US20230406935A1 - Fc binding fragments comprising a pd-l1 antigen-binding site - Google Patents
Fc binding fragments comprising a pd-l1 antigen-binding site Download PDFInfo
- Publication number
- US20230406935A1 US20230406935A1 US18/063,521 US202218063521A US2023406935A1 US 20230406935 A1 US20230406935 A1 US 20230406935A1 US 202218063521 A US202218063521 A US 202218063521A US 2023406935 A1 US2023406935 A1 US 2023406935A1
- Authority
- US
- United States
- Prior art keywords
- sequence
- seq
- domain
- amino acid
- specific binding
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 230000027455 binding Effects 0.000 title claims abstract description 227
- 239000000427 antigen Substances 0.000 title claims abstract description 143
- 102000036639 antigens Human genes 0.000 title claims abstract description 143
- 108091007433 antigens Proteins 0.000 title claims abstract description 143
- 239000012634 fragment Substances 0.000 title claims description 52
- 108010074708 B7-H1 Antigen Proteins 0.000 claims abstract description 252
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 64
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 301
- 235000001014 amino acid Nutrition 0.000 claims description 256
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 claims description 251
- 229940024606 amino acid Drugs 0.000 claims description 250
- 150000001413 amino acids Chemical class 0.000 claims description 56
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 claims description 53
- 238000012217 deletion Methods 0.000 claims description 39
- 230000037430 deletion Effects 0.000 claims description 39
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 claims description 38
- 235000003704 aspartic acid Nutrition 0.000 claims description 36
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 claims description 36
- 108060003951 Immunoglobulin Proteins 0.000 claims description 34
- 102000018358 immunoglobulin Human genes 0.000 claims description 34
- 235000004279 alanine Nutrition 0.000 claims description 32
- 230000002998 immunogenetic effect Effects 0.000 claims description 32
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 claims description 30
- 239000004471 Glycine Substances 0.000 claims description 28
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 26
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 claims description 25
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 claims description 23
- 229910052739 hydrogen Inorganic materials 0.000 claims description 23
- 229930182817 methionine Natural products 0.000 claims description 21
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 claims description 20
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 claims description 20
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 claims description 20
- 235000009582 asparagine Nutrition 0.000 claims description 20
- 229960001230 asparagine Drugs 0.000 claims description 20
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 claims description 17
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 claims description 16
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 claims description 16
- 125000000539 amino acid group Chemical group 0.000 claims description 15
- 235000013922 glutamic acid Nutrition 0.000 claims description 15
- 239000004220 glutamic acid Substances 0.000 claims description 15
- 239000004474 valine Substances 0.000 claims description 15
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 claims description 13
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 claims description 12
- 210000000987 immune system Anatomy 0.000 claims description 12
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 claims description 11
- 229910052757 nitrogen Inorganic materials 0.000 claims description 8
- 102100021317 Inducible T-cell costimulator Human genes 0.000 claims description 7
- 101710205775 Inducible T-cell costimulator Proteins 0.000 claims description 7
- 231100000433 cytotoxic Toxicity 0.000 claims description 7
- 230000001472 cytotoxic effect Effects 0.000 claims description 7
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 claims description 6
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 claims description 6
- 230000000139 costimulatory effect Effects 0.000 claims description 5
- 229910052698 phosphorus Inorganic materials 0.000 claims description 4
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 claims description 2
- 230000009870 specific binding Effects 0.000 abstract description 458
- 238000011282 treatment Methods 0.000 abstract description 41
- 201000011510 cancer Diseases 0.000 abstract description 38
- 206010061218 Inflammation Diseases 0.000 abstract description 23
- 230000004054 inflammatory process Effects 0.000 abstract description 23
- 208000035473 Communicable disease Diseases 0.000 abstract description 18
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 18
- 201000010099 disease Diseases 0.000 abstract description 17
- 208000027866 inflammatory disease Diseases 0.000 abstract description 11
- 102000008096 B7-H1 Antigen Human genes 0.000 abstract 3
- 210000004027 cell Anatomy 0.000 description 174
- 238000003556 assay Methods 0.000 description 120
- 230000035772 mutation Effects 0.000 description 98
- 101001117317 Homo sapiens Programmed cell death 1 ligand 1 Proteins 0.000 description 77
- 102000048776 human CD274 Human genes 0.000 description 75
- 230000000694 effects Effects 0.000 description 73
- 238000000034 method Methods 0.000 description 61
- 230000006044 T cell activation Effects 0.000 description 55
- 230000000903 blocking effect Effects 0.000 description 49
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 48
- 102100024952 Protein CBFA2T1 Human genes 0.000 description 47
- 210000001744 T-lymphocyte Anatomy 0.000 description 42
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 41
- 230000004075 alteration Effects 0.000 description 40
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 35
- 238000006467 substitution reaction Methods 0.000 description 33
- 239000013641 positive control Substances 0.000 description 30
- 108090000623 proteins and genes Proteins 0.000 description 29
- 235000018102 proteins Nutrition 0.000 description 27
- 102000004169 proteins and genes Human genes 0.000 description 27
- 229940045513 CTLA4 antagonist Drugs 0.000 description 25
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 24
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 24
- 101000611936 Homo sapiens Programmed cell death protein 1 Proteins 0.000 description 23
- 230000003993 interaction Effects 0.000 description 23
- 239000000203 mixture Substances 0.000 description 23
- 238000002844 melting Methods 0.000 description 22
- 230000008018 melting Effects 0.000 description 22
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 21
- 230000014509 gene expression Effects 0.000 description 21
- 230000004048 modification Effects 0.000 description 21
- 238000012986 modification Methods 0.000 description 21
- 239000013598 vector Substances 0.000 description 21
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 20
- 102000008203 CTLA-4 Antigen Human genes 0.000 description 20
- 239000003814 drug Substances 0.000 description 20
- 238000005516 engineering process Methods 0.000 description 20
- 230000009824 affinity maturation Effects 0.000 description 17
- 238000004458 analytical method Methods 0.000 description 17
- 239000006228 supernatant Substances 0.000 description 17
- 230000005714 functional activity Effects 0.000 description 15
- 102000048362 human PDCD1 Human genes 0.000 description 15
- 230000006872 improvement Effects 0.000 description 15
- 238000001542 size-exclusion chromatography Methods 0.000 description 15
- 239000004475 Arginine Substances 0.000 description 14
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 14
- 229960005386 ipilimumab Drugs 0.000 description 14
- 239000002246 antineoplastic agent Substances 0.000 description 13
- 238000004519 manufacturing process Methods 0.000 description 13
- 238000012216 screening Methods 0.000 description 13
- 108010002350 Interleukin-2 Proteins 0.000 description 12
- 102000000588 Interleukin-2 Human genes 0.000 description 12
- 239000003795 chemical substances by application Substances 0.000 description 12
- 238000002703 mutagenesis Methods 0.000 description 12
- 231100000350 mutagenesis Toxicity 0.000 description 12
- 238000004806 packaging method and process Methods 0.000 description 12
- 238000002560 therapeutic procedure Methods 0.000 description 12
- 230000002776 aggregation Effects 0.000 description 11
- 238000004220 aggregation Methods 0.000 description 11
- 210000003719 b-lymphocyte Anatomy 0.000 description 11
- 238000010790 dilution Methods 0.000 description 11
- 239000012895 dilution Substances 0.000 description 11
- 102000054189 human CD80 Human genes 0.000 description 11
- 230000001965 increasing effect Effects 0.000 description 11
- 208000015181 infectious disease Diseases 0.000 description 11
- 238000012360 testing method Methods 0.000 description 11
- 229940124597 therapeutic agent Drugs 0.000 description 11
- 229940127089 cytotoxic agent Drugs 0.000 description 10
- 108020004414 DNA Proteins 0.000 description 9
- 238000002965 ELISA Methods 0.000 description 9
- 101001117316 Mus musculus Programmed cell death 1 ligand 1 Proteins 0.000 description 9
- 238000002474 experimental method Methods 0.000 description 9
- 230000028993 immune response Effects 0.000 description 9
- 239000002609 medium Substances 0.000 description 9
- 108020004707 nucleic acids Proteins 0.000 description 9
- 102000039446 nucleic acids Human genes 0.000 description 9
- 150000007523 nucleic acids Chemical class 0.000 description 9
- 230000002829 reductive effect Effects 0.000 description 9
- 102000004127 Cytokines Human genes 0.000 description 8
- 108090000695 Cytokines Proteins 0.000 description 8
- 241000699666 Mus <mouse, genus> Species 0.000 description 8
- 229930182555 Penicillin Natural products 0.000 description 8
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 8
- 108010090804 Streptavidin Proteins 0.000 description 8
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 8
- 239000004473 Threonine Substances 0.000 description 8
- 241000700605 Viruses Species 0.000 description 8
- 239000012867 bioactive agent Substances 0.000 description 8
- 238000012512 characterization method Methods 0.000 description 8
- 239000002955 immunomodulating agent Substances 0.000 description 8
- 239000003446 ligand Substances 0.000 description 8
- 201000001441 melanoma Diseases 0.000 description 8
- 229940049954 penicillin Drugs 0.000 description 8
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 8
- 239000008194 pharmaceutical composition Substances 0.000 description 8
- 108090000765 processed proteins & peptides Proteins 0.000 description 8
- 238000001525 receptor binding assay Methods 0.000 description 8
- 230000009467 reduction Effects 0.000 description 8
- 230000004044 response Effects 0.000 description 8
- 238000002255 vaccination Methods 0.000 description 8
- 206010005003 Bladder cancer Diseases 0.000 description 7
- 206010006187 Breast cancer Diseases 0.000 description 7
- 208000026310 Breast neoplasm Diseases 0.000 description 7
- 101000867232 Escherichia coli Heat-stable enterotoxin II Proteins 0.000 description 7
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 7
- 206010047115 Vasculitis Diseases 0.000 description 7
- 238000007792 addition Methods 0.000 description 7
- 230000008901 benefit Effects 0.000 description 7
- 239000000872 buffer Substances 0.000 description 7
- 231100000655 enterotoxin Toxicity 0.000 description 7
- 239000013604 expression vector Substances 0.000 description 7
- 238000003780 insertion Methods 0.000 description 7
- 230000037431 insertion Effects 0.000 description 7
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 7
- 244000052769 pathogen Species 0.000 description 7
- 201000005112 urinary bladder cancer Diseases 0.000 description 7
- 108010073807 IgG Receptors Proteins 0.000 description 6
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 6
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 6
- 239000012515 MabSelect SuRe Substances 0.000 description 6
- 208000005718 Stomach Neoplasms Diseases 0.000 description 6
- QTENRWWVYAAPBI-YZTFXSNBSA-N Streptomycin sulfate Chemical compound OS(O)(=O)=O.OS(O)(=O)=O.OS(O)(=O)=O.CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@H]1[C@H](N=C(N)N)[C@@H](O)[C@H](N=C(N)N)[C@@H](O)[C@@H]1O.CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@H]1[C@H](N=C(N)N)[C@@H](O)[C@H](N=C(N)N)[C@@H](O)[C@@H]1O QTENRWWVYAAPBI-YZTFXSNBSA-N 0.000 description 6
- 108091008874 T cell receptors Proteins 0.000 description 6
- 239000011324 bead Substances 0.000 description 6
- 229940022399 cancer vaccine Drugs 0.000 description 6
- 230000000295 complement effect Effects 0.000 description 6
- 238000010276 construction Methods 0.000 description 6
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 6
- 238000001794 hormone therapy Methods 0.000 description 6
- 230000005764 inhibitory process Effects 0.000 description 6
- 230000001404 mediated effect Effects 0.000 description 6
- 210000001616 monocyte Anatomy 0.000 description 6
- 230000000869 mutational effect Effects 0.000 description 6
- 244000309459 oncolytic virus Species 0.000 description 6
