WO2004035603A2 - Erythropoietin receptor binding antibodies - Google Patents
Erythropoietin receptor binding antibodies Download PDFInfo
- Publication number
- WO2004035603A2 WO2004035603A2 PCT/US2003/032243 US0332243W WO2004035603A2 WO 2004035603 A2 WO2004035603 A2 WO 2004035603A2 US 0332243 W US0332243 W US 0332243W WO 2004035603 A2 WO2004035603 A2 WO 2004035603A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- antibody fragment
- amino acid
- acid sequence
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention relates to antibodies that recognize, bind to and, preferably, activate the erythropoietin receptor.
- EPO Erythropoietin
- erythropoiesis is a glycoprotein that is the primary regulator of erythropoiesis. Specifically, EPO is responsible for promoting the growth, differentiation and survival of erythroid progenitors, which give rise to mature red blood cells. In response to changes in the level of oxygen in the blood and tissues, erythropoietin appears to stimulate both proliferation and differentiation of immature erythroblasts. It also functions as a growth factor, stimulating the mitotic activity of erythroid progenitor cells, such as erythrocyte burst forming and colony- forming units. It also acts as a differentiation factor, triggering transformation of an erythrocyte colony-forming-unit into a proerythroblast (See Erslev, A., New Eng. J. Med., 316:101-103 (1987)).
- EPO has a molecular weight of about 34,000 daltons and can occur in three forms - alpha, beta and asialo.
- EPO is synthesized in the fetal liver. Subsequently, EPO is synthesized in the kidney, circulates in the plasma and is excreted in the urine.
- EPO Human urinary EPO has been isolated and purified (See, Miyake et al., J Biol. Chem., 252:5558 (1977)). Moreover, methods for identifying, cloning and expressing genes encoding EPO (See U.S. Patent 4,703,008) as well as purifying recombinant EPO from a cell medium (See U.S. Patent 4,667,016) are known in the art. The activity of EPO is mediated through the binding and activation of a cell surface receptor refened to as the erythropoietin receptor.
- the EPO receptor belongs to the cytokine receptor superfamily and is believed to contain at least two distinct polypeptides, a 55-72 kDa species and a 85-100 kDa species (See U.S. Patent 6,319,499, Mayeux et al., J. Biol Chem, 266:23380 (1991), McCaffery et al., J. Biol. Chem., 264:10507 (1991)). Other studies have revealed other polypeptide complexes of EPO receptor having molecular weights such as 110, 130 and 145 kDa (See U.S. Patent 6,319,499).
- the murine and human EPO receptors have been cloned and expressed (See D'Andrea et al., Cell, 57:277 (1989); Jones et al., Blood, 76:31 (1990); Winkelmann et al., Blood, 76:24 (1990); WO 90/08822/ U.S. Patent 5,278,065).
- the full length human EPO receptor is a 483 amino acid transmembrane protein with an approximately 25 amino acid signal peptide (See U.S. Patent 6,319,499).
- the human receptor demonstrates about a 82% amino acid sequence homology with the murine receptor. Id.
- the EPO receptor In the absence of ligand the EPO receptor exists in a preformed dimer. The binding of EPO to its receptor causes a conformational change such that the cytoplasmic domains are placed in close proximity. While not completely understood, it is believed that this "dimerization" plays a role in the activation of the receptor. The activation of the EPO receptor results in a number of biological effects. Some of these activities include stimulation of proliferation, stimulation of differentiation and inhibition of apoptosis (See U.S. Patent 6,319,499, Liboi et al., PNAS USA, 90:11351 (1993), Koury, Science, 248:378 (1990)).
- EPO receptor dimerization and activation It is the relationship between the EPO receptor dimerization and activation that can be used to identify compounds (i.e. such as antibodies) other than EPO that are capable of: (1) dimerizing the EPO receptor; and (2) activating the receptor. These compounds would be useful in treating mammals suffering from anemia and in identifying mammals having a dysfunctional EPO receptor.
- the invention relates to antibodies that bind to the human erythropoietin receptor.
- the antibodies comprise a heavy chain variable region that is selected from the group consisting of SEQ ID NOS: 3, 7, 11, 15, 19, 31, 35, 39, 43, 47, 51, 55 and fragments thereof.
- the antibodies comprise a light chain variable region that is selected from the group consisting of SEQ ID NOS: 5, 9, 13, 17, 21, 23, 25, 27, 29, 33, 37, 41, 45, 49, 53, 57 and fragments thereof.
- the present invention relates to an isolated antibody that is capable of binding a human erythropoietin receptor in a mammal.
- an antibody comprises a heavy chain variable region or a light chain variable region that comprises a continuous sequence from CDRl through CDR3.
- the amino acid sequence of the heavy chain variable region comprising the continuous sequence from CDRl through CDR3 is selected from the group consisting of: SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61 and fragments thereof.
- amino acid sequence of the light chain variable region comprising the continuous sequence from CDRl through CDR3 is selected from the group consisting of: SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68 and fragments thereof.
- the present invention relates to an antibody that activates an endogenous activity of a human erythropoietin receptor in a mammal but does not interact with a peptide having an amino acid sequence of PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID NO:l).
- the present invention relates to an antibody that is capable of activating an endogenous activity of a human erythropoietin receptor in a mammal, wherein said antibody or antibody fragment thereof exhibits a binding affinity within one hundred fold of the binding affinity of endogenous human erythropoietin to the erythropoietin receptor.
- the present invention relates to an antibody or antibody fragment thereof that activates an endogenous activity of a human erythropoietin receptor in a mammal.
- the antibody or antibody fragment thereof comprises at least one human heavy chain variable region having the amino acid sequence of SEQ ID NO: 3 or antibody fragment thereof, and/or at least one human light chain variable region having the amino acid sequence of SEQ ID NO: 5 or antibody fragment thereof, provided that said antibody or antibody fragment thereof does not interact with a peptide having an amino acid sequence of PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID NO:l).
- the present invention relates to an antibody or antibody fragment thereof that activates an endogenous activity of a human erythropoietin receptor in a mammal.
- the antibody or antibody fragment thereof comprises at least one heavy chain variable region having the amino acid sequence of SEQ ID NO: 7 or antibody fragment thereof, and/or at least one light chain variable region having the amino acid sequence of SEQ ID NO: 9 or antibody fragment thereof, provided that said antibody or antibody fragment thereof does not interact with a peptide having an amino acid sequence of PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID NO.T).
- This embodiment also includes other heavy chain variable regions selected from the group consisting of SEQ ID NO: 11, 15, 19, 31, 35, 39, 43, 47, 51, and 55 or an antibody fragment of any of these aforementioned SEQ ID NOS, wherein said antibody or antibody fragment thereof does not interact with a peptide having an amino acid sequence of SEQ ID NO: 1.
- Other light chain variable regions included in this embodiment may be selected from the group consisting of SEQ ID NO: 13, 17, 21, 23, 25, 27, 29, 33, 37, 41, 45, 49, 53 and 57 or an antibody fragment of any of these aforementioned SEQ ID NOS, wherein said antibody or antibody fragment thereof does not interact with a peptide having an amino acid sequence of SEQ ID NO: 1.
- the invention provides an antibody or antibody fragment thereof that activates an endogenous activity of a human erythropoietin receptor in a mammal, the antibody comprising the amino acid sequences of at least one heavy chain variable region and at least one light chain variable region selected from the group consisting of SEQ ID NO:l 1/SEQ ID NO:13, SEQ ID NO:15/SEQ ID NO:17, SEQ ID NO:19/SEQ ID NO:21, SEQ ID NO.T 1/SEQ ID NO:23, SEQ ID NO.T 1/SEQ ID NO:25, SEQ ID NO: 11/SEQ ID NO:27, SEQ ID NOT 1/SEQ ID NO:29, SEQ ID NO:31/SEQ ID NO:33, SEQ ID NO:35/SEQ ID
- the present invention relates to a method of activating an endogenous activity of a human erythropoietin receptor in a mammal.
- the method involves the step of administering to a mammal a therapeutically effective amount of an antibody or antibody fragment thereof to activate the EPO receptor.
- the antibody or antibody fragment thereof does not interact with a peptide having an amino acid sequence of PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID NO:l).
- the present invention relates to a method of modulating an endogenous activity of a human erythropoietin receptor in a mammal.
- the method involves administering to a mammal a therapeutically effective amount of an antibody or antibody fragment thereof to modulate the endogenous activity of a human erythropoietin receptor in a mammal but does not interact with a peptide having an amino acid sequence of PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID NO:l).
- the present invention relates to a method of treating a mammal suffering from pure red cell aplasia induced by neutralizing anti- erythropoietin antibodies.
- the method involves administering to a mammal in need of treatment a therapeutically effective amount of an antibody or antibody fragment thereof to activate said receptor, wherein said antibody or antibody fragment thereof does not interact with a peptide having an amino acid sequence of PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID NO:l).
- the present invention relates to pharmaceutical compositions.
- the pharmaceutical compositions of the present invention contain a therapeutically effective amount of an antibody or antibody fragment thereof and a pharmaceutically acceptable excipient.
- the antibody or antibody fragment contained in the pharmaceutical composition activates an endogenous activity of a human erythropoietin receptor in a mammal but does not interact with a peptide having an amino acid sequence of PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID NO:l).
- the present invention relates to an IgG2 antibody or antibody fragment that binds to and activates the erythropoietin receptor.
- the IgG2 antibodies or antibody fragments of this embodiment bind to and interact with any epitope that is involved in activating the EPO receptor.
- Such antibodies may be polyclonal or monoclonal antibodies or any antibody fragment thereof.
- the IgG2 antibodies may be chimeric, humanized or human antibodies.
- the present invention provides a method of activating an endogenous activity of a human erythropoietin receptor in a mammal comprising the step of administering to a mammal a therapeutically effective amount of an IgG2 antibody or antibody fragment of the invention to activate the receptor.
- the present invention provides a method of modulating an endogenous activity of a human erythropoietin receptor in a mammal comprising the step of administering to a mammal a therapeutically effective amount of an IgG2 antibody or antibody fragment of the invention to modulate the receptor.
- the present invention provides a method of treating a mammal suffering aplasia, the method comprising the step of administering to a mammal in need of treatment a therapeutically effective amount of an IgG2 antibody or antibody fragment of the invention to activate the receptor.
- the present invention provides a method of treating a mammal suffering aplasia, the method comprising the step of administering to a mammal in need of treatment a therapeutically effective amount of an IgG2 antibody or antibody fragment of the invention to modulate the receptor.
- the present invention provides a pharmaceutical composition comprising a therapeutically effective amount of an IgG2 antibody or antibody fragment of the invention and a pharmaceutically acceptable excipient.
- the present invention relates to isolated and purified polynucleotide and amino acid sequences.
- the isolated and purified polynucleotide sequences can be selected from the group consisting of: SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:44, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54, SEQ ID NO:56 and fragments, complements and degenerate codon equivalent
- the present invention further relates to isolated and purified amino acid sequences selected from the group consisting of: SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NOT 1, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:41, SEQ ID NO:43, SEQ ID NO:45, SEQ ID NO:47, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO
- Figure 1 shows the isolated and purified polynucleotide (top strand and bottom strands
- amino acid sequence comprises SEQ ID NOS:71 through 74.
- sequence of the constant region alone is shown as SEQ ID NO: 75.
- the variable chain ends at nucleotide 1283.
- the variable/constant joining region is at nucleotides 1284-1289.
- the constant region is from nucleotides 1290-2826.
- Figure 2 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO: 76 and SEQ ID NO: 77, respectively) and amino acid sequence of the light chain of human antibody Ab 12.
- the amino acid sequence comprises SEQ ID NOS. -78.
- the sequence of the constant region alone is shown as SEQ ID NO: 79.
- the variable chain ends at nucleotide 1363.
- the variable/constant joining region (underlined) is at nucleotides 1364-1369.
- the constant region is from nucleotides 1370-1618.
- Figure 3 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:80 and SEQ ID NO:81, respectively) and amino acid sequence of the heavy chain of human antibody AM98.
- the amino acid sequence comprises SEQ ID NOS:82 and SEQ ID NOS 72 through 74.
- the variable chain ends at nucleotide 1304.
- the variable/constant joining region (underlined) is at nucleotides 1305-1310.
- the constant region is from nucleotides 1311-2847.
- Figure 4 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:83 and SEQ ID NO:84, respectively) and amino acid sequence of the light chain of human antibody AM 98.
- the amino acid sequence comprises SEQ ID NOS:78.
- the variable chain ends at nucleotide 1351.
- the variable/constant joining region (underlined) is at nucleotides 1352-1357.
- the constant region is from nucleotides 1358-1606.
- Figure 5 shows the competition of AM 2 with 125 I-labeled EPO for binding to Chinese Hamster Ovary cells expressing recombinant EPO receptor.
- Figure 6 shows the results of an EPO dependent human cell proliferation assay using Abl2 and AM98.
- Figure 7 shows that A 2 remains active in inducing the proliferation of F36E cells after storage at 4°C for up to 20 days.
- Figure 8 shows that AM 2 induces the formation of CFU-E (colony forming unit- erythroid) from human 36 progenitor cells.
- Figure 9 shows the induction of proliferation of human erythroid producing cells with AM 98.
- FIG. 10 shows that AM 98 induces the formation of CFU-E colonies from cynomologous bone manow-derived erythroid progenitor cells.
- FIG 11 shows that AM 2 does not interact with the peptide SE-3.
- Ab71 A interacts with the SE-3 peptide.
- Figure 12 shows that human Abs secreted by primary hybridomas induce the proliferation of F36E cells.
- Figure 13 shows that human Ab supematants secreted by primary hybridomas interact with intact EPO receptor, but not with peptide SE-3.
- Figure 14 shows the activity of various concentrations of A 2 on the proliferation of UT7/EPO cells.
- Figure 15 shows the activity of various concentrations of AM 98 on the proliferation of UT7/EPO cells.
- Figure 16 shows the activity of various concentrations of AM 98 (with or without the addition of a secondary goat anti-human FC antibody) on the growth and proliferation of UT7 EPO cells.
- Figure 17 shows the activity of various concentrations of AM 2 (with or without the addition of a secondary goat anti-human FC antibody) on the growth and proliferation of UT7/EPO cells.
- Figure 18 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-003 of the invention, with Figure 18A (SEQ ID NO: 10) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 18B (SEQ ID NOT 1) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 18 A, Figure 18C (SEQ ID NO: 12) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 18D (SEQ ID NO: 13) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 18C.
- Figure 18A SEQ ID NO: 10
- Figure 18B SEQ ID NOT 1
- Figure 18C SEQ ID NO: 12
- Figure 18D SEQ ID NO: 13
- Figure 19 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-012 (also referred to herein as A 2) of the invention, with Figure 19A (SEQ ID NO:2) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 19B (SEQ ID NO: 3) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 19 A, Figure 19C (SEQ ID NO:4) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 19D (SEQ ID NO: 5) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 19C.
- Figure 19A SEQ ID NO:2
- Figure 19B SEQ ID NO: 3
- Figure 19C representing the nucleotide sequence encoding the variable region of the light chain
- Figure 19D SEQ ID NO: 5 representing the amino acid sequence encoded by the
- Figure 20 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-022 of the invention, with Figure 20A (SEQ ID NO: 14) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 20B (SEQ ID NO: 15) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 20A, Figure 20C (SEQ ID NO: 16) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 20D (SEQ ID NO: 17) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 20C.
