinavir (Viracept), saquinavir (Invirase, Fortovase), amprenavir (Agenerase), lopinavir (Kaletra), tipranavir, and the like.
- chemokine antagonists internal ligands of chemokine receptor, its derivatives, non-peptide low molecular compounds or antibodies of chemokine receptor are included.
- internal ligands of chemokine receptors include, without limitation, MIP- l ⁇ , MIP-I ⁇ , RANTES, SDF-l ⁇ , SDF-l ⁇ , MCP-I, MCP-2, MCP-4, Eotaxin, MDC, and the like.
- the derivatives of internal ligand include, but are not limited to, AOP-RANTES, Met-SDF-l ⁇ , Met-SDF-l ⁇ , and the like.
- Antibodies of chemokine receptor include, for example, Pro- 140, and the like.
- CCRl antagonists include, but are not limited to, the compounds disclosed in the specification of WO98/04554, WO98/38167, WO99/40061, WO00/14086, WO00/14089, WO01/72728, JP2002- 179676, WO02/036581, WO03/013656, WO03/035627, WO03/035037, or BX-471, and the like.
- CCR2 antagonists include compounds disclosed in the specification of WO99/07351, WO99/40913, WO00/46195, WO00/46196, WO00/46197, WO00/46198, WO00/46199, WO00/69432,
- CCR3 antagonists include, without limitation, compounds disclosed in the specification of DEl 9837386, WO99/55324, WO99/55330, WO00/04003, WO00/27800, WO00/27835, WO00/27843, WO00/29377, WO00/31032, WO00/31033, WO00/34278, WO00/35449, WOOO/35451 , WO00/35452, WOOO/35453, WO00/35454, WO00/35876, WO00/35877, WO00/41685, WO00/51607, WOOO/51608, WOOO/51609, WO00/51610, WO00/53172, WO00/53600, WO00/58305, WO00/59497, WOOO/59498, WO00/59502, WOOO/5
- CCR4 antagonists include, but are not limited to, compounds disclosed in the specification of WO02/030357, WO02/030358, WO02/094264, WO03/051870, WO03/059893, and the like.
- CCR5 antagonists include compounds disclosed in the specification of WO99/17773, WO99/32100, WOOO/06085, WO00/06146, WO00/10965, WOOO/06153, WO00/21916, WO00/37455, EP1013276, WO00/38680, WO00/39125, WO00/40239, WO00/42045, WOOO/53175, WO00/42852, WO00/66551 , WO00/66558, WO00/66559, WO00/66141, WOOO/68203, JP2000309598, WO00/51607, WOOO/51608, WOOO/51609, WOOO/51610, WO00/5
- CXCR4 antagonists include AMD-3100, T-22, KRH-1120 or the compounds disclosed in the specification of WO00/66112, and the like.
- fusion inhibitors include, without limitation, T-20 (pentafuside), T- 1249, and the like.
- Integrase inhibitors include, but are not limited to, Equisetin, Temacrazine, PL- 2500, V- 165, NSC-618929, L-870810, L-708906 analog, S- 1360, 1838, and the like.
- disease-modifying anti-rheumatic drugs include, in concrete terms, aurothioglucose, gold sodium thiomalate, auranofin, actarit, D-penicillamine, lobenzarit disodium, bucillamine, hydroxychloroquine, salazosulfapyridine, and the like.
- anti-inflammatory enzyme preparations include, in concrete terms, lysozyme hydrochloride, bromelain, pronase, serrapeptase, combination drugs of streptokinase-streptodornase, and the like.
- cartilage protectants include, in concrete terms, sodium hyaluronate, glucosamine, chondroitin sulfate, glycosaminoglycan polysulfate, and the like.
- Other agents, including anti- viral agents commonly prescribed for treatment of influenza include, but are not limited to, amantadine, zanamivir, acyclovir, oseltamavir, and ribavirin.
- the DNA sequence encoding for the H5 hemagglutinin protein sequence of the HPAI influenza strain A/Hong Kong/483/97 was obtained from the NCBI nucleotide database. This viral strain was selected as it was isolated from one of the first fatal human cases of H5 influenza during the outbreak of chicken and human influenza in Hong Kong in 1997. The full length genetic sequence was assembled into a synthetic gene in the pUCminusMCS vector by Blue Heron Biotechnology (Bothwell, WA).
- HK483 H5 hemagglutinin (HA) gene was cloned from the pUCminusMCS vector supplied by Blue Heron and inserted into the pCI mammalian expression vector (Promega, Madison, WI) under the control of the CMV promoter.
- the plasmid also referred to herein as "pCI-HK483" was then sequenced to verify that the insert was complete and in the correct orientation.
- the DNA sequence was also verified by in silico translation using the NEBcutter V2.0 online tool (New England Biolabs, Ipswich, MA).
- the resulting protein sequence was used to search the NCBI blast database and returned a 100 % match for the HK-483 hemagglutinin protein (accession # AAC32099).
- the pCI-HK483 plasmid was then transformed into DH5aTM-TlR competent cells (Invitrogen Cat # 12297-016) and plated onto LB-ampicillin agar plates. Colonies were screened for successful insertion of the pCI-HK483 plasmid by restriction digest. The plasmid from selected colonies was again verified by DNA sequencing.
- a large scale preparation of endotoxin-free plasmid was prepared from a selected E. coli transformants using an EndoFree Plasmid Gigakit from Qiagen (Valencia, CA). The purified, endotoxin- free plasmid was harvested according to the manufacturer's instructions and stored at -20°C until needed.
- HEK 293 cells (ATCC CRL-1573TM) were transfected with pCI-HK483 plasmid using Lipofectamine 2000 (Invitrogen Cat # 11668-019). After 48 hours, incubation cells were harvested and a batch of transfected cell lysate was prepared using RIPA buffer (Pierce, Rockford, IL). A control batch of untransfected HEK293 lysate was also prepared. Embryonated hens eggs were inoculated with the low pathogenicity avian influenza (LPAI) strain A/mallard duck/Pennsylvania/ 10218/84 (H5N2) (ATCC® 1331-VR) under BSL-3 conditions.
- LPAI low pathogenicity avian influenza
- Virus particles were inactivated by mixing the allantoic fluid with an equal volume of ethyl ether in a stoppered separating funnel and mixing vigorously for 30 minutes. After allowing the mixture to stand to facilitate its separation into two phases, the lower portion was decanted from the separating funnel via the stop-cock and sparged with nitrogen to remove any residual ether. A control batch of uninfected allantoic fluid was prepared in a similar fashion as a control.
- a Western blot was performed using pCI-HK483 transfected and untransfected HEK293 cell extracts and infected allantoic fluid as an antigen source.
- the blot was developed using a commercially available mouse polyclonal antibody directed against the HAl portion of influenza H5 molecule (Immune Technology Cat # IT-003-005).
- Figure 1 indicated that the anti-H5 polyclonal antibody specifically recognized the H5 allantoic fluid indicating reactivity with H5 HA protein. Reactivity was also noted against pCI-HK483 transfected HEK293 extract, but not against untransfected control cell extract. This data indicates that transfection of HEK293 cells with the pCI-HK483 construct results in the production of H5 HA protein.
- Example 2 Generation of Hybridomas
- a pre-bleed serum sample was obtained by withdrawing no more than 200 ⁇ l of whole blood via the lateral tail vein of each mouse according to ATCC standard operating procedures (SOP).
- Purified endotoxin-free pCI-HK483 at a dose of 100 ⁇ g was prepared in sterile Ringers' solution in a volume equal to 8 % of the body weight of the animal.
- the maximum volume to be delivered was capped at 3.0 mL (equivalent to a 37.5 g mouse).
- the DNA solution was injected as a bolus into the lateral tail vein according to ATCC SOP in 6 to 7 seconds. Mice were immunized in this fashion a total of 4 times on days 0, 14, 21, and 28.
- the murine polyclonal antiserum appears to react more strongly with the influenza proteins than the commercial preparation, and has lower non-specific binding.
- the murine polyclonal recognizes 3 protein species - the full length HAO, and the HA 1 and HA2 components of the spliced hemagglutinin molecule.
- the commercial preparation does not react with the HA2 species as the antigen for this immunization was a truncated protein that does not contain the HA2 portion of the molecule.
- hybridoma cell lines were produced by fusing the splenocytes with the murine myeloma cell line Sp2/0-Agl4 (ATCC® CRL-1581TM) using a standard protocol. Following plating by limiting dilution, outgrowing colonies were screened for differential reactivity against recombinant HK483 HA protein by ELISA. Initially, ELISA plates were coated with transfected HEK293 cell lysate. The absolute ELISA OD was used to screen for putative reactive clones. Following 2 rounds of screening using this method, the 13 most reactive clones were selected for subcloning and further characterization ( Figure 5).
- HEK293 cells directly. Fluorescent conjugate antibodies were used to visualize any staining of the cells using a fluorescent microscope. The images shown in Figure 8 indicate that transfected HEK293 cells stain positively with both monoclonal antibodies, whereas untransfected HEK293 cells do not. Transfected and untransfected HEK293 stained with either Immune Technologies anti-H5 polyclonal antiserum, ATCC produced murine anti- HP AI H5 polyclonal antiserum were included as positive controls and conditioned supernatant from the murine myeloma cell line Sp2/0-Agl4 was used as a negative control.
- Example 4 Sequencing of Variable Regions of Selected Hybridoma Clones To determine the sequence of the variable regions of clones 6D5-F5 and 1F7-F2, a frozen pellet of 106 cells from each hybridoma cell line was used. Total RNA extraction was performed using the RNeasy kit (Qiagen, Valencia, CA), and the quantity and quality of extracted RNA was measured using the Agilent 2100 Bioanalyzer (Agilent RNA Nano Kit). cDNA synthesis and PCR amplification of variable regions of each of the immunoglobin transcripts (heavy and light chains) was performed using the Superscript III One-Step RT-PCR kit and Platinum Taq DNA polymerase (Invitrogen, Carlsbad, CA).
- PCR amplicons representing the variable regions of heavy and light chains of each immunoglobulin were then cloned into pCR 2.1 -TOPO vector (TOPO TA Cloning Kit, Invitrogen).
- Transformed competent cells were plated onto ImMedia Amp Blue plates (Invitrogen, Carlsbad, CA) and then selected using blue-white screening. Clones were grown overnight using LB Media with 50ug/L ampicillin, and plasmid DNA was extracted using QIAprep Spin Miniprep kit (Qiagen, Valencia, CA). The presence of inserts was confirmed by restriction endonuclease digestion using EcoRI.
- Sequencing was performed by in a CEQ 8000 Genetic Analysis System (Beckman-Coulter, Fullerton, CA) and the CodonCode Aligner software (Codon Code, Dedham, Ma) was used for data analysis.
- BLAST analyses were performed to compare the sequences of the variable regions of heavy and light chains of immunoglobulin with published sequences.
- nucleotide and amino acid sequences of the variable regions of clone 1F7 heavy and light (kappa) chains are as follows: Clone 1F7 variable region heavy chain; nucleotide sequence (SEO ID NO: 1) GAGGTGCAGCTGGAGGAGTCAGGACCTGGCCTGGTGGCGCCCTCACAGA
- nucleotide and amino acid sequences of the variable regions of clone 6D5 heavy and light (kappa) chains are as follows: Clone 6D5 variable region heavy chain; nucleotide sequence (SEQ ID NO: 5)
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Virology (AREA)
- Biophysics (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Pulmonology (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Communicable Diseases (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Abstract
The present invention relates to isolated avian influenza antibodies, isolated cells and pharmaceutical compositions comprising such avian influenza antibodies, methods of diagnosing subjects suspected or having or at risk for developing an avian influenza infection, and methods of treating subjects using such antibodies.
Description
AVIAN INFLUENZA ANTIBODIES, COMPOSITIONS, AND
METHODS THEREOF
FIELD OF THE INVENTION The present invention relates generally to the fields of immunology and cell biology.
In particular, the present invention relates to isolated avian influenza antibodies, isolated cells and pharmaceutical compositions, and methods of immunizing subjects using such antibodies.
BACKGROUND OF THE INVENTION Influenza is a seasonal epidemic disease in humans, occurring during the colder months in temperate climates and occasionally accompanied by mortality in older adults. In tropical and subtropical climates, infections occur throughout the year, often with one or two peaks of increased activity. Periodically, and at irregular intervals, severe worldwide pandemic outbreaks occur. Historical evidence suggests that pandemics have occurred at 10 to 40-year intervals since the 1600s, originating mainly in Asia. Three pandemics occurred in the past century: the Spanish influenza pandemic in 1918-1919, which claimed an estimated 50 million lives and the Asian (1957) and Hong Kong (1968-1969) pandemics, which each resulted in 1-2 million deaths.
Three types of human influenza viruses have been recognized, termed types "A," "B," and "C" and are distinguished by their antigenically distinct nucleoprotein and matrix protein. These viruses are classified as members of the genus Orthomyxovirus in the family Orthomyxoviridae, and are named according to their type, location where isolated, the successive isolate number from that location, and year of isolation. Only influenza A and B are responsible for major outbreaks and severe disease. Influenza A and B viruses have two major surface glycoprotein antigens hemagglutinin (HA), responsible for cell attachment, and an enzymatically active neuraminidase (NA), which assists virus maturation and release. For the virus to be infectious, the viral HA must undergo post-translational cleavage into two peptides, HAl and HA2. These two surface antigens of both influenza A and B undergo gradual, progressive antigenic variation, referred to as "antigenic drift", which allows the viruses to escape immunity acquired through infection or vaccination and to cause further outbreaks and epidemics. These changes can also be seen by phylogenetic analysis of the HA and NA gene sequences. In addition, influenza A viruses with three antigenically distinct HAs and two distinct NAs have circulated in the human population since laboratory studies
commenced, and the influenza A viruses are now divided into subtypes based on their HA proteins.
The Asian and Hong Kong pandemics involved the emergence of new influenza A subtypes in the human population, so few, if any, had an immunity to the HA antigens. This phenomenon is referred to as "antigenic shift". Influenza viruses have evolved in an avian host and aquatic birds are the major reservoir of influenza A viruses. For influenza A, sixteen antigenically distinct HAs and nine NAs have been recognized, all of which can be found asymptomatically circulating in aquatic birds. Some subtypes are capable of infecting and even becoming established in certain mammals, including horses, swine and humans, and some have been able to infect and cause disease in domestic poultry. Influenza viruses display host specificity, and avian viruses do not usually infect humans. A major determinant of this specificity is the difference in cell receptor binding requirements of the HA molecule via differing conformations of carbohydrate (N-acetylneuraminic acid) residues on cell surfaces of different species. However, there is evidence that a significant change in receptor preference can occur with as little as a single amino acid mutation at the HA receptor site, and during evolution of new subtypes in humans, the binding preference for mammalian cell receptors increases with further mutations as a subtype continues to emerge.
Although influenza viruses are usually non-pathogenic in their natural waterfowl hosts, two subtypes in particular, H5 and H7 may become highly pathogenic once introduced into domestic poultry. The transition of these subtypes to a highly pathogenic form is associated with acquisition of additional basic amino acids at the cleavage site of the HA molecule. This transforms the virus from one in which cleavage activation of the HA is restricted to the respiratory and intestinal tract, where there are trypsin-like proteases, into one that can be activated by cell-associated proteases that are found throughout the body, resulting in a generalized infection referred to as "pantropism". Historically, outbreaks of the highly pathogenic forms of avian influenza (HPAI) were sporadic, with only 17 episodes reported in the period 1959-1997, and none in Asia. With a single exception, the HPAI form of the virus had not been detected in wild aquatic birds and there had been little evidence that humans could be affected by these viruses, with only two recorded cases, both involving H7 virus.
Recently, influenza A/H5N1 has developed into an epizootic of domestic poultry with associated human infections, observed first in Hong Kong in 1997, spreading throughout South-East Asia over the following 7 years, and then extending to Russia, Europe, Africa, the Indian subcontinent and the Middle East during the latter part of 2005 and early 2006. The first indication of this outbreak was a fatal human case of H5N1 infection in Hong Kong in May 1997. This was followed later in the year by a further 17 cases (five fatal), all associated with contact with infected poultry. A cull of poultry in Hong Kong appeared to have controlled this outbreak, but it reemerged progressively and largely undetected in Asia during 2003 and then caused major outbreaks in Thailand and Vietnam early in 2004, with reports of human cases in which the mortality rate was around 50%. Indeed, by 2006, the WHO had confirmed 256 cases from 10 countries in Asia and Africa, with 151 deaths — a case fatality rate of 59%. The reason for the sudden change in the epidemiology of the H5 virus is unclear; a substantial increase in poultry production in Asia, generally under poor housing conditions and often accessible to wild birds, may be a contributing factor. Analysis of the human and avian isolates over the history of these outbreaks has shown that the virus has undergone extensive genetic change, both by repeated reassortment with avian viruses and by mutation, and that a number of antigenic and genetic lineages of virus have emerged in bird populations in different regions. In addition, the highly pathogenic form of the virus has been found widely distributed in aquatic birds, including migratory species, and it appears that these, as well as trade in domestic poultry, have contributed to the widening geographic spread of infection. Most of the human infections that have occurred appear to have been acquired from direct contact with poultry or poultry products. Although there has been evidence of occasional human-to-human transmission, there is evidence neither of genetic reassortment with human influenza, nor of a significant change of receptor specificity. However, there may be adaptive changes conducive to interspecies transmission.
Therefore, the worldwide health risk as a result of avian influenza has created an urgent need in the art for effective methods and therapeutic agents to treat avian influenza in humans. To assist in the development of diagnostic tests, therapeutics and vaccines, well characterized immunological reagents are required for the study of this emerging human pathogen. As disclosed herein, the present invention meets this need by providing novel antibodies, compositions containing such antibodies, and methods of using such antibodies.
SUMMARY OF THE INVENTION
The present invention relates to novel isolated avian influenza antibodies, methods of using such avian influenza antibodies to diagnose or identify subjects having avian influenza or suffering from an avian influenza infection, methods of treating subjects who have an avian influenza infection, or who are suspected of having an avian influenza infection, and pharmaceutical compositions/formulations comprising such avian influenza antibodies. The subject matter of the present invention is particularly useful in detecting, treating, and immunizing subjects against the highly pathogenic avian influenza strain H5N1. Accordingly, in one embodiment, the invention provides an isolated avian influenza antibody comprising a fragment crystallizable (Fc) constant region and an antigen-binding region, wherein the antigen-binding region binds one or more avian influenza viral proteins or a peptide, fragment or derivative thereof with high affinity. The avian influenza proteins or peptide, fragment, or derivative thereof can be derived from, for example, avian influenza strain H5N1, but is not limited to this particular strain. The one or more avian influenza viral proteins can comprise, for example, hemagglutinin, neuraminidase, polymerase basic protein, RNA-directed RNA polymerase, polymerase acidic protein, matrix protein 1, matrix protein 2, nucleocapsid, non-structural protein 1 , or non-structural protein 2. Preferably, the hemagglutinin is hemagglutinin H5. The antibodies described by the present invention can be recombinant. Preferably, the
Fc constant region of the antibodies of the invention comprises sequences derived from a human.
The present invention also provides an isolated avian influenza H5N1 antibody, comprising a human fragment crystallizable region and an antigen-binding region, wherein the antigen-binding region binds avian influenza hemagglutinin H5 with high affinity. A pharmaceutical composition comprising the isolated antibody of the present invention is also provided, along with one or more pharmaceutically acceptable buffers, excipients, and/or diluents.
The present invention also provides a kit for detecting the presence of avian influenza virus, viral particles, viral proteins, or viral peptides in a sample from a subject, comprising one or more detection reagents, a sample from a subject who has not been diagnosed as having avian influenza, and optionally instructions for use, wherein the detection reagents
comprise isolated antibody described herein. The kit can comprise detection reagents such as, but not limited to, one or more aptamers, one or more oligonucleotides, or combinations thereof.
The present invention also provides a method of diagnosing or identifying one or more subjects having an avian influenza infection, comprising contacting one or more cells from the subject with the isolated antibody of claim 1, and detecting the presence of avian influenza viral protein bound to the antibody.
A method of treating a subject having an avian influenza infection is also provided, comprising administering a therapeutically effective amount of the pharmaceutical composition of the invention to the subject, and detecting changes in the amount of avian influenza viral proteins in a sample from the subject.
Also provided by the present invention is a method of immunizing a subject against avian influenza infection, comprising administering a prophylactically effective amount of the pharmaceutical composition described herein to the subject, and detecting changes in the amount of avian influenza viral proteins in a sample from the subject.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. Although methods and materials similar or equivalent to those described herein can be used in the practice of the present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are expressly incorporated by reference in their entirety. In cases of conflict, the present specification, including definitions, will control. In addition, materials, methods, and examples described herein are illustrative only and are not intended to be limiting.
Other features and advantages of the invention will be apparent from and are encompassed by the following detailed description and claims.
BRIEF DESCRIPTION OF THE DRAWINGS
The following Detailed Description, given by way of example, but not intended to limit the invention to specific embodiments described, may be understood in conjunction with the accompanying Figures, incorporated herein by reference, in which:
Figure 1 is a Western blot detecting recombinant hemagglutinin H5 protein in pCI- HK483 transfected HEK 293 cell lysates using a commercial polyclonal anti-serum against
H5 HA. Lane 1 corresponds to MagicMark XP ladder; Lanes 2-5 correspond to 50 μg, 75 μg, 100 μg, and 125 μg of pCI-HK483 transfected HEK 293 cell extracts; Lane 6 corresponds to 125 μg of untransfected HEK 293 cell extract; and Lane 7 corresponds to 30 μg of ether split A/mallard duck/Pennsylvania 10218/84 (H5N2) infected allantoic fluid. Figure 2 is a graph depicting the ELISA data for mouse polyclonal anti-serum following repeated hydrodynamic injection of Balb/c mice. Mouse 795 demonstrated the highest ELISA reactivity post-immunization against pCI-HK483 transfected cell extracts.