- 230000001717 pathogenic effect Effects 0.000 description 6
- 239000008188 pellet Substances 0.000 description 6
- 238000000159 protein binding assay Methods 0.000 description 6
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 230000008685 targeting Effects 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 230000003612 virological effect Effects 0.000 description 6
- 206010009944 Colon cancer Diseases 0.000 description 5
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 5
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 5
- 102000009490 IgG Receptors Human genes 0.000 description 5
- 102100020862 Lymphocyte activation gene 3 protein Human genes 0.000 description 5
- 241001529936 Murinae Species 0.000 description 5
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 5
- 206010033128 Ovarian cancer Diseases 0.000 description 5
- 206010061535 Ovarian neoplasm Diseases 0.000 description 5
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 5
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 5
- 208000006011 Stroke Diseases 0.000 description 5
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 5
- 230000004913 activation Effects 0.000 description 5
- 239000000556 agonist Substances 0.000 description 5
- 230000000259 anti-tumor effect Effects 0.000 description 5
- 210000000612 antigen-presenting cell Anatomy 0.000 description 5
- 238000013459 approach Methods 0.000 description 5
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 5
- 238000000423 cell based assay Methods 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 230000001684 chronic effect Effects 0.000 description 5
- 239000000539 dimer Substances 0.000 description 5
- 206010017758 gastric cancer Diseases 0.000 description 5
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 5
- 238000002955 isolation Methods 0.000 description 5
- 230000036515 potency Effects 0.000 description 5
- 230000003389 potentiating effect Effects 0.000 description 5
- 102000005962 receptors Human genes 0.000 description 5
- 108020003175 receptors Proteins 0.000 description 5
- 238000009097 single-agent therapy Methods 0.000 description 5
- 201000011549 stomach cancer Diseases 0.000 description 5
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 5
- 210000001519 tissue Anatomy 0.000 description 5
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 5
- 125000002987 valine group Chemical group [H]N([H])C([H])(C(*)=O)C([H])(C([H])([H])[H])C([H])([H])[H] 0.000 description 5
- 241000894006 Bacteria Species 0.000 description 4
- 208000035143 Bacterial infection Diseases 0.000 description 4
- -1 CEACAM Proteins 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 4
- 238000008157 ELISA kit Methods 0.000 description 4
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 4
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 4
- 101000599940 Homo sapiens Interferon gamma Proteins 0.000 description 4
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 4
- 241000725303 Human immunodeficiency virus Species 0.000 description 4
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 4
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 4
- 241000282567 Macaca fascicularis Species 0.000 description 4
- 208000002030 Merkel cell carcinoma Diseases 0.000 description 4
- 206010027406 Mesothelioma Diseases 0.000 description 4
- 101001043827 Mus musculus Interleukin-2 Proteins 0.000 description 4
- 206010029266 Neuroendocrine carcinoma of the skin Diseases 0.000 description 4
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 4
- 239000004698 Polyethylene Substances 0.000 description 4
- 208000006265 Renal cell carcinoma Diseases 0.000 description 4
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 4
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 description 4
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 4
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 4
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 4
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 239000011230 binding agent Substances 0.000 description 4
- 238000002512 chemotherapy Methods 0.000 description 4
- 208000017763 cutaneous neuroendocrine carcinoma Diseases 0.000 description 4
- 238000010494 dissociation reaction Methods 0.000 description 4
- 230000005593 dissociations Effects 0.000 description 4
- 238000002296 dynamic light scattering Methods 0.000 description 4
- 239000012737 fresh medium Substances 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- 201000010536 head and neck cancer Diseases 0.000 description 4
- 208000014829 head and neck neoplasm Diseases 0.000 description 4
- 201000000459 head and neck squamous cell carcinoma Diseases 0.000 description 4
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 4
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 210000002865 immune cell Anatomy 0.000 description 4
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 4
- 201000002528 pancreatic cancer Diseases 0.000 description 4
- 208000008443 pancreatic carcinoma Diseases 0.000 description 4
- 239000000546 pharmaceutical excipient Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 238000001959 radiotherapy Methods 0.000 description 4
- 102200098660 rs200754249 Human genes 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 238000010361 transduction Methods 0.000 description 4
- 230000026683 transduction Effects 0.000 description 4
- 230000010474 transient expression Effects 0.000 description 4
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 3
- 101150013553 CD40 gene Proteins 0.000 description 3
- 102100025597 Caspase-4 Human genes 0.000 description 3
- 241000701022 Cytomegalovirus Species 0.000 description 3
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 3
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 3
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 3
- 101000933112 Homo sapiens Caspase-4 Proteins 0.000 description 3
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 208000031888 Mycoses Diseases 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 3
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 3
- 239000007864 aqueous solution Substances 0.000 description 3
- 208000022362 bacterial infectious disease Diseases 0.000 description 3
- 230000009286 beneficial effect Effects 0.000 description 3
- 230000006287 biotinylation Effects 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 3
- 238000012937 correction Methods 0.000 description 3
- 238000012258 culturing Methods 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 239000012636 effector Substances 0.000 description 3
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 3
- 208000005017 glioblastoma Diseases 0.000 description 3
- 229940098197 human immunoglobulin g Drugs 0.000 description 3
- 230000002519 immonomodulatory effect Effects 0.000 description 3
- 238000009169 immunotherapy Methods 0.000 description 3
- 208000032839 leukemia Diseases 0.000 description 3
- 230000007774 longterm Effects 0.000 description 3
- 201000005202 lung cancer Diseases 0.000 description 3
- 208000020816 lung neoplasm Diseases 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 230000035800 maturation Effects 0.000 description 3
- 230000001394 metastastic effect Effects 0.000 description 3
- 206010061289 metastatic neoplasm Diseases 0.000 description 3
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 3
- 230000036961 partial effect Effects 0.000 description 3
- 229920001184 polypeptide Polymers 0.000 description 3
- 229920000136 polysorbate Polymers 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 229950010131 puromycin Drugs 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 150000003384 small molecules Chemical class 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 206010044412 transitional cell carcinoma Diseases 0.000 description 3
- 210000004881 tumor cell Anatomy 0.000 description 3
- 208000023747 urothelial carcinoma Diseases 0.000 description 3
- OZFAFGSSMRRTDW-UHFFFAOYSA-N (2,4-dichlorophenyl) benzenesulfonate Chemical compound ClC1=CC(Cl)=CC=C1OS(=O)(=O)C1=CC=CC=C1 OZFAFGSSMRRTDW-UHFFFAOYSA-N 0.000 description 2
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 2
- 102100022464 5'-nucleotidase Human genes 0.000 description 2
- QCVGEOXPDFCNHA-UHFFFAOYSA-N 5,5-dimethyl-2,4-dioxo-1,3-oxazolidine-3-carboxamide Chemical compound CC1(C)OC(=O)N(C(N)=O)C1=O QCVGEOXPDFCNHA-UHFFFAOYSA-N 0.000 description 2
- 208000003950 B-cell lymphoma Diseases 0.000 description 2
- 102100038078 CD276 antigen Human genes 0.000 description 2
- 101710185679 CD276 antigen Proteins 0.000 description 2
- 102000000844 Cell Surface Receptors Human genes 0.000 description 2
- 108010001857 Cell Surface Receptors Proteins 0.000 description 2
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 2
- 108010000912 Egg Proteins Proteins 0.000 description 2
- 102000002322 Egg Proteins Human genes 0.000 description 2
- 206010014733 Endometrial cancer Diseases 0.000 description 2
- 206010014759 Endometrial neoplasm Diseases 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 229920001917 Ficoll Polymers 0.000 description 2
- 241000233866 Fungi Species 0.000 description 2
- 201000010915 Glioblastoma multiforme Diseases 0.000 description 2
- 102000050627 Glucocorticoid-Induced TNFR-Related Human genes 0.000 description 2
- 241000711549 Hepacivirus C Species 0.000 description 2
- 101710083479 Hepatitis A virus cellular receptor 2 homolog Proteins 0.000 description 2
- 241000700721 Hepatitis B virus Species 0.000 description 2
- 241000724675 Hepatitis E virus Species 0.000 description 2
- 208000037262 Hepatitis delta Diseases 0.000 description 2
- 241000724709 Hepatitis delta virus Species 0.000 description 2
- 241000709721 Hepatovirus A Species 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000678236 Homo sapiens 5'-nucleotidase Proteins 0.000 description 2
- 101100005713 Homo sapiens CD4 gene Proteins 0.000 description 2
- 101001002657 Homo sapiens Interleukin-2 Proteins 0.000 description 2
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 2
- 241000701074 Human alphaherpesvirus 2 Species 0.000 description 2
- GRRNUXAQVGOGFE-UHFFFAOYSA-N Hygromycin-B Natural products OC1C(NC)CC(N)C(O)C1OC1C2OC3(C(C(O)C(O)C(C(N)CO)O3)O)OC2C(O)C(CO)O1 GRRNUXAQVGOGFE-UHFFFAOYSA-N 0.000 description 2
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 2
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 2
- 102000002698 KIR Receptors Human genes 0.000 description 2
- 108010043610 KIR Receptors Proteins 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 102000043131 MHC class II family Human genes 0.000 description 2
- 108091054438 MHC class II family Proteins 0.000 description 2
- 102100028198 Macrophage colony-stimulating factor 1 receptor Human genes 0.000 description 2
- 101710150918 Macrophage colony-stimulating factor 1 receptor Proteins 0.000 description 2
- 206010064912 Malignant transformation Diseases 0.000 description 2
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 2
- 101000686985 Mouse mammary tumor virus (strain C3H) Protein PR73 Proteins 0.000 description 2
- 102000016943 Muramidase Human genes 0.000 description 2
- 108010014251 Muramidase Proteins 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 2
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 2
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 2
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 2
- 239000012661 PARP inhibitor Substances 0.000 description 2
- 208000030852 Parasitic disease Diseases 0.000 description 2
- 229940121906 Poly ADP ribose polymerase inhibitor Drugs 0.000 description 2
- 241000725643 Respiratory syncytial virus Species 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 206010041067 Small cell lung cancer Diseases 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 229940126547 T-cell immunoglobulin mucin-3 Drugs 0.000 description 2
- 229940123237 Taxane Drugs 0.000 description 2
- 102100030742 Transforming growth factor beta-1 proprotein Human genes 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 2
- 101710187882 Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 2
- 108010079206 V-Set Domain-Containing T-Cell Activation Inhibitor 1 Proteins 0.000 description 2
- 102100038929 V-set domain-containing T-cell activation inhibitor 1 Human genes 0.000 description 2
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 description 2
- 208000035868 Vascular inflammations Diseases 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 239000012190 activator Substances 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 229940100198 alkylating agent Drugs 0.000 description 2
- 239000002168 alkylating agent Substances 0.000 description 2
- 230000000118 anti-neoplastic effect Effects 0.000 description 2
- 238000011319 anticancer therapy Methods 0.000 description 2
- 230000008512 biological response Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 238000007413 biotinylation Methods 0.000 description 2
- 229930189065 blasticidin Natural products 0.000 description 2
- 210000000481 breast Anatomy 0.000 description 2
- 238000004364 calculation method Methods 0.000 description 2
- 210000003169 central nervous system Anatomy 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 238000004737 colorimetric analysis Methods 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 230000001086 cytosolic effect Effects 0.000 description 2