- Figure 20A SEQ ID NO: 14
- Figure 20B SEQ ID NO: 15
- Figure 20C SEQ ID NO: 16
- Figure 20D SEQ ID NO: 17
- Figure 21 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-054 of the invention, with Figure 21 A (SEQ ID NO.T 8) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 2 IB (SEQ ID NO: 19) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 21 A, Figure 21 C (SEQ ID NO:20) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 21D (SEQ ID NO:21) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 21C.
- Figure 21 A SEQ ID NO.T 8
- Figure 2 IB SEQ ID NO: 19
- Figure 21 C SEQ ID NO:20
- Figure 21D SEQ ID NO:21
- Figure 22 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-060 of the invention, with Figure 22A (SEQ ID NO: 10) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 22B (SEQ ID NO.T 1) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 22A, Figure 22C (SEQ ID NO:22) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 22D (SEQ ID NO:23) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 22C.
- Figure 22A SEQ ID NO: 10
- Figure 22B SEQ ID NO.T 1
- Figure 22C SEQ ID NO:22
- Figure 22D SEQ ID NO:23
- Figure 23 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-102 of the invention, with Figure 23A (SEQ ID NO:10) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 23B (SEQ ID NO: 11) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 23 A, Figure 23C (SEQ ID NO:24) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 23D (SEQ ID NO:25) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 23C.
- Figure 23A SEQ ID NO:10
- Figure 23B SEQ ID NO: 11
- Figure 23C SEQ ID NO:24
- Figure 23D SEQ ID NO:25
- Figure 24 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-135 of the invention, with Figure 24A (SEQ ID NO:10) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 24B (SEQ ID NO:l 1) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 24 A, Figure 24C (SEQ ID NO:26) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 24D (SEQ ID NO:27) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 24C.
- Figure 24A SEQ ID NO:10
- Figure 24B SEQ ID NO:l 1
- Figure 24C SEQ ID NO:26
- Figure 24D SEQ ID NO:27
- Figure 25 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-145 of the invention, with Figure 25 A (SEQ ID NO: 10) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 25B (SEQ ID NOT 1) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 25A, Figure 25C (SEQ ID NO:28) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 25D (SEQ ID NO:29) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 25C.
- Figure 25 A SEQ ID NO: 10
- Figure 25B SEQ ID NOT 1
- Figure 25C SEQ ID NO:28
- Figure 25D SEQ ID NO:29
- Figure 26 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-198 (also referred to herein as Abl98) of the invention, with Figure 26 A (SEQ ID NO: 6) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 26B (SEQ ID NO:7) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 26 A, Figure 26C (SEQ ID NO: 8) representing the nucleotide sequence encoding the variable region of the light chain, and
- Figure 26D (SEQ ID NO:9) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 26C.
- Figure 27 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-254 of the invention, with Figure 27A (SEQ ID NO:30) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 27B (SEQ ID NO:31) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 27 A, Figure 27C (SEQ ID NO: 32) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 27D (SEQ ID NO:33) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 27C.
- Figure 27A SEQ ID NO:30
- Figure 27B SEQ ID NO:31
- Figure 27C SEQ ID NO: 32
- Figure 27D SEQ ID NO:33
- Figure 28 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-267 of the invention, with Figure 28A (SEQ ID NO:34) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 28B (SEQ ID NO:35) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 28A, Figure 28C (SEQ ID NO:36) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 28D (SEQ ID NO:37) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 28C.
- Figure 29 is a table showing amino acid sequence alignments of heavy chain variable regions of anti-EPOr mAbs generated according to the invention with their associated germline variable region sequences and identifying framework regions and complementarity determining regions.
- Figure 30 is a table showing amino acid sequence alignments of light chain variable regions of anti-EPOr mAbs generated according to the invention with their associated germline variable region sequences and identifying framework regions and complementarity determining regions.
- Figure 31 is a graph comparing the erythropoietic activity, at various concentrations, of a gamma-1 Ab 12 monoclonal antibody (Mab) and a gamma-2 Ab 12 Mab on an F36e human erythroleukemic cell line.
- Figure 32 is a graph showing the increase in percent reticulocyte and percent hematocrit in trangenic mice subjected to a multiple dosing regimen of vehicle, Epogen (5U) or Ab 12 antibody (5 or 50 ⁇ g).
- Figure 33 is a graph showing the increase in percent hematocrit in transgenic mice subjected to a weekly dosing regimen (over 3 weeks) of various concentrations of AranespTM or Ab l2.
- Figure 34 is a graph showing the increase in percent hematocrit in transgenic mice subjected to single versus weekly dosing regimens of various concentrations of AranespTM or Ab 12.
- Figure 35 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-390 of the invention, with Figure 35A (SEQ ID NO:38) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 35B (SEQ ID NO:39) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 35 A, Figure 35C (SEQ ID NO:40) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 35D (SEQ ID NO:41) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 35C.
- Figure 35A SEQ ID NO:38
- Figure 35B SEQ ID NO:39
- Figure 35C SEQ ID NO:40
- Figure 35D SEQ ID NO:41
- Figure 36 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-412 of the invention, with Figure 36A (SEQ ID NO:42) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 36B (SEQ ID NO:43) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 36A, Figure 36C (SEQ ID NO:44) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 36D (SEQ ID NO:45) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 36C.
- Figure 36A SEQ ID NO:42
- Figure 36B SEQ ID NO:43
- Figure 36C representing the nucleotide sequence encoding the variable region of the light chain
- Figure 36D SEQ ID NO:45
- Figure 37 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-430/432 of the invention, with Figure 37A (SEQ ID NO:46) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 37B (SEQ ID NO:47) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 37A, Figure 37C (SEQ ID NO:48) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 37D (SEQ ID NO:49) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 37C.
- Figure 37A SEQ ID NO:46
- Figure 37B SEQ ID NO:47
- Figure 37C SEQ ID NO:48
- Figure 37D SEQ ID NO:49
- Figure 38 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-467 of the invention, with Figure 38A (SEQ ID NO:50) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 38B (SEQ ID NO:51) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 38A, Figure 38C (SEQ ID NO:52) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 38D (SEQ ID NO: 53) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 38C.
- Figure 38A SEQ ID NO:50
- Figure 38B SEQ ID NO:51
- Figure 38C SEQ ID NO:52
- Figure 38D SEQ ID NO: 53
- Figure 39 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-484 of the invention, with Figure 39A (SEQ ID NO:54) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 39B (SEQ ID NO: 55) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 39A, Figure 39C (SEQ ID NO:56) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 39D (SEQ ID NO:57) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 39C.
- Figure 39A SEQ ID NO:54
- Figure 39B SEQ ID NO: 55
- Figure 39C SEQ ID NO:56
- Figure 39D SEQ ID NO:57
- Figure 40 is a table showing amino acid sequence alignments of heavy chain variable regions of anti-EPOr mAbs generated according to the invention with their associated germline variable region sequences and identifying framework regions and complementarity determining regions.
- Figure 41 is a table showing amino acid sequence alignments of light chain variable regions of anti-EPOr mAbs generated according to the invention with their associated germline variable region sequences and identifying framework regions and complementarity determining regions.
- Figure 42 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:86 and SEQ ID NO:87, respectively) and amino acid sequence of the heavy chain of human antibody Ab390.
- the amino acid sequence comprises SEQ ID NOS:88 and SEQ ID NOS 72 through 74.
- the variable chain ends at nucleotide 463.
- the variable/constant joining region (underlined) is at nucleotides 464-469.
- the constant region is from nucleotides 470-2006.
- Figure 43 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:89 and SEQ IDNO:90, respectively) and amino acid sequence of the light chain of human antibody Ab390.
- the amino acid sequence comprises SEQ ID NOS :91.
- the variable chain ends at nucleotide 463.
- the variable/constant joining region (underlined) is at nucleotides 464-469.
- the constant region is from nucleotides 470-718.
- Figure 44 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:92 and SEQ ID NO:93, respectively) and amino acid sequence of the heavy chain of human antibody Ab412.
- the amino acid sequence comprises SEQ ID NOS:94 and SEQ ID NOS 72 through 74.
- the variable chain ends at nucleotide 469.
- the variable/constant joining region (underlined) is at nucleotides 470-475.
- the constant region is from nucleotides 476-2012.
- Figure 45 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:95 and SEQ ID NO:96, respectively) and amino acid sequence of the light chain of human antibody Ab412.
- the amino acid sequence comprises SEQ ID NOS: 97.
- the variable chain ends at nucleotide 463.
- the variable/constant joining region (underlined) is at nucleotides 464-469.
- the constant region is from nucleotides 470-718.
- Figure 46 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:98 and SEQ ID NO:99, respectively) and amino acid sequence of the heavy chain of human antibody Ab432.
- the amino acid sequence comprises SEQ ID NOS: 100 and SEQ ID NOS 72 through 74.
- the variable chain ends at nucleotide 463.
- the variable/constant joining region (underlined) is at nucleotides 464-469.
- the constant region is from nucleotides 470-2006.
- Figure 47 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:101 and SEQ ID NO:102, respectively) and amino acid sequence of the light chain of human antibody Ab430.
- the amino acid sequence comprises SEQ ID NOS.T03.
- the variable chain ends at nucleotide 463.
- the variable/constant joining region (underlined) is at nucleotides 464-469.
- the constant region is from nucleotides 470-718.
- Figure 48 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:104 and SEQ ID NO:105, respectively) and amino acid sequence of the heavy chain of human antibody Ab467.
- the amino acid sequence comprises SEQ ID NOST06 and SEQ ID NOS 72 through 74.
- the variable chain ends at nucleotide 463.
- the variable/constant joining region (underlined) is at nucleotides 464-469.
- the constant region is from nucleotides 470-2006.
- Figure 49 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:107 and SEQ ID NO:108, respectively) and amino acid sequence of the light chain of human antibody Ab467.
- the amino acid sequence comprises SEQ ID NOS: 109.
- the variable chain ends at nucleotide 463.
- the variable/constant joining region (underlined) is at nucleotides 464-469.
- the constant region is from nucleotides 470-718.
- Figure 50 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NOT 10 and SEQ ID NOT 11, respectively) and amino acid sequence of the heavy chain of human antibody Ab484.
- the amino acid sequence comprises SEQ ID NOS:l 12 and SEQ ID NOS 72 through 74.
- the variable chain ends at nucleotide 469.
- the variable/constant joining region (underlined) is at nucleotides 470-475.
- the constant region is from nucleotides 470-2012.
- Figure 51 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NOT 13 and SEQ ID NOT 14, respectively) and amino acid sequence of the light chain of human antibody Ab484.
- the amino acid sequence comprises SEQ ID NOS: 115.
- the variable chain ends at nucleotide 463.
- the variable/constant joining region (underlined) is at nucleotides 464-469.
- the constant region is from nucleotides 470-718.
- antibody refers to single chain, two- chain, and multi-chain proteins and glycoproteins that belong to the classes of polyclonal, monoclonal, chimeric and human or humanized.
- antibody also includes synthetic and genetically engineered variants thereof.
- antibody fragment refers to Fab, Fab', F(ab') 2 and Fv fragments, as well as any portion of an antibody having specificity toward at least one desired epitope.
- gamma-2 As used herein, the term "gamma-2", “gamma-2 isotype” or “IgG2” refers to subclass 2 of immunoglobulin G (IgG), as well as any antibody fragment thereof.
- IgG immunoglobulin G
- the four subclasses of IgG molecules are well characterized and well known to those of ordinary skill in the art. (See for example, Molecular Biology of the Cell, 2 nd Edition by Bruce Alberts et al, 1989) Panels of monoclonal antibodies are available that recognize all human isotypes (IgA,IgG, IgD IgE, and IgM) and subisotypes (IgAl,IgA2, IgGl, IgG2, IgG3, and IgG4) of human immunoglobulins.
- humanized antibody refers to an antibody that is derived from a non-human antibody (i.e murine) that retains or substantially retains the antigen-binding properties of the parent antibody but is less immunogenic in humans.
- human antibody refers to an antibody that possesses a sequence that is derived from a human germ-line immunoglobulin sequence, such as antibodies derived from transgenic mice having human immunoglobulin genes (e.g., XenoMouse® mice), human phage display libraries, or human B cells.
- epitopic determinants refers to any protein determinate capable of specifically binding to an antibody or T-cell receptors. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
- endogenous refers to a product or activity arising in the body or cell as opposed to a product or activity coming from outside.
- a polynucleotide "derived from” or “specific for a designated sequence refers to a polynucleotide sequence that comprises a contiguous sequence of approximately at least 6 nucleotides, preferably at least about 8 nucleotides, more preferably at least about 10-12 nucleotides, and even more preferably at least about 15-20 nucleotides corresponding, i.e., identical or complementary to, a region of the designated nucleotide sequence.
- the sequence may be complementary or identical to a sequence that is unique to a particular polynucleotide sequence as determined by techniques known in the art.
- Regions from which sequences may be derived include but are not limited to, regions encoding specific epitopes, as well as non-translated and/or non-transcribed regions.
- the derived polynucleotide will not necessarily be derived physically from the nucleotide sequence of interest under study, but may be generated in any manner, including, but not limited to, chemical synthesis, replication, reverse transcription or transcription, that is based on the information provided by the sequence of bases in the region(s) from which the polynucleotide is derived. As such, it may represent either a sense or an antisense orientation of the original polynucleotide.
- combinations of regions corresponding to that of the designated sequence may be modified in ways known in the art to be consistent with the intended use.
- the phrase "encoded by” refers to a nucleic acid sequence that codes for a polypeptide sequence, wherein the polypeptide sequence or a portion thereof contains an amino acid sequence of at least 3 to 5 amino acids, more preferably at least 8 to 10 amino acids, and even more preferably at least 15 to 20 amino acids from a polypeptide encoded by the nucleic acid sequence. Also encompassed are polypeptide sequences that are immunologically identifiable with a polypeptide encoded by the sequence. Thus, a
- polypeptide has at least about 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95% or more identity to the antibodies of the present invention. Further, the antibodies of the present invention may have at least about 60%, 70%, 75%, 80%, 85%, 90% or 95% similarity to a polypeptide or amino sequences of the antibodies of the present invention.
- the amino acid sequences of the antibodies of the present invention can be selected from the group consisting of SEQUENCE ID NOS: 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55 and 57.
- Prefened amino acid sequences of the antibodies of the present invention are selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 51 and 53.
- recombinant polypeptide As used herein, the phrase "recombinant polypeptide,” “recombinant protein,” or “a polypeptide produced by recombinant techniques", which terms may be used interchangeably herein, describes a polypeptide that by virtue of its origin or manipulation is not associated with all or a portion of the polypeptide with which it is associated in nature and/or is linked to a polypeptide other than that to which it is lined in nature.
- a recombinant or encoded polypeptide or protein is not necessarily translated from a designated nucleic acid sequence. It also may be generated in any manner, including chemical synthesis or expression of a recombinant expression system.
- synthetic peptide refers to a polymeric form of amino acids of any length, which may be chemically synthesized by methods well known in the art (See U.S. Patents 4,816,513, 5,854,389, 5,891,993 and 6,184,344).
- polynucleotide refers to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. This term refers only to the primary structure of the molecule. Thus, the term includes double and single-stranded DNA as well as double- and single-stranded RNA. It also includes modifications, such as methylation or capping and unmodified forms of the polynucleotide.