Figures 3 A and 3B are Western blots of pCI-HK483 transfected (Figure 3A) and untransfected (Figure 3B) HEK 293 cell extracts using murine polyclonal anti-serum obtained following hydrodynamic immunization of Balb/c mice with pCI-HK483 plasmid. Lane 1 corresponds to SeeBlue Marker; Lane 2 corresponds to cell extracts from Mouse 794; Lane 3 corresponds to cell extracts from Mouse 795; and Lane 4 corresponds to cell extracts from Mouse 796.
Figures 4A and 4B depict Western blotting profiles in an experiment comparing the commercial Immune Technologies H5 polyclonal antiserum (Figure 4A) and murine polyclonal anti-serum produced by the inventors using hydrodynamic injection of mice with pCI-HK483 (Figure 4B). The murine polyclonal anti-serum reacts more specifically and with greater intensity than the commercial preparation. Additionally, the murine polyclonal antiserum preparation recognizes the HA2 region of the HA protein, whereas the commercial preparation does not.
Figures 5 A and 5B are graphs showing an ELISA screening of murine hybridomas against pCI-HK483 transfected HEK 293 whole cell extracts. The hybridoma supernatants exhibiting the greatest reactivity with the antigen preparation are shown in rank order.
Figures 6A and 6B are graphs depicting secondary screening of hybridoma clones for reactivity with HPAI H5 hemagglutinin. The ratio of optical density (OD) readings for positive and negative antigen preparations is shown for the HPAI strain and the LPAI strain. Two hybridomas (clones 6D5-F5 and 1F7-F2) exhibited elevated reactivity with the HK483 HPAI hemagglutinin and demonstrated no cross-reactivity with the protein from the LAPI H5N2 strain. Figures 7A and 7B depict Western blots showing confirmation of specificity of clones
6D5-F5 (Figure 7A) and 1F7-F2 (Figure 7B) for HPAI H5 hemagglutinins. Bands
corresponding to HAi are evident for the HK485 antigen preparation, but none is noted for the H5N2 LPAI antigen preparation.
Figure 8 are immunofluorescence micrographs showing the detection of HK483 hemagglutinin. Strong reactivity of murine polyclonal anti-serum and monoclonal antibodies 6D5-F5 and 1F7-F2 can be seen in pCI-HK483 transfected HEK 293 cells. No reactivity is noted for untransfected HEK 293 cells (top panel). Staining with Immune Tech anti-H5 polyclonal antibody and SP-2/0-Agl4 murine myeloma supernatant was included as positive and negative controls, respectively (lower panel).
DETAILED DESCRIPTION OF THE INVENTION
The present invention relates to isolated avian influenza antibodies, in particular avian influenza strain H5N1, that are capable of binding to an epitope of one or more avian influenza viral proteins, such as, for example, hemagglutinin H5 or neuraminidase Nl. The present invention also concerns cell lines and hybridomas expressing the isolated avian influenza antibodies described herein, as well as pharmaceutical compositions comprising such isolated antibodies, and methods of immunizing subjects using such isolated antibodies. The antibodies, compositions, cell lines, and methods provided herein can be used to therapeutically treat existing avian influenza infections occurring in subjects, or alternatively, can be used to prophylactically prevent avian influenza infections in subjects. As used herein, "a," an" and "the" include singular and plural referents unless the context clearly dictates otherwise. Thus, for example, reference to "an active agent" or "a pharmacologically active agent" includes a single active agent as well as two or more different active agents in combination, reference to "a carrier" includes mixtures of two or more carriers as well as a single carrier, and the like. The term "antibody" is meant to include polyclonal antibodies, monoclonal antibodies
(mAbs), chimeric antibodies, neutralizing antibodies, anti-idiotypic (anti-Id) antibodies to antibodies that can be labeled in soluble or bound form, as well as fragments, regions or derivatives thereof, provided by any known technique, such as, but not limited to, enzymatic cleavage, peptide synthesis or recombinant techniques. As used herein, the term "antigen binding region" refers to that portion of an antibody molecule which contains the amino acid residues that bind and interact with an antigen and confer on the antibody its specificity and affinity for the antigen. The antibody region
includes the "framework" amino acid residues necessary to maintain the proper conformation of the antigen-binding residues.
An "antigen" is a molecule or a portion of a molecule capable of being bound by an antibody which is additionally capable of inducing an animal to produce antibody capable of binding to an epitope of that antigen. An antigen can have one or more than one epitope. The specific reaction referred to above is meant to indicate that the antigen will react, in a highly selective manner, with its corresponding antibody and not with the multitude of other antibodies which can be evoked by other antigens. Preferred antigens that bind antibodies, fragments and regions of antibodies of the present invention include at least one, preferably two, three, four, five, six, seven, eight, nine, ten or more amino acid residues of one or more avian influenza viral proteins, such as but not limited to, hemagglutinin, neuraminidase, polymerase basic proteins, RNA-directed RNA polymerase, polymerase acidic proteins, matrix protein 1, matrix protein 2, nucleocapsid, non-structural protein 1, and non-structural protein 2. The term "epitope" is meant to refer to that portion of any molecule capable of being recognized by and bound by an antibody at one or more of the antibody's antigen binding regions. Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and have specific three dimensional structural characteristics as well as specific charge characteristics. An epitope can comprise the antibody binding region of any one or more avian influenza viral proteins disclosed herein (such as, for example, hemagglutinin or neuraminidase), or a metabolite thereof. An epitope can also comprise at least one, preferably two, three, four, five, six, seven, eight, nine, ten or more amino acid residues of avian influenza hemagglutinin H5 or neuraminidase Nl. The amino acid residues of the epitope that are recognized by the isolated antibodies of the invention need not be contiguous.
"Isolated," when used to describe the various avian influenza antibodies, antibody fragments, proteins, and polypeptides disclosed herein, means polypeptide that has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials that would typically interfere with diagnostic or therapeutic uses for the polypeptide, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. Ordinarily, the isolated antibody, fragment, protein, or polypeptide will be prepared by at least one purification step.
An "isolated" avian influenza antibody-encoding nucleic acid or other polypeptide- encoding nucleic acid is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the natural source of the polypeptide-encoding nucleic acid. An isolated nucleic acid molecule is other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from the corresponding nucleic acid molecule as it exists in natural cells. However, an isolated nucleic acid molecule includes nucleic acid molecules contained in cells that ordinarily express the polypeptide where, for example, the nucleic acid molecule is in a chromosomal location different from that of natural cells. A "sample" in the context of the present invention is a biological sample isolated from a subject and can include, for example, serum, blood plasma, blood cells, endothelial cells, tissue biopsies or extracts or homogenates, lymphatic fluid, pancreatic juice, ascites fluid, interstitial fluid (also known as "extracellular fluid" and encompasses the fluid found in spaces between cells, including, inter alia, gingival crevicular fluid), bone marrow, sputum, saliva, tears, or urine, inflammatory exudate, cerebrospinal fluid, amniotic fluid, and the like.
"Stringency" of hybridization reactions is readily determinable by one of ordinary skill in the art, and generally is an empirical calculation dependent upon probe length, washing temperature, and salt concentration. In general, longer probes require higher temperatures for proper annealing, while shorter probes need lower temperatures. Hybridization generally depends on the ability of denatured DNA to reanneal when complementary strands are present in an environment below their melting temperature. The higher the degree of desired homology between the probe and hybridizable sequence, the higher the relative temperature which can be used. As a result, it follows that higher relative temperatures would tend to make the reaction conditions more stringent, while lower temperatures less so. For additional details and explanation of stringency of hybridization reactions, see Ausubel et al., Current Protocols in Molecular Biology, Wiley Interscience Publishers, (1995).
"Stringent conditions" or "high stringency conditions", as defined herein, may be identified by those that: (1) employ low ionic strength and high temperature for washing, for example 0.015 M sodium chloride/0.0015 M sodium citrate/0.1% sodium dodecyl sulfate at 500C; (2) employ during hybridization a denaturing agent, such as formamide, for example, 50% (v/v) formamide with 0.1% bovine serum albumin/0.1% Ficoll/0.1%
polyvinylpyrrolidone/50 mM sodium phosphate buffer at pH 6.5 with 750 mM sodium chloride, 75 mM sodium citrate at 42°C; or (3) employ 50% formamide, 5x SSC (0.75 M NaCl, 0.075 M sodium citrate), 50 mM sodium phosphate (pH 6.8), 0.1% sodium pyrophosphate, 5x Denhardt's solution, sonicated salmon sperm DNA (50 μg/ml), 0.1% SDS, and 10% dextran sulfate at 42°C, with washes at 42°C in 0.2x SSC (sodium chloride/sodium citrate) and 50% formamide at 55°C, followed by a high-stringency wash consisting of 0.1 x SSC containing EDTA at 55°C. "Moderately stringent conditions" may be identified as described by Sambrook et al., Molecular Cloning: A Laboratory Manual, New York: Cold Spring Harbor Press, 1989, and include the use of washing solution and hybridization conditions (e.g., temperature, ionic strength and %SDS) less stringent that those described above. An example of moderately stringent conditions is overnight incubation at 37°C in a solution comprising: 20% formamide, 5x SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5x Denhardt's solution, 10% dextran sulfate, and 20 mg/ml denatured sheared salmon sperm DNA, followed by washing the filters in Ix SSC at about 37-50°C. The skilled artisan will recognize how to adjust the temperature, ionic strength, etc. as necessary to accommodate factors such as probe length and the like.
A "subject" in the context of the present invention is preferably a mammal. The mammal can be a human, non-human primate, mouse, rat, dog, cat, horse, pig, bird, or cow, but are not limited to these examples. A subject can be male or female.
Influenza Viral Structure, Life Cycle, and Infectivity
Influenza virus is shed into respiratory secretions, which are then coughed or sneezed into the air and transmitted to the next host. Infection occurs in the cells of the tracheobronchial epithelium, where the first cycle of replication takes 4-6 hours. Very high titres of virus are shed during the initial infection period. This, combined with the short incubation period, produces the characteristically explosive nature of influenza outbreaks. Estimates of attack rates in outbreaks vary from 10% to nearly 100%, depending on the type of community, age of individuals, vaccination rates and methods of diagnosis.
Influenza infection ranges in severity from asymptomatic infection to serious illness with systemic features. The potential sequelae of influenza infection include viral and bacterial pneumonia and contribute to the overall burden of the disease. Acute infection is characterized by abrupt onset of symptoms that include fever (in the region of 38-400C) or
feverishness, chills, cough, headache, myalgia, sore throat, malaise, anorexia and many other non-specific symptoms. The total extent of sites of influenza replication is heretofore unknown. Although the disease is associated with many systemic symptoms, it appears unlikely that the virus replicates to any great extent outside the respiratory tract in uncomplicated infections. Induction of inflammatory cytokines has been cited as a potential explanation of the systemic features of influenza infection. Infection of peripheral blood leukocytes with a variety of virulent and avirulent influenza viruses resulted in the production of inflammatory cytokines including interleukin-l β, interleukin-6, interferon-α, and macrophage inflammatory protein- lot. The structures of influenza A viruses are quite similar. By electron microscopy, the viruses are pleomorphic, including virions that are roughly spherical (approximately 120 nm in diameter) and filamentous. Two distinct types of spikes (approximately 16 nm in length), corresponding to the hemagglutinin (HA) and neuraminidase (NA) molecules, reside on the surface of the virions. The HA spike appears rod shaped and protrudes from the envelope as a trimer; the NA spike is a mushroom-shaped tetramer. These two glycoproteins are anchored to the lipid envelope derived from the plasma membrane of host cells by short sequences of hydrophobic amino acids (transmembrane region). HA is a type I glycoprotein (containing an N-terminal ectodomain and a C-terminal anchor), while NA is a type II glycoprotein (containing an N-proximal anchor and a C-terminal ectodomain). HA enables the virion to attach to cell surface sialyloligosaccharides and is responsible for its hemagglutinating activity. HA elicits virus-neutralizing antibodies that are important in protection against infection. NA is a sialidase that prevents virion aggregation by removing cell and virion surface sialic acid (the primary moiety in sialyloligosaccharides recognized by HA). Antibodies to NA are also important in protecting hosts. In addition to HA and NA, a limited number of M2 proteins are integrated into the virions. They form tetramers, have Hl ion channel activity, and, when activated by the low pH in endosomes, acidify the inside of the virion, facilitating its uncoating. Ml protein that lies within the envelope is thought to function in assembly and budding. Eight segments of single-stranded RNA molecules (negative sense, or complementary to mRNA) are contained within the viral envelope, in association with NP and three subunits of viral polymerase (PB 1 , PB2, and PA), which together form a ribonucleoprotein (RNP) complex that participates in RNA replication and transcription. NS2 protein, now known to exist in virions, is thought to play a role in the
export of RNP from the nucleus through interaction with Ml protein. NSl protein, the only nonstructural protein of influenza A viruses, has multiple functions, including regulation of splicing and nuclear export of cellular mRNAs as well as stimulation of translation. Its major function seems to be to counteract the interferon activity of the host, since an NS 1 knockout virus was viable although it grew less efficiently than the parent virus in interferon non- defective cells.
After binding to sialic acid-containing receptors on the membrane surface, the virus enters the cell by receptor-mediated endocytosis. A low pH in the endosome induces a conformational change in HA, resulting in membrane fusion between the viral envelope and the endosomal membrane. Within the endosome, the M2 proton channel exposes the viral core to low pH, resulting in dissociation of Ml from RNP and leading to a release of RNP to the cytoplasm. RNP is then transported to the nucleus, most probably by nuclear localization signals in proteins composed of the RNP complex PBl, PB2, and NP.
The mechanism of viral RNA transcription is unique. The 5' cap from cellular mRNAs is cleaved by a viral endonucleases and used as a primer for transcription by the viral transcriptase. Six of eight RNA segments are transcribed into mRNAs in a monocistronic manner and translated into HA, NA, NP, PBl, PB2, and PA. By contrast, two RNA segments are each transcribed to two mRNAs by splicing. For both the M and NS genes, these mRNAs are translated in different reading frames, generating Ml and M2 proteins and NSl and NS2 proteins, respectively. It is believed that the increased concentration of free NP triggers the shift from mRNA synthesis to cRNA and vRNA synthesis. Newly synthesized vRNAs are encapsidated with NP in the nucleus, where they function as templates for secondary transcription of viral mRNAs.
Later in infection, the principal translation products are Ml, HA, and NA. HA and NA are glycosylated in the rough endoplasmic reticulum, further processed in the Golgi apparatus, and then transported to the cell surface, where they integrate into the cell membrane. Nuclear localization of Ml and NS2 proteins is essential for the migration of RNP out of the nucleus for assembly into progeny viral particles in the cytoplasm. The RNP- Ml complex presumably interacts with Ml proteins that are associated with the plasma membrane and then buds outward through the cell membrane, enclosing itself within a bubble of membrane (envelope) studded with both the HA and NA glycoproteins.
HA plays a critical role in the pathogenesis of influenza. I is one of the two major antigenic determinants that are recognized by the host's neutralizing antibodies and its susceptibility to cleavage by host protease determines the range of tissues in which the virus can replicate. HA is a 550 amino acid polypeptide that forms homotrimers (spikes) on the exterior of the influenza virus particle. The nascent HA is directed to the cell membrane in an infected host cell and is anchored to the cell membrane by a short transmembrane region at the C-terminus. In this form, HA is referred to as HA0 and has not yet undergone the final modification that allows it to acquire full biological activity. This final step involves proteolytic cleavage of a specific region by host enzymes, resulting in two subunits, HAi and HA2, which are linked by a disulfide bridge. The cleavage of HA0 occurs close to the point of insertion of HA into the viral membrane. The nascent HA is also subject to extensive post- translational glycosylation, which may also act as a mechanism for immune evasion.
The HAs of avirulent avian influenza viruses are usually cleaved only in a limited number of cell types, so that the viruses cause only localized infections in the respiratory or intestinal tract, or both, resulting in mild or asymptomatic infections. By contrast, the HAs of virulent avian viruses are cleaved in a broad range of different host cells and therefore are capable of causing lethal systemic infection in poultry and in humans. In tissue culture, the HAs of virulent viruses are cleaved in the absence of exogenous proteases, such as trypsin, whereas those of avirulent viruses are not, indicating a difference in sensitivity of the two HAs to endogenous cellular proteases. These findings implicate HA cleavability as one of the major determinants of the tissue tropism of influenza viruses and suggest that differences in the tissue distribution of proteases and HA susceptibility to these enzymes determine the outcome of virus infection.
The present invention provides antibodies, antibody fragments, and antibody derivatives directed to avian influenza A viruses, such as the HPAI strain H5N1 , but also encompasses any influenza A strain, such as but not limited to subtypes HlONl, H10N2, H10N3, H10N4, H10N5, H10N6, H10N7, H10N8, H10N9, HI lNl, H1 1N2, H11N3, H11N4, Hl 1N5, Hl 1N6, Hl 1N7, Hl 1N8, Hl 1N9, H12N1, H12N2, H12N4, H12N5, H12N6, H12N8, H12N9, H13N2, H13N3, H13N6, H13N9, H14N5, H14N6, H15N2, H15N6, H15N8, H15N9, H16N3, HlNl, H1N2, H1N3, H1N5, H1N6, H1N8, H1N9, H2N1 , H2N2, H2N3, H2N4, H2N5, H2N6, H2N7, H2N8, H2N9, H3N1, H3N2, H3N3, H3N4, H3N5, H3N6, H3N8, H3N9, H4N1, H4N2, H4N3, H4N4, H4N5, H4N6, H4N7, H4N8, H4N9, H5N2, H5N3,
H5N4, H5N5, H5N6, H5N7, H5N8, H5N9, H6N1, H6N2, H6N3, H6N4, H6N5, H6N6, H6N7, H6N8, H6N9, H7N1, H7N2, H7N3, H7N4, H7N5, H7N6, H7N7, H7N8, H7N9, H8N2, H8N3, H8N4, H8N5, H9N1, H9N2, H9N3, H9N4, H9N5, H9N6, H9N7, H9N8, H9N9, as well as any other unclassified influenza A subtype.
Antibodies of the Invention
The present invention provides avian influenza antibodies (such as, for example, avian influenza strain H5N1 antibodies) that are capable of binding to one or more avian influenza viral proteins, and preferably, antibodies that are capable of binding to one or more amino acids of avian influenza hemagglutinin H5. The term "antibody" as used in the context of the present invention includes polyclonal antibodies, monoclonal antibodies (mAbs), chimeric antibodies, neutralizing antibodies, anti-idiotypic (anti-Id) antibodies, that can be labeled in soluble or bound form, as well as fragments, regions, or derivatives thereof, provided by any known technique, such as, but not limited to, enzymatic cleavage, peptide synthesis, or recombinant techniques.
"Antibody fragments" comprise a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody. Examples of antibody fragments include Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies (Zapata et al., Protein Eng. 8(10): 1057-1062 (1995); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments. Papain digestion of antibodies produces two identical antigen-binding regions or fragments, called "Fab" fragments, each with a single antigen- binding site, and a residual "Fc" or "fragment crystallizable constant region" fragment, a designation reflecting the ability to crystallize readily. Preferably, the fragment crystallizable constant region is derived from a human, but can be derived from other species, such as, for example, mouse, rat, rabbit, goat, or monkey. Pepsin treatment yields an F(ab')2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen. Preferably, the antigen-binding fragments/regions bind to one or more avian influenza viral proteins, such as, for example, hemagglutinin H5.
"Fv" is the minimun antibody fragment which contains a complete antigen- recognition and -binding site. This region consists of a dimer of one heavy- and one light- chain variable domain in tight, non-covalent association. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface
of the VH-VL dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site. The Fab fragment also contains the constant domain of the light chain and the first constant domain (CHl) of the heavy chain. Fab fragments differ from Fab' fragments by the addition of a few residues at the carboxy terminus of the heavy chain CHl domain including one or more cysteines from the antibody hinge region. Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group. F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
The "light chains" of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa (K) and lambda (λ), based on the amino acid sequences of their constant domains. Depending on the amino acid sequence of the constant domain of their heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgGl, IgG2, IgG3, IgG4, IgA, and IgA2.
"Single-chain Fv" or "sFv" antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain. Preferably, the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the sFv to form the desired structure for antigen binding. For a review of sFv, see Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994). The term "diabodies" refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light- chain variable domain (VL) in the same polypeptide chain (VH-VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen- binding sites. Diabodies are described more fully in, for example, EP 404,097; WO 93/11 161 ; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
An "isolated" antibody is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes. Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
Polyclonal antibodies are heterogeneous populations of antibody molecules derived from the sera of animals immunized with an antigen. A monoclonal antibody contains a substantially homogeneous population of antibodies specific to antigens, which population contains substantially similar epitope binding sites. MAbs may be obtained by methods known to those skilled in the art. See, for example Kohler and Milstein, Nature 256:495-497 (1975); U.S. Pat. No. 4,376,1 10; Ausubel et al., eds., Current Protocols in Molecular Biology, Greene Publishing Assoc, and Wiley Interscience, N. Y., (1987, 1992); and Harlow and Lane, ANTIBODIES. A Laboratory Manual Cold Spring Harbor Laboratory (1988); Colligan et al., eds., Current Protocols in Immunology, Greene Publishing Assoc, and Wiley Interscience, N. Y., (1992, 1993), the contents of which references are incorporated entirely herein by reference.