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 239000000032 diagnostic agent Substances 0.000 description 2
- 229940039227 diagnostic agent Drugs 0.000 description 2
- 238000002022 differential scanning fluorescence spectroscopy Methods 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 238000006471 dimerization reaction Methods 0.000 description 2
- 231100000673 dose–response relationship Toxicity 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 229950009791 durvalumab Drugs 0.000 description 2
- 235000014103 egg white Nutrition 0.000 description 2
- 210000000969 egg white Anatomy 0.000 description 2
- 229940096118 ella Drugs 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 229940088598 enzyme Drugs 0.000 description 2
- 239000002532 enzyme inhibitor Substances 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 230000007717 exclusion Effects 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 238000005734 heterodimerization reaction Methods 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 102000055277 human IL2 Human genes 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- GRRNUXAQVGOGFE-NZSRVPFOSA-N hygromycin B Chemical compound O[C@@H]1[C@@H](NC)C[C@@H](N)[C@H](O)[C@H]1O[C@H]1[C@H]2O[C@@]3([C@@H]([C@@H](O)[C@@H](O)[C@@H](C(N)CO)O3)O)O[C@H]2[C@@H](O)[C@@H](CO)O1 GRRNUXAQVGOGFE-NZSRVPFOSA-N 0.000 description 2
- 229940097277 hygromycin b Drugs 0.000 description 2
- 230000005746 immune checkpoint blockade Effects 0.000 description 2
- 230000003832 immune regulation Effects 0.000 description 2
- 230000008629 immune suppression Effects 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 229940027941 immunoglobulin g Drugs 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 229960000274 lysozyme Drugs 0.000 description 2
- 239000004325 lysozyme Substances 0.000 description 2
- 235000010335 lysozyme Nutrition 0.000 description 2
- 230000036212 malign transformation Effects 0.000 description 2
- 238000013507 mapping Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 230000033607 mismatch repair Effects 0.000 description 2
- 238000007799 mixed lymphocyte reaction assay Methods 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 210000000066 myeloid cell Anatomy 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 238000007857 nested PCR Methods 0.000 description 2
- 229940127073 nucleoside analogue Drugs 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 210000001428 peripheral nervous system Anatomy 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 150000003057 platinum Chemical class 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 2
- 208000000587 small cell lung carcinoma Diseases 0.000 description 2
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 235000011149 sulphuric acid Nutrition 0.000 description 2
- 239000001117 sulphuric acid Substances 0.000 description 2
- 231100000617 superantigen Toxicity 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 230000002195 synergetic effect Effects 0.000 description 2
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 2
- 238000004448 titration Methods 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 229940121358 tyrosine kinase inhibitor Drugs 0.000 description 2
- 239000005483 tyrosine kinase inhibitor Substances 0.000 description 2
- OOLLAFOLCSJHRE-ZHAKMVSLSA-N ulipristal acetate Chemical compound C1=CC(N(C)C)=CC=C1[C@@H]1C2=C3CCC(=O)C=C3CC[C@H]2[C@H](CC[C@]2(OC(C)=O)C(C)=O)[C@]2(C)C1 OOLLAFOLCSJHRE-ZHAKMVSLSA-N 0.000 description 2
- 241000712461 unidentified influenza virus Species 0.000 description 2
- 238000003260 vortexing Methods 0.000 description 2
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- KKVYYGGCHJGEFJ-UHFFFAOYSA-N 1-n-(4-chlorophenyl)-6-methyl-5-n-[3-(7h-purin-6-yl)pyridin-2-yl]isoquinoline-1,5-diamine Chemical compound N=1C=CC2=C(NC=3C(=CC=CN=3)C=3C=4N=CNC=4N=CN=3)C(C)=CC=C2C=1NC1=CC=C(Cl)C=C1 KKVYYGGCHJGEFJ-UHFFFAOYSA-N 0.000 description 1
- 108010058566 130-nm albumin-bound paclitaxel Proteins 0.000 description 1
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical class O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- 238000004780 2D liquid chromatography Methods 0.000 description 1
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 1
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 description 1
- 241000589291 Acinetobacter Species 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 239000012103 Alexa Fluor 488 Substances 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 1
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 1
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 101710149863 C-C chemokine receptor type 4 Proteins 0.000 description 1
- 102100032976 CCR4-NOT transcription complex subunit 6 Human genes 0.000 description 1
- 102100027207 CD27 antigen Human genes 0.000 description 1
- 241000321538 Candidia Species 0.000 description 1
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 108010022366 Carcinoembryonic Antigen Proteins 0.000 description 1
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 1
- 102100021396 Cell surface glycoprotein CD200 receptor 1 Human genes 0.000 description 1
- 206010051288 Central nervous system inflammation Diseases 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 241000193163 Clostridioides difficile Species 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- 229930105110 Cyclosporin A Natural products 0.000 description 1
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 1
- 108010036949 Cyclosporine Proteins 0.000 description 1
- 238000007399 DNA isolation Methods 0.000 description 1
- 108010092160 Dactinomycin Proteins 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 102000012804 EPCAM Human genes 0.000 description 1
- 101150084967 EPCAM gene Proteins 0.000 description 1
- 241000588914 Enterobacter Species 0.000 description 1
- 241000709661 Enterovirus Species 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 208000001382 Experimental Melanoma Diseases 0.000 description 1
- 108010021468 Fc gamma receptor IIA Proteins 0.000 description 1
- 108010021472 Fc gamma receptor IIB Proteins 0.000 description 1
- LLQPHQFNMLZJMP-UHFFFAOYSA-N Fentrazamide Chemical compound N1=NN(C=2C(=CC=CC=2)Cl)C(=O)N1C(=O)N(CC)C1CCCCC1 LLQPHQFNMLZJMP-UHFFFAOYSA-N 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 241000192125 Firmicutes Species 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 206010017533 Fungal infection Diseases 0.000 description 1
- 229940032072 GVAX vaccine Drugs 0.000 description 1
- 101710088083 Glomulin Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 102100032530 Glypican-3 Human genes 0.000 description 1
- 102220467517 HLA class II histocompatibility antigen, DR beta 5 chain_D99G_mutation Human genes 0.000 description 1
- 101710154606 Hemagglutinin Proteins 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 description 1
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 1
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 1
- 101000969553 Homo sapiens Cell surface glycoprotein CD200 receptor 1 Proteins 0.000 description 1
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 1
- 101001014668 Homo sapiens Glypican-3 Proteins 0.000 description 1
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 description 1
- 101000868279 Homo sapiens Leukocyte surface antigen CD47 Proteins 0.000 description 1
- 101000576802 Homo sapiens Mesothelin Proteins 0.000 description 1
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 description 1
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 101000635938 Homo sapiens Transforming growth factor beta-1 proprotein Proteins 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 1
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 1
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 1
- 102000002227 Interferon Type I Human genes 0.000 description 1
- 108010014726 Interferon Type I Proteins 0.000 description 1
- 102000003814 Interleukin-10 Human genes 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- 108090000171 Interleukin-18 Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 108010002335 Interleukin-9 Proteins 0.000 description 1
- 208000032382 Ischaemic stroke Diseases 0.000 description 1
- 101150069255 KLRC1 gene Proteins 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 1
- 239000005411 L01XE02 - Gefitinib Substances 0.000 description 1
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 1
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 1
- 208000031671 Large B-Cell Diffuse Lymphoma Diseases 0.000 description 1
- 208000004554 Leishmaniasis Diseases 0.000 description 1
- 102100032913 Leukocyte surface antigen CD47 Human genes 0.000 description 1
- 239000012097 Lipofectamine 2000 Substances 0.000 description 1
- 241000186781 Listeria Species 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 1
- 102100029205 Low affinity immunoglobulin gamma Fc region receptor II-b Human genes 0.000 description 1
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 101100404845 Macaca mulatta NKG2A gene Proteins 0.000 description 1
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 1
- 206010025654 Malignant melanoma of sites other than skin Diseases 0.000 description 1
- 208000032271 Malignant tumor of penis Diseases 0.000 description 1
- 208000025205 Mantle-Cell Lymphoma Diseases 0.000 description 1
- 102100025096 Mesothelin Human genes 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 206010027480 Metastatic malignant melanoma Diseases 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 101100381978 Mus musculus Braf gene Proteins 0.000 description 1
- 101100519207 Mus musculus Pdcd1 gene Proteins 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 230000004988 N-glycosylation Effects 0.000 description 1
- 102100022682 NKG2-A/NKG2-B type II integral membrane protein Human genes 0.000 description 1
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 description 1
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 108010006232 Neuraminidase Proteins 0.000 description 1
- 102000005348 Neuraminidase Human genes 0.000 description 1
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 1
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 208000009608 Papillomavirus Infections Diseases 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- 206010034299 Penile cancer Diseases 0.000 description 1
- 208000027190 Peripheral T-cell lymphomas Diseases 0.000 description 1
- 241000235648 Pichia Species 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 101710094000 Programmed cell death 1 ligand 1 Proteins 0.000 description 1
- 102100023832 Prolyl endopeptidase FAP Human genes 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 101710176177 Protein A56 Proteins 0.000 description 1
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 239000008156 Ringer's lactate solution Substances 0.000 description 1
- 101150036449 SIRPA gene Proteins 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- 208000033749 Small cell carcinoma of the bladder Diseases 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- 230000010782 T cell mediated cytotoxicity Effects 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 208000031672 T-Cell Peripheral Lymphoma Diseases 0.000 description 1
- 101150057140 TACSTD1 gene Proteins 0.000 description 1
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 241000223996 Toxoplasma Species 0.000 description 1
- 206010057179 Toxoplasma infections Diseases 0.000 description 1
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 1
- 101800001690 Transmembrane protein gp41 Proteins 0.000 description 1
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 1
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 108091005906 Type I transmembrane proteins Proteins 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 1
- 229930183665 actinomycin Natural products 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 230000008484 agonism Effects 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 238000013103 analytical ultracentrifugation Methods 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000010775 animal oil Substances 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 230000008485 antagonism Effects 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000001512 anti-cytomegaloviral effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 229940034982 antineoplastic agent Drugs 0.000 description 1
- 239000003972 antineoplastic antibiotic Substances 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 229960003852 atezolizumab Drugs 0.000 description 1
- 201000004988 autoimmune vasculitis Diseases 0.000 description 1
- 229950002916 avelumab Drugs 0.000 description 1
- 229960003005 axitinib Drugs 0.000 description 1
- RITAVMQDGBJQJZ-FMIVXFBMSA-N axitinib Chemical compound CNC(=O)C1=CC=CC=C1SC1=CC=C(C(\C=C\C=2N=CC=CC=2)=NN2)C2=C1 RITAVMQDGBJQJZ-FMIVXFBMSA-N 0.000 description 1
- 229960002756 azacitidine Drugs 0.000 description 1
- 238000002869 basic local alignment search tool Methods 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 230000001588 bifunctional effect Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 108091006004 biotinylated proteins Proteins 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- BMLSTPRTEKLIPM-UHFFFAOYSA-I calcium;potassium;disodium;hydrogen carbonate;dichloride;dihydroxide;hydrate Chemical compound O.[OH-].[OH-].[Na+].[Na+].[Cl-].[Cl-].[K+].[Ca+2].OC([O-])=O BMLSTPRTEKLIPM-UHFFFAOYSA-I 0.000 description 1