- polynucleotide “oligomer,” “oligonucleotide,” and “oligo,” are used interchangeably herein.
- purified polynucleotide refers to a polynucleotide of interest or fragment thereof that is essentially free, e.g. contains less than about 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95% of the protein with which the polynucleotide is naturally associated.
- Techniques for purifying polynucleotides of interest include, for example, disruption of the cell containing the polynucleotide with a chaotropic agent and separation of the polynucleotide(s) and proteins by ion-exchange chromatography, affinity chromatography and sedimentation according to density.
- purified polypeptide or “purified protein” means a polypeptide of interest or fragment thereof which is essentially free of, e.g., contains less than about 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, cellular components with which the polypeptide of interest is naturally associated. Methods for purifying polypeptides of interest are known in the art.
- isolated refers to material that is removed from its original environment (e.g., the natural environment if it is naturally occuning).
- a naturally occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or DNA or polypeptide, separated from some or all of the coexisting materials in the natural system, is isolated.
- Such polynucleotide could be part of a vector and/or such polynucleotide or polypeptide could be part of a composition, and still be isolated in that the vector or composition is not part of its natural environment.
- polypeptide and “protein” are used interchangeably and refer to at least one molecular chain of amino acids linked through covalent and/or non- covalent bonds. The terms do not refer to a specific length of the product. Thus, peptides, oligopeptides and proteins are included within the definition of polypeptide. The terms include post-translational modifications of the polypeptide, including, but not limited to, glycosylations, acetylations, phosphorylations and the like. In addition, protein fragments, analogs, mutated or variant proteins, fusion proteins and the like are included within the meaning of polypeptide.
- recombinant host cells refers to cells that can be, or have been, used as recipients for recombinant vector or other transfened DNA, and include the original progeny of the original cell that has been transfected.
- telome refers to any genetic element, such as a plasmid, a chromosome or a virus, that behaves as an autonomous unit of polynucleotide replication within a cell.
- operably linked refers to a situation wherein the components described are in a relationship permitting them to function in their intended manner.
- a control sequence "operably linked" to a coding sequence is ligated in such a manner that expression of the coding sequence is achieved under conditions compatible with the control sequence.
- vector refers to a replicon in which another polynucleotide segment is attached, such as to bring about the replication and/or expression of the attached segment.
- control sequence refers to a polynucleotide sequence that is necessary to effect the expression of a coding sequence to which it is ligated. The nature of such control sequences differs depending upon the host organism. In prokaryotes, such control sequences generally include a promoter, a ribosomal binding site and terminators and, in some instances, enhancers. The term “control sequence” thus is intended to include at a minimum all components whose presence is necessary for expression, and also may include additional components whose presence is advantageous, for example, leader sequences.
- transfection refers to the introduction of an exogenous polynucleotide into a prokaryotic or eucaryotic host cell, inespective of the method used for the introduction.
- transfection refers to both stable and transient introduction of the polynucleotide, and encompasses direct uptake of polynucleotides, transformation, transduction and f-mating.
- the exogenous polynucleotide may be maintained as a non- integrated replicon, for example, a plasmid, or alternatively, may be integrated into the host genome.
- treatment refers to prophylaxis and/or therapy.
- purified product refers to a preparation of the product which has been isolated from the cellular constituents with which the product is normally associated and from other types of cells that may be present in the sample of interest.
- the phrase "activation of an erythropoietin (EPO) receptor” refers to one or more molecular processes which an EPO receptor undergoes that result in the transduction of a signal to the interior of a receptor-bearing cell. Ultimately, this signal brings about one or more changes in cellular physiology. Activation of the EPO receptor typically results in the proliferation or differentiation of EPO receptor-bearing cells, such as, but not limited to, erythroid progenitor cells. A number of events are involved in the activation of the EPO receptor, such as, but not limited to, the dimerization of the receptor.
- EPO erythropoietin
- the structural unit of an antibody is a tetramer.
- Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (25 kDa) and one "heavy” chain (about 50-70 kDa).
- the amino-terminal portion of each chain includes a variable region that is primarily responsible for antigen recognition.
- the carboxy-terminal portion of the chain defines a constant region that is responsible for the effector function of the antibody.
- Human light chains are classified as kappa and lambda light chains.
- Heavy chains are classified as mu, delta, gamma, alpha, or epsilon and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE.
- IgG immunoglobulins are classified further into four subclasses (IgGl, IgG2, IgG3 and IgG4) having gamma- 1, gamma-2, gamma-3 and gamma-4 heavy chains, respectively.
- Most of the therapeutic human, chimeric or humanized antibodies available are of the IgGl antibody type including Herceptin for breast cancer, Rituxan for Non-Hodgkins lymphoma and Humira and Remicade for rheumatoid arthritis (See Glennie, M.J. et al., Drug Discovery Today, 8:503 (2003).
- variable and constant regions are joined by a "J" region with the heavy chain also include a "D” region.
- the variable regions of each light/heavy chain pair form the antigen binding site.
- an intact antibody has two binding sites, which, except in bifunctional or bispecific antibodies, are the same.
- Bifunctional or bispecific antibodies are artificial hybrid antibodies that have two different heavy /light chain pairs and two different binding sites. Bifunctional or bispecific antibodies can be produced using routine techniques known in the art.
- the structure of the chains of an antibody exhibit the same general structure of relatively conserved framework regions (FR) joined by three hyper variable regions, also called complementarity determining regions or CDRs.
- the CDRs from the two chains of each pair are aligned by the framework regions, enabling binding to a specific epitope.
- both the light and heavy chains comprise the domains FRI, CDRl, FR2, CDR2, FR3, CDR3 and FR4.
- U.S. Patent 6,319,499 describes antibodies that bind to and activate an erythropoietin receptor (EPO-R).
- EPO-R erythropoietin receptor
- the antibodies specifically identified in this patent are Mabs 71 and 73.
- Mab 71 binds to a peptide designated "SE-3" having the amino acid sequence of PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID NOT) (See Example 3).
- SE-3 is located on the human EPO-R between amino acid residues 49-78.
- this region of the EPO-R i.e. amino acid residues 49-79
- a cross linker such as Mab 71
- Example 6 in U.S. Patent 6,319,499 states that Mab 71 binds "significant amounts of peptide SE-3" compared to other peptides tested. This example further states that this "indicates that Mab 71 binds to a region of the human EPO-R containing or overlapping residues 49 to 78.”
- Mabs 71 and 73 are murine antibodies. Although rodent and human antibodies may both provide precision for target specificity, human antibodies interact far more effectively with the natural defenses of the body and do not elicit anti-antibody responses to the same extent as rodent antibodies (Winter, G. and Milstein, C. Nature 349: 293 (1991). Additionally, the flexibility of human IgG subclasses differ (Roux, K.H.
- the present invention relates to an antibody or antibody fragment that binds to the erythropoietin receptor.
- the antibody or antibody fragment that binds to the erythropoietin receptor comprises at least one heavy chain having an amino acid sequence selected from the group consisting of: SEQ ID NOS: 3, 7, 11, 15, 19, 31, 35, 39, 43, 47, 51, 55 and fragments thereof.
- the antibody or antibody fragment that binds to the erythropoietin receptor comprises at least one light chain having an amino acid sequence selected from the group consisting of: SEQ ID NOS: 5, 9, 13, 17, 21, 23, 25, 27, 29, 33, 37, 41, 45, 49, 53, 57 and fragments thereof.
- the present invention relates to an isolated antibody that is capable of binding a human erythropoietin receptor in a mammal. More specifically, the antibody comprises a heavy chain variable region or a light chain variable region which comprises a continuous sequence from CDRl through CDR3.
- the amino acid sequence of the heavy chain variable region comprising the continuous sequence from CDRl through CDR3 is selected from the group consisting of: SEQ ID NO:58, SEQ ID NO:59, , SEQ ID NO:60 and SEQ ID NO:61, and fragments thereof.
- the amino acid sequence of the light chain variable region comprising the continuous sequence from CDRl through CDR3 is selected from the group consisting of: SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, and SEQ ID NO:68, and fragments thereof.
- the present invention relates to an isolated antibody which comprises a heavy chain variable region or a light chain variable region which comprises at least one CDR.
- the antibody comprises a heavy chain variable region comprising at least one CDR selected from the group consisting of amino acid residues 99- 112 of SEQ ID NO.T 1 , 26-35 of SEQ ID NO:3, 50-65 of SEQ ID NO:3, 98-105 of SEQ ID NO:3, 26-35 of SEQ ID NOT9, 50-66 of SEQ ID NO:19, 99-105 of SEQ ID NO:19, 50-66 of SEQ ID NO:31, 99-105 of SEQ ID NO:31, 26-35 of SEQ ID NO:39, 50-65 of SEQ ID NO:39, 98-105 of SEQ ID NO:39, 26-37 of SEQ ID NO:43, 52-67 of SEQ ID NO:43, 100-107 of SEQ ID NO:43, 26-35 of SEQ ID NO:47, 50-65 of SEQ ID NO:47, 26-35 of SEQ ID NO:51, 50-65 of SEQ ID NO:51, 98-105 of SEQ ID NO:51, 26-37
- the present invention relates to an antibody or antibody fragment that binds to and activates the erythropoietin receptor.
- the antibodies of the present invention bind to at least one epitope that is involved in activating the EPO receptor (Example 4).
- the antibodies of the present invention do not interact with the peptide designated SE-3.
- the antibodies of the present invention are erythropoietic even though the antibodies do not bind to the SE-3 peptide. Therefore, the human antibodies of the present invention interact with at least one different epitope on the human EPO receptor than the antibodies described in U.S. Patent 6,319,499.
- the present invention relates to an IgG2 antibody or antibody fragment that binds to and activates the erythropoietin receptor.
- the IgG2 antibodies or antibody fragments of this embodiment bind to and interact with any epitope that is involved in activating the EPO receptor.
- the antibodies of the present invention exhibit a binding affinity to the erythropoietin receptor within one hundred fold of the binding affinity of endogenous human erythropoietin to the erythropoietin receptor.
- a high ( ⁇ lnM) and low ( ⁇ l ⁇ M) affinity of the EPO receptor for EPO has been reported resulting from two nonequivalent receptor binding sites on EPO (See Philo, J.S. et al., Biochemistry, 35:1681 (1996)).
- the antibodies of the present invention can be polyclonal antibodies, monoclonal antibodies, chimeric antibodies (See U.S. Patent 6,020,153) or human or humanized antibodies or antibody fragments thereof. Synthetic and genetically engineered variants (See U.S. Patent 6,331,415) of any of the foregoing are also contemplated by the present invention. Preferably, however, the antibodies of the present invention are human or humanized antibodies.
- the advantage of human or humanized antibodies is that they potentially decrease or eliminate the immunogenicity of the antibody in a host recipient, thereby permitting an increase in the bioavailability and a reduction in the possibility of adverse immune reaction, thus potentially enabling multiple antibody administrations.
- Humanized antibodies include chimeric or CDR-grafted antibodies. Also, human antibodies can be produced using genetically engineered strains of animals in which the antibody gene expression of the animal is suppressed and functionally replaced with human antibody gene expression.
- transgenic animals such as a transgenic mouse. These transgenic animals contain a substantial portion of the human antibody producing genome inserted into their own genome and the animal's own endogenous antibody production is rendered deficient in the production of antibodies. Methods for making such transgenic animals are known in the art. Such transgenic animals can be made using XenoMouse® technology or by using a "minilocus" approach. Methods for making
- XenomiceTM are described in U.S. Patent Nos. 6,162,963, 6,150,584, 6,114,598 and 6,075,181.
- Methods for making transgenic animals using the "minilocus" approach are described in U.S. Patents 5,545,807, 5,545,806 and 5,625,825. Also see International Publication No. WO93/12227.
- human antibodies can be obtained by immunizing a XenoMouse® mouse (Abgenix, Fremont, California) with an antigen of interest.
- the lymphatic cells (such as B-cells) are recovered from the mice that express antibodies. These recovered cells can be fused with myelpid-type cell line to prepare immortal hybridoma cell lines. These hybridoma cell lines can be screened and selected to identify hybridoma cell lines that produce antibodies specific to the antigen of interest.
- the antibodies can be expressed in cell lines other than hybridoma cell lines. More specifically, sequences encoding particular antibodies can be cloned from cells producing the antibodies and used for transformation of a suitable mammalian host cell.
- Transformation can be by any known method for introducing polynucleotides into a host cell, including, for example, packaging the polynucleotide in a virus or into a viral vector and transducing a host cell with a virus or vector or by transfection procedures known in the art such as those described in U.S. Patents 4,399,216, 4,912,040, 4,740,461 and 4,959,455.
- one or more genes encoding the heavy chain can be expressed in a cell and one or more genes encoding the light chain can be expressed in a second cell.
- the resulting heavy and light chains can then be fused together to form the antibodies of the present invention using techniques known in the art.
- genes encoding for parts of the heavy and light chains can be ligated using restriction endonucleases to reconstruct the gene coding for each chain. Such a gene can then be expressed in a cell to produce the antibodies of the present invention.
- the transformation procedure used will depend upon the host to be transformed.
- Methods for introducing heterologous polynucleotides into mammalian cells include dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) into liposomes and direct microinjection of the DNA molecule.
- Mammalian cell lines that can be used as hosts for expression are well known in the art and include, but are not limited to, Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells bacterial cells, such as E. coli, yeast cells, such as Saccharomyces cerevisiae, etc.
- CHO Chinese hamster ovary
- HeLa cells HeLa cells
- baby hamster kidney (BHK) cells baby hamster kidney (BHK) cells
- COS monkey kidney cells
- human hepatocellular carcinoma cells bacterial cells such as E. coli
- yeast cells such as Saccharomyces cerevisiae, etc.
- Humanized antibodies can also be made using a CDR-grafted approach. Such humanized antibodies are well known in the art. Generally, humanized antibodies are produced by obtaining nucleic acid sequences that encode the variable heavy and variable light sequences of an antibody that binds to the EPO receptor, identifying the complementary determining region or "CDR" in the variable heavy and variable light sequences and grafting the CDR nucleic acid sequences on to human framework nucleic acid sequences. (See, for example, U.S. Patent Nos. 4,816,567 and 5,225,539).
- the human framework that is selected is one that is suitable for in vivo administration, meaning that it does not exhibit immunogenicity. For example, such a determination can be made by prior experience with in vivo usage of such antibodies and studies of amino acid similarities.
- the amino acid sequences encoding the CDRs are identified and the conesponding nucleic acid sequences grafted on to selected human FRs. This can be done using known primers and linkers, the selection of which are known in the art.
- variable heavy and variable light sequences are expressed to produce a humanized Fv or humanized antibody that binds to the EPO receptor.
- humanized variable heavy and light sequences are expressed as a fusion protein with human constant domain sequences so an intact antibody that binds to the EPO receptor is obtained.
- a humanized Fv antibody can be produced that does not contain the constant sequences. Fusion of the human constant sequence to the humanized variable region is prefened.
- the EPO receptor that is bound by and preferably activated using the antibodies of the present invention is preferably a mammalian EPO receptor, most preferably a human EPO receptor.
- the present invention also contemplates the use of analogs of the EPO receptor, such as those described in U.S. Patent 5,292,654.
- Human EPO receptor can be purchased from R & D Systems (Minneapolis, Minnesota).
- PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID NO: 1); and (3) exhibit a binding affinity within one hundred fold of the binding affinity of endogeous human EPO to the EPO receptor, are the human antibodies designated AM2 and AM98.
- Abl2 and AM98 are human antibodies that were developed using the XenoMouse® XenoMax technology described herein (See Example 1).
- the present invention relates to polynucleotide and polypeptide sequences that encode for the antibodies described herein.
- polynucleotides encode for both the variable and constant regions of each of the heavy and light chains, although other combinations are also contemplated by the present invention.
- the present invention also contemplates oligonucleotide fragments derived from the disclosed polynucleotides and nucleic acid sequences complementary to these polynucleotides.
- the polynucleotides can be in the form of RNA or DNA.
- Polynucleotides in the form of DNA, cDNA, genomic DNA, nucleic acid analogs and synthetic DNA are within the scope of the present invention.
- the DNA may be double-stranded or single-stranded, and if single stranded, may be the coding (sense) strand or non-coding (anti-sense) strand.
- the coding sequence that encodes the polypeptide may be identical to the coding sequence provided herein or may be a different coding sequence which coding sequence, as a result of the redundancy or degeneracy of the genetic code, encodes the same polypeptide as the DNA provided herein.
- the polynucleotides encode at least one heavy chain variable region and at least one light chain variable region of the present invention.
- Examples of such polynucleotides are shown in SEQ ID NOS: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54 and 56 as well as fragments, complements and degenerate codon equivalents thereof.
- SEQ ID NO: 2 encodes for the heavy chain of AM2 (variable region)
- SEQ ID NO:4 encodes for the light chain of AM2
- SEQ ID NO:6 encodes for the heavy chain of AM98 (variable region) and SEQ ID NO: 8 encodes for the light chain of AM 98 (variable region).
- the present invention also includes variant polynucleotides containing modifications such as polynucleotide deletions, substitutions or additions, and any polypeptide modification resulting from the variant polynucleotide sequence.
- a polynucleotide of the present invention may also have a coding sequence that is a naturally occurring variant of the coding sequence provided herein.
- polynucleotides will be considered to hybridize to the sequences provided herein if there is at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95% identity between the polynucleotide and the sequence.
- the present invention further relates to polypeptides that encode for the antibodies of the present invention as well as fragments, analogs and derivatives of such polypeptides.
- the polypeptides of the present invention may be recombinant polypeptides, naturally purified polypeptides or synthetic polypeptides.
- the fragment, derivative or analogs of the polypeptides of the present invention may be one in which one or more of the amino acid residues is substituted with a conserved or non-conserved amino acid residue (preferably a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code; or it may be one in which one or more of the amino acid residues includes a substituent group; or it may be on in which the polypeptide is fused with another compound, such as a compound to increase the half-life of the polypeptide (for example, polyethylene glycol); or it may be one in which the additional amino acids are fused to the polypeptide, such as a leader or secretory sequence or a sequence that is employed for purification of the polypeptide or a proprotein sequence.
- a conserved or non-conserved amino acid residue preferably a conserved amino acid residue
- substituted amino acid residue may or may not be one encoded by the genetic code
- one or more of the amino acid residues includes
- a polypeptide of the present invention may have an amino acid sequence that is identical to that of the antibodies described herein or that is different by minor variations due to one or more amino acid substitutions.
- the variation may be a "conservative change" typically in the range of about 1 to 5 amino acids, wherein the substituted amino acid has similar structural or chemical properties, e.g., replacement of leucine with isoleucine or threonine with serine.
- variations may include nonconservative changes, e.g., replacement of a glycine with a tryptophan.
- Similar minor variations may also include amino acid deletions or insertions or both. Guidance in determining which and how many amino acid residues may be substituted, inserted, or deleted without changing biological or immunological activity may be found using computer programs well known in the art, for example DNASTAR software (DNASTAR, Inc., Madison, Wisconsin).
- the polypeptides encode at least one heavy chain variable region or at least one light chain variable region of the antibodies of the present invention. More preferably, the polypeptides encode at least one heavy chain variable region and one light chain variable region of the antibodies of the present invention.
- Examples of such polypeptides are those having the amino acid sequences shown in SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 46, 47, 49, 51, 53, 55, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, and fragments thereof.
- the heavy chain of AM2 has the amino acid sequence shown in SEQ ID NO: 3 and the light chain has the amino acid sequence shown in SEQ ID NO:5.
- the amino acid sequence of the heavy chain of AM98 is shown in SEQ ID NO:7 and the light chain has the amino acid sequence shown in SEQ ID NO:9.
- the present invention also provides vectors that include the polynucleotides of the present invention, host cells which are genetically engineered with vectors of the present invention and the production of the antibodies of the present invention by recombinant techniques.
- Host cells are genetically engineered (transfected, transduced or transformed) with vectors, such as, cloning vectors or expression vectors.
- the vector may be in the form of a plasmid, a viral particle, a phage, etc.
- the engineered host cells can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting transfected cells, etc.
- the culture conditions such as temperature, pH and the like, are those previously used with the host cell selected for expression, and will be apparent to those of skilled in the art.
- the polynucleotides of the present invention can be employed to produce the polypeptides and hence the antibodies of the present invention.
- the polynucleotide sequences of the present invention can be included in any one of a variety of expression vehicles, in particular, vectors or plasmids for expressing a polypeptide.
- vectors include chromosomal, nonchromosomal and synthetic DNA sequences, derivatives of SV40, bacterial plasmids, phage DNA, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, viral DNA such as vaccinia, adenovirus, fowl pox virus and pseudorabies.
- any other plasmid or vector may be used so long as it is replicable and viable in the host.
- the appropriate DNA sequence may be inserted into the vector by a variety of procedures. In general, the DNA sequence is inserted into appropriate restriction endonuclease sites by procedures known in the art.
- the polynucleotide sequence in the expression vector is operatively linked to an appropriate expression control sequence (i.e. promoter) to direct mRNA synthesis. Examples of such promoters include, but are not limited to, the LTR or the SV40 promoter, the E. coli lac or trp, the phage lambda P promoter and other promoters known to control expression of genes in prokaryotic or eukaryotic cells or their viruses.
- the expression vector also contains a ribosome binding site for translation initiation and a transcription terminator.
- the vector may also include appropriate sequences for amplifying expression.
- the vector can contain enhancers, which are transcription-stimulating DNA sequences of viral origin, such as those derived form simian virus such as SV40, polyoma vims, bovine papilloma virus or Moloney sarcoma virus, or genomic, origin.
- the vector preferably also contains an origin of replication.
- the vector can be constructed to contain an exogenous origin of replication or, such an origin of replication can be derived from SV40 or another viral source, or by the host cell chromosomal replication mechanism.
- the vectors preferably contain a marker gene for selection of transfected host cells such as dihydrofolate reductase or antibiotics, such as G-418 (geneticin, a neomycin- derivative) or hygromycin, or genes which complement a genetic lesion of the host cells such as the absence of thymidine kinase, hypoxanthine phosphoribosyl transferase, dihydrofolate reductase, etc.
- a marker gene for selection of transfected host cells such as dihydrofolate reductase or antibiotics, such as G-418 (geneticin, a neomycin- derivative) or hygromycin, or genes which complement a genetic lesion of the host cells such as the absence of thymidine kinase, hypoxanthine phosphoribosyl transferase, dihydrofolate reductase, etc.
- Suitable vectors for use in the present invention are known in the art. Any plasmid or vector can be used in the present invention as long as it is replicable and is viable in the host.
- Examples of vectors that can be used include those that are suitable for mammalian hosts and based on viral replication systems, such as simian virus 40 (SV40), Rous sarcoma virus (RSV), adenovirus 2, bovine papilloma virus (BPV), papovavirus BK mutant (BKV), or mouse and human cytomegalovirus (CVM).
- SV40 simian virus 40
- RSV Rous sarcoma virus
- BPV bovine papilloma virus
- BKV papovavirus BK mutant
- CVM mouse and human cytomegalovirus
- the present invention relates to host cells containing the above-described constructs.
- the host cell can be a higher eukaryotic cell, such as a mammalian cell, or a lower eukaryotic cell, such as a yeast cell, or the host cell can be a prokaryotic cell, such as a bacterial cell.
- the host cells provide a suitable environment for the production of active antibodies, since the biosynthesis of functional tetrameric antibody molecules requires correct nascent polypeptide chain folding, glycosylation, and assembly.
- suitable host cells include mammalian cells, such as COS-7 cells, Bowes melanoma cells, Chinese hamster ovary (CHO) cells, embryonic lung cells L-132, and mammalian cells of lymphoid origin, such as myeloma or lymphoma cells.
- the host cells can be transfected with a vector containing a polynucleotide sequence encoding the H-chain alone, with a second vector encoding the light chain alone (such as by using two different vectors as discussed previously).
- the host cells are transfected with two different vectors.
- Introduction of the vectors into the host cell can be effected by calcium phosphate transfection, DEAE-Dextran mediated transfection or electroporation (L. David et al., Basic Methods in Molecular Biology 2" Edition, Appleton and Lang, Paramount Publishing, East Norwalk, Conn. (1994)).
- one or more polynucleotide sequences that encode for the light and heavy chain variable regions and light and heavy chain constant regions of the antibodies of the present invention should be incorporated into a vector.
- Polynucleotide sequences encoding the light and heavy chains of the antibodies of the present invention can be incorporated into one or multiple vectors and then incorporated into the host cells.
- the antibodies of the present invention have a number of uses.
- the antibodies may be used to treat any condition treatable by erythropoietin or a biologically active variant or analog thereof.
- antibodies of the invention are useful for treating disorders characterized by low red blood cell levels and/or decreased hemoglobin levels (e.g. anemia).
- the antibodies of the invention may be used for treating disorders characterized by decreased or subnormal levels of oxygen in the blood or tissue, such as, for example, hypoxemia or chronic tissue hypoxia and/or diseases characterized by inadequate blood circulation or reduced blood flow.
- Antibodies of the invention also may be useful in promoting wound healing or for protecting against neural cell and/or tissue damage, resulting from brain/spinal cord injury, stroke and the like.
- Non-limiting examples of conditions that may be treatable by the antibodies of the invention include anemia, such as chemotherapy-induced anemia, cancer associated anemia, anemia of chronic disease, HIV- associated anemia, bone marcow transplant-associated anemia and the like, heart failure, ischemic heart disease and renal failure.
- the invention includes methods of treating any of the aforementioned diseases or conditions comprising the step of administering to a mammal a therapeutically effective amount of said antibody.
- the mammal is a human.
- the antibodies of the present invention also can be used to identify and diagnose mammals that have a dysfunctional EPO receptor. Mammals that have a dysfunctional EPO receptor are characterized by disorders such as anemia. Preferably, the mammal being identified and diagnosed is a human. Additionally, the antibodies of the present invention can be used in the treatment of anemia in mammals suffering from red blood cell aplasia. Red blood cell aplasia may result from the formation of neutralizing anti-erythropoietin antibodies in patients during treatment with recombinant erythropoietin (Casadevall, N. et al., n. Eng. J. Med. 346: 469 (2002)). The method involves the step of administering to a mammal suffering from said aplasia and in need of treatment a therapeutically effective amount of the antibodies of the present invention.
- the EPO receptor antibodies and antibody fragments of the invention also can be used to detect EPO receptor (e.g., in a biological sample, such as tissue specimens, intact cells, or extracts thereof), using a conventional immunoassay, such as an enzyme linked immunosorbent assay (ELISA), a radioimmunoassay (RIA) or tissue immunohistochemistry.
- a conventional immunoassay such as an enzyme linked immunosorbent assay (ELISA), a radioimmunoassay (RIA) or tissue immunohistochemistry.
- ELISA enzyme linked immunosorbent assay
- RIA radioimmunoassay
- tissue immunohistochemistry tissue immunohistochemistry.
- the invention provides a method for detecting EPO receptor in a biological sample comprising contacting a biological sample with an antibody or antibody fragment of the mvention and detecting either the antibody (or antibody portion), to thereby detect EPO receptor in the biological sample.
- the antibody or antibody fragment is directly or indirectly labeled with a detectable substance to facilitate detection
- Suitable detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials and radioactive materials.
- suitable enzymes include horseradish peroxidase, alkaline phosphatase, B-galactosidase, or acetylcholinesterase
- suitable prosthetic group complexes include streptavidin biotin and avidin/biotin
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine, dansyl chloride or phycoerythrin
- an example of a luminescent material includes luminol
- suitable radioactive material include 125 1, 131 1, 35 S. or 3 H.
- the present invention relates to a pharmaceutical composition containing a therapeutically effective amount of the antibody of the present invention along with a pharmaceutically acceptable carrier or excipient.
- pharmaceutically acceptable ca ier or “pharmaceutically acceptable excipient” includes any and all solvents, dispersion media, coating, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- pharmaceutically acceptable carriers or excipients include one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like as well as combinations thereof.
- isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
- Pharmaceutically acceptable substances such as wetting or minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the of the antibody or antibody portion also may be included.
- disintegrating agents can be included, such as cross-linked polyvinyl py ⁇ olidone, agar, alginic acid or a salt thereof, such as sodium alginate and the like.
- the pharmaceutical composition can include one or more of the following, canier proteins such as serum albumin, buffers, binding agents, sweeteners and other flavoring agents; coloring agents and polyethylene glycol.
- compositions of this invention may be in a variety of forms. They include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g. injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories.
- liquid solutions e.g. injectable and infusible solutions
- dispersions or suspensions tablets, pills, powders, liposomes and suppositories.
- the prefened fonn depends on the intended mode of administration and therapeutic application. Typical prefened compositions are in the form of injectable or infusible solutions, such as compositions similar to those used for passive immunization of humans with other antibodies.
- the prefened mode of administration is parenteral (e.g., intravenous, subcutaneous, intraperitoneal, intramuscular).
- the antibody is administered by intravenous infusion or injection.
- the antibody or antibody fragment is administered by intramuscular or subcutaneous injection.
- compositions include, but are not limited to, rectal, transdermal, vaginal, transmucosal or intestinal administration.
- compositions typically must be sterile and stable under the conditions of manufacture and storage.
- the composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration.
- Sterile injectable solutions can be prepared by incorporating the active compound (i.e. antibody or antibody fragment) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- the prefened methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- the proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- the antibodies and antibody fragments of the invention can be administered by a variety of methods known in the art, although for many therapeutic applications, the prefened route/mode of administration is intravenous injection or infusion. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results.
- the active compound may be prepared with a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
- a controlled release formulation including implants, transdermal patches, and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycohc acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilledin the art. See, e.g. Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York,
- an antibody or antibody portion of the invention may be orally administered, for example, with an inert diluent or an assimilable edible carrier.
- the compound (and other ingredients if desired) may also be enclosed in a hard or soft shell gelatin capsule, compressed into tablets, buccal tablets, troches, capsules, elixiers, suspensions, syrups, wafers, and the like.
- To administer an antibody or antibody fragment of the invention by other than parenteral administration it may be necessary to coat the compound with, or co- administer the compound with, a material to prevent its inactivation.
- an antibody or antibody fragment of the invention is coformulated with and/or coadministered with one or more additional therapeutic agents.
- an EPO receptor antibody or antibody fragment of the invention may be coformulated and/or coadministerd with one or more additional antibodies that bind other targets (e.g. , antibodies that bind other cytokines or that bind cell surface molecules) or one or more cytokines.