Such antibodies may be of any immunoglobulin class including IgG, IgM, IgE, IgA, GILD and any subclass thereof. A hybridoma producing a mAb of the present invention may be cultivated in vitro, in situ or in vivo. Production of high titers of mAbs in vivo or in situ makes this a preferred method of production. The present invention also concerns hybridomas and cell lines expressing the avian influenza antibodies described herein. Chimeric antibodies are molecules different portions of which are derived from different animal species, such as those having variable region derived from a murine mAb and a human immunoglobulin constant region, which are primarily used to reduce immunogenicity in application and to increase yields in production, for example, where murine mAbs have higher yields from hybridomas but higher immunogenicity in humans, such that human/murine chimeric mAbs are used. Chimeric antibodies and methods for their production are known in the art (Cabilly et al., Proc. Natl. Acad. Sci. USA 81:3273-3277 (1984); Morrison et al., Proc. Natl. Acad. Sci. USA 81 :6851-6855 (1984); Boulianne et al., Nature 312:643-646 (1984); Cabilly et al., European Patent Application 125023 (published
Nov. 14, 1984); Neuberger et al., Nature 314:268-270 (1985); Taniguchi et al., European Patent Application 171496 (published Feb. 19, 1985); Morrison et al., European Patent Application 173494 (published Mar. 5, 1986); Neuberger et al., PCT Application WO 86/01533, (published Mar. 13, 1986); Kudo et al., European Patent Application 184187 (published Jun. 11, 1986); Morrison et al., European Patent Application 173494 (published Mar. 5, 1986); Sahagan et al., J. Immunol. 137:1066-1074 (1986); Robinson et al., International Patent Publication No. PCT/US86/02269 (published 7 May 1987); Liu et al., Proc. Natl. Acad. Sci. USA 84:3439-3443 (1987); Sun et al., Proc. Natl. Acad. Sci. USA 84:214-218 (1987); Better et al., Science 240:1041-1043 (1988); and Harlow and Lane Antibodies: a Laboratory Manual Cold Spring Harbor Laboratory (1988)). These references are entirely incorporated herein by reference.
As used herein, the term "neutralizing antibody" refers to an antibody that can inhibit an avian influenza infection by about 20-100%, preferably by at least about 10, 20, 30, 40, 50, 55, 60, 65, 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100% or more depending on the assay. The capacity of an avian influenza neutralizing antibody to inhibit an avian influenza infection As preferably assessed by at least one suitable assay, as described herein and/or as known in the art.
An anti-idiotypic (anti-Id) antibody is an antibody which recognizes unique determinants generally associated with the antigen-binding site of an antibody. An Id antibody can be prepared by immunizing an animal of the same species and genetic type (e.g., mouse strain) as the source of the mAb with the mAb to which an anti-Id is being prepared. The immunized animal will recognize and respond to the idiotypic determinants of the immunizing antibody by producing an antibody to these idiotypic determinants (the anti-Id antibody). See, for example, U.S. Pat. No. 4,699,880, which is herein entirely incorporated by reference.
The anti-Id antibody may also be used as an "immunogen" to induce an immune response in yet another animal, producing a so-called anti-anti-Id antibody. The anti-anti-Id may be epitopically identical to the original mAb which induced the anti-Id. Thus, by using antibodies to the idiotypic determinants of a mAb, it is possible to identify other clones expressing antibodies of identical specificity.
Antibodies of the present invention can include at least one of a heavy chain constant region (Hc), a heavy chain variable region (Hv), a light chain variable region (Lv) and a light
chain constant region (Lc), wherein a polyclonal Ab, monoclonal Ab, fragment and/or regions thereof include at least one heavy chain variable region (Hv) or light chain variable region (Ly) which binds a portion of an avian influenza viral protein, such as, for example, hemagglutinin H5 or neuraminidase Nl. Preferred methods for determining mAb specificity and affinity by competitive inhibition can be found in Harlow, et al., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N. Y., 1988), Colligan et al., eds., Current Protocols in Immunology, Greene Publishing Assoc, and Wiley Interscience, N. Y., (1992, 1993), and Muller, Meth. Enzymol. 92:589-601 (1983), which references are entirely incorporated herein by reference.
The techniques to raise antibodies of the present invention to small peptide sequences that recognize and bind to those sequences in the free or conjugated form or when presented as a native sequence in the context of a large protein are well known in the art. Such antibodies include murine, murine-human and human-human antibodies produced by hybridoma or recombinant techniques known in the art.
As used herein, the term "antigen binding region" refers to that portion of an antibody molecule which contains the amino acid residues that interact with an antigen and confer on the antibody its specificity and affinity for the antigen. The antibody region includes the "framework" amino acid residues necessary to maintain the proper conformation of the antigen-binding residues.
As used herein, the term "chimeric antibody" includes monovalent, divalent or polyvalent antibodies. A monovalent chimeric antibody is a dimer (HL) formed by a chimeric H chain associated through disulfide bridges with a chimeric L chain. A divalent chimeric antibody is tetramer (H2L2) formed by two HL dimers associated through at least one disulfide bridge. A polyvalent chimeric antibody can also be produced, for example, by employing a CH region that aggregates (e.g., from an IgM H chain, or μ chain).
Murine and chimeric antibodies, fragments and regions of the present invention comprise individual heavy (H) and/or light (L) immunoglobulin chains. A chimeric H chain comprises an antigen binding region derived from the H chain of a non-human antibody specific for one or more avian influenza viral proteins or preferably, avian influenza hemagglutinin H5 or neuraminidase Nl, which is linked to at least a portion of a human H chain C region (CH), such as CHi or CH2.
A chimeric L chain according to the present invention comprises an antigen binding region derived from the L chain of a non-human antibody specific for one or more avian influenza viral proteins or preferably, avian influenza hemagglutinin H5 or neuraminidase 1, linked to at least a portion of a human L chain C region (CL). Antibodies, fragments or derivatives having chimeric H chains and L chains of the same or different variable region binding specificity, can also be prepared by appropriate association of the individual polypeptide chains, according to known method steps, e.g., according to Ausubel, Harlow, and Colligan, the contents of which references are incorporated entirely herein by reference. With this approach, hosts expressing chimeric H chains (or their derivatives) are separately cultured from hosts expressing chimeric L chains (or their derivatives), and the antibody chains are separately recovered and then associated. Alternatively, the hosts can be co- cultured and the chains allowed to associate spontaneously in the culture medium, followed by recovery of the assembled antibody, fragment or derivative.
The hybrid cells are formed by the fusion of an anti-avian influenza viral protein- producing cell, or in particular, anti -hemagglutinin H5 or anti-neuraminidase Nl antibody- producing cell, typically a spleen cell of an animal immunized against either natural or recombinant avian influenza viral proteins, or a peptide fragment of any one or more avian influenza viral proteins. Alternatively, the non-human antibody-producing cell can be a B lymphocyte obtained from the blood, spleen, lymph nodes or other tissue of an animal immunized with one or more avian influenza viral proteins, or the full or partial amino acid sequence of one or more avian influenza viral proteins, such as, but not limited to, hemagglutinin H5 or neuraminidase Nl .
The second fusion partner, which provides the immortalizing function, can be a lymphoblastoid cell or a plasmacytoma or myeloma cell, which is not itself an antibody producing cell, but is malignant. Preferred fusion partner cells include the hybridoma SP2/0- AgH, abbreviated as SP2/0 (ATCC CRL1581) and the myeloma P3X63Ag8 (ATCC TIB9), or its derivatives. Hybridomas can also be produced by fusing other suitable immortal cell line (e.g., a myeloma cell line such as, but not limited to, NSO, NSl, NS2, AEl, L.5, >243, Sp2 SA3, Sp2 MAI, Sp2 SSl, Sp2 SA5, U937, MLA 144, ACT IV, M0LT4, DA-I, JURKAT, WEHI, K-562, COS, RAJI, NIH 3T3, HL-60, MLA 144, NAMAIWA, NEURO 2A, or the like, or heteromyelomas, fusion products thereof, or any cell or fusion cell derived therefrom, or any other suitable cell line as known in the art, with cells, such as, but not
limited to, isolated or cloned spleen cells, or any other cells expressing heavy or light chain constant or variable or framework or CDR sequences, either as endogenous or heterologous nucleic acid, as recombinant or endogenous, viral, bacterial, algal, prokaryotic, amphibian, insect, reptilian, fish, mammalian, rodent, equine, avian, goat, sheep, primate, eukaryotic, genomic DNA, cDNA, rDNA, mitochondrial DNA or RNA, hnRNA, mRNA, tRNA, single, double or triple stranded, hybridized, and the like or any combination thereof. See, e.g, Ausubel, Harlow, and Colligan, the contents of which are incorporated entirely herein by reference.
Antibody producing cells can be obtained from the peripheral blood or, preferably the spleen or lymph nodes, of humans or other suitable animals that have been immunized with the antigen of interest. Any other suitable host cell can also be used for expressing heterologous or endogenous nucleic acid encoding an Ig derived protein, specified fragment or variant thereof, of the present invention. The fused cells (hybridomas) or recombinant cells can be isolated using selective culture conditions or other suitable known methods, and cloned by limiting dilution or cell sorting, or other known methods. Cells which produce Ig derived proteins with the desired specificity can be selected by a suitable assay (e.g., ELISA).
The antibody-producing cell contributing the nucleotide sequences encoding the antigen-binding region of the avian influenza antibodies of the present invention can also be produced by transformation of a non-human, such as a primate, or a human cell. For example, a B lymphocyte which produces an antibody of the invention can be infected and transformed with a virus such as Epstein-Barr virus to yield an immortal antibody producing cell (Kozbor et al., Immunol. Today 4:72-79 (1983)). Alternatively, the B lymphocyte can be transformed by providing a transforming gene or transforming gene product, as is well-known in the art. See, e.g, Ausubel infra, Harlow infra, and Colligan infra, the contents of which references are incorporated entirely herein by reference.
Monoclonal antibodies obtained by cell fusions and hybridomas are accomplished by standard procedures well known to those skilled in the field of immunology. Fusion partner cell lines and methods for fusing and selecting hybridomas and screening for mAbs are well known in the art. See, e.g, Ausubel, Harlow, and Colligan, the contents of which are incorporated entirely herein by reference.
The mAbs of the present invention can be produced in large quantities by injecting hybridoma or transfectoma cells secreting the antibody into the peritoneal cavity of mice and,
after appropriate time, harvesting the ascites fluid which contains a high titer of the mAb, and isolating the mAb therefrom. For such in vivo production of the mAb with a non-murine hybridoma (e.g., rat or human), hybridoma cells are preferably grown in irradiated or athymic nude mice. Alternatively, the antibodies can be produced by culturing hybridoma or transfectoma cells in vitro and isolating secreted mAb from the cell culture medium or recombinantly, in eukaryotic or prokaryotic cells.
Other suitable methods of producing or isolating antibodies of the requisite specificity can be used, including, but not limited to, methods that select recombinant antibody from a peptide or protein library (e.g., but not limited to, a bacteriophage, ribosome, oligonucleotide, RNA, cDNA, or the like, display library; e.g., as available from Cambridge antibody Technologies, Cambridgeshire, UK; MorphoSys, Martinsreid/Planegg, Del.; Biovation, Aberdeen, Scotland, UK; Biolnvent, Lund, Sweden; Dyax Corp., Enzon, Affymax/Biosite; Xoma, Berkeley, Calif; Ixsys. See, e.g., EP 368,684, PCT/GB91/01 134; PCT/GB92/01755; PCT/GB92/002240; PCT/GB92/00883; PCT/GB93/00605; U.S. Ser. No. 08/350260(May 12, 1994); PCT/GB94/01422; PCT/GB94/02662; PCT/GB97/01835; (CAT/MRC);
WO90/14443; WO90/14424; WO90/14430; PCT/US94/1234; WO92/18619; WO96/07754; (Scripps); WO96/13583, WO97/08320 (MorphoSys); WO95/16027 (Biolnvent); WO88/06630; WO90/3809 (Dyax); U.S. Pat. No. 4,704,692 (Enzon); PCT/US91/02989 (Affymax); WO89/06283; EP 371 998; EP 550 400; (Xoma); EP 229 046; PCT/US91/07149 (Ixsys); or stochastically generated peptides or proteins— U.S. Pat. Nos. 5,723,323, 5,763,192, 5,814,476, 5,817,483, 5,824,514, 5,976,862, WO 86/05803, EP 590 689 (Ixsys, now Applied Molecular Evolution (AME), each entirely incorporated herein by reference) or that rely upon immunization of transgenic animals (e.g., SCID mice, Nguyen et al., Microbiol. Immunol. 41 :901-907 (1997); Sandhu et al., Crit. Rev. Biotechnol. 16:95-118 (1996); Eren et al., Immunol. 93:154-161 (1998), each entirely incorporated by reference as well as related patents and applications) that are capable of producing a repertoire of human antibodies, as known in the art and/or as described herein. Such techniques, include, but are not limited to, ribosome display (Hanes et al., Proc. Natl. Acad. Sci. USA, 94:4937-4942 (May 1997); Hanes et al., Proc. Natl. Acad. Sci. USA, 95:14130-14135 (November 1998)); single cell antibody producing technologies (e.g., selected lymphocyte antibody method ("SLAM") (U.S. Pat. No. 5,627,052, Wen et al., J. Immunol. 17:887-892 (1987); Babcook et al., Proc. Natl. Acad. Sci. USA 93:7843-7848 (1996)); gel microdroplet and flow cytometry (Powell et al.,
Biotechnol. 8:333-337 (1990); One Cell Systems, Cambridge, Mass.; Gray et al., J. Imm. Meth. 182:155-163 (1995); Kenny et al., Bio/Technol. 13:787-790 (1995)); B-cell selection (Steenbakkers et al., Molec. Biol. Reports 19:125-134 (1994); Jonak et al., Progress Biotech, Vol. 5, In Vitro Immunization in Hybridoma Technology, Borrebaeck, ed., Elsevier Science Publishers B.V., Amsterdam, Netherlands (1988)), each of which is entirely incorporated herein by reference.
The invention also provides for "derivatives" of the murine or chimeric antibodies, fragments, regions or derivatives thereof, which term includes those proteins encoded by truncated or modified genes to yield molecular species functionally resembling the antibody fragments. The modifications include, but are not limited to, addition of genetic sequences coding for cytotoxic proteins such as plant and bacterial toxins. The fragments and derivatives can be produced from any of the hosts of this invention. Alternatively, antibodies, fragments and regions can be bound to cytotoxic proteins or compounds in vitro, to provide cytotoxic antibodies which would selectively kill cells expressing one or more avian influenza viral proteins.
Fragments include, for example, Fab, Fab', F(ab')2 and Fv. These fragments lack the Fc fragment of intact antibody, clear more rapidly from the circulation, and can have less non-specific tissue binding than an intact antibody (Wahl et al., J. Nucl. Med. 24:316-325 (1983)). These fragments are produced from intact antibodies using methods well known in the art, for example by proteolytic cleavage with enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab')2 fragments).
The identification of these antigen binding region and/or epitopes recognized by mAbs of the present invention provides the information necessary to generate additional monoclonal antibodies with similar binding characteristics and therapeutic or diagnostic utility that parallel the embodiments of this application.
Recombinant murine or chimeric murine-human or human-human antibodies that bind an epitope included in the amino acid sequences of one or more avian influenza viral proteins can be provided according to the present invention using known techniques based on the teaching provided herein. See, e.g., Ausubel et al., eds. Current Protocols in Molecular Biology, Wiley Interscience, N. Y. (1987, 1992, 1993); and Sambrook et al. Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press (1989), the entire contents of which are incorporated herein by reference.
The DNA encoding an antibody of the present invention can be genomic DNA or cDNA which encodes at least one of the heavy chain constant region (Hc), the heavy chain variable region (Hv), the light chain variable region (Lv) and the light chain constant regions (Lc). A convenient alternative to the use of chromosomal gene fragments as the source of DNA encoding the murine V region antigen-binding segment is the use of cDNA for the construction of chimeric immunoglobulin or antibody genes, e.g., as reported by Liu et al. (Proc. Natl. Acad. ScL, USA 84:3439 (1987) and J. Immunology 139:3521 (1987), which references are hereby entirely incorporated herein by reference. The use of cDNA requires that gene expression elements appropriate for the host cell be combined with the gene in order to achieve synthesis of the desired protein. The use of cDNA sequences is advantageous over genomic sequences (which contain introns), in that cDNA sequences can be expressed in bacteria or other hosts which lack appropriate RNA splicing systems.
For example, a cDNA encoding a murine V region antigen-binding segment capable of binding to one or more avian influenza viral proteins, for example, hemagglutinin H5 or neuraminidase N 1 , can be provided using known methods. Probes that bind a portion of a DNA sequence encoding the antibodies of the present invention can be used to isolate DNA from hybridomas expressing antibodies, fragments or regions, as presented herein, according to the present invention, by known methods.
Oligonucleotides representing a portion of the variable region are useful for screening for the presence of homologous genes and for the cloning of such genes encoding variable or constant regions of antibodies according to the invention. Such probes preferably bind to portions of sequences which encode light chain or heavy chain variable regions which bind an epitope of one or more avian influenza viral proteins, especially an epitope of at least 5 amino acids of hemagglutinin H5 or neuraminidase Nl . Such techniques for synthesizing such oligonucleotides are well known and disclosed by, for example, Wu, et al., Prog. Nucl. Acid. Res. Molec. Biol. 21 :101-141 (1978), and Ausubel et al., eds. Current Protocols in Molecular Biology, Wiley Interscience (1987, 1993), the entire contents of which are herein incorporated by reference.
Because the genetic code is degenerate, more than one codon can be used to encode a particular amino acid (Watson, et al.). Using the genetic code, one or more different oligonucleotides can be identified, each of which would be capable of encoding the amino acid. The probability that a particular oligonucleotide will, in fact, constitute the actual XXX-
encoding sequence can be estimated by considering abnormal base pairing relationships and the frequency with which a particular codon is actually used (to encode a particular amino acid) in eukaryotic or prokaryotic cells expressing an antibody of the invention or a fragment thereof. Such "codon usage rules" are disclosed by Lathe, et al., J. Molec. Biol. 183:1-12 (1985). Using the "codon usage rules" of Lathe, a single oligonucleotide, or a set of oligonucleotides, that contains a theoretical "most probable" nucleotide sequence capable of encoding preferred variable or constant region sequences is identified.
Although occasionally an amino acid sequence can be encoded by only a single oligonucleotide, frequently the amino acid sequence can be encoded by any of a set of similar oligonucleotides. Importantly, whereas all of the members of this set contain oligonucleotides which are capable of encoding the peptide fragment and, thus, potentially contain the same oligonucleotide sequence as the gene which encodes the peptide fragment, only one member of the set contains the nucleotide sequence that is identical to the nucleotide sequence of the gene. Because this member is present within the set, and is capable of hybridizing to DNA even in the presence of the other members of the set, it is possible to employ the unfractionated set of oligonucleotides in the same manner in which one would employ a single oligonucleotide to clone the gene that encodes the protein.
The oligonucleotide, or set of oligonucleotides, containing the theoretical "most probable" sequence capable of encoding an antibody of the present invention or fragment including a variable or constant region is used to identify the sequence of a complementary oligonucleotide or set of oligonucleotides which is capable of hybridizing to the "most probable" sequence, or set of sequences. An oligonucleotide containing such a complementary sequence can be employed as a probe to identify and isolate the variable or constant region gene (Sambrook et al., infra). "» A suitable oligonucleotide, or set of oligonucleotides, which is capable of encoding a fragment of the variable or constant region (or which is complementary to such an oligonucleotide, or set of oligonucleotides) is identified (using the above-described procedure), synthesized, and hybridized by means well known in the art, against a DNA or, more preferably, a cDNA preparation derived from cells which are capable of expressing antibodies or variable or constant regions thereof. Single stranded oligonucleotide molecules complementary to the "most probable" variable or constant anti-avian influenza viral protein region peptide coding sequences can be synthesized using procedures which are well known
to those of ordinary skill in the art (Belagaje, et al., J. Biol. Chem. 254:5765-5780 (1979); Maniatis, et al., In: Molecular Mechanisms in the Control of Gene Expression, Nierlich, et al., Eds., Acad. Press, NY (1976); Wu, et al., Prog. Nucl. Acid Res. Molec. Biol. 21 : 101-141 (1978); Khorana, Science 203:614-625 (1979)). Additionally, DNA synthesis can be achieved through the use of automated synthesizers. Techniques of nucleic acid hybridization are disclosed by Sambrook et al. (infra), and by Hayrnes, et al. (In: Nucleic Acid Hybridization, A Practical Approach, IRL Press, Washington, DC (1985)), which references are herein incorporated by reference.
In an alternative way of cloning a polynucleotide encoding a variable or constant region, a library of expression vectors is prepared by cloning DNA or, more preferably, cDNA (from a cell capable of expressing an antibody or variable or constant region) into an expression vector. The library can then be screened for members capable of expressing a protein which competitively inhibits the binding of an antibody, and which has a nucleotide sequence that is capable of encoding polypeptides that have the same amino acid sequence as the antibodies of the present invention or fragments thereof. In this embodiment, DNA, or more preferably cDNA, is extracted and purified from a cell which is capable of expressing an antibody or fragment. The purified cDNA is fragmented (by shearing, endonuclease digestion, etc.) to produce a pool of DNA or cDNA fragments. DNA or cDNA fragments from this pool are then cloned into an expression vector in order to produce a genomic library of expression vectors whose members each contain a unique cloned DNA or cDNA fragment such as in a lambda phage library, expression in prokaryotic cell (e.g., bacteria) or eukaryotic cells, (e.g., mammalian, yeast, insect or, fungus). See, e.g., Ausubel, Harlow, Colligan; Nyyssonen et al. Bio/Technology 11 :591-595 (Can 1993); Marks et al., Bio/Technology 11 : 1145-1 149 (October 1993). Once a nucleic acid encoding such variable or constant regions is isolated, the nucleic acid can be appropriately expressed in a host cell, along with other constant or variable heavy or light chain encoding nucleic acid. Such antibodies preferably include a murine or human variable region which contains a framework residue having complementarity determining residues which are responsible for antigen binding. Preferably, a variable light or heavy chain encoded by a nucleic acid as described above binds an epitope of at least 5 amino acids included in one or more avian influenza viral proteins, such as for example hemagglutinin H5 or neuraminidase Nl .
Human genes which encode the constant (C) regions of the murine and chimeric
antibodies, fragments and regions of the present invention can be derived from a human fetal liver library, by known methods. Human C regions genes can be derived from any human cell including those which express and produce human immunoglobulins or human antibodies. The human CH region can be derived from any of the known classes or isotypes of human H chains, including γ, μ, α, δ or ε, and subtypes thereof, such as Gl, G2, G3 and G4. Since the H chain isotype is responsible for the various effector functions of an antibody, the choice of CH region will be guided by the desired effector functions, such as complement fixation, or activity in antibody-dependent cellular cytotoxicity (ADCC). Preferably, the CH region is derived from gamma 1 (IgGl), gamma 3 (IgG3), gamma 4 (IgG4), or μ (IgM). The human CL region can be derived from either human L chain isotype, kappa or lambda.