- ZEWYCNBZMPELPF-UHFFFAOYSA-J calcium;potassium;sodium;2-hydroxypropanoic acid;sodium;tetrachloride Chemical compound [Na].[Na+].[Cl-].[Cl-].[Cl-].[Cl-].[K+].[Ca+2].CC(O)C(O)=O ZEWYCNBZMPELPF-UHFFFAOYSA-J 0.000 description 1
- 238000002619 cancer immunotherapy Methods 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 190000008236 carboplatin Chemical compound 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 238000002659 cell therapy Methods 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 1
- 229960001265 ciclosporin Drugs 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 230000024203 complement activation Effects 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 239000003431 cross linking reagent Substances 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 230000016396 cytokine production Effects 0.000 description 1
- 229960002465 dabrafenib Drugs 0.000 description 1
- BFSMGDJOXZAERB-UHFFFAOYSA-N dabrafenib Chemical compound S1C(C(C)(C)C)=NC(C=2C(=C(NS(=O)(=O)C=3C(=CC=CC=3F)F)C=CC=2)F)=C1C1=CC=NC(N)=N1 BFSMGDJOXZAERB-UHFFFAOYSA-N 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 229950008937 defactinib Drugs 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000000113 differential scanning calorimetry Methods 0.000 description 1
- 206010012818 diffuse large B-cell lymphoma Diseases 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- RUZYUOTYCVRMRZ-UHFFFAOYSA-N doxazosin Chemical compound C1OC2=CC=CC=C2OC1C(=O)N(CC1)CCN1C1=NC(N)=C(C=C(C(OC)=C2)OC)C2=N1 RUZYUOTYCVRMRZ-UHFFFAOYSA-N 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- JBIWCJUYHHGXTC-AKNGSSGZSA-N doxycycline Chemical compound O=C1C2=C(O)C=CC=C2[C@H](C)[C@@H]2C1=C(O)[C@]1(O)C(=O)C(C(N)=O)=C(O)[C@@H](N(C)C)[C@@H]1[C@H]2O JBIWCJUYHHGXTC-AKNGSSGZSA-N 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 201000002491 encephalomyelitis Diseases 0.000 description 1
- INVTYAOGFAGBOE-UHFFFAOYSA-N entinostat Chemical compound NC1=CC=CC=C1NC(=O)C(C=C1)=CC=C1CNC(=O)OCC1=CC=CN=C1 INVTYAOGFAGBOE-UHFFFAOYSA-N 0.000 description 1
- 229950005837 entinostat Drugs 0.000 description 1
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 1
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 1
- 229960003649 eribulin Drugs 0.000 description 1
- UFNVPOGXISZXJD-XJPMSQCNSA-N eribulin Chemical compound C([C@H]1CC[C@@H]2O[C@@H]3[C@H]4O[C@H]5C[C@](O[C@H]4[C@H]2O1)(O[C@@H]53)CC[C@@H]1O[C@H](C(C1)=C)CC1)C(=O)C[C@@H]2[C@@H](OC)[C@@H](C[C@H](O)CN)O[C@H]2C[C@@H]2C(=C)[C@H](C)C[C@H]1O2 UFNVPOGXISZXJD-XJPMSQCNSA-N 0.000 description 1
- 229960001433 erlotinib Drugs 0.000 description 1
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- UGDGKPDPIXAUJL-UHFFFAOYSA-N ethyl n-[4-[benzyl(2-phenylethyl)amino]-2-(4-ethylphenyl)-1h-imidazo[4,5-c]pyridin-6-yl]carbamate Chemical compound N=1C(NC(=O)OCC)=CC=2NC(C=3C=CC(CC)=CC=3)=NC=2C=1N(CC=1C=CC=CC=1)CCC1=CC=CC=C1 UGDGKPDPIXAUJL-UHFFFAOYSA-N 0.000 description 1
- RKWPMPQERYDCTB-UHFFFAOYSA-N ethyl n-[4-[benzyl(2-phenylethyl)amino]-2-(4-nitrophenyl)-1h-imidazo[4,5-c]pyridin-6-yl]carbamate Chemical compound N=1C(NC(=O)OCC)=CC=2NC(C=3C=CC(=CC=3)[N+]([O-])=O)=NC=2C=1N(CC=1C=CC=CC=1)CCC1=CC=CC=C1 RKWPMPQERYDCTB-UHFFFAOYSA-N 0.000 description 1
- PVCRZXZVBSCCHH-UHFFFAOYSA-N ethyl n-[4-[benzyl(2-phenylethyl)amino]-2-(4-phenoxyphenyl)-1h-imidazo[4,5-c]pyridin-6-yl]carbamate Chemical compound N=1C(NC(=O)OCC)=CC=2NC(C=3C=CC(OC=4C=CC=CC=4)=CC=3)=NC=2C=1N(CC=1C=CC=CC=1)CCC1=CC=CC=C1 PVCRZXZVBSCCHH-UHFFFAOYSA-N 0.000 description 1
- 238000013213 extrapolation Methods 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 201000003444 follicular lymphoma Diseases 0.000 description 1
- 238000002825 functional assay Methods 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 229960002584 gefitinib Drugs 0.000 description 1
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 239000000185 hemagglutinin Substances 0.000 description 1
- 208000002672 hepatitis B Diseases 0.000 description 1
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 1
- 230000005745 host immune response Effects 0.000 description 1
- 102000043321 human CTLA4 Human genes 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 244000052637 human pathogen Species 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- KTUFNOKKBVMGRW-UHFFFAOYSA-N imatinib Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 KTUFNOKKBVMGRW-UHFFFAOYSA-N 0.000 description 1
- 229960002411 imatinib Drugs 0.000 description 1
- 230000005934 immune activation Effects 0.000 description 1
- 230000008004 immune attack Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 229940127121 immunoconjugate Drugs 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 108010074108 interleukin-21 Proteins 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 108020001756 ligand binding domains Proteins 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 208000020968 mature T-cell and NK-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 208000021039 metastatic melanoma Diseases 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 208000027889 monkey disease Diseases 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 1
- FWLMVFUGMHIOAA-UHFFFAOYSA-N n-methyl-4-[[4-[[3-[methyl(methylsulfonyl)amino]pyrazin-2-yl]methylamino]-5-(trifluoromethyl)pyrimidin-2-yl]amino]benzamide Chemical compound C1=CC(C(=O)NC)=CC=C1NC1=NC=C(C(F)(F)F)C(NCC=2C(=NC=CN=2)N(C)S(C)(=O)=O)=N1 FWLMVFUGMHIOAA-UHFFFAOYSA-N 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 108010087904 neutravidin Proteins 0.000 description 1
- 229960003301 nivolumab Drugs 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 229960001756 oxaliplatin Drugs 0.000 description 1
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 229960005079 pemetrexed Drugs 0.000 description 1
- QOFFJEBXNKRSPX-ZDUSSCGKSA-N pemetrexed Chemical compound C1=N[C]2NC(N)=NC(=O)C2=C1CCC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 QOFFJEBXNKRSPX-ZDUSSCGKSA-N 0.000 description 1
- 239000003208 petroleum Substances 0.000 description 1
- JGWRKYUXBBNENE-UHFFFAOYSA-N pexidartinib Chemical compound C1=NC(C(F)(F)F)=CC=C1CNC(N=C1)=CC=C1CC1=CNC2=NC=C(Cl)C=C12 JGWRKYUXBBNENE-UHFFFAOYSA-N 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000007112 pro inflammatory response Effects 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 239000000651 prodrug Substances 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 238000002818 protein evolution Methods 0.000 description 1
- 239000012217 radiopharmaceutical Substances 0.000 description 1
- 229940121896 radiopharmaceutical Drugs 0.000 description 1
- 230000002799 radiopharmaceutical effect Effects 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 210000003289 regulatory T cell Anatomy 0.000 description 1
- 230000008844 regulatory mechanism Effects 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 102220098934 rs878854576 Human genes 0.000 description 1
- 239000012723 sample buffer Substances 0.000 description 1
- 208000011571 secondary malignant neoplasm Diseases 0.000 description 1
- 238000010187 selection method Methods 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 239000008354 sodium chloride injection Substances 0.000 description 1
- 229940054269 sodium pyruvate Drugs 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 238000013097 stability assessment Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 229960001796 sunitinib Drugs 0.000 description 1
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 229960004964 temozolomide Drugs 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 230000009258 tissue cross reactivity Effects 0.000 description 1
- 230000000451 tissue damage Effects 0.000 description 1
- 231100000827 tissue damage Toxicity 0.000 description 1
- 229960004066 trametinib Drugs 0.000 description 1
- LIRYPHYGHXZJBZ-UHFFFAOYSA-N trametinib Chemical compound CC(=O)NC1=CC=CC(N2C(N(C3CC3)C(=O)C3=C(NC=4C(=CC(I)=CC=4)F)N(C)C(=O)C(C)=C32)=O)=C1 LIRYPHYGHXZJBZ-UHFFFAOYSA-N 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 229950007217 tremelimumab Drugs 0.000 description 1
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 201000007710 urinary bladder small cell neuroendocrine carcinoma Diseases 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 229960000653 valrubicin Drugs 0.000 description 1
- ZOCKGBMQLCSHFP-KQRAQHLDSA-N valrubicin Chemical compound O([C@H]1C[C@](CC2=C(O)C=3C(=O)C4=CC=CC(OC)=C4C(=O)C=3C(O)=C21)(O)C(=O)COC(=O)CCCC)[C@H]1C[C@H](NC(=O)C(F)(F)F)[C@H](O)[C@H](C)O1 ZOCKGBMQLCSHFP-KQRAQHLDSA-N 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 229960003862 vemurafenib Drugs 0.000 description 1
- GPXBXXGIAQBQNI-UHFFFAOYSA-N vemurafenib Chemical compound CCCS(=O)(=O)NC1=CC=C(F)C(C(=O)C=2C3=CC(=CN=C3NC=2)C=2C=CC(Cl)=CC=2)=C1F GPXBXXGIAQBQNI-UHFFFAOYSA-N 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/734—Complement-dependent cytotoxicity [CDC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2318/00—Antibody mimetics or scaffolds
- C07K2318/20—Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
Definitions
- the present invention relates to specific binding members which bind to programmed death-ligand 1 (PD-L1).
- the specific binding members preferably comprise a PD-L1 antigen-binding site located in structural loops of a constant domain of the specific binding member.
- the specific binding members of the invention find application, for example, in the treatment of cancer, as well as infectious diseases and inflammation.
- PD-1 Programmed cell death 1
- PD-L1 CD274, B7-H1
- PD-L2 B7-DC
- PD-L1 is constitutively or transiently expressed on multiple immune cell types and certain tumour cells.
- PD-L1 is a type I transmembrane protein with two Ig-like domains within the extracellular region, a transmembrane domain and a short cytoplasmic domain.
- the complete human PD-L1 sequence can be found under UniProt accession no. Q9NZQ7.
- the cytoplasmic domain has no known signal transduction motif suggesting that there is no signaling by PD-L1 on interaction of the ligand with its receptor.
- the molecular weight of human PD-L1 is 40 kDa (290 amino acids) and it shares 70% and 93% amino acid identity with the murine and cynomolgus orthologs of PD-L1, respectively.
- Human PD-L1 binds to its receptor PD-1 with an affinity (K D ) of 770 nM.
- PD-1 is expressed on activated T cells, B cells and myeloid cells, and modulates activation or inhibition of cellular immune responses. Binding of PD-L1 to PD-1 delivers an inhibitory signal, reducing cytokine production and proliferation of T cells. Consequently, PD-L1 expression by cells can mediate protection against cytotoxic T lymphocyte (CTL) killing and is a regulatory mechanism that dampens chronic immune responses during viral infections.
- CTL cytotoxic T lymphocyte
- Cancer as a chronic and pro-inflammatory disease, subverts this immune-protective pathway through up-regulation of PD-L1 expression to evade the host immune response. In the context of an active immune response, IFN ⁇ also upregulates the expression of PD-L1.
- PD-L1 also mediates immune suppression through interaction with another protein, B7.1 (also known as CD80), blocking its ability to deliver one of the secondary signals of activation on T cells through CD28.
- B7.1 also known as CD80
- PD-L1 expression has been shown in a wide variety of solid tumours. Of 654 samples examined in one study, spanning 19 tumours from different sites, 14% were PD-L1 positive. The highest PD-L1 positive frequencies were seen in head and neck (31%), cervical (29%), cancer of unknown primary origin (CUP; 28%), glioblastoma multiforme (GBM; 25%), bladder cancer (21%), oesophageal cancer (20%), triple negative (TN) breast cancer (18%), and hepatocarcinoma (15%) (Grosso et al, 2013). Tumour-associated expression of PD-L1 has been shown to confer immune resistance and potentially protect tumour cells from T cell mediated apoptosis.
- Atezolizumab (TecentriqTM) is a humanised IgG1 antibody which binds to PD-L1. It is in clinical trials as a monotherapy and also in combination with other biologic and/or small molecule therapies for treatment of solid cancers, including colorectal cancer, breast cancer, non-small-cell lung cancer, small cell lung cancer, bladder cancer, and renal cell carcinoma.
- Avelumab (BavencioTM) is a fully human IgG1 antibody which binds to PD-L1 and is undergoing clinical testing in a number of cancers including bladder cancer, gastric cancer, head and neck cancer, mesothelioma, non-small-cell lung carcinoma, ovarian cancer, renal cancer, Merkel-cell carcinoma, and metastatic urothelial carcinoma (UC).
- bladder cancer gastric cancer, head and neck cancer
- mesothelioma non-small-cell lung carcinoma
- ovarian cancer ovarian cancer
- renal cancer Merkel-cell carcinoma
- UC metastatic urothelial carcinoma
- Durvalumab is a human IgG1 antibody which binds to PD-L1 and is being tested in clinical trials alone or in combination with tremelimumab in squamous cell carcinoma of the head and neck, bladder cancer, pancreatic cancer and with other biologic and small molecules in trials for additional solid cancers such as gastric cancers, melanoma and unresectable hepatocellular carcinoma.