- one or more antibodies of the invention may be used in combination with two or more of the foregoing therapeutic agents.
- Such combination therapies may advantageously utilize lower dosages of the administered therapeutic agents, thus avoiding possible toxicities or complications associated with the various monotherapies.
- the term "therapeutically effective amount” means an amount of antibody or antibody fragment that produces the effects for which it is administered. The exact dose will be ascertainable by one skilled in the art. As known in the art, adjustments based on age, body weight, sex, diet, time of administration, drug interaction and severity of condition may be necessary and will be ascertainable with routine experimentation by those skilled in the art. A therapeutically effective amount is also one in which the therapeutically beneficial effects outweigh any toxic or detrimental effects of the antibody or antibody fragment.
- prophylactically effective amount refers to an amount effective, at dosages and for periods of time necessary to achieve the desired prophylactic result. Typically, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
- Dosage regimens may be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
- Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the mammalian subjects to be tested; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical canier.
- dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic or prophylactic effect to be achieved and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
- An exemplary, non-limiting range for a therapeutically or prophylactically effective amount of an antibody or antibody portion of the invention is 0.1-20 mg/kg, more preferably 1- 10 mg/kg. It is to be noted that dosage values may vary with the type and severity of the condition to be alleviated.
- EXAMPLE 1 Generation of human Erythropoietin Receptor antibodies Antigen Preparation.
- the antigen used for immunization of XenoMouse® animals was coupled to a universal T-cell epitope (TCE) (J. Immunol, 148(5):1499 (1992)) using two different methods. A mixture containing an equal amount of each was used as the immunogen.
- TCE T-cell epitope
- DTT Dithiothreitol
- cysteine coupled TCE J.Immunol, 148(5): 1499 (1992)
- the reduced cysteine coupled TCE is added to 200 meg soluble extracellular domain of human EpoR (R&D Systems, Minneapolis, MN) re-suspended in Phosphate Buffered Saline (PBS) (8.1 mM Na 2 HPO 4 , 1.6 mM NaH 2 P0 4 , 136 mM NaCI, 2.6 mM KC1, pH 7.4) and 33 meg of Sulfosuccmimidyl 4-(N-maleimidomethyl)-cyclohexane-l -carboxylate (sulfo SMCC), and mixed 4°C over night. Un-reacted EpoR was removed by centrifugation through a lOKDa cut off Centricon column (Millipore, Bedford, MA).
- Monoclonal antibodies of the invention including AM 2 and AM98 (also refened to herein as AB-ABT2-XG2-012 and AB-ABT2-XG2-198, respectively) were developed by immunizing XenoMouse® mice (XenoMouse® XG2, Abgenix, Inc., Fremont, CA and Vancouver, BC) with soluble EpoR coupled to a TCE as described above.
- the initial immunization was with 20 meg of antigen and mixed 1:1 v/v with Complete Freund's Adjuvant (CFA) (Sigma, St Louis, MO) per mouse.
- CFA Complete Freund's Adjuvant
- the subsequent immunizations were with 20 meg of antigen mixed 1 :1 v/v with incomplete Freund's (IF A).
- each animal was immunized at the base of tail and by intraperitoneal injection on days 0, 14, 28 and 42.
- Anti-EpoR antibody titers were determined by ELISA. 0.7 mcg/ml biotin EpoR (described above) was coated onto streptavadin plates (Sigma,
- EpoR immunized animals, or naive XenMouse® animals were titrated in 2%milk/PBS at a 1 :2 dilution in duplicate from a 1 TOO initial dilution. The last well was left blank, and plates were washed five times with dH 2 O.
- XenoMouse® animal 14 was selected for harvest based on the serology data in Table 1.
- B cells from the harvested animals were cultured and those secreting EpoR-specific antibodies were isolated essentially as described in Babcook et al., Proc. Natl. Acad. Sci. USA, 93:7843-7848 (1996).
- ELISA performed as described above for sera titers, was used to identify EpoR-specific wells. Fifty plates cultured at 500 cells/well were screened on biotin EpoR to identify the antigen-specific wells. The data as shown in Table 2 demonstrated the presence of 701 wells with ODs significantly over background (0.05).
- Agonist activity assay Proliferation of an Epo responsive cell line was used as the basis for the agonist screen. These 137 wells were then screened for agonist activity using the human erythroleukemia cell line UT-7/Epo (Abbott ref#.RB29454-174). 12.5 mcL of supernatant were added to 1 x 105 cells per well in RPMI 1640 (10% FCS) to a final volume of' 50 mcL in a half-area 96 well plate. The well size is half the area of a typical 96 well plate. Proliferation was identified visually and compared to cells in media containing a titration of human Epo or no Epo as a base line control. Eleven wells with proliferation activity were identified.
- EpoR-specific Hemolytic Plaque Assay A number of specialized reagents are needed to conduct the assay. These reagents were prepared as follows.
- SRBC Sheep red blood cells
- the SRBCs were centrifuged at 3000g for 5 min, the supernatant drawn off and 25 mis PBS at pH 7.4 as a wash. The wash cycle was repeated 3 times, then 4.75 ml immune cell media (RPMI 1640 with 10% FCS) was added to the 250 ul biotinylated-SRBC (B-SRBC) pellet to gently re-suspend the B- SRBC (5% B-SRBC stock). Stock was stored at 4° C until needed.
- Streptavidin (SA) coating of B-SRBC One ml of the 5% B-SRBC stock was transferred into to a fresh eppendorf tube. The B-SRBC cells were pelleted with a pulse spin at 8000 rpm (6800 rcf) in a microfuge, the supernatant drawn off, the pellet re-suspended in 1.0 ml PBS at pH 7.4, and the centrifugation repeated. The wash cycle was repeated 2 times, then the B- SRBC pellet was resuspended in 1.0 ml of PBS at pH 7.4 to give a final concentration of 5% (v/v).
- EpoR coating of SA-SRBC The SA-SRBC were coated with biotinylated EpoR at lOug/ml, the mixed and rotated at RT for 20 min. The SRBC were washed twice with 1.0 ml of PBS at pH 7.4 as above. The EpoR-coated SRBC were re-suspended in RPMI (+10%FCS) to a final concentration of 5% (v/v).
- the cells were resuspended in 50ul of PBS and incubated with 40 mcg/mL Gt-anti mouse IgG Fc antibody conjugated to Alexa488 (Molecular Probes, Eugene, OR).
- the tubes were rotated at RT for 25 min, and then washed with lOOul PBS and the cells re-suspended in 10 ul PBS.
- lOul of the stained cells were spotted onto a clean glass microscope slide, covered with a glass coverslip, observed under fluorescent light, and scored on an arbitrary scale of 0-4.
- Preparation of plasma cells The contents of a single microculture well identified by the previous assays as containing a B cell clone secreting the immunoglobulin of interest were harvested. Using a 100-1000 ul pipettman, the contents of the well were recovered by adding 37C RPMI (+10% FCS). The cells were re-suspended by pipetting and then transfered to a fresh 1.5 ml eppendorf tube (final vol. approx 500-700ul). The cells were centrifuged in a microfuge at 1500 rpm (240 rcf) for 2 minutes at room temperature, then the tube rotated 180 degrees and spun again for 2 minutes at 1500 rpm.
- the freeze media was drawn off and the immune cells resuspended in 100 ul RPMI (10% FCS), then centrifuged. This washing with RPMI (10% FCS) was repeated and the cells re-suspended in 60ul RPMI (FCS) and stored on ice until ready to use.
- Plaque assay Glass slides (2 x 3 inch) were prepared in advance with silicone edges and allowed to cure overnight at RT. Before use the slides were treated with approx. 5ul of SigmaCoat (Sigma, Oakville, ON) wiped evenly over glass surface, allowed to dry and then wiped vigorously. To a 60ul sample of cells was added 60ul each of EpoR-coated SRBC (5% v/v stock), 4x guina pig complement (Sigma, Oakville, ON) stock prepared in RPMI with 10% FCS, and 4x enhancing sera stock (1:900 in RPMI with 10% FCS). The mixture (3 - 5ul) was spotted onto the prepared slides and the spots covered with undiluted paraffin oil. The slides were incubated at 37° C for a minimum of 45 minutes.
- Plaque assay results The coating was determined qualitatively by immunofluorescent microscopy to be very high (4/4) using MAB307 to detect coating compared to a secondary detection reagent alone (0/4). There was no signal detected using the MAB307 antibody on red blood cells that were only coated with streptavidin (0/4). These red blood cells were then used to identify antigen-specific plasma cells from the fourteen wells identified in Table 4. After micrornanipulation to rescue the antigen-specific plasma cells, the genes encoding the variable region genes were rescued by RT-PCR on a single plasma cell.
- variable heavy chain region was cloned into an IgG2 expression vector. This vector was generated by cloning the constant domain of human IgG2 into the multiple cloning site of pcDNA3.1+/Hygro (Invitrogen, Burlington, ON). The variable light chain region was cloned into an IgK expression vector. This vector was generated by cloning the constant domain of human IgK into the multiple cloning site of pcDNA3.1+ Neo (Invitrogen, Burlington, ON).
- the appropriate pairs of heavy chain and the light chain expression vectors were then co- lipofected into a 60 mm dish of 70% confluent human embryonal kidney 293 cells and the transfected cells were left to secrete a recombinant antibody for 24 hours.
- the supernatant (3 mL) was harvested from the HEK 293 cells and the secretion of an intact antibody (AB-ABT2- XG2-012 and AB-ABT2-XG2-198) was demonstrated with a sandwich ELISA to specifically detect human IgG (Table 5, fourth column).
- the specificity of AB-ABT2-XG2-012 and AB- ABT2-XG2-198 was assessed through binding of the recombinant antibody to biotinylated EpoR using ELISA (Table 5, fifth column).
- the ELISA for antigen specific antibody secretion was performed as follows. Control plates were coated with 2mg/mL Goat anti-human IgG H+L O/N. For the binding plates, biotin-EpoR (0.7 mcg/mL) was coated onto streptavadin 96 well plates (Sigma, St Louis, MO) for one hour at room temperature. The plates were washed five times with dH O.
- Recombinant antibodies were titrated 1 :2 for 7 wells from the undiluted minilipofection supernatant. The plates were washed five times with dH 2 O. A goat anti-human IgG Fc- specific HRP-conjugated antibody was added at a final concentration of 1 ug/mL for 1 hour at RT for the secretion and the binding ELISA. The plates were washed five times with dH O. The plates were developed with the addition of TMB chromogenic substrate (KPL, Gaithersburg, MD) for 30 minutes and the ELISA was stopped by the addition of 1 M phosphoric acid. Each ELISA plate was analyzed to determine the optical density of each well at 450 nm.
- TMB chromogenic substrate KPL, Gaithersburg, MD
- the ABT2-XG2-012 and ABT2-XG2-198 antibody were purified from the supernatant using a Protein-A Sepharose (Amersham Biosciences, Piscataway, NJ) affinity chromatography (1 mL). The antibody was eluted from the Protein-A column with 500 mcL of 0.1 M Glycine pH 2.5. The eluate was dialysed in PBS pH 7.4 and filter sterilized. The antibody was analyzed by non-reducing SDS-PAGE to assess purity and yield.
- Agonist activity of recombinant antibodies The ability of these recombinant antibodies to stimulate the proliferation of Epo responsive cells was examined using the UT-7/Epo cells with proliferation quantitated by MTS reagent (Promega, Madison, WI) measured at 490 nm as described in the Agonist Activity Assay above.
- ABT2-SCX-012 and ABT2-SCX-198 induced proliferation in comparison to cells in media without antibody and are shown below (Fig.14 and 15 respectively). Effect of anti-Human Fc. It is possible that the agonist activity of ABT2-SCX-012 and ABT2-SCX-198 are due to self-aggregation.
- ABT2-SCX-012 Since the addition of secondary Ab inhibited the activity of ABT2-SCX-012 we concluded that aggregation of this antibody interferes with it's activity and thus it is unlikely that ABT2-SCX-012 has agonist activity due to aggregation. However, the results of ABT2- SCX-198 are more difficult to interpret. The lack of an effect could suggest that ABT2-SCX- 198 is fully aggregated and thus the addition of secondary Ab has no further effects on its activity. Alternatively, the lack of effect suggests the activity of ABT2-SCX-198 is not perturbed by the conformational restrictions applied by a secondary antibody.
- variable heavy chains and variable light chains for antibodies ABT2-SCX-012 and ABT2-SCX-198 were sequenced to determine their DNA sequences.
- Figures 1 and 2 provide full-length sequences, including the constant regions.
- variable heavy sequences were analyzed to determine the VH family, the D-region sequence and the J-region sequence.
- the sequences were then translated to determine the primary amino acid sequence (Fig.29) and compared to the germline VH, D and J-region sequences to assess somatic hypermutations.
- the primary amino acid sequences of all the anti- EpoR antibody gamma chains are shown in Figure 16.
- the germline sequences are shown above and the mutations are indicated with the new amino acid sequence. Unaltered amino acids are indicated with a dash (-).
- the light chain was analyzed similarly to determine the V and the J-regions and to identify any somatic mutations from germline kappa sequences ( Figure 30).
- the heavy chain of ABT2-SCX-012 was shown to utilize the VH 4-59 (DP-71), DIR4rc and the JH4a gene segments, while the light chain was shown to use the Vkl (A30) and the Jkl gene segments.
- the heavy chain of ABT2-SCX-198 was shown to utilize the VH 3-30 (V3-30), D4-23 and the JH6b gene segments, while the light chain was shown to use the Vkl (L5) and the Jk3 gene segments.
- EXAMPLE 3 Biacore Studies The studies described below were performed on a Biacore 2000 utilizing the Biacontrol software version 3.1. (Biacore, Uppsala, Sweden). Binding analyses were performed with antibody immobilized directly to the chip surface and followed by injection of varying receptor concentrations.
- Immobilizations of antibody were performed using the default immobilization program in the Biacore software package. Antibodies were diluted to 10 ug/mL in the supplied acetate buffers to prescreen for the appropriate pH at which to conduct the immobilizations. For immobilizations, antibodies were diluted into the appropriate acetate buffer (10 mM acetate pH 4.0) and coupled directly to the chip surface using standard EDC chemistry at three different protein levels (500, 1000, and 1500 RU). The fourth flow cell was mock coupled with EDC to cap the carboxyl groups and provide a background surface as a negative control. Binding studies
- EXAMPLE 5 Human CD36+ CFUe Assay Frozen human CD36+ erythroid progenitor cells obtained from Poietics (Biowhittaker (Walkersville, MD)) were thawed and 10 4 cells/ml in IMDM-2%FBS. Cells (0.3 ml) were added to 0.3 ml tubes containing 2.4 ml Methocult (StemCell Technologies, Vancouver,
- CD 36+ progenitor cells The colonies, identified microscopically, were red in color. The size and number of the colonies is reduced compared to those observed with the EPO control probably due to a reduced proliferative signal.
- CD34+ cells were enriched from human peripheral blood using a Direct CD34+
- Progenitor Cell Isolation Kit (Miltenyi, Auburn, CA). Recovered cells were washed twice with alpha-medium and re-suspended in suspension culture media (alpha-media supplemented with 30% FCS, 1% deionized BSA, 10 "5 M ⁇ -mercaptoethanol, 10 "6 M dexamethasone, 0.3 mg/mL human hollo-transfenin and 10 ng/mL human recombinant stem cell factor). Cells were plated out at a density of 1 x 10 4 cells/mL in duplicates in 6- well microplates with test antibody at concentrations ranging from 0.1 - 100 ng/mL. Plates were incubated at 37°C and 5% CO 2 for two weeks. Duplicate samples from each well were recovered for cell counts and staining with benzidine (Reference Fibach, E., 1998 Hemoglobin, 22:5-6, 445-458).