Genes encoding human immunoglobulin C regions are obtained from human cells by standard cloning techniques (Sambrook, et al. (Molecular Cloning: A Laboratory Manual, 2nd Edition, Cold Spring Harbor Press, Cold Spring Harbor, N. Y. (1989) and Ausubel et al., eds. Current Protocols in Molecular Biology (1987-1993)). Human C region genes are readily available from known clones containing genes representing the two classes of L chains, the five classes of H chains and subclasses thereof. Chimeric antibody fragments, such as F(ab')2 and Fab, can be prepared by designing a chimeric H chain gene which is appropriately truncated. For example, a chimeric gene encoding an H chain portion of an F(ab')2 fragment would include DNA sequences encoding the CHi domain and hinge region of the H chain, followed by a translational stop codon to yield the truncated molecule.
Generally, the murine, human or murine and chimeric antibodies, fragments and regions of the present invention are produced by cloning DNA segments encoding the H and L chain antigen-binding regions of an antibody, and joining these DNA segments to DNA segments encoding CH and CL regions, respectively, to produce antibody-encoding genes. A fused chimeric gene can be created which comprises a first DNA segment that encodes at least the antigen-binding region of non-human origin, such as a functionally rearranged V region with joining (J) segment, linked to a second DNA segment encoding at least a part of a human C region. Therefore, cDNA encoding the antibody V and C regions, the method of producing the chimeric antibody according to the present invention involves several steps, involving isolation of messenger RNA (mRNA) from the cell line producing an antibody of the invention and from optional additional antibodies supplying heavy and light constant regions; cloning and cDNA production therefrom; preparation of a full length cDNA
library from purified mRNA from which the appropriate V and/or C region gene segments of the L and H chain genes can be identified with appropriate probes, sequenced, and made compatible with a C or V gene segment from another antibody for a chimeric antibody; constructing complete H or L chain coding sequences by linkage of the cloned specific V region gene segments to cloned C region gene; expressing and producing L and H chains in selected hosts, including prokaryotic and eukaryotic cells to provide murine-murine, human- murine, human-human or human murine antibodies.
One common feature of all immunoglobulin H and L chain genes and their encoded mRNAs is the J region. H and L chain J regions have different sequences, but a high degree of sequence homology exists (greater than 80%) among each group, especially near the C region. This homology is exploited in this method and consensus sequences of H and L chain J regions can be used to design oligonucleotides for use as primers for introducing useful restriction sites into the J region for subsequent linkage of V region segments to human C region segments. C region cDNA vectors prepared from human cells can be modified by site-directed mutagenesis to place a restriction site at the analogous position in the human sequence. For example, one can clone the complete human kappa chain C (C.sub.k) region and the complete human gamma- 1 C region (Cγi). In this case, the alternative method based upon genomic C region clones as the source for C region vectors would not allow these genes to be expressed in bacterial systems where enzymes needed to remove intervening sequences are absent. Cloned V region segments are excised and ligated to L or H chain C region vectors. Alternatively, the human Cγi region can be modified by introducing a termination codon thereby generating a gene sequence which encodes the H chain portion of an Fab molecule. The coding sequences with linked V and C regions are then transferred into appropriate expression vehicles for expression in appropriate hosts, prokaryotic or eukaryotic.
Two coding DNA sequences are said to be "operably linked" if the linkage results in a continuously translatable sequence without alteration or interruption of the triplet reading frame. A DNA coding sequence is operably linked to a gene expression element if the linkage results in the proper function of that gene expression element to result in expression of the coding sequence.
Expression vehicles include plasmids or other vectors, which are used for carrying a functionally complete human CH or CL chain sequence having appropriate restriction sites
engineered so that any VH or VL chain sequence with appropriate cohesive ends can be easily inserted therein. Human CH or CL chain sequence-containing vehicles thus serve as intermediates for the expression of any desired complete H or L chain in any appropriate host.
A chimeric antibody, such as a mouse-human or human-human, will typically be synthesized from genes driven by the chromosomal gene promoters native to the mouse H and L chain V regions used in the constructs; splicing usually occurs between the splice donor site in the mouse J region and the splice acceptor site preceding the human C region and also at the splice regions that occur within the human C region; polyadenylation and transcription termination occur at native chromosomal sites downstream of the human coding regions.
A nucleic acid sequence encoding at least one antibody or Ab fragment of the present invention may be recombined with vector DNA in accordance with conventional techniques, including blunt-ended or staggered-ended termini for ligation, restriction enzyme digestion to provide appropriate termini, filling in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and ligation with appropriate ligases. Techniques for such manipulations are disclosed, e.g., by Ausubel, infra, Sambrook, infra, entirely incorporated herein by reference, and are well known in the art.
A nucleic acid molecule, such as DNA, is said to be "capable of expressing" a polypeptide if it contains nucleotide sequences which contain transcriptional and translational regulatory information and such sequences are "operably linked" to nucleotide sequences which encode the polypeptide. An operable linkage is a linkage in which the regulatory DNA sequences and the DNA sequence sought to be expressed are connected in such a way as to permit gene expression of antibodies or Ab fragments in recoverable amounts. The precise nature of the regulatory regions needed for gene expression may vary from organism to organism, as is well known in the analogous art. See, e.g., Sambrook, supra and Ausubel supra.
The present invention accordingly encompasses the expression of antibodies or Ab fragments, in either prokaryotic or eukaryotic cells, although eukaryotic expression is preferred. Preferred hosts are bacterial or eukaryotic hosts including bacteria, yeast, insects, fungi, bird and mammalian cells either in vivo, or in situ, or host cells of mammalian, insect, bird or yeast origin. It is preferable that the mammalian cell or tissue is of human, primate,
hamster, rabbit, rodent, cow, pig, sheep, horse, goat, dog or cat origin, but any other mammalian cell may be used.
Further, by use of, for example, the yeast ubiquitin hydrolase system, in vivo synthesis of ubiquitin-transmembrane polypeptide fusion proteins can be achieved. The fusion proteins produced thereby may be processed in vivo or purified and processed in vitro, allowing synthesis of an antibody or Ab fragment of the present invention with a specified amino terminus sequence. Moreover, problems associated with retention of initiation codon-derived methionine residues in direct yeast (or bacterial) expression may be avoided. Sabin et al., Bio/Technol. 7(7): 705-709 (1989); Miller et al., Bio/Technol. 7(7):698-704 (1989). Any of a series of yeast gene expression systems incorporating promoter and termination elements from the actively expressed genes coding for glycolytic enzymes produced in large quantities when yeast are grown in mediums rich in glucose can be utilized to obtain the antibodies or Ab fragments of the present invention. Known glycolytic genes can also provide very efficient transcriptional control signals. For example, the promoter and terminator signals of the phosphoglycerate kinase gene can be utilized.
Production of antibodies or Ab fragments or functional derivatives thereof in insects can be achieved, for example, by infecting the insect host with a baculovirus engineered to express a transmembrane polypeptide by methods known to those of skill. See Ausubel et al., eds. Current Protocols in Molecular Biology Wiley Interscience, 16.8-16.1 1 (1987, 1993). In a preferred embodiment, the introduced nucleotide sequence will be incorporated into a plasmid or viral vector capable of autonomous replication in the recipient host. Any of a wide variety of vectors may be employed for this purpose. See, e.g., Ausubel et al., sections 1.5, 1.10, 7.1, 7.3, 8.1 , 9.6, 9.7, 13.4, 16.2, 16.6, and 16.8-16.11. Factors of importance in selecting a particular plasmid or viral vector include: the ease with which recipient cells that contain the vector may be recognized and selected from those recipient cells which do not contain the vector; the number of copies of the vector which are desired in a particular host; and whether it is desirable to be able to "shuttle" the vector between host cells of different species.
Preferred prokaryotic vectors known in the art include plasmids such as those capable of replication in E. coli (such as, for example, pBR322, CoIEl, pSClOl, pACYC
184, .pi.VX). Such plasmids are, for example, disclosed by Maniatis, T., et al. (Molecular Cloning, A Laboratory Manual, Second Edition, Cold Spring Harbor Press, Cold Spring
Harbor, N.Y. (1989); Ausubel, infra. Bacillus plasmids include pC194, pC221, pT127, etc. Such plasmids are disclosed by Gryczan, T. (In: The Molecular Biology of the Bacilli, Academic Press, NY (1982), pp. 307-329). Suitable Streptomyces plasmids include pi Jl 01 (Kendall, K. J., et al., J. Bacteriol. 169:4177-4183 (1987)), and streptomyces bacteriophages such as .phi.C31 (Chater, K. F., et al., In: Sixth International Symposium on Actinomycetales Biology, Akademiai Kaido, Budapest, Hungary (1986), pp. 45-54). Pseudomonas plasmids are reviewed by John, J. F., et al. (Rev. Infect. Dis. 8:693-704 (1986)), and Izaki, K. (Jpn. J. Bacteriol. 33:729-742 (1978); and Ausubel et al., supra).
Alternatively, gene expression elements useful for the expression of cDNA encoding antibodies, antibody fragments, or peptides include, but are not limited to (a) viral transcription promoters and their enhancer elements, such as the SV40 early promoter (Okayama, et al., MoI. Cell. Biol. 3:280 (1983)), Rous sarcoma virus LTR (Gorman, et al., Proc. Natl. Acad. Sci., USA 79:6777 (1982)), and Moloney murine leukemia virus LTR (Grosschedl, et al., Cell 41 :885 (1985)); (b) splice regions and polyadenylation sites such as those derived from the SV40 late region (Okayarea et al., infra); and (c) polyadenylation sites such as in SV40 (Okayama et al., infra).
Antibody cDNAs can be expressed as described by Liu et al., infra, and Weidle et al., Gene 51 :21 (1987), using as expression elements the SV40 early promoter and its enhancer, the mouse immunoglobulin H chain promoter enhancers, SV40 late region mRNA splicing, rabbit S-globin intervening sequence, immunoglobulin and rabbit S-globin polyadenylation sites, and SV40 polyadenylation elements.
For antibody-encoding nucleic acids comprised of part cDNA, part genomic DNA (Whittle et al., Protein Engineering 1 :499 (1987)), the transcriptional promoter can be human cytomegalovirus, the promoter enhancers can be cytomegalovirus and mouse/human immunoglobulin, and mRNA splicing and polyadenylation regions can be the native chromosomal immunoglobulin sequences. For example, for expression of cDNA genes in rodent cells, the transcriptional promoter is a viral LTR sequence, the transcriptional promoter enhancers are either or both the mouse immunoglobulin heavy chain enhancer and the viral LTR enhancer, the splice region contains an intron of greater than 31 bp, and the polyadenylation and transcription termination regions are derived from the native chromosomal sequence corresponding to the immunoglobulin chain being synthesized.
cDNA sequences encoding other proteins can also be combined with the above-recited expression elements to achieve expression of the proteins in mammalian cells.
Each fused gene can be assembled in, or inserted into, an expression vector. Recipient cells capable of expressing the chimeric antibody chain gene product are then transfected singly with the sequence encoding the antibody, or chimeric H or chimeric L chain-encoding gene, or are co -transfected with a chimeric H and a chimeric L chain gene. The transfected recipient cells are cultured under conditions that permit expression of the incorporated genes and the expressed antibody chains or intact antibodies or fragments are recovered from the culture. The fused genes encoding the antibodies or chimeric H and L chains, or portions thereof, can be assembled in separate expression vectors that are then used to co-transfect a recipient cell.
Each vector can contain two selectable genes, a first selectable gene designed for selection in a bacterial system and a second selectable gene designed for selection in a eukaryotic system, wherein each vector has a different pair of genes. This strategy results in vectors which first direct the production, and permit amplification, of the fused genes in a bacterial system. The genes so produced and amplified in a bacterial host are subsequently used to co-transfect a eukaryotic cell, and allow selection of a co-transfected cell carrying the desired transfected genes.
Examples of selectable genes for use in a bacterial system are the gene that confers resistance to ampicillin and the gene that confers resistance to chloramphenicol. Preferred selectable genes for use in eukaryotic transfectants include the xanthine guanine phosphoribosyl transferase gene (designated gpt) and the phosphotransferase gens from Tn5 (designated neo). Selection of cells expressing gpt is based on the fact that the enzyme encoded by this gene utilizes xanthine as a substrate for purine nucleotide synthesis, whereas the analogous endogenous enzyme cannot. In a medium containing mycophenolic acid, which blocks the conversion of inosine monophosphate to xanthine monophosphate, and xanthine, only cells expressing the gpt gene can survive. The product of the neo blocks the inhibition of protein synthesis by the antibiotic G418 and other antibiotics of the neomycin class. The two selection procedures can be used simultaneously or sequentially to select for the expression of antibody chain genes introduced on two different DNA vectors into a eukaryotic cell. It is not necessary to include different selectable markers for eukaryotic cells;
an H and an L chain vector, each containing the same selectable marker can be co-transfected. After selection of the appropriately resistant cells, the majority of the clones will contain integrated copies of both H and L chain vectors and/or antibody fragments. Alternatively, the fused genes encoding the chimeric H and L chains can be assembled on the same expression vector.
For transfection of the expression vectors and production of the antibody of the invention, the preferred recipient cell line is a myeloma cell. Myeloma cells can synthesize, assemble and secrete antibodies encoded by transfected antibody genes and possess the mechanism for glycosylation of the antibody. A particularly preferred recipient cell is the recombinant antibody-producing myeloma cell SP2/0 (ATCC #CRL 8287). SP2/0 cells produce only antibodies encoded by the transfected genes. Myeloma cells can be grown in culture or in the peritoneal cavity of a mouse, where secreted antibodies can be obtained from ascites fluid. Other suitable recipient cells include lymphoid cells such as B lymphocytes of human or non-human origin, hybridoma cells of human or non-human origin, or interspecies heterohybridoma cells.
The expression vector carrying an antibody construct, antibody, or antibody fragment of the present invention can be introduced into an appropriate host cell by any of a variety of suitable means, including such biochemical means as transformation, transfection, conjugation, protoplast fusion, calcium phosphate-precipitation, and application with polycations such as diethylaminoethyl (DEAE) dextran, and such mechanical means as electroporation, direct microinjection, and microprojectile bombardment (Johnston et al., Science 240:1538 (1988)). A preferred way of introducing DNA into lymphoid cells is by electroporation (Potter et al., Proc. Natl. Acad. Sci. USA 81 :7161 (1984); Yoshikawa, et al., Jpn. J. Cancer Res. 77: 1 122-1133). In this procedure, recipient cells are subjected to an electric pulse in the presence of the DNA to be incorporated. Typically, after transfection, cells are allowed to recover in complete medium for about 24 hours, and are then seeded in 96-well culture plates in the presence of the selective medium. G418 selection is performed using about 0.4 to 0.8 mg/ml G418. Mycophenolic acid selection utilizes about 6 μg/ml plus about 0.25 mg/ml xanthine. The electroporation technique is expected to yield transfection frequencies of about 10"5 to about 10"4 for Sp2/0 cells. In the protoplast fusion method, lysozyme is used to strip cell walls from catarrhal harboring the recombinant plasmid
containing the chimeric antibody gene. The resulting spheroplasts can then be fused with myeloma cells with polyethylene glycol.
The antibody-encoding nucleic acids of the present invention can also be expressed in non-lymphoid mammalian cells or in other eukaryotic cells, such as yeast, or in prokaryotic cells, in particular bacteria. Yeast provides substantial advantages over bacteria for the production of, for example, immunoglobulin H and L chains. Yeasts carry out post- translational peptide modifications including glycosylation. A number of recombinant DNA strategies now exist which utilize strong promoter sequences and high copy number plasmids which can be used for production of the desired proteins in yeast. Yeast recognizes leader sequences of cloned mammalian gene products and secretes peptides bearing leader sequences (i.e., pre-peptides) (Hitzman, et al., 1 lth International Conference on Yeast Genetics and Molecular Biology, Montpelier, France, Sep. 13-17, 1982).
Yeast gene expression systems can be routinely evaluated for the levels of production, secretion and the stability of antibody fragments and regions thereof. Any of a series of yeast gene expression systems incorporating promoter and termination elements from the actively expressed genes coding for glycolytic enzymes produced in large quantities when yeasts are grown in media rich in glucose can be utilized. Known glycolytic genes can also provide very efficient transcription control signals. For example, the promoter and terminator signals of the phosphoglycerate kinase (PGK) gene can be utilized. A number of approaches can be taken for evaluating optimal expression plasmids for the expression of cloned antibody cDNAs in yeast (see Glover, ed., DNA Cloning, Vol. II, pp 45-66, IRL Press, 1985).
Bacterial strains can also be utilized as hosts for the production of antibody molecules or peptides described by this invention, E. coli Kl 2 strains such as E. coli W3110 (ATCC 27325), and other enterobacteria such as Salmonella typhimuήum or Serratia marcescens, and various Pseudomonas species can be used. Plasmid vectors containing replicon and control sequences which are derived from species compatible with a host cell are used in connection with these bacterial hosts. The vector carries a replication site, as well as specific genes which are capable of providing phenotypic selection in transformed cells. A number of approaches can be taken for evaluating the expression plasmids for the production of antibodies, fragments and regions or antibody chains encoded by the cloned antibody- encoding cDNAs in bacteria (see Glover, ed., DNA Cloning, Vol. I, IRL Press, 1985, Ausubel, infra, Sambrook, infra, Colligan, infra).
Preferred hosts are mammalian cells, grown in vitro or in vivo. Mammalian cells provide post-translational modifications to antibody molecules including leader peptide removal, folding and assembly of H and L chains, glycosylation of the antibody molecules, and secretion of functional antibody protein. Mammalian cells which can be useful as hosts for the production of antibody proteins, in addition to the cells of lymphoid origin described above, include cells of fibroblast origin, such as Vero (ATCC CRL 81) or CHO-Kl (ATCC CRL 61).
Many vector systems are available for the expression of cloned antibodies, H and L chain genes, or antibody fragments in mammalian cells (see Glover, ed., DNA Cloning, Vol. II, pp 143-238, IRL Press, 1985). Different approaches can be followed to obtain complete H2L2 antibodies. As discussed above, it is possible to co-express H and L chains in the same cells to achieve intracellular association and linkage of H and L chains into complete tetrameric H2L2 antibodies and/or antibodies and/or antibody fragments of the invention. The co-expression can occur by using either the same or different plasmids in the same host. Genes for both H and L chains and/or antibodies and/or antibody fragments can be placed into the same plasmid, which can then be transfected into cells, thereby selecting directly for cells that express both chains. Alternatively, cells can be transfected first with a plasmid encoding one chain, for example the L chain, followed by transfection of the resulting cell line with an H chain plasmid containing a second selectable marker. Cell lines producing antibodies and/or H2L2 molecules and/or antibody fragments via either route could be transfected with plasmids encoding additional copies of peptides, H, L, or H plus L chains in conjunction with additional selectable markers to generate cell lines with enhanced properties, such as higher production of assembled H2L2 antibody molecules or enhanced stability of the transfected cell lines. In addition to polyclonal, monoclonal, or chimeric antibodies, the present invention is also directed to an anti-idiotypic (anti-Id) antibody specific for the antibodies of the invention. An anti-Id antibody is an antibody which recognizes unique determinants generally associated with the antigen-binding region of another antibody. The antibody specific for one or more avian influenza viral proteins is termed the idiotypic or Id antibody. The anti-Id can be prepared by immunizing an animal of the same species and genetic type (e.g. mouse strain) as the source of the Id antibody with the Id antibody or the antigen-binding region thereof. The immunized animal will recognize and respond to the idiotypic determinants of
the immunizing antibody and produce an anti-Id antibody. The anti-Id antibody can also be used as an "immunogen" to induce an immune response in yet another animal, producing a so-called anti-anti-Id antibody. The anti-anti-Id can be epitopically identical to the original antibody which induced the anti-Id. Thus, by using antibodies to the idiotypic determinants of a mAb, it is possible to identify other clones expressing antibodies of identical specificity.
Accordingly, mAbs generated against one or more avian influenza viral proteins according to the present invention can be used to induce anti-Id antibodies in suitable animals, such as BALB/c mice. Spleen cells from such immunized mice can be used to produce anti-Id hybridomas secreting anti-Id mAbs. Further, the anti-Id InAbs can be coupled to a carrier such as keyhole limpet hemocyanin (KLH) and used to immunize additional BALB/c mice. Sera from these mice will contain anti-anti-Id antibodies that have the binding properties of the original mAb specific for an epitope of an avian influenza viral protein, or preferably, an epitope containing within amino acid sequences of hemagglutinin H5 or neuraminidase Nl. Preferably, the avian influenza antibodies of the invention bind one or more avian influenza viral proteins with high affinity, such as of at least 10'9 M, at least 10"'° M, at least 10'" M, or at least 10'12 M. In another preferred embodiment, the avian influenza antibodies substantially neutralize at least one activity or proteolytic cleavage of at least one avian influenza viral protein.
The avian influenza antibodies of the invention can bind avian influenza viral proteins or fragments with a wide range of affinities (KD). In a preferred embodiment, at least one antibody of the present invention can optionally bind avian influenza viral proteins or fragments with high affinity. For example, the avian influenza antibodies of the invention can bind avian influenza viral proteins or fragments with a KD equal to or less than about 10"9 M or, more preferably, with a KD equal to or less than about 0.1-9.9 (or any range or value therein) X 10'10 M, 10'11, 10"12, 10'13 or any range or value therein.
The affinity or avidity of an antibody for an antigen can be determined experimentally using any suitable method. (See, for example, Berzofsky, et al., "Ig derived protein-Antigen Interactions," In Fundamental Immunology, Paul, W. E., Ed., Raven Press: New York, N. Y. (1984); Kuby, Janis Immunology, W. H. Freeman and Company: New York, N. Y. (1992); and methods described herein). The measured affinity of a particular antibody-antigen interaction can vary if measured under different conditions (e.g., salt concentration, pH). Thus, measurements of affinity and other antigen-binding parameters (e.g., KD, Ka, Kd) are
preferably made with standardized solutions of antibody and antigen, and a standardized buffer, such as the buffer described herein.