- Durvalumab has been approved for the treatment of patients with locally advanced or metastatic urothelial carcinoma and unresectable stage Ill NSCLC.
- anti-PD-L1 antibodies including BMS-936559 (NCT00729664), have been tested in clinical trials, and others are in preclinical testing.
- PD-L1 blockade may improve biological responses to infection, in particular, helping to counteract T cell exhaustion, manage immune-mediated clearance, and generate long-term immunity (Wykes, M. N. and Lewin, S. R., 2018).
- the PD-1/PD-L1 pathway may be a therapeutic target for the treatment of inflammation, diseases and conditions associated with inflammation, and inflammatory diseases, such as stroke and stroke-related inflammation (Bodhankar et al., 2015), and vascular inflammation or vasculitis, e.g., medium and large vessel vasculitis, or vasculitis of the central and/or peripheral nervous system (Hid Cadena et al., 2018 and Daxini et al., 2018).
- anti-PD-L1 antibodies Whilst there are various anti-PD-L1 therapeutics in development, current data shows that overall treatment with existing anti-PD-L1 monotherapies results in a response in less than 50% of cancer patients. The spectrum and severity of reported adverse reactions differs between antibodies in clinical testing. To increase the objective response rate (ORR), and/or seek to reduce adverse effects, anti-PD-L1 antibodies may be combined with other biologics, such as antibodies against other checkpoint regulators, as well as with small molecule therapies and other immune system activating approaches, such as tumour vaccines.
- ORR objective response rate
- the present inventors have prepared a number of specific binding members comprising a non-native binding site for PD-L1 in the CH3 domain of the specific binding members. These specific binding members were isolated through an initial screen of a na ⁇ ve CH3 domain phage library, followed by a complex programme of iterative rounds of mutagenesis, screening and selection to isolate variants of the specific binding members initially selected which had improved activity and affinity for PD-L1.
- the present inventors found that specific binding members, identified from an initial affinity maturation programme following the initial screen of the na ⁇ ve CH3 domain phage library, showed increased affinity for PD-L1, as well as increased blocking of the interaction between PD-L1 and its ligand PD-1.
- the selected specific binding members unexpectedly had very weak activity in a T cell activation assay.
- specific binding members which not only had high affinity for PD-L1 but also excellent activity in a T cell activation assay.
- These specific binding members surprisingly comprised CH3 domains which had a deletion in the AB structural loop sequence (located at either residue 14, 15 or 16 of the AB structural loop). The deletion is thought to be an artefact resulting from accidentally truncated mutagenesis primers.
- Specific binding members comprising such deletions in their structural loop regions are usually removed during the selection process, as deletions rarely result in specific binding members which retain antigen-binding activity.
- this truncated AB loop sequence which was not identified following mutagenesis of the AB loop, is thought to have been present in the output pool from the selections as a rare clone or lower affinity binder.
- this truncated AB structural loop sequence was shuffled with the other structural loops, it became the dominant AB structural loop sequence, suggesting a strong contribution of this deletion to the antigen-binding activity and/or structure of the specific binding members following the shuffling of the structural loop sequences.
- the above approach allowed the present inventors to identify a large number of specific binding members which comprise a binding site for PD-L1 in their CH3 domain, and which showed excellent binding to PD-L1, and were either shown, or are expected, to have high activity in T cell activation assays. Based on these characteristics, it is expected that the specific binding members of the invention will find application in the treatment of human cancers, as well as infectious diseases, inflammation, diseases and conditions associated with inflammation, and inflammatory diseases, through inhibition of PD-L1.
- the specific binding members were also shown to have a high affinity for cynomolgus PD-L1, which is comparable to the affinity for human PD-L1 and is expected to be useful in the evaluation of the properties of the specific binding members in cynomolgus monkey disease models.
- the reason for this is that the results obtained are more likely to be predictive of the effects of the specific binding member in human patients than when a specific binding member having a higher variability in its affinity for human and cynomolgus PD-L1 is tested in cynomolgus monkey models.
- the present invention provides a specific binding member which binds to PD-L1, and comprises a PD-L1 antigen-binding site located in a constant domain, such as CL, CH1, CH2 or CH3 domain, preferably a CH1, CH2 or CH3 domain, most preferably a CH3 domain of the specific binding member.
- a constant domain such as CL, CH1, CH2 or CH3 domain, preferably a CH1, CH2 or CH3 domain, most preferably a CH3 domain of the specific binding member.
- the PD-L1 binding site of the specific binding member of the invention preferably comprises:
- the present invention therefore provides:
- [5] A specific binding member according to any one of [1] to [4], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the serine (S) is substituted with amino acid A.
- [17] A specific binding member according to any one of [1] to [16], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the glycine (G) is substituted with amino acid A.
- [20] A specific binding member according to any one of [1] to [16], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the glycine (G) is substituted with amino acid F.
- [66] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at position 93 of the CH3 domain is substituted with amino acid E.
- [68] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at position 93 of the CH3 domain is substituted with amino acid G.
- [74] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at position 93 of the CH3 domain is substituted with amino acid R.
- [78] A specific binding member according to any one of [1] to [77], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the glutamine (Q) at position 97 of the CH3 domain is substituted with amino acid A.
- [94] A specific binding member according to any one of [1] to [89], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the methionine (M) at position 98 of the CH3 domain is substituted with amino acid W.
- [96] A specific binding member according to any one of [1] to [95], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at position 99 of the CH3 domain is substituted with amino acid E.
- Amino acids may be referred to by their one letter or three letter codes, or by their full name.
- the one and three letter codes, as well as the full names, of each of the twenty standard amino acids are set out below.
- Amino acid One letter code Three letter code alanine A ala arginine R arg asparagine N asn aspartic acid D asp cysteine C cys glutamic acid E glu glutamine Q gln glycine G gly histidine H his isoleucine I ile leucine L leu lysine K lys methionine M met phenylalanine F phe proline P pro serine S ser threonine T thr tryptophan W trp tyrosine Y tyr valine V val
- the PD-L1 binding site of the specific binding member of the invention preferably comprises a first sequence, second sequence and third sequence, wherein:
- the binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-116, wherein the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 19.
- the binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-288, wherein the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 27.
- the binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-289 and Fcab FS17-33-334, wherein the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 31.
- the binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-296, wherein the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 35.
- the binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-449, wherein the first sequence has the sequence set forth in SEQ ID NO: 42, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 43.
- the binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-451, wherein the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 43.
- the present inventors performed a further mutagenesis programme in order to identify specific binding members comprising a non-native binding site for PD-L1 in the CH3 domain of the specific binding member which had an enhanced melting temperature and thus are expected to be more stable. This enhanced stability is expected to be beneficial in the manufacture and storage of the specific binding members.
- the present inventors surprisingly found that reversion of the aspartic acid (D) residue at position 99 of the CH3 domain of a specific binding member of the invention to the wild-type glycine (G) residue increased the melting temperature of the specific binding member.
- this amino acid reversion has the added advantage that it reduces the mutational burden of the resulting specific binding member.
- the present inventors further found that substitution of the histidine (H) residue at position 113 of the CH3 domain of the specific binding member with an arginine (R) residue, in addition to the reversion at position 99, also resulted in a specific binding member with an increased melting temperature of the specific binding members. Both of these mutations arose independently twice, indicating that these amino acid changes may be important for the increase in the melting temperature of the specific binding members.
- the specific binding member of the invention comprises a PD-L1 binding site comprising a first, second and third sequence as disclosed herein, wherein the third sequence is located in the EF structural loop, preferably at positions 92 to 100 of the CH3 domain, and consists of a variant of SEQ ID NO: 19, wherein the aspartic acid (D) at position 99 is substituted with glycine (G), more preferably, where the aspartic acid (D) at position 99 is substituted with glycine (G) and the methionine (M) at position 98 is substituted with leucine (L).
- the histidine (H) at position 113 of the CH3 domain of a specific binding member of the invention may be substituted with arginine (R).
- the specific binding member may further comprise the following additional mutations in the CH3 domain:
- the present invention thus further provides:
- the PD-L1 binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-488, wherein the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 70, wherein the residues at positions 84.1, 85.3, 101 and 113 of the CH3 domain of the specific binding member are proline (P), threonine (T), alanine (A) and arginine (R), respectively.
- P proline
- T threonine
- A alanine
- R arginine
- the PD-L1 binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-539, wherein the first sequence has the sequence set forth in SEQ ID NO: 42, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 74 and the residue at position 113 of the CH3 domain of the specific binding member is arginine (R).
- the specific binding member comprises the first sequence, second sequence and third sequence of Fcab FS17-33-548, wherein the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 78.
- the binding site of the specific binding member of the invention may comprise a total of up to twelve, up to eleven, up to ten, up to nine, up to eight, up to seven, up to six, up to five, up to four, up to three, up to two, or one (further) amino acid modifications(s) in a first, second and third sequence, as disclosed herein.
- the specific binding member may comprise a total of up to three, up to two, or one (further) amino acid modifications(s) in a first, second and third sequence, as disclosed herein.
- the specific binding member may comprise a total of up to two, or one (further) amino acid modification(s) in a first, second and third sequence, as disclosed herein.
- the total number of modifications in a first, second and third sequence refers to the total number of modifications made in these sequences combined.
- the binding site of the specific binding member of the invention may comprise up to two, or one (further) amino acid modification(s) in a first sequence, as disclosed herein.
- the specific binding member may comprise up to five, up to four, up to three, up to two, or one (further) amino acid modification(s) in a second sequence, as disclosed herein.
- the binding site of the specific binding member of the invention may comprise up to six, up to five, up to four, up to three, up to two, or one (further) amino acid modification(s) in a third sequence, as disclosed herein.
- the binding site of the specific binding member of the invention may comprise up to two, or one (further) amino acid modification(s) in a first sequence and/or up to two, or one (further) amino acid modification(s) in a third sequence, as disclosed herein.
- the binding member may comprise one (further) amino acid modification in a first sequence and/or one (further) amino acid modification in a third sequence, as disclosed herein.
- the binding site of the specific binding member of the invention comprises one (further) amino acid modification in a first, second or third sequence, as disclosed herein.
- the binding site of the specific binding member of the invention may comprise a third sequence in which the methionine (M) at position 98 is substituted with amino acid L.
- the binding site of the specific binding member of the invention may comprise one, two or three, preferably one or two, more preferably one, further amino acid modification(s) in the first, second or third sequence.
- the amino acid deletion at position 14, 15 or 16 of the CH3 domain is preferably maintained and/or the amino acids at positions 17, 18 of the CH3 domain are preferably unmodified compared with the parent sequence.
- the amino acid(s) at position 77, and optionally position 45.3, of the CH3 domain is (are) preferably unmodified compared with the parent sequence.
- the amino acid(s) at position 94, and optionally position 92, of the CH3 domain is (are) preferably unmodified compared with the parent sequence.
- a modification may be an amino acid substitution, deletion or insertion.
- the modification is a substitution.
- the amino acid at position 101 of the CH3 domain of the specific binding member is valine (V).
- the amino acid at position 101 of the CH3 domain of the specific binding member is alanine (A).
- the present inventors showed that certain residues in the AB and EF loops, as well as the framework region could be converted back to the wild-type (WT) residue (see FIGS. 1 A- 1 D ) with a minimal effect on the off-rate (koff) of the specific binding member when bound to PD-L1, while reducing the mutational burden of the specific binding member.
- the binding site of the specific binding member of the invention comprises a first sequence with:
- the binding site of the specific binding member of the invention comprises a third sequence with:
- the amino acid at position 38 of the CH3 domain of the specific binding member may be a valine or alanine residue, preferably an alanine residue.
- the sequence of the CH3 domain of the specific binding member, other than the sequences of the PD-L1 antigen-binding site, is not particularly limited.
- the CH3 domain is a human immunoglobulin G domain, such as a human IgG1, IgG2, IgG3, or IgG4 CH3 domain, most preferably a human IgG1 CH3 domain.