- Bone marrow was harvested from cynomolgus monkeys and diluted 1 :2 with PBS. Three ml of the diluted bone marrow was layered over six ml of Lymphoprep (Gibco (Invitrogen), Carlsbad, CA Cat. #1001967), centrifuged at 2700rpm for 20 minutes and the buffy coat recovered and diluted in 10ml IMDM-2%FBS. Cells were centrifuged and resuspended at 10 6 cells/ml in IMDM-2%FBS. Cells (0.3 ml) were added to tubes containing 2.4 ml Methocult (StemCell Technologies, Vancouver, Canada) Cat.
- 96 well polystyrene plates (Dynatec (Elk Grove Village, IL) Immunolon 4) were coated with 80 ul of 5ug/ml soluble EPO receptor (sEPOR) (R&D Systems (Minneapolis, MN) Cat. #307-ER/LF), or peptide SE-3 (PGNYSFSYQLEDEPWKLCRLHWAPTARGAV) (described in U.S. Patent 6,319,499) diluted in 0.015M Na 2 CO 3 , 0.035M NaHCO 3 , pH 9.4 for 2 hours at room temperature and overnight at 4°C.
- sEPOR 5ug/ml soluble EPO receptor
- peptide SE-3 peptide SE-3
- FIG 11 shows that AM2 does not interact (i.e. bind) with SE-3 peptide.
- Ab 71 A does interact (i.e. binds) with the SE-3 peptide Both Abs 12, and 71 A interacted with immobilized erythropoietin receptor.
- EXAMPLE 9 EPO Dependent Proliferation Assay Primary hybridoma supematants were diluted in assay medium and tested for then- ability to stimulate the proliferation of the F36E human erythroleukemic cells as described in EXAMPLE 5. Results with five primary supematants are shown in Figure 12. These samples stimulated the proliferation of F36E cells .
- EXAMPLE 10 ELISA to Measure Binding of Hybridoma Supematants to SE-3 Peptide Forty-two primary hybridoma supematants were tested for their ability to bind to either immobilized EPO receptor or peptide SE-3 as described in EXAMPLE 10.
- Figure 13 shows that whereas all the hybridoma supematants tested interact with immobilized EPO receptor, only sample 16 interacted with SE-3 peptide at levels above background.
- EXAMPLE 11 Comparison of Erythropoietic Activity of Gamma- 1 AM 2 versus Gamma-2 AM 2 Proliferation assays (as described in Example 4) were performed to compare the erythropoietic activity of gamma- 1 Ab 12 and gamma-2 Ab 12 on F36e human erythroleukemic cells. The results are shown in Figure 31. As Figure 31 shows, gamma-2 Ab 12 was more effective at stimulating proliferation of the F36E cell line than gamma- 1 Ab 12.
- EXAMPLE 12 Effect of Ab 12 on Erythropoiesis in vivo
- transgenic mice were dosed with Ab 12 (50 ⁇ g), at one week intervals for 3 weeks or with a single dose of Ab 12 (150 ⁇ g) and bled on day 19 for determination of percent hematocrit.
- Control animals received vehicle alone, a single dose of AranespTM (900 ng) or 3 total doses of AranespTM injected at weekly intervals (300 ng x 3).
- Figure 34 shows that both dosing regimens of Ab 12 caused a statistically significant increase in percent hematocrit over the vehicle control. In contrast, the single dose regimen of AranespTM did not have this effect.
Abstract
Description
Claims
Priority Applications (10)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
JP2004544846A JP4411472B2 (en) | 2002-10-14 | 2003-10-14 | Erythropoietin receptor binding antibody |
PL379985A PL379985A1 (en) | 2002-10-14 | 2003-10-14 | Erythropoietin receptor binding antibodies |
AU2003282588A AU2003282588B2 (en) | 2002-10-14 | 2003-10-14 | Erythropoietin receptor binding antibodies |
BR0315275-8A BR0315275A (en) | 2002-10-14 | 2003-10-14 | Antibodies that bind to erythropoietin receptor |
CA2501984A CA2501984C (en) | 2002-10-14 | 2003-10-14 | Erythropoietin receptor binding antibodies |
NZ539263A NZ539263A (en) | 2002-10-14 | 2003-10-14 | Erythropoietin receptor binding antibodies |
CN2003801060796A CN101027322B (en) | 2002-10-14 | 2003-10-14 | Erythropoietin receptor binding antibodies |
MXPA05003997A MXPA05003997A (en) | 2002-10-14 | 2003-10-14 | Erythropoietin receptor binding antibodies. |
EP03774776A EP1578779A4 (en) | 2002-10-14 | 2003-10-14 | Erythropoietin receptor binding antibodies |
AU2010214778A AU2010214778A1 (en) | 2002-10-14 | 2010-09-02 | Erythropoietin receptor binding antibodies |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US10/269,711 US20040071694A1 (en) | 2002-10-14 | 2002-10-14 | Erythropoietin receptor binding antibodies |
US10/269,711 | 2002-10-14 | ||
US10/684,109 US7396913B2 (en) | 2002-10-14 | 2003-10-10 | Erythropoietin receptor binding antibodies |
US10/684,109 | 2003-10-10 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2004035603A2 true WO2004035603A2 (en) | 2004-04-29 |
WO2004035603A3 WO2004035603A3 (en) | 2006-04-27 |
Family
ID=32109805
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2003/032243 WO2004035603A2 (en) | 2002-10-14 | 2003-10-14 | Erythropoietin receptor binding antibodies |
Country Status (13)
Country | Link |
---|---|
EP (1) | EP1578779A4 (en) |
JP (2) | JP4411472B2 (en) |
KR (1) | KR20050059263A (en) |
CN (1) | CN103524618A (en) |
AU (2) | AU2003282588B2 (en) |
BR (1) | BR0315275A (en) |
CA (1) | CA2501984C (en) |
MX (1) | MXPA05003997A (en) |
NZ (1) | NZ539263A (en) |
PL (1) | PL379985A1 (en) |
TW (1) | TWI320716B (en) |
WO (1) | WO2004035603A2 (en) |
ZA (1) | ZA201004902B (en) |
Cited By (92)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005100403A3 (en) * | 2004-04-09 | 2006-07-13 | Abbott Lab | Antibodies to erythropoietin receptor and uses thereof |
WO2009094551A1 (en) | 2008-01-25 | 2009-07-30 | Amgen Inc. | Ferroportin antibodies and methods of use |
WO2010022924A1 (en) * | 2008-08-28 | 2010-03-04 | F. Hoffmann-La Roche Ag | Antibodies against human epo receptor |
WO2010056981A2 (en) | 2008-11-13 | 2010-05-20 | Massachusetts General Hospital | Methods and compositions for regulating iron homeostasis by modulation bmp-6 |
WO2010081679A2 (en) | 2009-01-15 | 2010-07-22 | F. Hoffmann-La Roche Ag | Antibodies against human epo receptor |
WO2011050333A1 (en) | 2009-10-23 | 2011-04-28 | Amgen Inc. | Vial adapter and system |
WO2011156373A1 (en) | 2010-06-07 | 2011-12-15 | Amgen Inc. | Drug delivery device |
WO2012135315A1 (en) | 2011-03-31 | 2012-10-04 | Amgen Inc. | Vial adapter and system |
WO2012171996A1 (en) | 2011-06-15 | 2012-12-20 | F. Hoffmann-La Roche Ag | Anti-human epo receptor antibodies and methods of use |
US8383114B2 (en) | 2007-09-27 | 2013-02-26 | Amgen Inc. | Pharmaceutical formulations |
WO2013055873A1 (en) | 2011-10-14 | 2013-04-18 | Amgen Inc. | Injector and method of assembly |
EP2620448A1 (en) | 2008-05-01 | 2013-07-31 | Amgen Inc. | Anti-hepcidin antibodies and methods of use |
US20140120614A1 (en) * | 2004-02-06 | 2014-05-01 | Medarex, L.L.C. | Antibodies against clostridium difficile toxins and uses thereof |
WO2014081780A1 (en) | 2012-11-21 | 2014-05-30 | Amgen Inc. | Drug delivery device |
WO2014144096A1 (en) | 2013-03-15 | 2014-09-18 | Amgen Inc. | Drug cassette, autoinjector, and autoinjector system |
WO2014149357A1 (en) | 2013-03-22 | 2014-09-25 | Amgen Inc. | Injector and method of assembly |
WO2015061386A1 (en) | 2013-10-24 | 2015-04-30 | Amgen Inc. | Injector and method of assembly |
WO2015061389A1 (en) | 2013-10-24 | 2015-04-30 | Amgen Inc. | Drug delivery system with temperature-sensitive control |
WO2015119906A1 (en) | 2014-02-05 | 2015-08-13 | Amgen Inc. | Drug delivery system with electromagnetic field generator |
WO2015171777A1 (en) | 2014-05-07 | 2015-11-12 | Amgen Inc. | Autoinjector with shock reducing elements |
WO2015187797A1 (en) | 2014-06-03 | 2015-12-10 | Amgen Inc. | Controllable drug delivery system and method of use |
WO2016049036A1 (en) | 2014-09-22 | 2016-03-31 | Intrinsic Lifesciences Llc | Humanized anti-hepcidin antibodies and uses thereof |
WO2016061220A2 (en) | 2014-10-14 | 2016-04-21 | Amgen Inc. | Drug injection device with visual and audio indicators |
WO2016100781A1 (en) | 2014-12-19 | 2016-06-23 | Amgen Inc. | Drug delivery device with proximity sensor |
WO2016100055A1 (en) | 2014-12-19 | 2016-06-23 | Amgen Inc. | Drug delivery device with live button or user interface field |
WO2017039786A1 (en) | 2015-09-02 | 2017-03-09 | Amgen Inc. | Syringe assembly adapter for a syringe |
US9657098B2 (en) | 2013-03-15 | 2017-05-23 | Intrinsic Lifesciences, Llc | Anti-hepcidin antibodies and uses thereof |
WO2017100501A1 (en) | 2015-12-09 | 2017-06-15 | Amgen Inc. | Auto-injector with signaling cap |
WO2017120178A1 (en) | 2016-01-06 | 2017-07-13 | Amgen Inc. | Auto-injector with signaling electronics |
US9718883B2 (en) | 2003-09-10 | 2017-08-01 | Amgen Fremont Inc. | Antibodies to M-CSF |
EP3184539A3 (en) * | 2001-10-23 | 2017-09-13 | PSMA Development Company L.L.C. | Psma antibodies |
WO2017160799A1 (en) | 2016-03-15 | 2017-09-21 | Amgen Inc. | Reducing probability of glass breakage in drug delivery devices |
WO2017189089A1 (en) | 2016-04-29 | 2017-11-02 | Amgen Inc. | Drug delivery device with messaging label |
WO2017192287A1 (en) | 2016-05-02 | 2017-11-09 | Amgen Inc. | Syringe adapter and guide for filling an on-body injector |
WO2017197222A1 (en) | 2016-05-13 | 2017-11-16 | Amgen Inc. | Vial sleeve assembly |
WO2017200989A1 (en) | 2016-05-16 | 2017-11-23 | Amgen Inc. | Data encryption in medical devices with limited computational capability |
WO2017209899A1 (en) | 2016-06-03 | 2017-12-07 | Amgen Inc. | Impact testing apparatuses and methods for drug delivery devices |
WO2018004842A1 (en) | 2016-07-01 | 2018-01-04 | Amgen Inc. | Drug delivery device having minimized risk of component fracture upon impact events |
WO2018034784A1 (en) | 2016-08-17 | 2018-02-22 | Amgen Inc. | Drug delivery device with placement detection |
WO2018081234A1 (en) | 2016-10-25 | 2018-05-03 | Amgen Inc. | On-body injector |
WO2018136398A1 (en) | 2017-01-17 | 2018-07-26 | Amgen Inc. | Injection devices and related methods of use and assembly |
WO2018152073A1 (en) | 2017-02-17 | 2018-08-23 | Amgen Inc. | Insertion mechanism for drug delivery device |
WO2018151890A1 (en) | 2017-02-17 | 2018-08-23 | Amgen Inc. | Drug delivery device with sterile fluid flowpath and related method of assembly |
WO2018165499A1 (en) | 2017-03-09 | 2018-09-13 | Amgen Inc. | Insertion mechanism for drug delivery device |
WO2018165143A1 (en) | 2017-03-06 | 2018-09-13 | Amgen Inc. | Drug delivery device with activation prevention feature |
WO2018164829A1 (en) | 2017-03-07 | 2018-09-13 | Amgen Inc. | Needle insertion by overpressure |
WO2018172219A1 (en) | 2017-03-20 | 2018-09-27 | F. Hoffmann-La Roche Ag | Method for in vitro glycoengineering of an erythropoiesis stimulating protein |
EP3381445A2 (en) | 2007-11-15 | 2018-10-03 | Amgen Inc. | Aqueous formulation of antibody stablised by antioxidants for parenteral administration |
WO2018183039A1 (en) | 2017-03-28 | 2018-10-04 | Amgen Inc. | Plunger rod and syringe assembly system and method |
WO2018226515A1 (en) | 2017-06-08 | 2018-12-13 | Amgen Inc. | Syringe assembly for a drug delivery device and method of assembly |
WO2018226565A1 (en) | 2017-06-08 | 2018-12-13 | Amgen Inc. | Torque driven drug delivery device |
WO2018236619A1 (en) | 2017-06-22 | 2018-12-27 | Amgen Inc. | Device activation impact/shock reduction |
WO2018237225A1 (en) | 2017-06-23 | 2018-12-27 | Amgen Inc. | Electronic drug delivery device comprising a cap activated by a switch assembly |
WO2019014014A1 (en) | 2017-07-14 | 2019-01-17 | Amgen Inc. | Needle insertion-retraction system having dual torsion spring system |
WO2019018169A1 (en) | 2017-07-21 | 2019-01-24 | Amgen Inc. | Gas permeable sealing member for drug container and methods of assembly |
WO2019022950A1 (en) | 2017-07-25 | 2019-01-31 | Amgen Inc. | Drug delivery device with container access system and related method of assembly |
WO2019022951A1 (en) | 2017-07-25 | 2019-01-31 | Amgen Inc. | Drug delivery device with gear module and related method of assembly |
WO2019032482A2 (en) | 2017-08-09 | 2019-02-14 | Amgen Inc. | Hydraulic-pneumatic pressurized chamber drug delivery system |
WO2019036181A1 (en) | 2017-08-18 | 2019-02-21 | Amgen Inc. | Wearable injector with sterile adhesive patch |
WO2019040548A1 (en) | 2017-08-22 | 2019-02-28 | Amgen Inc. | Needle insertion mechanism for drug delivery device |
WO2019070472A1 (en) | 2017-10-04 | 2019-04-11 | Amgen Inc. | Flow adapter for drug delivery device |
WO2019070552A1 (en) | 2017-10-06 | 2019-04-11 | Amgen Inc. | Drug delivery device with interlock assembly and related method of assembly |
WO2019074579A1 (en) | 2017-10-09 | 2019-04-18 | Amgen Inc. | Drug delivery device with drive assembly and related method of assembly |
WO2019090079A1 (en) | 2017-11-03 | 2019-05-09 | Amgen Inc. | System and approaches for sterilizing a drug delivery device |
WO2019090303A1 (en) | 2017-11-06 | 2019-05-09 | Amgen Inc. | Fill-finish assemblies and related methods |
WO2019089178A1 (en) | 2017-11-06 | 2019-05-09 | Amgen Inc. | Drug delivery device with placement and flow sensing |