The invention also provides at least one isolated avian influenza antibody-encoding nucleic acid, comprising a nucleic acid that hybridizes under stringent conditions, or has at least 95% identity, to a nucleic acid encoding an avian influenza antibody protein.
The invention further provides a vector expressing an avian influenza antibody of the invention, comprising such a nucleic acid, wherein the vector optionally further comprises at least one promoter selected from the group consisting of a late or early SV40 promoter, a CMV promoter, an HSV tk promoter, a pgk (phosphoglycerate kinase) promoter, a human immunoglobulin promoter, or an EF-I alpha promoter. Such a vector can optionally further comprise at least one selection gene or portion thereof selected from at least one of methotrexate (MTX), dihydrofolate reductase (DHFR), green fluorescent protein (GFP), neomycin (G418), or glutamine synthetase (GS). The invention further comprises a mammalian host cell comprising such an isolated nucleic acid, optionally, wherein said host cell is at least one selected from COS-I, COS-7, HEK293, BHK21, CHO, BSC-I, Hep G2, 653, SP2/0, 293, HeLa, myeloma, or lymphoma cells, or any derivative, immortalized or transformed cell thereof.
Avian influenza viral load or seroconversion can be determined at the protein or nucleic acid level using any method known in the art. Virus, viral particles, viral protein, or viral nucleic acid amounts can be detected, inter alia, electrophoretically (such as by agarose gel electrophoresis, sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), Tris-HCl polyacrylamide gels, non-denaturing protein gels, two-dimensional gel electrophoresis (2DE), and the like), immunochemically (i.e., radioimmunoassay, immunoblotting, immunoprecipitation, immunofluorescence, enzyme-linked immunosorbent assay), by "proteomics technology", or by "genomic analysis." For example, at the nucleic acid level, Northern and Southern hybridization analysis, as well as ribonuclease protection assays using probes which specifically recognize one or more of these sequences can be used to determine avian influenza gene expression. Alternatively, expression can be measured using reverse-transcription-based PCR assays (RT-PCR), e.g., using primers specific for the differentially expressed sequence of genes. Expression can also be determined at the protein level, e.g., by measuring the levels of peptides encoded by the gene products described herein, or activities thereof. Such methods are well known in the art and include, e.g.,
immunoassays based on antibodies to proteins encoded by the genes, aptamers or molecular imprints. Any biological material can be used for the detection/quantification of the protein or its activity. Alternatively, a suitable method can be selected to determine the activity of proteins encoded by the marker genes according to the activity of each protein analyzed. Immunoassays carried out in accordance with the present invention may be homogeneous assays or heterogeneous assays. In a homogeneous assay, the immunological reaction usually involves the specific antibody (e.g., the isolated avian influenza antibodies of the present invention), a labeled analyte, and the sample of interest. The signal arising from the label is modified, directly or indirectly, upon the binding of the antibody to the labeled analyte. Both the immunological reaction and detection of the extent thereof can be carried out in a homogeneous solution. Immunochemical labels which may be employed include free radicals, radioisotopes, fluorescent dyes, enzymes, bacteriophages, or coenzymes.
In a heterogeneous assay approach, the reagents are usually the sample, the antibody, and means for producing a detectable signal. Samples as described above may be used. The antibody can be immobilized on a support, such as a bead (such as protein A agarose, protein G agarose, latex, polystyrene, magnetic or paramagnetic beads), plate or slide, and contacted with the specimen suspected of containing the antigen in a liquid phase. The support is then separated from the liquid phase and either the support phase or the liquid phase is examined for a detectable signal employing means for producing such signal. The signal is related to the presence of the analyte in the sample. Means for producing a detectable signal include the use of radioactive labels, fluorescent labels, or enzyme labels. For example, if the antigen to be detected contains a second binding site, an antibody which binds to that site can be conjugated to a detectable group and added to the liquid phase reaction solution before the separation step. The presence of the detectable group on the solid support indicates the presence of the antigen in the test sample. Examples of suitable immunoassays are oligonucleotides, immunoblotting, immunoprecipitation, immunofluorescence methods, chemiluminescence methods, electrochemiluminescence or enzyme-linked immunoassays.
Those skilled in the art will be familiar with numerous specific immunoassay formats and variations thereof which may be useful for carrying out the method disclosed herein. See generally E. Maggio, Enzyme-Immunoassay, (1980) (CRC Press, Inc., Boca Raton, FIa.); see also U.S. Pat. No. 4,727,022 to Skold et al. titled "Methods for Modulating Ligand-Receptor Interactions and their Application," U.S. Pat. No. 4,659,678 to Forrest et al. titled
"Immunoassay of Antigens," U.S. Pat. No. 4,376,110 to David et al., titled "Immunometric Assays Using Monoclonal Antibodies," U.S. Pat. No. 4,275,149 to Litman et al., titled "Macromolecular Environment Control in Specific Receptor Assays," U.S. Pat. No. 4,233,402 to Maggio et al., titled "Reagents and Method Employing Channeling," and U.S. Pat. No. 4,230,767 to Boguslaski et al., titled "Heterogenous Specific Binding Assay Employing a Coenzyme as Label."
The present invention also provides avian influenza antibodies, detectably labeled, as described below, for use in diagnostic methods for detecting avian influenza virus, viral particles, or viral proteins in subjects known to be or suspected of having an avian influenza infection. Avian influenza antibodies of the present invention are useful for immunoassays which detect or quantitate avian influenza viral proteins, viral particles, viral peptides, or other avian influenza antibodies, in a sample from a subject. An immunoassay for avian influenza viral proteins, viral particles, or viral peptides typically comprises incubating a biological sample in the presence of a detectably labeled high affinity avian influenza antibody of the present invention capable of selectively binding to one or more avian influenza viral proteins, viral particles, or viral peptides, and detecting the labeled avian influenza antibody which is bound in a sample. Various clinical assay procedures are well known in the art, e.g., as described in Immunoassays for the 80's, A. Voller et al., eds., University Park, 1981. Thus, an avian influenza antibody as provided by the present invention can be added to nitrocellulose, or another solid support which is capable of immobilizing cells, cell particles or soluble proteins. The support can then be washed with suitable buffers followed by treatment with the detectably labeled avian influenza antibody. The solid phase support can then be washed with the buffer a second time to remove unbound antibody. The amount of bound label on the solid support can then be detected by methods known in the art.
By "solid phase support" or "carrier" is intended any support capable of binding peptide, antigen or antibody. Well-known supports or carriers, include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, agaroses, and magnetite. The nature of the carrier can be either soluble to some extent or insoluble for the purposes of the present invention. The support material can have virtually any possible structural configuration so long as the coupled molecule is capable of binding to one or more avian influenza viral proteins or peptides, or an avian
influenza antibody such as those provided by the present invention. Thus, the support configuration can be spherical, as in a bead, or cylindrical, as in the inside surface of a test tube, or the external surface of a rod. Alternatively, the surface can be flat, such as a sheet, culture dish, test strip, etc. Preferred supports include polystyrene beads. Those skilled in the art will know many other suitable carriers for binding antibody, peptide or antigen, or can ascertain the same by routine experimentation.
Methods well-known in the art can determine binding activity of a given lot of an avian influenza antibody. Those skilled in the art can easily determine operative and optimal assay conditions by routine experimentation. Detectably labeling the avian influenza antibodies of the invention can be accomplished by linking to an enzyme for use in an enzyme immunoassay (EIA), or enzyme-linked immunosorbent assay (ELISA). The linked enzyme reacts with the exposed substrate to generate a chemical moiety which can be detected, for example, by spectrophotometric, fluorometric or by visual means. Enzymes which can be used to detectably label the avian influenza antibodies of the present invention include, but are not limited to, malate dehydrogenase, staphylococcal nuclease, delta-5- steroid isomerase, yeast alcohol dehydrogenase, α-glycerophosphate dehydrogenase, triose phosphate isomerase, horseradish peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, β-galactosidase, ribonuclease, urease, catalase, glucose-6-phosphate dehydrogenase, glucoamylase and acetylcholinesterase. By radioactively labeling the avian influenza antibodies, it is possible to detect avian influenza virus, viral particles, viral proteins, and/or viral peptides through the use of a radioimmunoassay (RIA) (see, for example, Work, et al., Laboratory Techniques and Biochemistry in Molecular Biology, North Holland Publishing Company, N. Y. (1978)). The radioactive isotope can be detected by such means as the use of a gamma counter or a scintillation counter or by autoradiography. Isotopes which are particularly useful for the purpose of the present invention are: 3H, 1311, 35S, 14C, and, preferably, 125I.
It is also possible to label the avian influenza antibodies with a fluorescent compound. When the fluorescent labeled antibody is exposed to light of the proper wave length, its presence can then be detected due to fluorescence. Among the most commonly used fluorescent labelling compounds are fluorescein isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, o-phthaldehyde and fluorescaamine.
The avian influenza antibodies of the invention can also be detectably labeled using fluorescence-emitting metals such as 125Eu, or others of the lanthanide series. These metals can be attached to the avian influenza antibody using such metal chelating groups as diethylenetriaminepentaacetic acid (DTPA) or ethylenediamine-tetraacetic acid (EDTA). The avian influenza antibodies also can be detectably labeled by coupling to a chemiluminescent compound. The presence of the chemiluminescently labeled antibody is then determined by detecting the presence of luminescence that arises during the course of a chemical reaction. Examples of particularly useful chemiluminescent labeling compounds are luminol, isoluminol, theromatic acridinium ester, imidazole, acridinium salt and oxalate ester. Likewise, a bioluminescent compound can be used to label the avian influenza antibody, fragment or derivative of the present invention. Bioluminescence is a type of chemiluminescence found in biological systems in which a catalytic protein increases the efficiency of the chemiluminescent reaction. The presence of a bioluminescent protein is determined by detecting the presence of luminescence. Important bioluminescent compounds for purposes of labeling are luciferin, luciferase and aequorin.
Detection of the avian influenza antibody, fragment or derivative can be accomplished by a scintillation counter, for example, if the detectable label is a radioactive gamma emitter, or by a fluorometer, for example, if the label is a fluorescent material. In the case of an enzyme label, the detection can be accomplished by colorometric methods which employ a substrate for the enzyme. Detection can also be accomplished by visual comparison of the extent of enzymatic reaction of a substrate in comparison with similarly prepared standards.
For the purposes of the present invention, the avian influenza virus, viral particles, viral proteins, and/or viral peptides, which can be detected by the above assays can be present in a biological sample. Any sample containing or suspected of containing avian influenza virus, viral particles, viral proteins, and/or viral peptides can be used. Preferably, the sample is a biological fluid such as, for example, serum, blood plasma, blood cells, endothelial cells, tissue biopsies or extracts or homogenates, lymphatic fluid, pancreatic juice, ascites fluid, interstitial fluid (also known as "extracellular fluid" and encompasses the fluid found in spaces between cells, including, inter alia, gingival crevicular fluid), bone marrow, sputum, saliva, tears, or urine, inflammatory exudate, cerebrospinal fluid, amniotic fluid, and the like. However, the invention is not limited to assays using only these samples, it being possible for
one of ordinary skill in the art to determine suitable conditions which allow the use of other samples.
In situ detection can be accomplished by removing a histological specimen from a subject, and providing the combination of labeled antibodies of the present invention to such a specimen. The antibody (or fragment or derivative) is preferably provided by applying or by overlaying the labeled antibody (or fragment or derivative) to a biological sample. Through the use of such a procedure, it is possible to determine not only the presence of avian influenza but also the distribution of avian influenza in the examined tissue. Using the present invention, those of ordinary skill will readily perceive that any of a wide variety of histological methods (such as staining procedures) can be modified in order to achieve such in situ detection.
The antibody, fragment or derivative of the present invention can be adapted for utilization in an immunometric assay, also known as a "two-site" or "sandwich" assay. In a typical immunometric assay, a quantity of unlabeled antibody (or fragment of antibody) is bound to a solid support that is insoluble in the fluid being tested and a quantity of detectably labeled soluble antibody is added to permit detection and/or quantitation of the ternary complex formed between solid-phase antibody, antigen, and labeled antibody.
Typical, and preferred, immunometric assays include "forward" assays in which the antibody bound to the solid phase is first contacted with the sample being tested to extract the avian influenza virus, viral particles, viral proteins, or viral peptides from the sample by formation of a binary solid phase antibody-avian influenza antigen complex. After a suitable incubation period, the solid support is washed to remove the residue of the fluid sample, including unreacted avian influenza antigen, if any, and then contacted with the solution containing a known quantity of labeled antibody (which functions as a "reporter molecule"). After a second incubation period to permit the labeled antibody to complex with the avian influenza antigen (i.e., avian influenza virus, viral particle, viral protein, or viral peptide) bound to the solid support through the unlabeled antibody, the solid support is washed a second time to remove the unreacted labeled antibody. This type of forward sandwich assay can be a simple "yes/no" assay to determine whether avian influenza antigen is present or can be made quantitative by comparing the measure of labeled antibody with that obtained for a standard sample containing known quantities of avian influenza antigen. Such "two-site" or
"sandwich" assays are described by Wide (Radioimmune Assay Method, Kirkham, ed., Livingstone, Edinburgh, 1970, pp. 199-206).
Other type of "sandwich" assays, which can also be useful in detecting the presence of avian influenza, are the so-called "simultaneous" and "reverse" assays. A simultaneous assay involves a single incubation step wherein the antibody bound to the solid support and labeled antibody are both added to the sample being tested at the same time. After the incubation is completed, the solid support is washed to remove the residue of fluid sample and uncomplexed labeled antibody. The presence of labeled antibody associated with the solid support is then determined as it would be in a conventional "forward" sandwich assay. In the "reverse" assay, stepwise addition first of a solution of labeled antibody to the fluid sample followed by the addition of unlabeled antibody bound to a solid support after a suitable incubation period, is utilized. After a second incubation, the solid phase is washed in conventional fashion to free it of the residue of the sample being tested and the solution of unreacted labeled antibody. The determination of labeled antibody associated with a solid support is then determined as in the "simultaneous" and "forward" assays. In one embodiment, a combination of antibodies of the present invention specific for separate epitopes can be used to construct a sensitive three-site immunoradiometric assay.
The isolated avian influenza antibodies can also be useful for detecting post- translational modifications of avian influenza proteins, polypeptides, mutations, and polymorphisms, such as tyrosine phosphorylation, threonine phosphorylation, serine phosphorylation, glycosylation (e.g., O-GlcNAc). Such antibodies specifically detect the phosphorylated amino acids in a protein or proteins of interest, and can be used in immunoblotting, immunofluorescence, and ELISA assays described herein. These antibodies are well-known to those skilled in the art, and commercially available. Post-translational modifications can also be determined using metastable ions in reflector matrix-assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF) (Wirth, U. et al. (2002) Proteomics 2(10): 1445-51).
Kits The invention also includes an avian influenza viral-detection reagent, e.g., nucleic acids that specifically identify one or more avian influenza nucleic acids by having homologous nucleic acid sequences, such as oligonucleotide sequences, complementary to a
portion of known avian influenza nucleic acids or antibodies to proteins encoded by avian influenza nucleic acids packaged together in the form of a kit. The kits of the present invention can allow one of skill in the art to, inter alia, diagnostically detect the presence of the avian influenza virus in a subject, and monitor the relative viral load or seroconversion in subjects infected by avian influenza virus. The kits of the invention can also be used to advantageously carry out any of the methods provided in this disclosure. The oligonucleotides can be fragments of avian influenza viral genes. For example, the oligonucleotides can be 200, 150, 100, 50, 25, 10 or less nucleotides in length. Preferably, the oligonucleotides are capable of binding or annealing to the avian influenza antibody- encoding nucleic acid under stringent conditions defined herein, or to one or more avian influenza viral proteins. The avian influenza-detection reagents can also comprise, inter alia, antibodies or fragments of antibodies (such as the isolated antibodies or antibody fragments described herein), and aptamers. The kit may contain in separate containers a nucleic acid or antibody (either already bound to a solid matrix or packaged separately with reagents for binding them to the matrix), control formulations (positive and/or negative), and/or a detectable label. Instructions (e.g., written, tape, VCR, CD-ROM, etc.) for carrying out the assay detecting one or more avian influenza viral proteins or nucleic acids as described herein may be included in the kit. The assay may for example be in the form of a Northern blot hybridization or a sandwich ELISA as known in the art. Alternatively, the kit can be in the form of a microarray as known in the art.
Diagnostic kits for carrying out the methods described herein are produced in a number of ways. Preferably, the kits of the present invention comprise a control (or reference) sample derived from a subject who has not been infected with avian influenza. Alternatively, the kits can comprise a control sample derived from a subject who has been diagnosed with or identified as suffering from avian influenza. In one embodiment, the diagnostic kit comprises (a) an antibody (e.g., the isolated avian influenza antibodies of the present invention) conjugated to a solid support and (b) a second antibody of the invention conjugated to a detectable group. The reagents may also include ancillary agents such as buffering agents and protein stabilizing agents, e.g., polysaccharides and the like. The diagnostic kit may further include, where necessary, other members of the signal-producing system of which system the detectable group is a member (e.g., enzyme substrates), agents for reducing background interference in a test, control reagents, apparatus for conducting a
test, and the like. Alternatively, a test kit contains (a) an antibody of the invention, and (b) a specific binding partner for the antibody conjugated to a detectable group. The test kit may be packaged in any suitable manner, typically with all elements in a single container, optionally with a sheet of printed instructions for carrying out the test. For example, avian influenza detection reagents can be immobilized on a solid matrix such as a porous strip to form at least one avian influenza virus detection site. The measurement or detection region of the porous strip may include a plurality of sites containing a nucleic acid. A test strip may also contain sites for negative and/or positive controls. Alternatively, control sites can be located on a separate strip from the test strip. Optionally, the different detection sites may contain different amounts of immobilized nucleic acids, e.g., a higher amount in the first detection site and lesser amounts in subsequent sites. Upon the addition of test sample, the number of sites displaying a detectable signal provides a quantitative indication of the amount of avian influenza virus present in the sample. The detection sites may be configured in any suitably detectable shape and are typically in the shape of a bar or dot spanning the width of a test strip.
Alternatively, the kit contains a nucleic acid substrate array comprising one or more nucleic acid sequences. The nucleic acids on the array specifically identify one or more nucleic acid sequences representing avian influenza viral genes by binding or hybridizing to one or more avian influenza viral genes under stringent conditions. In various embodiments, the expression of 2, 3, 4, 5, 6, 7, or all 8 avian influenza open reading frames can be identified by virtue of binding to the array. The substrate array can be on, e.g., a solid substrate, e.g., a "chip" as described in U.S. Patent No.5,744,305. Alternatively, the substrate array can be a solution array, e.g., xMAP (Luminex, Austin, TX), Cyvera (Illumina, San Diego, CA), CellCard (Vitra Bioscience, Mountain View, CA) and Quantum Dots' Mosaic (Invitrogen, Carlsbad, CA).
The skilled artisan can routinely make antibodies, nucleic acid probes, e.g., oligonucleotides, aptamers, siRNAs, antisense oligonucleotides, against any of the avian influenza genes and proteins described herein. The Examples presented herein describe generation of monoclonal antibodies in mice. Such techniques are well-known to those of ordinary skill in the art.
Pharmaceutical Compositions and Methods of Treatment
The isolated avian influenza antibodies, preferably included as part of a pharmaceutical composition or formulation as described herein, can be administered by any administration method known to a person skilled in the art. Examples of routes of administration include but are not limited to oral, parenteral, intraperitoneal, intravenous, intraarterial, transdermal, topical, sublingual, intramuscular, rectal, transbuccal, intranasal, liposomal, via inhalation, pulmonary, transmucosal, vaginal, intraocular, via local delivery by catheter or stent, implant, osmotic pump, cartridge, micro pump, subcutaneous, intraadiposal, intraarticular, intrathecal, or in a slow release dosage form. The isolated avian influenza antibodies or pharmaceutical compositions comprising the isolated avian influenza antibodies can be administered in accordance with any dose and dosing schedule that achieves a dose effective to treat disease.
In addition, this invention also encompasses pharmaceutical compositions comprising any solid or liquid physical form of one or more of the isolated avian influenza antibodies of the invention. For example, the isolated avian influenza antibodies can be prepared in a crystalline form, in amorphous form, and have any particle size. The isolated antibody particles may be micronized, or may be agglomerated, particulate granules, powders, oils, oily suspensions or any other form of solid or liquid physical form.
As examples, isolated avian influenza antibodies or pharmaceutical compositions comprising isolated avian influenza antibodies of the invention can be administered in such oral forms as tablets, capsules (each of which includes sustained release or timed release formulations), pills, powders, granules, elixirs, tinctures, suspensions, syrups, and emulsions. Likewise, the isolated avian influenza antibodies or pharmaceutical compositions comprising isolated avian influenza antibodies can be administered by intravenous (e.g., bolus or infusion), intraperitoneal, subcutaneous, intramuscular, or other routes using forms described herein and well known to those of ordinary skill in the pharmaceutical arts.
The present invention also provides at least one avian influenza antibody, fragment, or derivative composition (preferably a pharmaceutical composition) comprising at least one, at least two, at least three, at least four, at least five, at least six or more avian influenza antibodies, fragments, or derivatives thereof, as described herein and/or as known in the art that are provided in a non-naturally occurring composition, mixture or form. Such compositions comprise non-naturally occurring compositions comprising at least one or two full length, C- and/or N-terminally deleted variants, domains, fragments, or specified
variants, of the avian influenza antibodies described herein. Such composition percentages are by weight, volume, concentration, molarity, or molality as liquid or dry solutions, mixtures, suspension, emulsions or colloids, as known in the art or as described herein.
The at least one avian influenza antibody, antibody fragment, or antibody derivative used in accordance with the present invention can be produced by recombinant means, including from mammalian cell or transgenic preparations, or can be purified from other biological sources, as described herein or as known in the art.