- the sequences of human IgG1, IgG2, IgG3, or IgG4 CH3 domains are known in the art.
- the specific binding member comprises the CH3 domain set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, or 48, more preferably the CH3 domain set forth in SEQ ID NO: 28, 32, 36, 39, 44, or 48, most preferably the CH3 domain set forth in SEQ ID NO: 32, 44, or 48.
- the specific binding member comprises the CH3 domain set forth in SEQ ID NO: 71, 75 or 79.
- the specific binding member may comprise a CH3 domain with an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, or 48, preferably SEQ ID NO: 28, 32, 36, 39, 44, or 48, most preferably the CH3 domain set forth in SEQ ID NO: 32, 44, or 48.
- the specific binding member comprises a CH3 domain with an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 71, 75 or 79.
- the specific binding member may further comprise a CH2 domain.
- the CH2 domain is preferably located at the N-terminus of the CH3 domain, as in the case in a human IgG molecule.
- the CH2 domain of the specific binding member is preferably the CH2 domain of human IgG1, IgG2, IgG3, or IgG4, more preferably the CH2 domain of human IgG1.
- the sequences of human IgG domains are known in the art.
- the specific binding member comprises an IgG CH2 domain with the sequence set forth in SEQ ID NO: 5 or 6, or a CH2 domain with an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 5 or 6.
- the specific binding member comprises an IgG CH2 domain with the sequence set forth in SEQ ID NO: 82, or a CH2 domain with an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 82.
- the specific binding member comprises (i) the CH3 domain set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79 more preferably the CH3 domain set forth in SEQ ID NO: 28, 32, 36, 39, 44, 48, 71, 75 or 79 most preferably the CH3 domain set forth in SEQ ID NO: 32, 44, 48, 71, 75 or 79, and (ii) the CH2 domain set forth in SEQ ID NO: 5.
- the specific binding member comprises (i) the CH3 domain set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79 more preferably the CH3 domain set forth in SEQ ID NO: 28, 32, 36, 39, 44, 48, 71, 75 or 79 most preferably the CH3 domain set forth in SEQ ID NO: 32, 44, 48, 71, 75 or 79, and (ii) the CH2 domain set forth in SEQ ID NO: 6.
- the specific binding member comprises an immunoglobulin hinge region, or part thereof, at the N-terminus of the CH2 domain.
- the immunoglobulin hinge region allows the two CH2-CH3 domain sequences to associate and form a dimer.
- the hinge region, or part thereof is a human IgG1, IgG2, IgG3 or IgG4 hinge region, or part thereof. More preferably, the hinge region, or part thereof, is an IgG1 hinge region, or part thereof.
- the sequence of the human IgG1 hinge region is shown in SEQ ID NO: 69.
- a suitable truncated hinge region which may form part of specific binding member is shown in SEQ ID NO: 7.
- the specific binding member preferably comprises an immunoglobulin hinge region, or part thereof, at the N-terminus of the CH2 domain, wherein the hinge region has the sequence set forth in SEQ ID NO: 69 or SEQ ID NO: 7, or wherein the hinge region has an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 69 or 7.
- the specific binding member may comprises an immunoglobulin hinge region, or part thereof, at the N-terminus of the CH2 domain, wherein the hinge region comprises the sequence set forth in SEQ ID NO: 69, or a fragment thereof, wherein said fragment comprises at least five, at least six, at least seven, at least eight, at least nine or more, at least ten, at least eleven, at least twelve, at least thirteen, or at least fourteen of the amino acid residues of SEQ ID NO: 69.
- the specific binding member comprises (i) the CH3 domain set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79 more preferably the CH3 domain set forth in SEQ ID NO: 28, 32, 36, 39, 44, 48, 71, 75 or 79 most preferably the CH3 domain set forth in SEQ ID NO: 32, 44, 48, 71, 75 or 79, (ii) the CH2 domain set forth in SEQ ID NO: 5, and (ii) an immunoglobulin hinge region, or part thereof, at the N-terminus of the CH2 domain, wherein the immunoglobulin hinge region has the sequence set forth in SEQ ID NO: 69.
- the specific binding member comprises (i) the CH3 domain set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79 more preferably the CH3 domain set forth in SEQ ID NO: 28, 32, 36, 39, 44, 48, 71, 75 or 79 most preferably the CH3 domain set forth in SEQ ID NO: 32, 44, 48, 71, 75 or 79, (ii) the CH2 domain set forth in SEQ ID NO: 6, and (iii) an immunoglobulin hinge region, or part thereof, at the N-terminus of the CH2 domain, wherein the immunoglobulin hinge region has the sequence set forth in SEQ ID NO: 69.
- the specific binding member comprises the sequence set forth in SEQ ID NO: 25, 26, 29, 30, 33, 34, 37, 38, 40, 41, 45, 46, 49, or 50, or a sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 25, 26, 29, 33, 34, 30, 37, 38, 40, 41, 45, 46, 49, or 50.
- the specific binding member comprises the sequence set forth in SEQ ID NO: 29, 30, 33, 34, 37, 38, 40, 41, 45, 46, 49, or 50, or a sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 29, 30, 33, 34, 37, 38, 40, 41, 45, 46, 49, or 50.
- the specific binding member comprises the sequence set forth in SEQ ID NO: 45, 46, 49, or 50, or a sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 45, 46, 49, or 50.
- the specific binding member comprises the sequence set forth in SEQ ID NO: 33, or 34, or a sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 33, or 34
- the specific binding member comprises the sequence set forth in SEQ ID NO: 72, 73, 76, 77, 80, or 81, or a sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 72, 73, 76, 77, 80, or 81.
- Monoclonal antibody-based cancer immunotherapies such as anti-CTLA-4 or anti-PD-1/PD-L1 antibodies
- these monotherapies despite the remarkable clinical efficacy of these monotherapies in a number of malignancies, only a small subset of cancer patients responds to these treatments.
- Recently, combined inhibition of PD-1 and CTLA-4 in melanoma and non-small cell lung cancer has highlighted the potential to further enhance the clinical benefits of such monotherapies by combining them with other agents which have a complementary mechanism of action.
- the inventors surprisingly found that when specific binding members of the invention were prepared which comprised the CDR-based antigen binding site for CTLA-4 from ipilimumab, in addition to a PD-L1 antigen-binding site located in the CH3 domain of the specific binding member, and these were tested in a Staphylococcal Enterotoxin B assay (SEB assay), the specific binding members showed greater T cell activation than (i) a specific binding member comprising the same PD-L1 antigen-binding site in the CH3 domain and a CDR-based antigen binding site for an irrelevant antigen, (ii) ipilimumab, or a combination of (i) and (ii).
- SEB assay Staphylococcal Enterotoxin B assay
- the specific binding member may further comprise one or more additional antigen-binding sites to create a bi- or multi-specific molecule.
- the specific binding member comprises a CDR-based antigen-binding site.
- CDR-based antigen binding sites are found in naturally-occurring immunoglobulin molecules and their structure is well-known in the art.
- the specific binding member comprises a CDR-based antigen binding site
- the specific binding member is preferably an antibody molecule.
- the antibody molecule is not particularly limited, provided that it comprises a CH3 domain as herein defined and a CDR-based antigen binding site.
- the antibody molecule is a human immunoglobulin G molecule, such as a human IgG1, IgG2, IgG3 or IgG4 molecule, more preferably a human IgG1 molecule.
- human immunoglobulin G molecules such as a human IgG1, IgG2, IgG3 or IgG4 molecule, more preferably a human IgG1 molecule.
- sequences of human immunoglobulin G molecules are known in the art and introducing a CH3 domain or a CH3 domain sequence, as disclosed herein, into such a molecule would not present any difficulty for the skilled person.
- the specific binding member of the invention comprises (i) the sequence set forth in SEQ ID NO: 45, 46, 49, 50, 72, 73, 76, 77, 80, 81, 33, 34, 25, 26, 29, 30, 37, 38, 40, or 41, preferably the sequence set forth in SEQ ID NO: 45, 46, 49, 50, 72, 73, 76, 77, 80, 81, 33, or 34, and (ii) a CDR-based antigen-binding site.
- the CDR-based antigen binding site may bind an antigen, where the binding of said antigen is expected to be beneficial in the context of cancer treatment.
- the CDR-based antigen binding site may bind to a non-redundant and complementary checkpoint inhibitor, such as CTLA-4, LAG-3, TIGIT, TIM-3, VISTA, CD73, CSF-1R, KIR. B7-H3, B7-H4, 2B4, NKG2A, CD47, SIRPa, BTLA, CCR4, CD200R, or TGFbeta.
- a non-redundant and complementary checkpoint inhibitor such as CTLA-4, LAG-3, TIGIT, TIM-3, VISTA, CD73, CSF-1R, KIR.
- a specific binding member of the invention may comprise a CDR-based antigen-binding site which binds to, and is an agonist for, a costimulatory molecule expressed by T cells such as OX40, ICOS, CD40, HVEM, NKG2D, or TNFR2.
- the specific binding member of the invention may comprise a CDR-based antigen binding site which binds to a tumour associated antigen (TAA).
- TAA tumour associated antigen
- TAAs are c-Met, B7-H3, B7-H4, EGFR, HER-2, EPCAM, CEACAM, FAP, VEGF, MSLN, GPC3, CD38, CD19, and CD20.
- infectious diseases show many parallels with oncology.
- the role of PD-L1 in immune regulation could be harnessed to maximise the immune response against pathogens.
- Immunomodulation in the context of treatment of infectious diseases is an emerging area of medicine and early reviews suggest that PD-L1 blockade may improve biological responses to infection, in particular, helping to counteract T-cell exhaustion, manage immune-mediated clearance, and generate long-term immunity (Wykes and Lewin, 2018).
- a specific binding member of the invention comprising a CDR-based antigen-binding site which binds to an immune cell target, either for agonism or antagonism, may result in increased T-cell specificity and activity.
- the CDR-based antigen binding site may bind to an immune cell target, such as PD-1, PD-L2, CTLA-4, LAG-3, TIGIT, TIM3, OX40, CD40, ICOS, CD28, or CD80.
- an immune cell target such as PD-1, PD-L2, CTLA-4, LAG-3, TIGIT, TIM3, OX40, CD40, ICOS, CD28, or CD80.
- the CDR-based antigen binding site may bind to a pathogenic target, namely an antigen expressed by a human pathogen.
- the pathogen may be a virus, bacterium, fungus, or parasite.
- the pathogen is a virus, bacterium or fungus. More preferably, the pathogen is a virus or bacterium. Most preferably, the pathogen is a virus.
- viral antigens examples include proteins p24, gp120, and gp41 expressed by human immunodeficiency virus (HIV), hepatitis B surface antigen (HBsAg) expressed by hepatitis B virus (HBV), and hemagglutinin and neuraminidase expressed by influenza virus.
- bacterial antigens include Rv1733, Rv2389 and Rv2435n expressed by Mycobacterium tuberculosis.
- the CDR-based antigen-binding site of the specific binding member of the invention may not bind to OX40. In addition, or alternatively, the CDR-based antigen-binding site of the specific binding member of the invention may not bind to CD137. In addition, or alternatively, the CDR-based antigen-binding site of the specific binding member of the invention may not bind to CD27. In addition, or alternatively, the CDR-based antigen-binding site of the specific binding member of the invention may not bind to glucocorticoid-induced TNFR-related protein (GITR).
- GITR glucocorticoid-induced TNFR-related protein
- the CDR-based antigen-binding site of the specific binding member of the invention may not bind to lymphocyte-activation gene 3 (LAG-3). In addition, or alternatively, the CDR-based antigen-binding site of the specific binding member of the invention may not bind to Inducible T-cell COStimulator (ICOS).