WO2019094138A1 (en) | 2017-11-10 | 2019-05-16 | Amgen Inc. | Plungers for drug delivery devices |
WO2019099324A1 (en) | 2017-11-16 | 2019-05-23 | Amgen Inc. | Door latch mechanism for drug delivery device |
WO2019099322A1 (en) | 2017-11-16 | 2019-05-23 | Amgen Inc. | Autoinjector with stall and end point detection |
EP3556411A1 (en) | 2015-02-17 | 2019-10-23 | Amgen Inc. | Drug delivery device with vacuum assisted securement and/or feedback |
WO2019231582A1 (en) | 2018-05-30 | 2019-12-05 | Amgen Inc. | Thermal spring release mechanism for a drug delivery device |
WO2019231618A1 (en) | 2018-06-01 | 2019-12-05 | Amgen Inc. | Modular fluid path assemblies for drug delivery devices |
EP3593839A1 (en) | 2013-03-15 | 2020-01-15 | Amgen Inc. | Drug cassette |
WO2020023444A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Delivery devices for administering drugs |
WO2020023220A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Hybrid drug delivery devices with tacky skin attachment portion and related method of preparation |
WO2020023451A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Delivery devices for administering drugs |
WO2020023336A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Hybrid drug delivery devices with grip portion |
WO2020028009A1 (en) | 2018-07-31 | 2020-02-06 | Amgen Inc. | Fluid path assembly for a drug delivery device |
WO2020068623A1 (en) | 2018-09-24 | 2020-04-02 | Amgen Inc. | Interventional dosing systems and methods |
WO2020068476A1 (en) | 2018-09-28 | 2020-04-02 | Amgen Inc. | Muscle wire escapement activation assembly for a drug delivery device |
WO2020072577A1 (en) | 2018-10-02 | 2020-04-09 | Amgen Inc. | Injection systems for drug delivery with internal force transmission |
WO2020072846A1 (en) | 2018-10-05 | 2020-04-09 | Amgen Inc. | Drug delivery device having dose indicator |
WO2020081480A1 (en) | 2018-10-15 | 2020-04-23 | Amgen Inc. | Platform assembly process for drug delivery device |
WO2020081479A1 (en) | 2018-10-15 | 2020-04-23 | Amgen Inc. | Drug delivery device having damping mechanism |
WO2020092056A1 (en) | 2018-11-01 | 2020-05-07 | Amgen Inc. | Drug delivery devices with partial needle retraction |
WO2020091956A1 (en) | 2018-11-01 | 2020-05-07 | Amgen Inc. | Drug delivery devices with partial drug delivery member retraction |
WO2020091981A1 (en) | 2018-11-01 | 2020-05-07 | Amgen Inc. | Drug delivery devices with partial drug delivery member retraction |
WO2020219482A1 (en) | 2019-04-24 | 2020-10-29 | Amgen Inc. | Syringe sterilization verification assemblies and methods |
WO2021041067A2 (en) | 2019-08-23 | 2021-03-04 | Amgen Inc. | Drug delivery device with configurable needle shield engagement components and related methods |
EP3981450A1 (en) | 2015-02-27 | 2022-04-13 | Amgen, Inc | Drug delivery device having a needle guard mechanism with a tunable threshold of resistance to needle guard movement |
EP4074355A1 (en) | 2011-04-20 | 2022-10-19 | Amgen Inc. | Autoinjector apparatus |
WO2022246055A1 (en) | 2021-05-21 | 2022-11-24 | Amgen Inc. | Method of optimizing a filling recipe for a drug container |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN105542006A (en) * | 2015-12-11 | 2016-05-04 | 北京大学第一医院 | Preparation method and use of anti-EPOR fusion protein antibody |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6153190A (en) * | 1995-06-07 | 2000-11-28 | Young; Peter Ronald | Erythropoietin receptor antibodies |
Family Cites Families (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1990008822A1 (en) * | 1989-02-03 | 1990-08-09 | Genetics Institute, Inc. | Erythropoietin receptor |
US5885574A (en) * | 1994-07-26 | 1999-03-23 | Amgen Inc. | Antibodies which activate an erythropoietin receptor |
WO1997048729A1 (en) * | 1996-06-21 | 1997-12-24 | Arris Pharmaceutical Corporation | Bivalent molecules that form an activating complex with an erythropoietin receptor |
US6103879A (en) * | 1996-06-21 | 2000-08-15 | Axys Pharmaceuticals, Inc. | Bivalent molecules that form an activating complex with an erythropoietin receptor |
EP1169352A4 (en) * | 1999-04-14 | 2005-05-04 | Smithkline Beecham Corp | Erythropoietin receptor antibodies |
-
2003
- 2003-10-13 TW TW092128277A patent/TWI320716B/en not_active IP Right Cessation
- 2003-10-14 MX MXPA05003997A patent/MXPA05003997A/en active IP Right Grant
- 2003-10-14 AU AU2003282588A patent/AU2003282588B2/en not_active Ceased
- 2003-10-14 JP JP2004544846A patent/JP4411472B2/en not_active Expired - Fee Related
- 2003-10-14 PL PL379985A patent/PL379985A1/en not_active Application Discontinuation
- 2003-10-14 KR KR1020057006487A patent/KR20050059263A/en not_active Application Discontinuation
- 2003-10-14 CA CA2501984A patent/CA2501984C/en not_active Expired - Fee Related
- 2003-10-14 CN CN201110126552.3A patent/CN103524618A/en active Pending
- 2003-10-14 WO PCT/US2003/032243 patent/WO2004035603A2/en active Search and Examination
- 2003-10-14 NZ NZ539263A patent/NZ539263A/en not_active IP Right Cessation
- 2003-10-14 BR BR0315275-8A patent/BR0315275A/en not_active Application Discontinuation
- 2003-10-14 EP EP03774776A patent/EP1578779A4/en not_active Withdrawn
-
2009
- 2009-02-12 JP JP2009029449A patent/JP2009149665A/en active Pending
-
2010
- 2010-07-12 ZA ZA2010/04902A patent/ZA201004902B/en unknown
- 2010-09-02 AU AU2010214778A patent/AU2010214778A1/en not_active Abandoned
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6153190A (en) * | 1995-06-07 | 2000-11-28 | Young; Peter Ronald | Erythropoietin receptor antibodies |
Non-Patent Citations (1)
Title |
---|
See also references of EP1578779A2 * |
Cited By (152)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP3184539A3 (en) * | 2001-10-23 | 2017-09-13 | PSMA Development Company L.L.C. | Psma antibodies |
US9718883B2 (en) | 2003-09-10 | 2017-08-01 | Amgen Fremont Inc. | Antibodies to M-CSF |
US10280219B2 (en) | 2003-09-10 | 2019-05-07 | Amgen Fremont Inc. | Antibodies to M-CSF |
US9217029B2 (en) * | 2004-02-06 | 2015-12-22 | University Of Massachusetts | Antibodies against clostridium difficile toxins and uses thereof |
US20140120614A1 (en) * | 2004-02-06 | 2014-05-01 | Medarex, L.L.C. | Antibodies against clostridium difficile toxins and uses thereof |
WO2005100403A3 (en) * | 2004-04-09 | 2006-07-13 | Abbott Lab | Antibodies to erythropoietin receptor and uses thereof |
EP2062917A3 (en) * | 2004-04-09 | 2009-09-30 | Abbott Laboratories | Antibodies to erythropoietin receptor and uses thereof |
US8383114B2 (en) | 2007-09-27 | 2013-02-26 | Amgen Inc. | Pharmaceutical formulations |
US9320797B2 (en) | 2007-09-27 | 2016-04-26 | Amgen Inc. | Pharmaceutical formulations |
US10653781B2 (en) | 2007-09-27 | 2020-05-19 | Amgen Inc. | Pharmaceutical formulations |
EP3381445A2 (en) | 2007-11-15 | 2018-10-03 | Amgen Inc. | Aqueous formulation of antibody stablised by antioxidants for parenteral administration |
EP2803675A2 (en) | 2008-01-25 | 2014-11-19 | Amgen, Inc | Ferroportin antibodies and methods of use |
US9688759B2 (en) | 2008-01-25 | 2017-06-27 | Amgen, Inc. | Ferroportin antibodies and methods of use |
WO2009094551A1 (en) | 2008-01-25 | 2009-07-30 | Amgen Inc. | Ferroportin antibodies and methods of use |
US9175078B2 (en) | 2008-01-25 | 2015-11-03 | Amgen Inc. | Ferroportin antibodies and methods of use |
EP2574628A1 (en) | 2008-01-25 | 2013-04-03 | Amgen Inc. | Ferroportin antibodies and methods of use |
EP2620448A1 (en) | 2008-05-01 | 2013-07-31 | Amgen Inc. | Anti-hepcidin antibodies and methods of use |
EP2816059A1 (en) | 2008-05-01 | 2014-12-24 | Amgen, Inc | Anti-hepcidin antibodies and methods of use |
CN102131829A (en) * | 2008-08-28 | 2011-07-20 | 弗·哈夫曼-拉罗切有限公司 | Antibodies against human epo receptor |
WO2010022924A1 (en) * | 2008-08-28 | 2010-03-04 | F. Hoffmann-La Roche Ag | Antibodies against human epo receptor |
EP3693014A1 (en) | 2008-11-13 | 2020-08-12 | The General Hospital Corporation | Methods and compositions for regulating iron homeostasis by modulation bmp-6 |
WO2010056981A2 (en) | 2008-11-13 | 2010-05-20 | Massachusetts General Hospital | Methods and compositions for regulating iron homeostasis by modulation bmp-6 |
WO2010081679A2 (en) | 2009-01-15 | 2010-07-22 | F. Hoffmann-La Roche Ag | Antibodies against human epo receptor |
US9221909B2 (en) | 2009-01-15 | 2015-12-29 | Hoffmann-La Roche Inc. | Antibodies against human EPO receptor |
WO2011050333A1 (en) | 2009-10-23 | 2011-04-28 | Amgen Inc. | Vial adapter and system |
WO2011156373A1 (en) | 2010-06-07 | 2011-12-15 | Amgen Inc. | Drug delivery device |
WO2012135315A1 (en) | 2011-03-31 | 2012-10-04 | Amgen Inc. | Vial adapter and system |
EP4074355A1 (en) | 2011-04-20 | 2022-10-19 | Amgen Inc. | Autoinjector apparatus |
KR20140013076A (en) * | 2011-06-15 | 2014-02-04 | 에프. 호프만-라 로슈 아게 | Anti-human epo receptor antibodies and methods of use |
WO2012171996A1 (en) | 2011-06-15 | 2012-12-20 | F. Hoffmann-La Roche Ag | Anti-human epo receptor antibodies and methods of use |
US8623666B2 (en) | 2011-06-15 | 2014-01-07 | Hoffmann-La Roche Inc. | Method for detecting erythropoietin (EPO) receptor using anti-human EPO receptor antibodies |
US9187563B2 (en) | 2011-06-15 | 2015-11-17 | Hoffmann-La Roche Inc. | Anti-human EPO receptor antibodies and methods of use |
KR101629073B1 (en) * | 2011-06-15 | 2016-06-09 | 에프. 호프만-라 로슈 아게 | Anti-human epo receptor antibodies and methods of use |
WO2013055873A1 (en) | 2011-10-14 | 2013-04-18 | Amgen Inc. | Injector and method of assembly |
EP3045190A1 (en) | 2011-10-14 | 2016-07-20 | Amgen, Inc | Injector and method of assembly |
EP3744371A1 (en) | 2011-10-14 | 2020-12-02 | Amgen, Inc | Injector and method of assembly |
EP3045189A1 (en) | 2011-10-14 | 2016-07-20 | Amgen, Inc | Injector and method of assembly |
EP3335747A1 (en) | 2011-10-14 | 2018-06-20 | Amgen Inc. | Injector and method of assembly |
EP3269413A1 (en) | 2011-10-14 | 2018-01-17 | Amgen, Inc | Injector and method of assembly |
EP3045187A1 (en) | 2011-10-14 | 2016-07-20 | Amgen, Inc | Injector and method of assembly |
EP3045188A1 (en) | 2011-10-14 | 2016-07-20 | Amgen, Inc | Injector and method of assembly |
US10682474B2 (en) | 2012-11-21 | 2020-06-16 | Amgen Inc. | Drug delivery device |
US11344681B2 (en) | 2012-11-21 | 2022-05-31 | Amgen Inc. | Drug delivery device |
EP4234694A2 (en) | 2012-11-21 | 2023-08-30 | Amgen Inc. | Drug delivery device |
EP3072548A1 (en) | 2012-11-21 | 2016-09-28 | Amgen, Inc | Drug delivery device |
EP3081249A1 (en) | 2012-11-21 | 2016-10-19 | Amgen, Inc | Drug delivery device |
US11458247B2 (en) | 2012-11-21 | 2022-10-04 | Amgen Inc. | Drug delivery device |
EP3656426A1 (en) | 2012-11-21 | 2020-05-27 | Amgen, Inc | Drug delivery device |
US11439745B2 (en) | 2012-11-21 | 2022-09-13 | Amgen Inc. | Drug delivery device |
WO2014081780A1 (en) | 2012-11-21 | 2014-05-30 | Amgen Inc. | Drug delivery device |
US9657098B2 (en) | 2013-03-15 | 2017-05-23 | Intrinsic Lifesciences, Llc | Anti-hepcidin antibodies and uses thereof |
WO2014144096A1 (en) | 2013-03-15 | 2014-09-18 | Amgen Inc. | Drug cassette, autoinjector, and autoinjector system |
EP3593839A1 (en) | 2013-03-15 | 2020-01-15 | Amgen Inc. | Drug cassette |
US9803011B2 (en) | 2013-03-15 | 2017-10-31 | Intrinsic Lifesciences Llc | Anti-hepcidin antibodies and uses thereof |
US10239941B2 (en) | 2013-03-15 | 2019-03-26 | Intrinsic Lifesciences Llc | Anti-hepcidin antibodies and uses thereof |
WO2014149357A1 (en) | 2013-03-22 | 2014-09-25 | Amgen Inc. | Injector and method of assembly |
EP3831427A1 (en) | 2013-03-22 | 2021-06-09 | Amgen Inc. | Injector and method of assembly |
EP3789064A1 (en) | 2013-10-24 | 2021-03-10 | Amgen, Inc | Injector and method of assembly |
EP3501575A1 (en) | 2013-10-24 | 2019-06-26 | Amgen, Inc | Drug delivery system with temperature-sensitive-control |
WO2015061389A1 (en) | 2013-10-24 | 2015-04-30 | Amgen Inc. | Drug delivery system with temperature-sensitive control |
WO2015061386A1 (en) | 2013-10-24 | 2015-04-30 | Amgen Inc. | Injector and method of assembly |
EP3421066A1 (en) | 2013-10-24 | 2019-01-02 | Amgen, Inc | Injector and method of assembly |
WO2015119906A1 (en) | 2014-02-05 | 2015-08-13 | Amgen Inc. | Drug delivery system with electromagnetic field generator |
EP3785749A1 (en) | 2014-05-07 | 2021-03-03 | Amgen Inc. | Autoinjector with shock reducing elements |
WO2015171777A1 (en) | 2014-05-07 | 2015-11-12 | Amgen Inc. | Autoinjector with shock reducing elements |
US11738146B2 (en) | 2014-06-03 | 2023-08-29 | Amgen Inc. | Drug delivery system and method of use |
EP4036924A1 (en) | 2014-06-03 | 2022-08-03 | Amgen, Inc | Devices and methods for assisting a user of a drug delivery device |
WO2015187797A1 (en) | 2014-06-03 | 2015-12-10 | Amgen Inc. | Controllable drug delivery system and method of use |