Suitable pharmaceutically acceptable salts of the agents described herein and suitable for use in the method of the invention, are conventional non-toxic salts and can include a salt with a base or an acid addition salt such as a salt with an inorganic base, for example, an alkali metal salt (e.g., lithium salt, sodium salt, potassium salt, etc.), an alkaline earth metal salt (e.g., calcium salt, magnesium salt, etc.), an ammonium salt; a salt with an organic base, for example, an organic amine salt (e.g., triethylamine salt, pyridine salt, picoline salt, ethanolamine salt, triethanolamine salt, dicyclohexylamine salt, N5N'- dibenzylethylenediamine salt, etc.) etc.; an inorganic acid addition salt (e.g., hydrochloride, hydrobromide, sulfate, phosphate, etc.); an organic carboxylic or sulfonic acid addition salt (e.g., formate, acetate, trifluoroacetate, maleate, tartrate, methanesulfonate, benzenesulfonate, p-toluenesulfonate, etc.); a salt with a basic or acidic amino acid (e.g., arginine, aspartic acid, glutamic acid, etc.) and the like. The range of at least one avian influenza antibody, antibody fragment, or antibody derivative in the pharmaceutical compositions and formulations of the present invention includes amounts yielding upon reconstitution, if in a wet/dry system, concentrations from about 1.0 μg/ml to about 1000 mg/ml, although lower and higher concentrations are operable and are dependent on the intended delivery vehicle, e.g., solution formulations will differ from transdermal patch, pulmonary, transmucosal, or osmotic or micro pump methods.
The term "treating" in its various grammatical forms in relation to the present invention refers to preventing (i.e. chemoprevention), curing, reversing, attenuating, alleviating, minimizing, suppressing or halting the deleterious effects of a disease state, disease progression, disease causative agent (e.g., bacteria or viruses) or other abnormal condition. For example, treatment may involve alleviating a symptom (i.e., not necessarily all symptoms) of a disease or attenuating the progression of a disease.
As used herein, the term "therapeutically effective amount" is intended to qualify the amount or amounts of the isolated antibodies of the invention, or pharmaceutical compositions comprising the isolated antibodies of the invention, that will achieve a desired biological response. In the context of the present invention, the desired biological response can be partial or total inhibition, delay or prevention of the progression of avian influenza infections; or inhibition, delay or prevention of the recurrence of avian influenza infections. The term "prophylactically effective amount" is intended to qualify the amount or amounts of the isolated antibodies of the invention, or pharmaceutical compositions comprising the isolated antibodies of the invention that will achieve the prevention of the onset or development of avian influenza infections (chemoprevention) in a subject, for example a human.
Such a method can comprise administering an effective amount of a composition or a pharmaceutical composition comprising at least one avian influenza antibody or specified portion or variant to a cell, tissue, organ, animal or subject in need of such modulation, treatment, alleviation, prevention, or reduction in symptoms, effects or mechanisms. The effective amount can comprise an amount of about 0.001 to 500 mg/kg per single or multiple administration, or to achieve a serum concentration of 0.01-5000 .mu./ml serum concentration per single or multiple administration, or any effective range or value therein, as done and determined using known methods, as described herein or known in the relevant arts. The effective amount can be a "therapeutically effective amount" or a "prophylactically effective amount" as defined herein.
The dosage administered will, of course, vary depending upon known factors. such as the pharmacodynamic characteristics of the particular agent, and its mode and route of administration; age, health, and weight of the recipient; nature and extent of symptoms, kind of concurrent treatment, frequency of treatment, and the effect desired. Usually a daily dosage of active ingredient can be about 0.01 to 100 milligrams per kilogram of body weight. Ordinarily 1.0 to 5, and preferably 1 to 10 milligrams per kilogram per day given in divided doses 1 to 6 times a day or in sustained release form is effective to obtain desired results.
As a non-limiting example, treatment of avian influenza-related pathologies, humans or animals can be provided as a daily dosage of the avian influenza antibodies of the present invention of anywhere between 0.1 to 100 mg/kg, such as 0.5, 0.9, 1.0, 1.1, 1.5, 2, 3, 4, 5, 6,
7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 40, 45, 50, 60, 70, 80, 90 or 100 mg/kg, per day, on at least one of day 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40, or alternatively, at least one of week 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20, or any combination thereof, using single or divided doses of every 24, 12, 8, 6, 4, or 2 hours, or any combination thereof. Such antibodies, fragments, or regions, will preferably have an affinity for one or more avian influenza viral proteins, viral particles, or viral peptides, expressed as Ka, of at least 10"8M, more preferably, at least 10'9M, such as 10"8 to 10'10M, 5 x 10"8M, 8 x 10-8M, 2 x 10"9M, 4 x 10"9M, 6 x 10"9M, 8 x 10"9M, or any range or value therein.
Dosage forms (composition) suitable for internal administration generally contain from about 0.1 milligram to about 500 milligrams of active ingredient per unit. In these pharmaceutical compositions the active ingredient will ordinarily be present in an amount of about 0.5-95% by weight based on the total weight of the composition. The isolated avian influenza antibodies of the invention can be administered as active ingredients in admixture with suitable pharmaceutical diluents, excipients or carriers (collectively referred to herein as "carrier" materials or "pharmaceutically acceptable carriers") suitably selected with respect to the intended form of administration. As used herein, "pharmaceutically acceptable carrier or diluent" is intended to include any and all solvents, stabilizers, buffers, salts, lipids, steroids (e.g., cholesterol), chelating agents (e.g., EDTA), lipophilic solvents, preservatives, adjuvants, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, polymeric excipients/additives such as polyvinylpyrrolidones, Ficolls, dextrates (e.g., cyclodextrins, such as 2-hydroxypropyl-β-cyclodextrin), polyethylene glycols, flavoring agents, sweeteners, antioxidants, anti-static agents, surfactants or solubilizers, and the like, compatible with pharmaceutical administration. Any inert excipient that is commonly used as a carrier or diluent may be used in the formulations of the present invention, such as for example, a gum, a starch, a sugar, a cellulosic material, an acrylate, or mixtures thereof. The compositions may further comprise a disintegrating agent and a lubricant, and in addition may comprise one or more additives selected from a binder, a buffer, a protease inhibitor, a surfactant, a solubilizing agent, a plasticizer, an emulsifier, a stabilizing agent, a viscosity increasing agent, a sweetener, a film forming agent, or any combination thereof. Furthermore, the
compositions of the present invention may be in the form of controlled release or immediate release formulations. Suitable carriers are described in the most recent edition of Remington's Pharmaceutical Sciences, a standard reference text in the field, which is incorporated herein by reference. Non-limiting examples of, and methods of preparing such sterile solutions are well known in the art, such as, but limited to, Gennaro, Ed., Remington's Pharmaceutical Sciences, 18th Edition, Mack Publishing Co. (Easton, Pa.) 1990. Pharmaceutically acceptable carriers can be routinely selected that are suitable for the mode of administration, solubility and/or stability of the avian influenza antibody compositions as well known in the art or as described herein. Preferred preservatives include those selected from the group consisting of phenol, m- cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol, alkylparaben (methyl, ethyl, propyl, butyl and the like), benzalkonium chloride, benzethonium chloride, sodium dehydroacetate and thimerosal, or mixtures thereof. The concentration of preservative used in the formulation is a concentration sufficient to yield an anti-microbial effect. Such concentrations are dependent on the preservative selected and are readily determined by the skilled artisan.
Other excipients, e.g., isotonicity agents, buffers, antioxidants, and preservative enhancers, can be optionally and preferably added to the diluent. An isotonicity agent, such as glycerin, is commonly used at known concentrations. A physiologically tolerated buffer is preferably added to provide improved pH control. The formulations can cover a wide range of pHs, such as from about pH 4 to about pH 10, and preferred ranges from about pH 5 to about pH 9, and a most preferred range of about 6.0 to about 8.0. Preferably, the formulations of the present invention have pH between about 6.8 and about 7.8. Preferred buffers include organic acid salts, such as salts of citric, ascorbic, gluconic, carbonic, tartaric, succinic, acetic, phthalic, Tris, tromethamine hydrochlorine, and phosphate buffers, most preferably, sodium phosphate, particularly phosphate buffered saline (PBS).
Other additives, such as a pharmaceutically acceptable solubilizers like Tween® 20 (polyoxyethylene (20) sorbitan monolaurate), Tween® 40 (polyoxyethylefle (20) sorbitan monopalmitate), Tween® 80 (polyoxyethylene (20) sorbitan monooleate), Pluronic® F68 (polyoxyethylene polyoxypropylene block copolymers), and PEG (polyethylene glycol) or non-ionic surfactants, such as polysorbate 20 or 80 or poloxamer 184 or 188, Pluronic® polyls, other block co-polymers, and chelators, such as EDTA and EGTA, can optionally be added to the formulations or compositions to reduce aggregation. These additives are
particularly useful if a pump or plastic container is used to administer the formulation. The presence of pharmaceutically acceptable surfactant mitigates the propensity for the protein to aggregate.
Pharmaceutical excipients and additives useful in the present composition include, but are not limited to, proteins, peptides, amino acids, lipids, and carbohydrates (e.g., sugars, including monosaccharides, di-, tri-, tetra-, and oligosaccharides; derivatized sugars, such as alditols, aldonic acids, esterified sugars and the like; and polysaccharides or sugar polymers), which can be present singly or in combination, comprising alone or in combination 1 -99.99% by weight or volume. Exemplary protein excipients include serum albumin, such as human serum albumin (HSA), recombinant human albumin (rHA), gelatin, casein, and the like. Representative amino acid components, which can also function in a buffering capacity, include alanine, glycine, arginine, betaine, histidine, glutamic acid, aspartic acid, cysteine, lysine, leucine, isoleucine, valine, methionine, phenylalanine, aspartame, and the like. One preferred amino acid is glycine. Carbohydrate excipients suitable for use in the pharmaceutical compositions and formulations of the invention include, for example, monosaccharides, such as fructose, maltose, galactose, glucose, D-mannose, sorbose, and the like; disaccharides, such as lactose, sucrose, trehalose, cellobiose, and the like; polysaccharides, such as raffinose, melezitose, maltodextrins, dextrans, starches, and the like; and alditols, such as mannitol, xylitol, maltitol, lactitol, xylitol sorbitol (glucitol), myoinositol and the like. Preferred carbohydrate excipients for use in the present invention are mannitol, trehalose, and raffinose.
Isolated avian influenza antibodies or pharmaceutical compositions comprising isolated avian influenza antibodies can also be prepared with soluble polymers as targetable drug carriers. Such polymers can include polyvinylpyrrolidone, pyran copolymer, polyhydroxy-propyl-methacrylamide-phenol, polyhydroxyethyl-aspartamide-phenol, or polyethyleneoxide-polylysine substituted with palmitoyl residues. Furthermore, the isolated avian influenza antibodies or pharmaceutical compositions comprising the isolated avian influenza antibodies can be prepared with biodegradable polymers useful in achieving controlled release of a drug, for example, polylactic acid, polyglycolic acid, copolymers of polylactic and polyglycolic acid, polyepsilon caprolactone, polyhydroxy butyric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanoacrylates and cross linked or amphipathic block copolymers of hydrogels.
Solid carriers/diluents include, but are not limited to, a gum, a starch (e.g., corn starch, pregelatinized starch), a sugar (e.g., lactose, mannitol, sucrose, dextrose), a cellulosic material (e.g., microcrystalline cellulose), an acrylate (e.g., polymethylacrylate), calcium carbonate, magnesium oxide, talc, or mixtures thereof. In addition, the compositions may further comprise binders (e.g., acacia, cornstarch, gelatin, carbomer, ethyl cellulose, guar gum, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, povidone), disintegrating agents (e.g., cornstarch, potato starch, alginic acid, silicon dioxide, croscarmellose sodium, crospovidone, guar gum, sodium starch glycolate, Primogel), buffers (e.g., tris-HCl, acetate, phosphate) of various pH and ionic strength, additives such as albumin or gelatin to prevent absorption to surfaces, detergents (e.g., Tween 20, Tween 80, Pluronic F68, bile acid salts), protease inhibitors, surfactants (e.g., sodium lauryl sulfate), permeation enhancers, solubilizing agents (e.g., glycerol, polyethylene glycerol), a glidant (e.g., colloidal silicon dioxide), anti-oxidants (e.g., ascorbic acid, sodium metabisulfϊte, butylated hydroxyanisole), stabilizers (e.g., hydroxypropyl cellulose, hydroxypropylmethyl cellulose), viscosity increasing agents (e.g., carbomer, colloidal silicon dioxide, ethyl cellulose, guar gum), sweeteners (e.g., sucrose, aspartame, citric acid), flavoring agents (e.g., peppermint, methyl salicylate, or orange flavoring), preservatives (e.g., Thimerosal, benzyl alcohol, parabens), lubricants (e.g., stearic acid, magnesium stearate, polyethylene glycol, sodium lauryl sulfate), flow-aids (e.g., colloidal silicon dioxide), plasticizers (e.g., diethyl phthalate, triethyl citrate), emulsifiers (e.g., carbomer, hydroxypropyl cellulose, sodium lauryl sulfate), polymer coatings (e.g., poloxamers or poloxamines), coating and film forming agents (e.g., ethyl cellulose, acrylates, polymethacrylates) and/or adjuvants.
In one embodiment, the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc. Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically acceptable carriers. These can be
prepared according to methods known to those skilled in the art, for example, as described in U.S. Patent No. 4,522,811.
These and additional known pharmaceutical excipients and/or additives suitable for use in the avian influenza antibody compositions according to the invention are known in the art, e.g., as listed in "Remington: The Science & Practice of Pharmacy", 19th ed., Williams & Williams, (1995), and in the "Physician's Desk Reference", 52nd ed., Medical Economics, Montvale, NJ. (1998), the disclosures of which are entirely incorporated herein by reference.
For parenteral administration, avian influenza antibodies can be formulated as a solution, suspension, emulsion or lyophilized powder in association with a pharmaceutically acceptable parenteral vehicle. Examples of such vehicles are water, saline, Ringer's solution, dextrose solution, and 5% human serum albumin. Liposomes and nonaqueous vehicles such as fixed oils can also be used. The vehicle or lyophilized powder can contain additives that maintain isotonicity (e.g., sodium chloride, mannitol) and chemical stability (e.g., buffers and preservatives). The formulation is sterilized by commonly used techniques. Suitable pharmaceutical carriers are described in the most recent edition of Remington's
Pharmaceutical Sciences, A. Osol, a standard reference text in this field of art. For example, a parenteral composition suitable for administration by injection is prepared by dissolving 1.5% by weight of active ingredient in 0.9% sodium chloride solution.
Isolated avian influenza antibodies and pharmaceutical compositions comprising isolated avian influenza antibodies can also be administered in the form of a depot injection or implant preparation, which may be formulated in such a manner as to permit a sustained release of the active ingredient. The active ingredient can be compressed into pellets or small cylinders and implanted subcutaneously or intramuscularly as depot injections or implants. Implants may employ inert materials such as biodegradable polymers or synthetic silicones, for example, Silastic, silicone rubber or other polymers manufactured by the Dow-Corning Corporation.
Isolated avian influenza antibodies or pharmaceutical compositions comprising isolated avian influenza antibodies can also be administered in the form of liposome delivery systems, such as small unilamellar vesicles, large unilamellar vesicles and multilamellar vesicles. Liposomes can be formed from a variety of phospholipids, such as cholesterol, stearylamine, or phosphatidylcholines. Liposomal preparations of diabetes-modulating agents may also be used in the methods of the invention.
For oral administration, the pharmaceutical compositions can be liquid or solid. Suitable solid oral formulations include tablets, capsules, pills, granules, pellets, and the like. Suitable liquid oral formulations include solutions, suspensions, dispersions, emulsions, oils, and the like. For liquid formulations, pharmaceutically acceptable carriers may be aqueous or nonaqueous solutions, suspensions, emulsions or oils. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions, or suspensions, including saline and buffered media. Examples of oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, mineral oil, olive oil, sunflower oil, and fish-liver oil. Solutions or suspensions can also include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose. The pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
Liposomes and non-aqueous vehicles such as fixed oils may also be used. The use of such media and agents for pharmaceutically active substances is well known in the art.
Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
For IV administration, glucuronic acid, L-lactic acid, acetic acid, citric acid or any pharmaceutically acceptable acid/conjugate base with reasonable buffering capacity in the pH range acceptable for intravenous administration can be used as buffers. Sodium chloride solution wherein the pH has been adjusted to the desired range with either acid or base, for example, hydrochloric acid or sodium hydroxide, can also be employed. Typically, a pH range for the intravenous formulation can be in the range of from about 5 to about 12. Subcutaneous formulations can be prepared according to procedures well known in the art at a pH in the range between about 5 and about 12, which include suitable buffers and isotonicity agents. They can be formulated to deliver a daily dose of the active agent in one
or more daily subcutaneous administrations. The choice of appropriate buffer and pH of a formulation, depending on solubility of the isolated avian influenza antibodies to be administered, is readily made by a person having ordinary skill in the art. Sodium chloride solution wherein the pH has been adjusted to the desired range with either acid or base, for example, hydrochloric acid or sodium hydroxide, can also be employed in the subcutaneous formulation. Typically, a pH range for the subcutaneous formulation can be in the range of from about 5 to about 12.
The compositions of the present invention can also be administered in intranasal form via topical use of suitable intranasal vehicles, or via transdermal routes, using those forms of transdermal skin patches well known to those of ordinary skill in that art. To be administered in the form of a transdermal delivery system, the dosage administration will, or course, be continuous rather than intermittent throughout the dosage regime.
As noted above, the invention provides for stable formulations, which preferably comprise a phosphate buffer with saline or a chosen salt, preserved solutions and formulations containing a preservative, as well as multi-use preserved formulations suitable for pharmaceutical or veterinary use, comprising at least one avian influenza antibody, antibody fragment, or antibody derivative in a pharmaceutically acceptable formulation. Preserved formulations contain at least one known preservative or optionally selected from the group consisting of at least one phenol, m-cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol, phenylmercuric nitrite, phenoxyethanol, formaldehyde, chlorobutanol, magnesium chloride (e.g., hexahydrate), alkylparaben (methyl, ethyl, propyl, butyl and the like), benzalkonium chloride, benzethonium chloride, sodium dehydroacetate and thimerosal, or mixtures thereof in an aqueous diluent. Any suitable concentration or mixture can be used as known in the art, such as 0.001-5%, or any range or value therein, such as, but not limited to 0.001, 0.003, 0.005, 0.009, 0.01, 0.02, 0.03, 0.05, 0.09, 0.1, 0.2, 0.3, 0.4., 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.3, 4.5, 4.6, 4.7, 4.8, 4.9, or any range or value therein. Non-limiting examples include, no preservative, 0.1-2% m-cresol (e.g., 0.2, 0.3. 0.4, 0.5, 0.9, 1.0%), 0.1-3% benzyl alcohol (e.g., 0.5, 0.9, 1.1., 1.5, 1.9, 2.0, 2.5%), 0.001-0.5% thimerosal (e.g., 0.005, 0.01), 0.001-2.0% phenol (e.g., 0.05, 0.25, 0.28, 0.5, 0.9, 1.0%), 0.0005-1.0% alkylparaben(s) (e.g., 0.00075, 0.0009, 0.001, 0.002, 0.005, 0.0075, 0.009, 0.01, 0.02, 0.05, 0.075, 0.09, 0.1, 0.2, 0.3, 0.5, 0.75, 0.9, 1.0%), and the like.
It is especially advantageous to formulate oral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals. The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.
The stable or preserved pharmaceutical compositions and formulations of the invention can be provided to subjects as clear solutions or as dual vials comprising a vial of lyophilized at least one avian influenza antibody, antibody fragment, or antibody derivative that is reconstituted with a second vial containing a preservative or buffer and excipients in an aqueous diluent. Either a single solution vial or dual vial requiring reconstitution can be reused multiple times and can suffice for a single or multiple cycles of subject treatment and thus provides a more convenient treatment regimen than currently available.
The invention also provides pharmaceutical compositions and formulations comprising at least one avian influenza antibody, fragment, or derivative, and at least one selected from sterile water, sterile buffered water, or at least one preservative selected from the group consisting of phenol, m-cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol, alkylparaben, benzalkonium chloride, benzethonium chloride, sodium dehydroacetate and thimerosal, or mixtures thereof in an aqueous diluent, optionally, wherein the concentration of avian influenza antibody can be about 0.1 mg/ml to about 100 mg/ml, further comprising at least one isotonicity agent or at least one physiologically acceptable buffer.
The invention also includes pharmaceutical compositions and formulations comprising at least one avian influenza antibody, fragment, or derivative in lyophilized form in a first container, and an optional second container comprising at least one of sterile water, sterile buffered water, or at least one preservative selected from the group consisting of phenol, m- cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol, alkylparaben, benzalkonium chloride, benzethonium chloride, sodium dehydroacetate and thimerosal, or mixtures thereof in an aqueous diluent, optionally further wherein the concentration of avian influenza antibody is
reconsitituted to a concentration of about 0.1 mg/ml to about 500 mg/ml, further comprising an isotonicity agent, or further comprising a physiologically acceptable buffer.
As noted above, the invention provides kits comprising packaging material and at least one vial comprising a solution of at least one avian influenza antibody, antibody fragment, or antibody derivative with the prescribed buffers and/or preservatives, optionally, in an aqueous diluent, wherein said packaging material comprises a label that indicates that such solution can be held over a period of 1, 2, 3, 4, 5, 6, 9, 12, 18, 20, 24, 30, 36, 40, 48, 54, 60, 66, 72 hours or greater. The invention further comprises a kit comprising packaging material, a first vial comprising lyophilized at least one avian influenza antibody, antibody fragment, or antibody derivative, and a second vial comprising an aqueous diluent of prescribed buffer or preservative, wherein said packaging material comprises a label that instructs a subject to reconstitute the at least one avian influenza antibody, antibody fragment, or antibody derivative in the aqueous diluent to form a solution that can be held over a period of twenty- four hours or greater. The pharmaceutical compositions and formulations of the present invention are useful for administration over a period of immediately to twenty-four hours or greater. Accordingly, the presently claimed articles of manufacture offer significant advantages to the subject. Pharmaceutical compositions and formulations of the invention can optionally be safely stored at temperatures of from about 2°C to about 40°C and retain the biologically activity of the protein for extended periods of time, thus allowing a package label indicating that the solution can be held and/or used over a period of 6, 12, 18, 24, 36, 48, 72, or 96 hours or greater. If preserved diluent is used, such label can include use up to 1 to 12 months, one- half, one and a half, and/or two years.