- LAG-3 lymphocyte-activation gene 3
- ICOS Inducible T-cell COStimulator
- the CDR-based antigen-binding site of the specific binding member of the invention may not bind to ICOS where (i) the PD-L1 binding site of the specific binding member comprises a first sequence located in the AB structural loop at positions 14 to 18 of the CH3 domain, wherein the specific binding member comprises an amino acid deletion at position 14, 15 or 16 of the CH3 domain, and wherein the first sequence consists of the sequence set forth in SEQ ID NO: 23, a second sequence located in the CD structural loop at positions 45.1 to 78 of the CH3 domain, wherein the second sequence consists of the sequence set forth in SEQ ID NO: 11, and a third sequence located in the EF structural loop at positions 92 to 100 of the CH3 domain, wherein the third sequence consists of the sequence set forth in SEQ ID NO: 31; (ii) the CH3 domain of the specific binding member comprises the sequence set forth in SEQ ID NO: 32; and/or (iii) where the specific binding member comprises the sequence set forth in SEQ ID NO: 33 or 34.
- the specific binding member may further be conjugated to an immune system modulator, cytotoxic molecule, radioisotope, or detectable label.
- the immune system modulator may be a cytotoxic molecule, such as a cytokine.
- the present invention also provides a nucleic acid encoding a specific binding member or antibody molecule of the invention, as well as a vector comprising such a nucleic acid.
- a recombinant host cell comprising a nucleic acid or the vector of the invention is also provided.
- Such a recombinant host cell may be used to produce a specific binding member of the invention.
- a method of producing a specific binding member or antibody molecule of the invention comprising culturing the recombinant host cell under conditions for production of the specific binding member or antibody molecule.
- the method may further comprise a step of isolating and/or purifying the specific binding member or antibody molecule.
- the specific binding members and antibodies of the present invention are expected to find application in therapeutic applications, in particular therapeutic applications in humans, such as cancer treatment, the treatment of infectious diseases, and the treatment of inflammation, diseases and conditions associated with inflammation, and inflammatory diseases.
- a pharmaceutical composition comprising a specific binding member or antibody molecule according to the invention and a pharmaceutically acceptable excipient.
- the present invention further provides a specific binding member or antibody molecule of the invention, for use in a method of treatment. Also provided is a method of treating a patient, wherein the method comprises administering to the patient a therapeutically effective amount of a specific binding member or antibody molecule according to the invention. Further provided is the use of a specific binding member or antibody molecule according to the invention for use in the manufacture of a medicament.
- a patient as referred to herein, is preferably a human patient.
- the present invention also provides a specific binding member or antibody molecule of the invention, for use in a method of treating cancer in a patient. Also provided is a method of treating cancer in a patient, wherein the method comprises administering to the patient a therapeutically effective amount of a specific binding member or antibody molecule according to the invention. Further provided is the use of a specific binding member or antibody molecule according to the invention for use in the manufacture of a medicament for the treatment of cancer in a patient.
- the treatment may further comprise administering to the patient a second anti-cancer agent and/or therapy, such as an anti-tumour vaccine and/or a chemotherapeutic agent.
- the second anti-cancer agent and/or therapy may be administered to the patient simultaneously, separately, or sequentially to the specific binding member or antibody molecule of the invention.
- the present invention also provides a specific binding member or antibody molecule of the invention, for use in a method of treating an infectious disease in a patient. Also provided is a method of treating an infectious disease in a patient, wherein the method comprises administering to the patient a therapeutically effective amount of a specific binding member or antibody molecule according to the invention. Further provided is the use of a specific binding member or antibody molecule according to the invention for use in the manufacture of a medicament for the treatment of an infectious disease in a patient. The treatment may further comprise administering to the patient a second agent and/or therapy for the treatment of the infectious disease. The second agent and/or therapy may be administered to the patient simultaneously, separately, or sequentially to the specific binding member or antibody molecule of the invention.
- the present invention also provides a specific binding member or antibody molecule of the invention, for use in a method of treating inflammation, a disease or condition associated with inflammation, or an inflammatory disease in a patient. Also provided is a method of treating inflammation, a disease or condition associated with inflammation, or an inflammatory disease in a patient, wherein the method comprises administering to the patient a therapeutically effective amount of a specific binding member or antibody molecule according to the invention. Further provided is the use of a specific binding member or antibody molecule according to the invention for use in the manufacture of a medicament for the treatment of inflammation, a disease or condition associated with inflammation, or an inflammatory disease in a patient.
- the treatment may further comprise administering to the patient a second agent and/or therapy for the treatment of the inflammation, disease or condition associated with inflammation, or inflammatory disease.
- the second agent and/or therapy may be administered to the patient simultaneously, separately, or sequentially to the specific binding member or antibody molecule of the invention.
- FIG. 1 A shows the sequences of the AB, CD and EF loops and framework position 38, 84.1, 85.3 and 113 of the CH3 domain of Fcabs FS17-33, FS17-33-37, FS17-33-116; FS17-33-288, FS17-33-289, FS17-33-296, FS17-33-334, FS17-33-449, FS17-33-451, FS17-33-488, FS17-33-539 and FS17-33-548, as well as the wild-type (WT) Fcab.
- WT wild-type
- FIG. 1 B- 1 C show a concordance of antibody residue numbering systems, including the IMGT, consecutive numbering (IMGT exon numbering), EU numbering, and Kabat numbering systems for the CH3 domain residues of an IgG1 CH3 domain, as well as the wild-type IgG1 CH3 domain amino acid sequence.
- FIG. 1 B- 1 C show a concordance of antibody residue numbering systems, including the IMGT, consecutive numbering (IMGT exon numbering), EU numbering, and Kabat numbering systems for the CH3 domain residues of an IgG1 CH3 domain, as well as the wild-type IgG1 CH3 domain amino acid sequence.
- 1 D shows an alignment of the CH3 domain sequences of the Fcabs FS17-33, FS17-33-37, FS17-33-116; FS17-33-288, FS17-33-289, FS17-33-296, FS17-33-334, FS17-33-449, FS17-33-451, FS17-33-488, FS17-33-539 and FS17-33-548, as well as the wild-type (WT) Fcab.
- WT wild-type
- FIGS. 2 A- 2 C show size exclusion chromatography (SEC) profiles of two Fcabs ( FIGS. 2 A- 2 B ) and a mAb 2 ( FIG. 2 C ).
- the parental Fcab FS17-33 shows a single peak with a shoulder ( FIG. 2 A ).
- Fcab FS17-33-116 shows a split peak ( FIG. 2 B ).
- SEC analysis shows the mAb 2 FS17-33-116/4420 ( FIG. 2 C ) had a small amount of aggregation, typical of what is seen with the parental 4420 mAb. Unlike the Fcabs, there is no apparent split peak or shoulder.
- FIG. 3 A shows that the anti-PD-L1 Fcab, FS17-33-116AA, inhibits human PD-L1 activity leading to release of IL-2 in a DO11.10 T cell activation assay. This release was comparable to the positive control anti-PD-L1 mAb, YW243.55.S1 (S1). The anti-PD-L1 Fcab, FS17-33-37AA, and a wild-type (WT) Fcab showed no significant T cell activation in this assay.
- FIG. 3 A shows that the anti-PD-L1 Fcab, FS17-33-116AA, inhibits human PD-L1 activity leading to release of IL-2 in a DO11.10 T cell activation assay. This release was comparable to the positive control anti-PD-L1 mAb, YW243.55.S1 (S1). The anti-PD-L1 Fcab, FS17-33-37AA, and a wild-type (WT) Fcab showed no significant T cell activation in this as
- FIG. 4 A shows that the anti-PD-L1 Fcabs, FS17-33-288AA, FS17-33-289AA and FS17-33-296AA and FS17-33-334AA, in Fcab and mock mAb 2 format inhibit human PD-L1, leading to release of IL-2 in a DO11.10 T cell activation assay.
- the conversion of the Fcab into a mock mAb 2 format resulted in a partial reduction in IL-2 release in this assay.
- FIG. 4 B shows that the anti-PD-L1 Fcabs, FS17-33-449 and FS17-33-451, in a mock mAb 2 format were also able to inhibit PD-L1 and release IL-2 in a DO11.10 T cell activation assay.
- FIGS. 5 A- 5 C show representative plots from the SEB assay. Both the Fcabs and the mock mAb 2 showed enhanced IFN ⁇ release by the T cells as compared to the IgG1 isotype control mAb HeID1.3 ( FIGS. 5 A- 5 B ). The activities of the Fcabs were close or comparable to the anti-PD-L1 positive control mAb, YW243.55.S70 (S70). The Fcabs in a mock mAb 2 format showed a slight reduction in IFN ⁇ release in this assay. FIG. 5 C shows that the presence of the LALA mutation (AA) in the Fcabs did not interfere with their activities in the SEB assay.
- AA LALA mutation
- FIGS. 6 A- 6 B show representative plots from the SEB assay. As compared to ipilimumab (anti-CTLA-4), both the mock mAb 2 and the PD-L1/CTLA-4 mAb 2 showed an enhanced IFN ⁇ release by the T cells.
- the present invention relates to specific binding members which bind to PD-L1.
- the specific binding members of the present invention comprise a PD-L1 antigen binding site located in a constant domain of the specific binding member.
- the term “PD-L1” may refer to human PD-L1, and/or cynomolgus monkey PD-L1, unless the context requires otherwise.
- the term “PD-L1” refers to human PD-L1.
- the term “specific binding member” describes an immunoglobulin, or fragment thereof, comprising a constant domain, preferably a CH3 domain, comprising a PD-L1 antigen-binding site.
- the specific binding member comprises a CH2 and CH3 domain, wherein the CH2 or CH3 domain, preferably the CH3 domain, comprises a PD-L1 antigen-binding site.
- the specific binding member further comprises an immunoglobulin hinge region, or part thereof, at the N-terminus of the CH2 domain.
- Such a molecule is also referred to herein as an antigen-binding Fc fragment, or FcabTM.
- the specific binding member may be partly, or wholly, synthetically produced.
- specific binding member thus includes fragments, provided said fragments comprise a PD-L1 antigen binding site located in a constant domain, such as a CL, CH1, CH2, or CH3 domain, preferably a CH1, CH2, or CH3 domain, most preferably a CH3 domain, of the specific binding member.
- a constant domain such as a CL, CH1, CH2, or CH3 domain, preferably a CH1, CH2, or CH3 domain, most preferably a CH3 domain, of the specific binding member.
- the specific binding member is an antibody molecule.
- antibody molecule encompasses fragments of antibody molecules, provided such fragments comprise a constant domain, such as a CH1, CH2, or CH3 domain, preferably a CH3 domain, comprising a PD-L1 antigen-binding site.
- the antibody molecule may be human or humanised.
- the antibody molecule is preferably a monoclonal antibody molecule. Examples of antibody molecules are the immunoglobulin isotypes, such as immunoglobulin G, and their isotypic subclasses, such as IgG1, IgG2, IgG3 and IgG4, as well as fragments thereof.
- the term “specific binding member” should be construed as covering antibody fragments, derivatives, functional equivalents and homologues of antibodies, whether natural or wholly or partially synthetic.
- An example of an antibody fragment comprising a CH3 domain is an Fc domain of an antibody.
- An example of an antibody fragment comprising both CDR sequences and CH3 domain is a minibody, which comprises an scFv joined to a CH3 domain (Hu et al., 1996).
- the specific binding member of the present invention binds to PD-L1. Binding in this context may refer to specific binding.
- the term “specific” may refer to the situation in which the specific binding member will not show any significant binding to molecules other than its specific binding partner(s), here PD-L1.
- the term “specific” is also applicable where the specific binding member is specific for particular epitopes, such as epitopes on PD-L1, that are carried by a number of antigens, in which case the specific binding member will be able to bind to the various antigens carrying the epitope.
- the specific binding member may not bind, or may not show any significant binding, to programmed death-ligand 1 (PD-1) and CD80, such as human and mouse CD80, and human and mouse PD-1.
- PD-1 and CD80 such as human and mouse CD80, and human and mouse PD-1.
- a specific binding member of the invention preferably comprises a PD-L1 antigen binding site.
- the PD-L1 antigen binding site is located in a constant domain of the specific binding member, such as a CH1, CH2, CH3 or CH4 domain.
- the PD-L1 antigen binding site is located in the CH3 domain of the specific binding member.