WO2015187799A1 (en) | 2014-06-03 | 2015-12-10 | Amgen Inc. | Systems and methods for remotely processing data collected by a drug delivery device |
WO2015187793A1 (en) | 2014-06-03 | 2015-12-10 | Amgen Inc. | Drug delivery system and method of use |
US11213624B2 (en) | 2014-06-03 | 2022-01-04 | Amgen Inc. | Controllable drug delivery system and method of use |
EP4362039A2 (en) | 2014-06-03 | 2024-05-01 | Amgen Inc. | Controllable drug delivery system and method of use |
WO2016049036A1 (en) | 2014-09-22 | 2016-03-31 | Intrinsic Lifesciences Llc | Humanized anti-hepcidin antibodies and uses thereof |
US10323088B2 (en) | 2014-09-22 | 2019-06-18 | Intrinsic Lifesciences Llc | Humanized anti-hepcidin antibodies and uses thereof |
WO2016061220A2 (en) | 2014-10-14 | 2016-04-21 | Amgen Inc. | Drug injection device with visual and audio indicators |
EP3943135A2 (en) | 2014-10-14 | 2022-01-26 | Amgen Inc. | Drug injection device with visual and audible indicators |
EP3848072A1 (en) | 2014-12-19 | 2021-07-14 | Amgen Inc. | Drug delivery device with proximity sensor |
EP3689394A1 (en) | 2014-12-19 | 2020-08-05 | Amgen Inc. | Drug delivery device with live button or user interface field |
US10765801B2 (en) | 2014-12-19 | 2020-09-08 | Amgen Inc. | Drug delivery device with proximity sensor |
US10799630B2 (en) | 2014-12-19 | 2020-10-13 | Amgen Inc. | Drug delivery device with proximity sensor |
WO2016100781A1 (en) | 2014-12-19 | 2016-06-23 | Amgen Inc. | Drug delivery device with proximity sensor |
US11944794B2 (en) | 2014-12-19 | 2024-04-02 | Amgen Inc. | Drug delivery device with proximity sensor |
US11357916B2 (en) | 2014-12-19 | 2022-06-14 | Amgen Inc. | Drug delivery device with live button or user interface field |
WO2016100055A1 (en) | 2014-12-19 | 2016-06-23 | Amgen Inc. | Drug delivery device with live button or user interface field |
EP3556411A1 (en) | 2015-02-17 | 2019-10-23 | Amgen Inc. | Drug delivery device with vacuum assisted securement and/or feedback |
EP3981450A1 (en) | 2015-02-27 | 2022-04-13 | Amgen, Inc | Drug delivery device having a needle guard mechanism with a tunable threshold of resistance to needle guard movement |
WO2017039786A1 (en) | 2015-09-02 | 2017-03-09 | Amgen Inc. | Syringe assembly adapter for a syringe |
WO2017100501A1 (en) | 2015-12-09 | 2017-06-15 | Amgen Inc. | Auto-injector with signaling cap |
WO2017120178A1 (en) | 2016-01-06 | 2017-07-13 | Amgen Inc. | Auto-injector with signaling electronics |
WO2017160799A1 (en) | 2016-03-15 | 2017-09-21 | Amgen Inc. | Reducing probability of glass breakage in drug delivery devices |
EP3721922A1 (en) | 2016-03-15 | 2020-10-14 | Amgen Inc. | Reducing probability of glass breakage in drug delivery devices |
EP4035711A1 (en) | 2016-03-15 | 2022-08-03 | Amgen Inc. | Reducing probability of glass breakage in drug delivery devices |
WO2017189089A1 (en) | 2016-04-29 | 2017-11-02 | Amgen Inc. | Drug delivery device with messaging label |
WO2017192287A1 (en) | 2016-05-02 | 2017-11-09 | Amgen Inc. | Syringe adapter and guide for filling an on-body injector |
WO2017197222A1 (en) | 2016-05-13 | 2017-11-16 | Amgen Inc. | Vial sleeve assembly |
WO2017200989A1 (en) | 2016-05-16 | 2017-11-23 | Amgen Inc. | Data encryption in medical devices with limited computational capability |
WO2017209899A1 (en) | 2016-06-03 | 2017-12-07 | Amgen Inc. | Impact testing apparatuses and methods for drug delivery devices |
WO2018004842A1 (en) | 2016-07-01 | 2018-01-04 | Amgen Inc. | Drug delivery device having minimized risk of component fracture upon impact events |
WO2018034784A1 (en) | 2016-08-17 | 2018-02-22 | Amgen Inc. | Drug delivery device with placement detection |
WO2018081234A1 (en) | 2016-10-25 | 2018-05-03 | Amgen Inc. | On-body injector |
WO2018136398A1 (en) | 2017-01-17 | 2018-07-26 | Amgen Inc. | Injection devices and related methods of use and assembly |
WO2018152073A1 (en) | 2017-02-17 | 2018-08-23 | Amgen Inc. | Insertion mechanism for drug delivery device |
WO2018151890A1 (en) | 2017-02-17 | 2018-08-23 | Amgen Inc. | Drug delivery device with sterile fluid flowpath and related method of assembly |
WO2018165143A1 (en) | 2017-03-06 | 2018-09-13 | Amgen Inc. | Drug delivery device with activation prevention feature |
WO2018164829A1 (en) | 2017-03-07 | 2018-09-13 | Amgen Inc. | Needle insertion by overpressure |
WO2018165499A1 (en) | 2017-03-09 | 2018-09-13 | Amgen Inc. | Insertion mechanism for drug delivery device |
WO2018172219A1 (en) | 2017-03-20 | 2018-09-27 | F. Hoffmann-La Roche Ag | Method for in vitro glycoengineering of an erythropoiesis stimulating protein |
EP4241807A2 (en) | 2017-03-28 | 2023-09-13 | Amgen Inc. | Plunger rod and syringe assembly system and method |
WO2018183039A1 (en) | 2017-03-28 | 2018-10-04 | Amgen Inc. | Plunger rod and syringe assembly system and method |
WO2018226515A1 (en) | 2017-06-08 | 2018-12-13 | Amgen Inc. | Syringe assembly for a drug delivery device and method of assembly |
WO2018226565A1 (en) | 2017-06-08 | 2018-12-13 | Amgen Inc. | Torque driven drug delivery device |
WO2018236619A1 (en) | 2017-06-22 | 2018-12-27 | Amgen Inc. | Device activation impact/shock reduction |
WO2018237225A1 (en) | 2017-06-23 | 2018-12-27 | Amgen Inc. | Electronic drug delivery device comprising a cap activated by a switch assembly |
WO2019014014A1 (en) | 2017-07-14 | 2019-01-17 | Amgen Inc. | Needle insertion-retraction system having dual torsion spring system |
EP4292576A2 (en) | 2017-07-21 | 2023-12-20 | Amgen Inc. | Gas permeable sealing member for drug container and methods of assembly |
WO2019018169A1 (en) | 2017-07-21 | 2019-01-24 | Amgen Inc. | Gas permeable sealing member for drug container and methods of assembly |
WO2019022950A1 (en) | 2017-07-25 | 2019-01-31 | Amgen Inc. | Drug delivery device with container access system and related method of assembly |
WO2019022951A1 (en) | 2017-07-25 | 2019-01-31 | Amgen Inc. | Drug delivery device with gear module and related method of assembly |
EP4085942A1 (en) | 2017-07-25 | 2022-11-09 | Amgen Inc. | Drug delivery device with gear module and related method of assembly |
WO2019032482A2 (en) | 2017-08-09 | 2019-02-14 | Amgen Inc. | Hydraulic-pneumatic pressurized chamber drug delivery system |
WO2019036181A1 (en) | 2017-08-18 | 2019-02-21 | Amgen Inc. | Wearable injector with sterile adhesive patch |
WO2019040548A1 (en) | 2017-08-22 | 2019-02-28 | Amgen Inc. | Needle insertion mechanism for drug delivery device |
WO2019070472A1 (en) | 2017-10-04 | 2019-04-11 | Amgen Inc. | Flow adapter for drug delivery device |
EP4257164A2 (en) | 2017-10-06 | 2023-10-11 | Amgen Inc. | Drug delivery device with interlock assembly and related method of assembly |
WO2019070552A1 (en) | 2017-10-06 | 2019-04-11 | Amgen Inc. | Drug delivery device with interlock assembly and related method of assembly |
WO2019074579A1 (en) | 2017-10-09 | 2019-04-18 | Amgen Inc. | Drug delivery device with drive assembly and related method of assembly |
WO2019090086A1 (en) | 2017-11-03 | 2019-05-09 | Amgen Inc. | Systems and approaches for sterilizing a drug delivery device |
WO2019090079A1 (en) | 2017-11-03 | 2019-05-09 | Amgen Inc. | System and approaches for sterilizing a drug delivery device |
WO2019090303A1 (en) | 2017-11-06 | 2019-05-09 | Amgen Inc. | Fill-finish assemblies and related methods |
WO2019089178A1 (en) | 2017-11-06 | 2019-05-09 | Amgen Inc. | Drug delivery device with placement and flow sensing |
WO2019094138A1 (en) | 2017-11-10 | 2019-05-16 | Amgen Inc. | Plungers for drug delivery devices |
WO2019099324A1 (en) | 2017-11-16 | 2019-05-23 | Amgen Inc. | Door latch mechanism for drug delivery device |
WO2019099322A1 (en) | 2017-11-16 | 2019-05-23 | Amgen Inc. | Autoinjector with stall and end point detection |
WO2019231582A1 (en) | 2018-05-30 | 2019-12-05 | Amgen Inc. | Thermal spring release mechanism for a drug delivery device |
WO2019231618A1 (en) | 2018-06-01 | 2019-12-05 | Amgen Inc. | Modular fluid path assemblies for drug delivery devices |
WO2020023336A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Hybrid drug delivery devices with grip portion |
WO2020023444A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Delivery devices for administering drugs |
WO2020023220A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Hybrid drug delivery devices with tacky skin attachment portion and related method of preparation |
WO2020023451A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Delivery devices for administering drugs |
WO2020028009A1 (en) | 2018-07-31 | 2020-02-06 | Amgen Inc. | Fluid path assembly for a drug delivery device |
WO2020068623A1 (en) | 2018-09-24 | 2020-04-02 | Amgen Inc. | Interventional dosing systems and methods |
WO2020068476A1 (en) | 2018-09-28 | 2020-04-02 | Amgen Inc. | Muscle wire escapement activation assembly for a drug delivery device |
WO2020072577A1 (en) | 2018-10-02 | 2020-04-09 | Amgen Inc. | Injection systems for drug delivery with internal force transmission |
WO2020072846A1 (en) | 2018-10-05 | 2020-04-09 | Amgen Inc. | Drug delivery device having dose indicator |
WO2020081480A1 (en) | 2018-10-15 | 2020-04-23 | Amgen Inc. | Platform assembly process for drug delivery device |
WO2020081479A1 (en) | 2018-10-15 | 2020-04-23 | Amgen Inc. | Drug delivery device having damping mechanism |
WO2020091956A1 (en) | 2018-11-01 | 2020-05-07 | Amgen Inc. | Drug delivery devices with partial drug delivery member retraction |
WO2020091981A1 (en) | 2018-11-01 | 2020-05-07 | Amgen Inc. | Drug delivery devices with partial drug delivery member retraction |
WO2020092056A1 (en) | 2018-11-01 | 2020-05-07 | Amgen Inc. | Drug delivery devices with partial needle retraction |
WO2020219482A1 (en) | 2019-04-24 | 2020-10-29 | Amgen Inc. | Syringe sterilization verification assemblies and methods |
WO2021041067A2 (en) | 2019-08-23 | 2021-03-04 | Amgen Inc. | Drug delivery device with configurable needle shield engagement components and related methods |
WO2022246055A1 (en) | 2021-05-21 | 2022-11-24 | Amgen Inc. | Method of optimizing a filling recipe for a drug container |
Also Published As
Publication number | Publication date |
---|---|
TWI320716B (en) | 2010-02-21 |
BR0315275A (en) | 2005-08-30 |
AU2003282588A1 (en) | 2004-05-04 |
JP2006523083A (en) | 2006-10-12 |
EP1578779A2 (en) | 2005-09-28 |
MXPA05003997A (en) | 2005-06-22 |
CN103524618A (en) | 2014-01-22 |
WO2004035603A3 (en) | 2006-04-27 |
AU2003282588B2 (en) | 2010-06-03 |
ZA201004902B (en) | 2012-06-27 |
KR20050059263A (en) | 2005-06-17 |
CA2501984C (en) | 2011-04-26 |
JP4411472B2 (en) | 2010-02-10 |
AU2010214778A1 (en) | 2010-09-23 |
JP2009149665A (en) | 2009-07-09 |
NZ539263A (en) | 2009-07-31 |
PL379985A1 (en) | 2006-11-27 |
EP1578779A4 (en) | 2011-11-16 |
CA2501984A1 (en) | 2004-04-29 |
TW200418505A (en) | 2004-10-01 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2003282588B2 (en) | Erythropoietin receptor binding antibodies | |
US7396913B2 (en) | Erythropoietin receptor binding antibodies | |
US20220002428A1 (en) | Binding molecules to the human ox40 receptor | |
EP1732950B1 (en) | Antibodies to erythropoietin receptor and uses thereof | |
US20040071694A1 (en) | Erythropoietin receptor binding antibodies | |
US20060018902A1 (en) | Antibodies to erythropoietin receptor and uses thereof | |
CN115515625A (en) | Novel antibody specifically binding to human CEACAM1/3/5 and application thereof | |
CA3196930A1 (en) | Novel anti-claudin18 antibodies | |
AU2014202213A1 (en) | Binding Molecules to the Human OX40 Receptor |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG UZ VC VN YU ZA ZM ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
WWE | Wipo information: entry into national phase |
Ref document number: 167875 Country of ref document: IL |
|
WWE | Wipo information: entry into national phase |
Ref document number: 539263 Country of ref document: NZ |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2501984 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2004544846 Country of ref document: JP Ref document number: 200502981 Country of ref document: ZA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 1020057006487 Country of ref document: KR Ref document number: 2003282588 Country of ref document: AU Ref document number: PA/a/2005/003997 Country of ref document: MX |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2003774776 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2062/DELNP/2005 Country of ref document: IN |
|
WWE | Wipo information: entry into national phase |
Ref document number: 20038A60796 Country of ref document: CN |
|
WWP | Wipo information: published in national office |
Ref document number: 1020057006487 Country of ref document: KR |
|
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
WWP | Wipo information: published in national office |
Ref document number: 2003774776 Country of ref document: EP |