The pharmaceutical compositions and formulations of the invention can be provided to subjects as clear solutions or as dual vials comprising a vial of lyophilized (at least one) avian influenza antibody, antibody fragment, or antibody derivative that is reconstituted with a second vial containing the aqueous diluent. Either a single solution vial or dual vial requiring reconstitution can be reused multiple times and can suffice for a single or multiple cycles of subject treatment and thus provides a more convenient treatment regimen than currently available.
The claimed products can be provided indirectly to subjects by providing to pharmacies, climes, or other such institutions and facilities, clear solutions or dual vials comprising a vial of lyophilized (at least one) avian influenza antibody, antibody fragment, or antibody derivative that is reconstituted with a second vial containing the aqueous diluent. The clear solution in this case can be up to one liter or even larger in size, providing a large reservoir from which smaller portions of the at least one avian influenza antibody solution can be retrieved one or multiple times for transfer into smaller vials and provided by the pharmacy or clinic to their customers and/or subjects.
Recognized devices comprising these single vial systems include those pen-injector devices for delivery of a solution such as BD Pens, BD Autojector®, Humaject®,
NovoPen®, B-D® pen, AutoPen®, and OptiPen®, GenotropinPen®, Genotronorm Pen®, Humatro Pen®, Reco-Pen®, Roferon Pen®, Biojector®, Iject®, J-Tip Needle-Free Injector®, Intraject®, Medi-Ject®, e.g., as made or developed by Becton Dickenson (Franklin Lakes, NJ), Disetronic (Burgdorf, Switzerland); Bioject (Portland, OR); National Medical products; Weston Medical (Peterborough, UK); Medi-Ject Corp (Minneapolis, MN). Recognized devices comprising a dual vial system include those pen- injector systems for reconstituting a lyophilized drug in a cartridge for delivery of the reconstituted solution, such as the HumatroPen®.
The pharmaceutical compositions, formulations, and kits of the present invention can include packaging material. The packaging material provides, in addition to the information required by the regulatory agencies, the conditions under which the product can be used. The packaging material of the present invention provides instructions to the subject to reconstitute the at least one avian influenza antibody in the aqueous diluent to form a solution and to use the solution over a period of 2 to 24 hours or greater for the two vial, wet/dry, product. For the single vial, solution product, the label indicates that such solution can be used over a period of 2 to 24 hours or greater. The presently claimed products are useful for human pharmaceutical use.
The solutions of at least one avian influenza antibody, antibody fragments, or antibody derivatives of the invention can be prepared by a process that comprises mixing at least one avian influenza antibody, fragment, or derivative in an aqueous diluent. Mixing the at least one avian influenza antibody and preservative in an aqueous diluent is carried out using
conventional dissolution and mixing procedures. To prepare a suitable formulation, for example, a measured amount of at least one avian influenza antibody in buffered solution is combined with the desired preservative in a buffered solution in quantities sufficient to provide the protein and preservative at the desired concentrations. Variations of this process would be recognized by one of ordinary skill in the art. For example, the order the components are added, whether additional additives are used, the temperature and pH at which the formulation is prepared, are all factors that may be optimized for the concentration and means of administration used. The pharmaceutical compositions and formulations described herein can be provided to subjects as clear solutions or as dual vials comprising a vial of lyophilized (at least one) avian influenza antibody, antibody fragment, or antibody derivative that is reconstituted with a second vial containing water, a preservative and/or excipients, preferably, a phosphate buffer and/or saline and a chosen salt, in an aqueous diluent. Either a single solution vial or dual vial requiring reconstitution can be reused multiple times and can suffice for a single or multiple cycles of subject treatment and thus can provide a more convenient treatment regimen than currently available.
The pharmaceutical compositions and formulations of the present invention can be prepared by a process that comprises mixing at least one avian influenza antibody, antibody fragment, or antibody derivative, and a selected buffer, preferably, a phosphate buffer containing saline or a chosen salt. Mixing the at least one avian influenza antibody, fragment, or derivative and buffer in an aqueous diluent is carried out using conventional dissolution and mixing procedures. To prepare a suitable formulation, for example, a measured amount of at least one avian influenza antibody, antibody fragment, or antibody derivative in water or buffer is combined with the desired buffering agent in water in quantities sufficient to provide the protein and buffer at the desired concentrations. Variations of this process would be recognized by one of ordinary skill in the art. For example, the order the components are added, whether additional additives are used, the temperature and pH at which the formulation is prepared, are all factors that can be optimized for the concentration and means of administration used.
The preparation of pharmaceutical compositions that contain an active component is well understood in the art, for example, by mixing, granulating, or tablet-forming processes. The active therapeutic ingredient is often mixed with excipients that are pharmaceutically acceptable and compatible with the active ingredient. For oral administration, the active
agents are mixed with additives customary for this purpose, such as vehicles, stabilizers, or inert diluents, and converted by customary methods into suitable forms for administration, such as tablets, coated tablets, hard or soft gelatin capsules, aqueous, alcoholic, or oily solutions and the like as detailed above. The isolated avian influenza antibodies, pharmaceutical compositions and formulations containing such isolated avian influenza antibodies can optionally be administered in combination with one or more additional drugs or agents for treatment of avian influenza or sequelae/symptoms related to avian influenza, such as a combination of one or two or more of selected from the group consisting of bronchodilator, cytokine, steroid, non-steroidal anti-inflammatory drug (NSAID), leukotriene receptor antagonist, phosphodiesterase inhibitor, anti-viral drug, immunosuppressive drug, anti-allergic drug, mediator release inhibitor, antihistamine drug, metabolism accelerator, protease inhibitor, reverse transcriptase inhibitor, integrase inhibitor, fusion inhibitor, aldose reductase inhibitor, cannabinoid-2 receptor stimulator, adrenocorticotropic hormone, metalloprotease inhibitor, prostaglandin, disease modifying anti-rheumatic drug, anti-inflammatory enzyme drug, cartilage protective drug, T-cell suppressor, TNF-α inhibitor, IL-I inhibitor, IL-6 inhibitor, interferon-α, -β, or -γ stimulator, NF-κB inhibitor and/or chemokine antagonist, but are not limited to these examples.
Steroids, glucocorticoids, and corticosteroids include, for example, clobetasol propionate, diflorasone diacetate, fluocinonide, mometasone furcate, betamethasone dipropionate, betamethasone butyrate propionate, betamethasone valerate, difluprednate, butesonid, diflucortolone valerate, amcinonide, halcinonide, dexamethasone, dexamethasone propionate, dexamethasone valerate, dexamethasone acetate, hydrocortisone acetate, hydrocortisone butyrate, hydrocortisone butyrate propionate, deprodone propionate, prednisolone valerate acetate, fluocinolone acetonide, beclometasone dipropionate, triamcinolone acetonide, flumetasone pivalate, alclometasone dipropionate, clobetasone butyrate, prednisolone, beclometasone dipropionate, fludroxycortide, cortisone acetate, hydrocortisone, hydrocortisone sodium phosphate, hydrocortisone sodium succinate, fludrocortisone acetate, prednisolone, prednisolone acetate, prednisolone sodium succinate, prednisolone butylacetate, prednisolone sodium phosphate, halopredone acetate, methylprednisolone, methylprednisolone acetate, methylprednisolone sodium succinate, triamcinolone, triamcinolone acetate, triamcinolone acetonide, dexamethasone,
dexamethasone acetate, dexamethasone sodium phosphate, dexamethasone palmitate, paramethason acetate, betamethasone, beclometasone dipropionate, fluticasone propionate, budesonide, flunisolide, triamcinolone, ST-126P, ciclesonide, dexamethasone palmitate, mometasone furoate, prasterone sulfonate, deflazacort, methylprednisolone suleptanate, methylprednisolone sodium succinate, and the like.
Examples of non-steroidal anti-inflammatory drugs include, for example, sasapyrine, sodium salicylate, aspirin, aspirin.cndot.di-aluminate composition, diflunisal, indometacin, suprofen, ufenamate, dimethyl isopropylazulene, bufexamac, felbinac, diclofenac, tolmetin sodium, Clinoril, fenbufen, nabumetone, proglumetacin, indometacin farnesil, acemetacin, proglumetacin maleate, amfenac sodium, mofezolac, etodolac, ibuprofen, ibuprofen piconol, naproxen, flurbiprofen, flurbiprofenaxetil, ketoprofen, fenoprofen calcium, thiaprofen, oxaprozin, pranoprofen, loxoprofen sodium, alminoprofen, zaltoprofen, mefenamic acid, aluminum mefenamate, tolfenamic acid, floctafenine, ketophenylbutazon, oxyphenbutasone, piroxicam, tenoxicam, ampiroxicam, Napageln ointment, epirizole, tiaramide hydrochloride, tinoridine hydrochloride, emorfazone, sulpyrine, migrenin, Saridon, Sedes-G, Amipylo-N, Sorbon, pyrine preparation for cold syndrome, acetaminophen, phenacetin, dimetotiazine mesilate, simetride composition, non-pyrine preparation for cold syndrome, and the like.
Examples of immunosuppressants include, for example, Protopic (FK-506), methotrexate, cyclosporine, ascomycin, leflunomide, bucillamine, salazosulfapyridine, sirolimus, mycophenolate mofetil, and the like. Prostaglandins (hereinafter, abbreviated to PG) include PG receptor agonist, PG receptor antagonist, and the like. Examples of PG receptor include PGE receptor (EPl, EP2, EP3, EP4), PGD receptor (DP, CRTH2), PGF receptor (FP), PGI receptor (IP), TX receptor (TP), and the like. Mediator release inhibitor include, for example, tranilast, sodium cromoglicate, amlexanox, repirinast, ibudilast, tazanolast, pemirolast potassium, and the like.
Examples of antihistamines include, for example, ketotifen fumarate, mequitazine, azelastine hydrochloride, oxatomide, terfenadine, emedastine difumarate, epinastine hydrochloride, astemizole, ebastine, cetirizine hydrochloride, bepotastine, fexofenadine, loratadine, desloratadine, olopatadine hydrochloride, TAK-427, ZCR-2060, NIP-530, mometasone furoate, mizolastine, BP-294, andolast, auranofin, acrivastine, famotidine, ranitidine, cimetidine, and the like.
Phosphodiesterase inhibitors include, for example, the PDE4 inhibitors such as
rolipram, cilomilast (also known in the art as Ariflo), Bay 19-8004, NIK-616, roflumilast (BY-217), cipamphylline (BRL-61063), atizoram (CP-80633), SCH-351591, YM-976, V- 1 1294A, PD-168787, D-4396, IC-485, and the like.
Examples of leukotriene receptor antagonists include, for example, pranlukast hydrate, montelukast, zafirlukast, seratrodast, MCC-847, KCA-757, CS-615, YM-158, L-740515, CP- 195494, LM-1484, RS-635, A-93178, S-36496, BIIL-284, ONO-4057, and the like. Thromboxane A2 receptor antagonist include, for example, seratrodast, ramatroban, domitroban calcium hydrate, KT-2-962, and the like. Examples of thromboxane synthase inhibitor include, for example, ozagrel hydrochloride, imitrodast sodium, and the like. Xanthine derivatives include, for example, aminophylline, theophylline, doxophylline, cipamphylline, diprophylline, and the like. Anticholinergic agents include, for example, ipratropium bromide, oxitropium bromide, flutropium bromide, cimetropium bromide, temiverine, tiotropium bromide, revatropate (UK-112166), oxybutynin hydrochloride, bethanechol chloride, propiverine hydrochloride, propantheline bromide, methylbenactyzium bromide, scopolamine butylbromide, tolterodine tartrate, trospium chloride, Z-338, UK-
1 12166-04, KRP-197, darifenacin, YM-905, mepenzolate bromide, ipratropium bromide, and the like.
Examples of β2-adrenaline receptor stimulants include, for example, fenoterol hydrobromide, salbutamol sulfate, terbutaline sulfate, formoterol fumarate, salmeterol xinafoate, isoproterenol sulfate, orciprenaline sulfate, chlorprenaline sulfate, epinephrine, trimetoquinol hydrochloride, hexoprenalinemesyl sulfate, procaterol hydrochloride, tulobuterol hydrochloride, tulobuterol, pirbuterol hydrochloride, clenbuterol hydrochloride, mabuterol hydrochloride, ritodrine hydrochloride, bambuterol, dopexamine hydrochloride, meluadrine tartrate, AR-C68397, levosalbutamol, R,R-formoterol, KUR-1246, KUL-721 1, AR-C89855, S-1319, and the like.
Examples of suitable cytokines include TNF-α, IFN-α, IFN-β and IFN-γ, interleukin- 1 , interleukin-6, interleukin-12, and the like.
Reverse transcriptase inhibitors include, without limitation, (1) nucleic-acid reverse transcriptase inhibitors: zidovudine (Retrovir), didanosine (Videx), zalcitabine (HIVID), stavudine (Zerit), lamivudine (Epivir), abacavir (Ziagen), adefovir, adefovir dipivoxil, emtricitabine (Coviracil), PMPA (Tenofovir), and the like, (2) nonnucleic-acid reverse transcriptase inhibitors: nevirapine (Viramune), delavirdine (Rescriptor), efavirenz (Sustiva,
Stocklin), capravirine (AGl 549), and the like. Examples of protease inhibitor include, but are not limited to, indinavir (Crixivan), ritonavir (Norvir), nelfinavir (Viracept), saquinavir (Invirase, Fortovase), amprenavir (Agenerase), lopinavir (Kaletra), tipranavir, and the like.
As chemokine antagonists, internal ligands of chemokine receptor, its derivatives, non-peptide low molecular compounds or antibodies of chemokine receptor are included. Examples of internal ligands of chemokine receptors include, without limitation, MIP- lα, MIP-I β, RANTES, SDF-lα, SDF-lβ, MCP-I, MCP-2, MCP-4, Eotaxin, MDC, and the like. Examples of the derivatives of internal ligand include, but are not limited to, AOP-RANTES, Met-SDF-lα, Met-SDF-lβ, and the like. Antibodies of chemokine receptor include, for example, Pro- 140, and the like. Examples of CCRl antagonists include, but are not limited to, the compounds disclosed in the specification of WO98/04554, WO98/38167, WO99/40061, WO00/14086, WO00/14089, WO01/72728, JP2002- 179676, WO02/036581, WO03/013656, WO03/035627, WO03/035037, or BX-471, and the like. CCR2 antagonists include compounds disclosed in the specification of WO99/07351, WO99/40913, WO00/46195, WO00/46196, WO00/46197, WO00/46198, WO00/46199, WO00/69432,
WO00/69815 or the compounds disclosed in Bioorg. Med. Chem. Lett., 10, 1803 (2000), and the like. Examples of CCR3 antagonists include, without limitation, compounds disclosed in the specification of DEl 9837386, WO99/55324, WO99/55330, WO00/04003, WO00/27800, WO00/27835, WO00/27843, WO00/29377, WO00/31032, WO00/31033, WO00/34278, WO00/35449, WOOO/35451 , WO00/35452, WOOO/35453, WO00/35454, WO00/35876, WO00/35877, WO00/41685, WO00/51607, WOOO/51608, WOOO/51609, WO00/51610, WO00/53172, WO00/53600, WO00/58305, WO00/59497, WOOO/59498, WO00/59502, WOOO/59503, WO00/62814, WO00/73327, WO01/09088, and the like. CCR4 antagonists include, but are not limited to, compounds disclosed in the specification of WO02/030357, WO02/030358, WO02/094264, WO03/051870, WO03/059893, and the like. CCR5 antagonists include compounds disclosed in the specification of WO99/17773, WO99/32100, WOOO/06085, WO00/06146, WO00/10965, WOOO/06153, WO00/21916, WO00/37455, EP1013276, WO00/38680, WO00/39125, WO00/40239, WO00/42045, WOOO/53175, WO00/42852, WO00/66551 , WO00/66558, WO00/66559, WO00/66141, WOOO/68203, JP2000309598, WO00/51607, WOOO/51608, WOOO/51609, WOOO/51610, WO00/56729, WO00/59497, WOOO/59498, WO00/59502, WOOO/59503, WOOO/76933, WO98/25605, WO99/04794, WO99/38514, or the compounds disclosed in Bioorg. Med. Chem. Lett., 10,
1803 (2000), or TAK-779, SCH-351125 (SCH-C), SCH-417690 (SCH-D), UK-427857, GW 873140A, TAK-220, and the like. CXCR4 antagonists include AMD-3100, T-22, KRH-1120 or the compounds disclosed in the specification of WO00/66112, and the like.
Examples of fusion inhibitors include, without limitation, T-20 (pentafuside), T- 1249, and the like. Integrase inhibitors include, but are not limited to, Equisetin, Temacrazine, PL- 2500, V- 165, NSC-618929, L-870810, L-708906 analog, S- 1360, 1838, and the like. Examples of disease-modifying anti-rheumatic drugs include, in concrete terms, aurothioglucose, gold sodium thiomalate, auranofin, actarit, D-penicillamine, lobenzarit disodium, bucillamine, hydroxychloroquine, salazosulfapyridine, and the like. Examples of anti-inflammatory enzyme preparations include, in concrete terms, lysozyme hydrochloride, bromelain, pronase, serrapeptase, combination drugs of streptokinase-streptodornase, and the like. Examples of cartilage protectants include, in concrete terms, sodium hyaluronate, glucosamine, chondroitin sulfate, glycosaminoglycan polysulfate, and the like. Other agents, including anti- viral agents commonly prescribed for treatment of influenza include, but are not limited to, amantadine, zanamivir, acyclovir, oseltamavir, and ribavirin.
EXAMPLES Example 1: Cloning and Expression of HPAI H5 Hemagglutinin
The DNA sequence encoding for the H5 hemagglutinin protein sequence of the HPAI influenza strain A/Hong Kong/483/97 (GenBank Accession # AF084280) was obtained from the NCBI nucleotide database. This viral strain was selected as it was isolated from one of the first fatal human cases of H5 influenza during the outbreak of chicken and human influenza in Hong Kong in 1997. The full length genetic sequence was assembled into a synthetic gene in the pUCminusMCS vector by Blue Heron Biotechnology (Bothwell, WA). The full length HK483 H5 hemagglutinin (HA) gene was cloned from the pUCminusMCS vector supplied by Blue Heron and inserted into the pCI mammalian expression vector (Promega, Madison, WI) under the control of the CMV promoter. The plasmid (also referred to herein as "pCI-HK483") was then sequenced to verify that the insert was complete and in the correct orientation. The DNA sequence was also verified by in silico translation using the NEBcutter V2.0 online tool (New England Biolabs, Ipswich, MA). The resulting protein sequence was used to search the NCBI blast database and returned a 100 % match for the HK-483 hemagglutinin protein (accession # AAC32099).
The pCI-HK483 plasmid was then transformed into DH5a™-TlR competent cells (Invitrogen Cat # 12297-016) and plated onto LB-ampicillin agar plates. Colonies were screened for successful insertion of the pCI-HK483 plasmid by restriction digest. The plasmid from selected colonies was again verified by DNA sequencing. A large scale preparation of endotoxin-free plasmid was prepared from a selected E. coli transformants using an EndoFree Plasmid Gigakit from Qiagen (Valencia, CA). The purified, endotoxin- free plasmid was harvested according to the manufacturer's instructions and stored at -20°C until needed.
HEK 293 cells (ATCC CRL-1573™) were transfected with pCI-HK483 plasmid using Lipofectamine 2000 (Invitrogen Cat # 11668-019). After 48 hours, incubation cells were harvested and a batch of transfected cell lysate was prepared using RIPA buffer (Pierce, Rockford, IL). A control batch of untransfected HEK293 lysate was also prepared. Embryonated hens eggs were inoculated with the low pathogenicity avian influenza (LPAI) strain A/mallard duck/Pennsylvania/ 10218/84 (H5N2) (ATCC® 1331-VR) under BSL-3 conditions. After a 3 day incubation, eggs were chilled at 4°C for 2 to 3 hours to terminate the embryos and the infected allantoic fluid was harvested. Virus particles were inactivated by mixing the allantoic fluid with an equal volume of ethyl ether in a stoppered separating funnel and mixing vigorously for 30 minutes. After allowing the mixture to stand to facilitate its separation into two phases, the lower portion was decanted from the separating funnel via the stop-cock and sparged with nitrogen to remove any residual ether. A control batch of uninfected allantoic fluid was prepared in a similar fashion as a control.
A Western blot was performed using pCI-HK483 transfected and untransfected HEK293 cell extracts and infected allantoic fluid as an antigen source. The blot was developed using a commercially available mouse polyclonal antibody directed against the HAl portion of influenza H5 molecule (Immune Technology Cat # IT-003-005). The results (Figure 1) indicated that the anti-H5 polyclonal antibody specifically recognized the H5 allantoic fluid indicating reactivity with H5 HA protein. Reactivity was also noted against pCI-HK483 transfected HEK293 extract, but not against untransfected control cell extract. This data indicates that transfection of HEK293 cells with the pCI-HK483 construct results in the production of H5 HA protein.
Example 2: Generation of Hybridomas
On day -1 , a pre-bleed serum sample was obtained by withdrawing no more than 200 μl of whole blood via the lateral tail vein of each mouse according to ATCC standard operating procedures (SOP). Purified endotoxin-free pCI-HK483 at a dose of 100 μg was prepared in sterile Ringers' solution in a volume equal to 8 % of the body weight of the animal. The maximum volume to be delivered was capped at 3.0 mL (equivalent to a 37.5 g mouse). The DNA solution was injected as a bolus into the lateral tail vein according to ATCC SOP in 6 to 7 seconds. Mice were immunized in this fashion a total of 4 times on days 0, 14, 21, and 28. Three days after the final injection, a further blood sample was collected as before to test for seroconversion to the antigen of interest. No later than 7 days after the final plasmid injection, selected animals were terminally bled and euthanized according to ATCC SOP. Spleens and/or lymph nodes were removed for the generation of hybridoma cell lines.
Analysis of the test bleeds revealed that 3 of the animals had responded to the plasmid injection and exhibited a positive reaction against both pCI-HK483 transfected cell extracts (see Figure 2). Western blot analysis against pCI-HK483 transfected HEK293 cell extracts also showed specific bands for HAO and HAl proteins using mouse polyclonal antiserum. No specific bands were noted when untransfected control HEK293 cell extracts were used (see Figure 3). The reactivity of the murine polyclonal antiserum was then compared to that of the commercial polyclonal serum (Immune Technologies). As can be seen in Figure 4, the murine polyclonal antiserum appears to react more strongly with the influenza proteins than the commercial preparation, and has lower non-specific binding. In addition, the murine polyclonal recognizes 3 protein species - the full length HAO, and the HA 1 and HA2 components of the spliced hemagglutinin molecule. The commercial preparation does not react with the HA2 species as the antigen for this immunization was a truncated protein that does not contain the HA2 portion of the molecule.
After removing the spleens from hydrodynamically immunized mice, hybridoma cell lines were produced by fusing the splenocytes with the murine myeloma cell line Sp2/0-Agl4 (ATCC® CRL-1581™) using a standard protocol. Following plating by limiting dilution, outgrowing colonies were screened for differential reactivity against recombinant HK483 HA protein by ELISA. Initially, ELISA plates were coated with transfected HEK293 cell lysate. The absolute ELISA OD was used to screen for putative reactive clones. Following 2 rounds of screening using this method, the 13 most reactive clones were selected for subcloning and
further characterization (Figure 5). During subsequent screening, supernatants were tested in parallel against both pCI-HK483 transfected and untransfected HEK293 cell extracts. The ratio of the ELISA OD readings for each antigen source was calculated to determine differential detection of the influenza target protein (see Figure 6a). Screening was also conducted with H5N2 infected and uninfected allantoic fluid. Hybridomas demonstrating an ELISA OD ratio > 2 were expanded for further characterization (see Figure 6b).
Example 3: Confirmation of HPAI H5 Hemagglutinin Specificity
To confirm specificity of clones 6D5-F5 and 1F7-F2, a Western blot was performed using pCI-HK483 transfected and untransfected HEK293 cell, and H5N2 infected and uninfected allantoic fluid. The blots (shown in Figure 7) confirm that both monoclonal antibodies specifically react against the HA protein from the HK483 strain of HPAI. Once again, no reactivity was noted for either of these clones for the LPAI H5N2 influenza strain. To determine if the monoclonal antibodies can also recognize the HA protein in it's native conformation each was used to stain pCI-HK483 transfected and untransfected
HEK293 cells directly. Fluorescent conjugate antibodies were used to visualize any staining of the cells using a fluorescent microscope. The images shown in Figure 8 indicate that transfected HEK293 cells stain positively with both monoclonal antibodies, whereas untransfected HEK293 cells do not. Transfected and untransfected HEK293 stained with either Immune Technologies anti-H5 polyclonal antiserum, ATCC produced murine anti- HP AI H5 polyclonal antiserum were included as positive controls and conditioned supernatant from the murine myeloma cell line Sp2/0-Agl4 was used as a negative control.
Example 4: Sequencing of Variable Regions of Selected Hybridoma Clones To determine the sequence of the variable regions of clones 6D5-F5 and 1F7-F2, a frozen pellet of 106 cells from each hybridoma cell line was used. Total RNA extraction was performed using the RNeasy kit (Qiagen, Valencia, CA), and the quantity and quality of extracted RNA was measured using the Agilent 2100 Bioanalyzer (Agilent RNA Nano Kit). cDNA synthesis and PCR amplification of variable regions of each of the immunoglobin transcripts (heavy and light chains) was performed using the Superscript III One-Step RT-PCR kit and Platinum Taq DNA polymerase (Invitrogen, Carlsbad, CA). Previously published primers (Dattamajumdar AK, et al. (1995) Immunogenetics 43: 141-
151) were used to amplify the variable regions of the immunoglobulin transcripts for heavy and light chains. The presence of PCR amplicons was confirmed by analyzing the RT-PCR products on a 2% agarose gel (single-comb E-GeI, Invitrogen, Carlsbad, CA)
The PCR amplicons representing the variable regions of heavy and light chains of each immunoglobulin were then cloned into pCR 2.1 -TOPO vector (TOPO TA Cloning Kit, Invitrogen). Transformed competent cells were plated onto ImMedia Amp Blue plates (Invitrogen, Carlsbad, CA) and then selected using blue-white screening. Clones were grown overnight using LB Media with 50ug/L ampicillin, and plasmid DNA was extracted using QIAprep Spin Miniprep kit (Qiagen, Valencia, CA). The presence of inserts was confirmed by restriction endonuclease digestion using EcoRI.
To ensure sufficient coverage for sequencing, five individual clones for each amplicon were selected for sequence analysis. Sequencing was performed by in a CEQ 8000 Genetic Analysis System (Beckman-Coulter, Fullerton, CA) and the CodonCode Aligner software (Codon Code, Dedham, Ma) was used for data analysis. BLAST analyses were performed to compare the sequences of the variable regions of heavy and light chains of immunoglobulin with published sequences.
The nucleotide and amino acid sequences of the variable regions of clone 1F7 heavy and light (kappa) chains are as follows: Clone 1F7 variable region heavy chain; nucleotide sequence (SEO ID NO: 1) GAGGTGCAGCTGGAGGAGTCAGGACCTGGCCTGGTGGCGCCCTCACAGA
GCCTGTCCATCACATGCACCGTCTCAGGGTTCTCATTAACCGGCTATGGT
GTAAACTGGGTTCGCCAGCCTCCAGGAAAGGGTCTGGAGTGGCTGGGAAT
GATATGGAGTGATGGAAACACAGACTATAATTCAGCTCTCAAATCCAGAC
TGAGCATCAGCAAGGACAACTCCAAGAGCCAAGTTTTCTTAAAAATGAAC AGTCTGCAAACTGATGACACAGCCAGGTACTACTGTGCCAGAGATCGGGG
GATCTCTCCTGGTTTGCTTACTGGGGCG
Clone 1F7 variable region heavy chain; amino acid sequence (SEO ID NO: 2)
EVQLEESGPGLVAPSQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGM IWSDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCARDRG ISPGLLTGA
Clone 1F7 variable region light (kappa) chain;nucleotide sequence (SEQ ID NO: 3) GAATTCGCCCTTGACATTCTGATGACCCAGTCTCACAAATTCATGTCCA CATCAGTAGGAGACAGGGTCAGCTTCACCTGCGAGGCCAGTCAGGATGTG AGTACTGCTGTAGCCTGGTATCAACAGAAACCAGGACAATCTCCTAAACT ACTGATTTACTCGGCATCCTACCGGTACACTGGAGTCCCTGATCGCTTCA CTGGCAGTGGATCTGGGACGGATTTCACTTTCACCATCAGCAGTGTGCAG GCTGAAGACCTGGCAGTTTATTACTGTCAGCAACATTATATTACTCCTCC CACGTTCGGTGCTGGGACCAAGCTGGAA
Clone 1F7 variable region light (kappa) chain; amino acid sequence (SEQ ID NO: 4)
EFALDILMTQSHKFMSTSVGDRVSFTCKASQDVSTAVAWYQQKPGQSPKL LIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYITPP TFGAGTKLE
The nucleotide and amino acid sequences of the variable regions of clone 6D5 heavy and light (kappa) chains are as follows: Clone 6D5 variable region heavy chain; nucleotide sequence (SEQ ID NO: 5)
TCAGGACCTGGCCTAGTGCAGTCCTCACAGAGCCTGTCCATCACCTGCAC AGTCTCTGGTTTCTCATTAACTAGCTATGCTGTACACTGGGTTCGCCAGT
CTCCAGGAAAGGGTCTGGAGTGGCTGGGAGTGATATGGAGTGGTGGAAGA
ACAGACCATAATGCAGCTTTCATATCCAGACTGAGCATCAGCAAGGACAA
TTCCAAGAGCCAGGTTTTCTTTAAAATGAACAGTCTGCAACCTAATGACA
CAGCCATATATTACTGTGCCAGAACTCCTTACTACGGCTACGGGTTTGCT TACTGGGGCCAAGGGACCACGGTCACAAGGGCGAATTCC
Clone 6D5 variable region heavy chain; amino acid sequence (SEQ ID NO: 6)
SGPGLVQSSQSLSITCTVSGFSLTSYAVHWVRQSPGKGLEWLGVIWSGGR TDHNAAFISRLSISKDNSKSQVFFKMNSLQPNDTAIYYCARTPYYGYGFA YWGQGTTVTRANS
Clone 6D5 variable region light (kappa) chain; nucleotide sequence (SEQ ID NO: 7)
GAATTCGCCCTTGACATTCTGATGACCCAGTCTCACAAAATCATGTCC ACATCAGTAGGAGACAGGGTCAGCATCACCTGCAGGGCCAGTCAGGATGT
GAGTACTGCTGTAGCCTGGTATCAACAGAAACCAGGACAATCTCCTAAAC
TACTGATTTACTCGGCATCCTACCGGTACACTGGAGTCCCTGATCGCTTC
ACTGGCAGTGGATCTGGGACGGATTTCACTTTCACCATCAGCAGTGTGCA
GGCTGAAGACCTGGCAGTTTATTACTGTCAGCAACATTATATTACTCCGT GGACGTTTGGTGGAGGGACCAAGCTGGAAATAAAA
Clone 6D5 variable region light (kappa) chain; amino acid sequence (SEQ ID NO: 8)
EFALDILMTQSHKIMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKL LIYSASYRYTGVPDRFTGSGSGTDFTFTIΞSVQAEDLAVYYCQQHYITPW TFGGGTKLEiK
It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the ambit of the following claims.
Claims
1. An isolated avian influenza antibody comprising a fragment crystallizable (Fc) constant region and an antigen-binding region, wherein the antigen-binding region binds one or more avian influenza viral proteins or a peptide, fragment or derivative thereof with high affinity.
2. The antibody of claim 1 , wherein the avian influenza proteins or peptide, fragment, or derivative thereof is derived from avian influenza strain H5N1.
3. The antibody of claim 1, wherein the one or more avian influenza viral proteins comprises hemagglutinin, neuraminidase, polymerase basic protein, RNA-directed RNA polymerase, polymerase acidic protein, matrix protein 1 , matrix protein 2, nucleocapsid, nonstructural protein 1, or non-structural protein 2.
4. The antibody of claim 3, wherein the hemagglutinin is hemagglutinin H5.
5. The antibody of claim 1, wherein the isolated antibody is recombinant.
6. The antibody of claim 1 , wherein the Fc constant region comprises sequences derived from a human.
7. An isolated avian influenza H5N1 antibody, comprising a human fragment crystallizable region and an antigen-binding region, wherein the antigen-binding region binds avian influenza hemagglutinin H5 with high affinity.
8. A pharmaceutical composition comprising the isolated antibody of claim 1 and one or more pharmaceutically acceptable buffers, excipients, and/or diluents.
9. A pharmaceutical composition comprising the isolated anti body of claim 7, and one or more pharmaceutically acceptable buffers, excipients, and/or diluents.
10. A kit for detecting the presence of avian influenza virus, viral particles, viral proteins, or viral peptides in a sample from a subject, comprising one or more detection reagents, a sample from a subject who has not been diagnosed as having avian influenza, and optionally instructions for use, wherein the detection reagents comprise isolated antibody of claim 1.
11. The kit of claim 10, wherein the detection reagents additionally comprise one or more aptamers, one or more oligonucleotides, or combinations thereof.
12. A kit for detecting the presence of avian influenza virus, viral particles, viral proteins, or viral peptides in a sample from a subject, comprising one or more detection reagents, a sample from a subject who has not been diagnosed as having avian influenza, and optionally instructions for use, wherein the detection reagents comprise isolated antibody of claim 7.
13. The kit of claim 12, wherein the detection reagents additionally comprise one or more aptamers, one or more oligonucleotides, or combinations thereof.
14. A method of diagnosing or identifying one or more subjects having an avian influenza infection, comprising contacting one or more cells from the subject with the isolated antibody of claim 1 , and detecting the presence of avian influenza viral protein bound to the antibody.
15. A method of treating a subject having an avian influenza infection, comprising administering a therapeutically effective amount of the pharmaceutical composition of claim 8 to the subject, and detecting changes in the amount of avian influenza viral proteins in a sample from the subject.
16. A method of immunizing a subject against avian influenza infection, comprising administering a prophylactically effective amount of the pharmaceutical composition of claim 8 to the subject, and detecting changes in the amount of avian influenza viral proteins in a sample from the subject.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US526407P | 2007-12-03 | 2007-12-03 | |
US61/005,264 | 2007-12-03 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2009073163A1 true WO2009073163A1 (en) | 2009-06-11 |
Family
ID=40718035
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2008/013259 WO2009073163A1 (en) | 2007-12-03 | 2008-12-01 | Avian influenza antibodies, compositions, and methods thereof |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2009073163A1 (en) |
Cited By (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2014011489A2 (en) * | 2012-07-10 | 2014-01-16 | Board Of Regents, The University Of Texas System | Monoclonal antibodies for use in diagnosis and therapy of cancers and automimmune disease |
US8877200B2 (en) | 2012-05-10 | 2014-11-04 | Visterra, Inc. | HA binding agents |
EP2832747A1 (en) * | 2013-08-01 | 2015-02-04 | Université Catholique de Louvain | Anti-GARP protein and uses thereof |
WO2015015003A1 (en) * | 2013-08-01 | 2015-02-05 | Université Catholique de Louvain | Anti-garp protein and uses thereof |
US10479829B2 (en) | 2017-05-11 | 2019-11-19 | Argenx Bvba | GARP-TGF-beta 1 antibodies |
US10513553B2 (en) | 2015-11-13 | 2019-12-24 | Visterra, Inc. | Compositions and methods for treating and preventing influenza |
US10537633B2 (en) | 2016-03-04 | 2020-01-21 | Jn Biosciences Llc | Antibodies to TIGIT |
CN112830966A (en) * | 2021-03-03 | 2021-05-25 | 浙江大学医学院附属第一医院 | anti-H6N 1 avian influenza virus hemagglutinin protein monoclonal antibody ZJU61-01 and application thereof |
US11230593B2 (en) | 2019-03-25 | 2022-01-25 | Visterra, Inc. | Compositions and methods for treating and preventing influenza |
US11820824B2 (en) | 2020-06-02 | 2023-11-21 | Arcus Biosciences, Inc. | Antibodies to TIGIT |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20050170334A1 (en) * | 2002-03-13 | 2005-08-04 | Toshifumi Mikayama | Human monoclonal antibodies to influenza M2 protein and methods of making and using same |
WO2007089753A2 (en) * | 2006-01-26 | 2007-08-09 | Hx Diagnostics, Inc. | Monoclonal antibodies binding to avian influenza virus subtype h5 haemagglutinin and uses thereof |
US20070224594A1 (en) * | 2005-07-01 | 2007-09-27 | Arbor Vita Corporation | Detection of influenza virus |
-
2008
- 2008-12-01 WO PCT/US2008/013259 patent/WO2009073163A1/en active Application Filing
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20050170334A1 (en) * | 2002-03-13 | 2005-08-04 | Toshifumi Mikayama | Human monoclonal antibodies to influenza M2 protein and methods of making and using same |
US20070224594A1 (en) * | 2005-07-01 | 2007-09-27 | Arbor Vita Corporation | Detection of influenza virus |
WO2007089753A2 (en) * | 2006-01-26 | 2007-08-09 | Hx Diagnostics, Inc. | Monoclonal antibodies binding to avian influenza virus subtype h5 haemagglutinin and uses thereof |
Cited By (25)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8877200B2 (en) | 2012-05-10 | 2014-11-04 | Visterra, Inc. | HA binding agents |
US10800835B2 (en) | 2012-05-10 | 2020-10-13 | Visterra, Inc. | HA binding agents |
US9096657B2 (en) | 2012-05-10 | 2015-08-04 | Visterra, Inc. | HA binding agents |
US9969794B2 (en) | 2012-05-10 | 2018-05-15 | Visterra, Inc. | HA binding agents |
EA034033B1 (en) * | 2012-07-10 | 2019-12-20 | Борд Оф Риджентс, Дзе Юниверсити Оф Техас Систем | Humanized antibodies for therapy of cancers |
WO2014011489A3 (en) * | 2012-07-10 | 2014-03-13 | Board Of Regents, The University Of Texas System | Monoclonal antibodies for use in diagnosis and therapy of cancers and automimmune disease |
US11192958B2 (en) | 2012-07-10 | 2021-12-07 | Board Of Regents, The University Of Texas System | Monoclonal antibodies for use in diagnosis and therapy of cancers and autoimmune disease |
US9926380B2 (en) | 2012-07-10 | 2018-03-27 | Board Of Regents, The University Of Texas System | Monoclonal antibodies for use in diagnosis and therapy of cancers and autoimmune disease |
WO2014011489A2 (en) * | 2012-07-10 | 2014-01-16 | Board Of Regents, The University Of Texas System | Monoclonal antibodies for use in diagnosis and therapy of cancers and automimmune disease |
WO2015015003A1 (en) * | 2013-08-01 | 2015-02-05 | Université Catholique de Louvain | Anti-garp protein and uses thereof |
US11230603B2 (en) | 2013-08-01 | 2022-01-25 | Ludwig Institute For Cancer Research Ltd | Anti-GARP protein |
US10000572B2 (en) | 2013-08-01 | 2018-06-19 | Université Catholique de Louvain | Method for inhibiting the immune suppressive function of human T regulatory cells by administering an anti-GARP monoclonal antibody |
EA035550B1 (en) * | 2013-08-01 | 2020-07-06 | Юниверсите Католик Де Лувэн | ANTIBODIES THAT BIND TO A COMPLEX OF hGARP/TGF-1 AND USE THEREOF |
US10822424B2 (en) | 2013-08-01 | 2020-11-03 | Université Catholique de Louvain | Method of screening for anti-GARP antibodies |
EP2832747A1 (en) * | 2013-08-01 | 2015-02-04 | Université Catholique de Louvain | Anti-GARP protein and uses thereof |
US10513553B2 (en) | 2015-11-13 | 2019-12-24 | Visterra, Inc. | Compositions and methods for treating and preventing influenza |
US10537633B2 (en) | 2016-03-04 | 2020-01-21 | Jn Biosciences Llc | Antibodies to TIGIT |
US11723971B2 (en) | 2016-03-04 | 2023-08-15 | JN Biosciences, LLC | Antibodies to TIGIT |
US10875914B2 (en) | 2017-05-11 | 2020-12-29 | Argenx Bvba | Nucleic acids encoding GARP-TGF-beta 1 antibodies |
US10793627B2 (en) | 2017-05-11 | 2020-10-06 | Argenx Bvba | GARP-TGF-β 1 IGG antibodies |
US10479829B2 (en) | 2017-05-11 | 2019-11-19 | Argenx Bvba | GARP-TGF-beta 1 antibodies |
US11230593B2 (en) | 2019-03-25 | 2022-01-25 | Visterra, Inc. | Compositions and methods for treating and preventing influenza |
US11820824B2 (en) | 2020-06-02 | 2023-11-21 | Arcus Biosciences, Inc. | Antibodies to TIGIT |
CN112830966A (en) * | 2021-03-03 | 2021-05-25 | 浙江大学医学院附属第一医院 | anti-H6N 1 avian influenza virus hemagglutinin protein monoclonal antibody ZJU61-01 and application thereof |
CN112830966B (en) * | 2021-03-03 | 2022-04-12 | 浙江大学医学院附属第一医院 | anti-H6N 1 avian influenza virus hemagglutinin protein monoclonal antibody ZJU61-01 and application thereof |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2009073163A1 (en) | Avian influenza antibodies, compositions, and methods thereof | |
JP6605643B2 (en) | Anti-dengue virus antibodies and uses thereof | |
US11254733B2 (en) | Anti-influenza B virus neuraminidase antibodies and uses thereof | |
JP5941841B2 (en) | Monoclonal antibody against influenza virus produced by periodic administration and use thereof | |
EP3011968B1 (en) | Composition comprising at least two influenza a virus-neutralizing-binding molecules | |
AU2021290356A1 (en) | Method of treating influenza a | |
US20220226470A1 (en) | Antibodies and methods for treatment of influenza a infection | |
US20200308257A1 (en) | Compositions and methods for treating and preventing influenza | |
Shih et al. | Identifying epitopes responsible for neutralizing antibody and DC-SIGN binding on the spike glycoprotein of the severe acute respiratory syndrome coronavirus | |
CA3137160A1 (en) | Anti-influenza b virus neuraminidase antibodies and uses thereof | |
US8894997B2 (en) | Monoclonal antibodies to influenza H1N1 virus uses thereof | |
US20200206308A1 (en) | Suppression of allergic lung inflammation and hyperreactivity | |
EP3348568B1 (en) | Monoclonal antibodies targeting neutralizing epitopes on h7 influenza viruses | |
KR20140012131A (en) | Compositions and methods for the therapy and diagnosis of influenza | |
Kim et al. | A host-restricted self-attenuated influenza virus provides broad pan-influenza a protection in a mouse model | |
WO2021222988A1 (en) | Cell entry-modulating agents and uses therefor | |
JP2023506156A (en) | Compositions and methods for treating or preventing influenza | |
WO2022225033A1 (en) | Glycosylated rbd and use thereof | |
AU2018256840A1 (en) | Method of treating pediatric disorders with antibodies specific for alpha 4 beta 7 integrin (vedolizumab) | |
WO2014097762A1 (en) | Antibody to highly pathogenic avian influenza | |
RU2803850C2 (en) | Neutralizing antibodies against the influenza a virus and ways of their application | |
CA3148990A1 (en) | Compositions and methods for treatment of influenza a infection | |
EP3070167A1 (en) | Antibody having broad neutralizing activity in group 1 influenza a virus | |
JP2022539877A (en) | Anti-HIV vaccine antibodies with reduced polyreactivity | |
KR20170133507A (en) | Humanized influenza monoclonal antibodies and methods for their use |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 08855960 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 08855960 Country of ref document: EP Kind code of ref document: A1 |