- the PD-L1 binding site preferably comprises:
- the PD-L1 binding site comprises:
- the specific binding member of the invention may further comprise an arginine (R) at position 113 of the CH3 domain of the specific binding member.
- the specific binding member of the invention may comprise the following additional mutations:
- IMGT ImMunoGeneTics
- the first sequence is located at residues 14 to 18 of the CH3 domain
- the second sequence is located at positions 45.1 to 78 of the CH3 domain
- the third sequence is located at positions 92 to 100 or 92 to 101, of the CH3 domain, wherein the amino acid residue numbering is according to the ImMunoGeneTics (IMGT) numbering scheme.
- IMGT ImMunoGeneTics
- the position of the residues of the CH3 domain may alternatively be indicated according to consecutive numbering, also referred to as IMGT exon numbering, EU numbering, or Kabat numbering of the residues in the wild-type IgG1 CH3 domain sequence set forth in SEQ ID NO: 4.
- FIGS. 1 B- 1 C The concordance between IMGT numbering, consecutive numbering (IMGT exon numbering), EU numbering, and Kabat numbering of the residues of the WT IgG1 CH3 domain (SEQ ID NO: 4) are shown in FIGS. 1 B- 1 C .
- the positions modified in accordance with consecutive numbering of the amino acid residues of SEQ ID NO: 4 are positions 18 to 22, 46 to 51, and 73 to 81 of the CH3 domain, respectively, as shown in FIG. 1 A .
- the PD-L1 binding site comprises a first sequence located in the AB loop, a second sequence located in CD loop and a third sequence located in the EF loop,
- the PD-L1 binding site comprises a first sequence located in the AB loop, a second sequence located in CD loop and a third sequence located in the EF loop, wherein
- the PD-L1 binding site of the specific binding member of the invention may comprise a first sequence located in the AB loop, a second sequence located in CD loop and a third sequence located in the EF loop,
- the first, second and third sequences are preferably located in structural loops of the constant domain of the specific binding member.
- the introduction of sequences into the structural loop regions of antibody constant domains to create new antigen-binding sites is described, for example, in WO2006/072620 and WO2009/132876.
- the structural loops of antibody constant domains include the AB, CD and EF loops.
- the AB, CD, and EF loops are located at residues 11-18, 43-78 and 92-101 of the CH3 domain.
- the first sequence is located at residues 14 to 18 of the CH3 domain
- the second sequence is located at positions 45.1 to 78 of the CH3 domain
- the third sequence is located at positions 92 to 100 or 92 to 101, of the CH3 domain.
- a specific binding member of the invention may further comprise an alanine or valine residue at position 38, preferably an alanine residue.
- a specific binding member which comprises a first, second and third sequence, wherein
- the specific binding member of the invention may further comprise a valine residue, or an amino acid deletion, at position 101 of the CH3 domain (as shown in FIG. 1 A ).
- a specific binding member which comprises a first, second and third sequence, wherein
- the specific binding member of the invention may further comprise an alanine residue (A) at position 101 of the CH3 domain (as shown in FIG. 1 A ).
- A alanine residue
- a specific binding member which comprises a first, second and third sequence, wherein
- the specific binding member of the invention comprises a CH3 domain which comprises, has, or consists of the sequence set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79, preferably a CH3 domain with the sequence set forth in SEQ ID NO: 28, 32, 36, 39, 44, 48, 75 or 79.
- the specific binding member of the invention may comprise a CH3 domain which comprises, has, or consists of the sequence set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79, wherein the lysine residue (K) at the immediate C-terminus of the sequence shown in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79 has been deleted.
- the specific binding member of the invention may comprise a CH2 domain of an immunoglobulin G molecule, such as a CH2 domain of an IgG1, IgG2, IgG3, or IgG4 molecule.
- the specific binding member of the invention comprises a CH2 domain of an IgG1 molecule.
- the CH2 domain may have the sequence set forth in SEQ ID NO: 6.
- the CH2 domain of the specific binding member may comprise one or more mutations that reduce or abrogate binding of the CH2 domain to one or more Fc ⁇ receptors, such as Fc ⁇ RI, Fc ⁇ RIIa, Fc ⁇ RIIb, Fc ⁇ RIII and/or to complement.
- Fc ⁇ RI Fc ⁇ RI
- Fc ⁇ RIIa Fc ⁇ RIIa
- Fc ⁇ RIIb Fc ⁇ RIII
- Mutations to reduce or abrogate binding of the CH2 domain to one or more Fc ⁇ receptors and/or complement are known in the art (Wang et al., 2018). These mutations include the “LALA mutation” described in Bruhns, et al., 2009 and Hezareh et al., 2001, which involves substitution of the leucine residues at IMGT positions 1.3 and 1.2 of the CH2 domain with alanine (L1.3A and L1.2A).
- the generation of aglycosylated antibodies through mutation of the conserved N-linked glycosylation site by mutating the asparagine (N) at IMGT position 84.4 of the CH2 domain to alanine, glycine or glutamine is also known to decrease IgG1 effector function (Wang et al., 2018).
- complement activation (Clq binding) and ADCC are known to be reduced through mutation of the proline at IMGT position 114 of the CH2 domain to alanine or glycine (P114A or P114G) (Idusogie et al., 2000; Klein et al., 2016). These mutations may also be combined in order to generate antibody molecules with further reduced or no ADCC or CDC activity.
- the specific binding member may comprise a CH2 domain, wherein the CH2 domain comprises:
- the specific binding member comprises a CH2 domain, wherein the CH2 domain comprises:
- the CH2 domain may have the sequence set forth in SEQ ID NO: 5.
- the antibody molecule comprises a CH2 domain, wherein the CH2 domain comprises:
- the CH2 domain may have the sequence set forth in SEQ ID NO: 82.
- the specific binding member may comprise one or more further antigen-binding sites that bind one or more further antigens, in addition to the PD-L1 antigen-binding site located in the constant domain of the specific binding member.
- the one or more further antigen-binding sites preferably bind their cognate antigens specifically.
- the one or more further antigen-binding sites may bind PD-L1 or another antigen.
- the specific binding member may thus be a multispecific, for example a bispecific, trispecific, or tetraspecific molecule, preferably a bispecific molecule.
- the specific binding member is capable of simultaneously binding to PD-L1 and the one or more further antigens.
- Antibody molecules are known to have a modular architecture comprising discrete domains, which can be combined in a multitude of different ways to create multispecific, e.g. bispecific, trispecific, or tetraspecific antibody formats. Exemplary multispecific antibody formats are described in Spiess et al. (2015) and Kontermann (2012), for example.
- the specific binding members of the present invention may be employed in such multispecific antibody formats. This has the additional advantage of introducing a further antigen-binding site into such multispecific antibody format through the presence of the antigen-binding site in the constant domain, e.g. the CH3 domain, of the specific binding member.
- the specific binding member of the invention may be a heterodimeric antibody molecule, such as a heterodimeric complete immunoglobulin molecule, or a fragment thereof.
- one part of the antibody molecule will have a sequence or sequences as described herein.
- the specific binding member of the invention is a bispecific heterodimeric antibody molecule
- the specific binding member may comprise a heavy chain comprising a CH3 domain as described herein paired with a heavy chain which binds an antigen other than PD-L1.
- heterodimeric antibodies include knobs-into-holes (KIHs) technology, which involves engineering the CH3 domains of an antibody molecule to create either a “knob” or a “hole” to promote chain heterodimerization.
- KHs knobs-into-holes
- heterodimeric antibodies can be prepared through the introduction of charge pairs into the antibody molecule to avoid homodimerization of CH3 domains by electrostatic repulsion and to direct heterodimerization by electrostatic attraction.
- Examples of heterodimeric antibody formats include CrossMab, mAb-Fv, SEED-body, and KIH IgG.
- a multispecific specific binding member of the invention may comprise a complete immunoglobulin molecule or a fragment thereof and an additional antigen-binding moiety or moieties.
- the antigen-binding moiety may for example be an Fv, scFv or single domain antibody, and may be fused to the complete immunoglobulin molecule or a fragment thereof.
- Examples of multispecific antibody molecules comprising additional antigen-binding moieties fused to a complete immunoglobulin molecule include DVD-IgG, DVI-IgG, scFv4-IgG, IgG-scFv, and scFv-IgG molecules (Spiess et al., 2015; FIG. 1 ).
- multispecific antibody molecules comprising additional antigen-binding moieties fused to an immunoglobulin fragment comprising a CH3 domain
- examples of multispecific antibody molecules comprising additional antigen-binding moieties fused to an immunoglobulin fragment comprising a CH3 domain include scDiabody-CH3, Diabody-CH3, and scFv-CH3 KIH, for example (Spiess et al., 2015; FIG. 1 ).
- the specific binding member according to the present invention comprises a second antigen-binding site, wherein the second antigen-binding site preferably is a CDR-based antigen binding site.
- CDR-based antigen binding site refers to the antigen-binding site of a specific binding member variable region which is composed of six CDR residues.
- the second antigen-binding site is preferably specific to a checkpoint inhibitor, costimulatory molecule or tumour associated antigen.
- the antibody molecules against a given antigen such as a tumour associated antigen, and determination of the CDR sequences of such an antibody molecule, is well within the capabilities of the skilled person and many suitable techniques are known in the art. Furthermore, antibodies, including the CDR sequences, against various immune system modulators are known in the art. Thus, the skilled person would have no difficulty in preparing a specific binding member comprising, in addition to a PD-L1 binding site as described herein, a CDR-based antigen-binding site for a second antigen.
- the specific binding member of the invention does not comprise a CDR-based antigen binding site.
- the specific binding members of the present invention may also comprise variants of the structural loop, CH3 domain, CH2 domain, CH2 and CH3 domain, CDR, VH domain, VL domain, light chain or heavy chain sequences disclosed herein. Suitable variants can be obtained by means of methods of sequence alteration, or mutation, and screening.
- a specific binding member comprising one or more variant sequences retains one or more of the functional characteristics of the parent specific binding member, such as binding specificity and/or binding affinity for PD-L1.
- a specific binding member comprising one or more variant sequences preferably binds to PD-L1 with the same affinity as, or a higher affinity than, the (parent) specific binding member.
- the parent specific binding member is a specific binding member which does not comprise the amino acid substitution(s), deletion(s), and/or insertion(s) which has (have) been incorporated into the variant specific binding member.
- a specific binding member of the invention may comprise a structural loop, CH3 domain, CH2 domain, CH2 and CH3 domain, CDR, VH domain, VL domain, light chain or heavy chain sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity to a structural loop, CH3 domain, CH2 domain, CH2 and CH3 domain, CDR, VH domain, VL domain, light chain or heavy chain sequence disclosed herein.
- the specific binding member of the invention comprises a CH3 domain sequence which has at least 96%, at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity to the CH3 domain sequence set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79, preferably SEQ ID NO: 28, 32, 36, 39, 44, 48, 71, 75 or 79, most preferably 32, 44, 48, 71, 75 or 79.
- the specific binding member of the invention comprises a CH3 domain having at least 96% sequence identity to the CH3 domain sequence set forth in SEQ ID NO: 24.
- the specific binding member of the invention comprises a CH2 domain sequence, which has at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity to the CH2 domain sequence set forth in SEQ ID NO: 5 or 6.
- the specific binding member of the invention comprises, or consists of, a sequence, which has at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity to sequence set forth in SEQ ID NO: 25, 26, 29, 30, 33, 34, 37, 38, 40, 41, 45, 46, 49, 50, 72, 73, 76, 77, 80, or 81, most preferably SEQ ID NO: 45, 46, 49, 50, 72, 73, 76, 77, 80, or 81.
- the specific binding member of the invention comprises, or consists of, a sequence, which has at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity to sequence set forth in SEQ ID NO: 33 or 34.
- Tables 9A, B and C show that in the context of the molecules prepared in the examples, certain residues in the structural loops could not be modified without an increase in the off-rate of the Fcab when bound to PD-L1 as compared with the off-rate of the parent molecule.
- GAP Garnier GCG package, Accelerys Inc, San Diego USA.
- GAP uses the Needleman and Wunsch algorithm to align two complete sequences, maximising the number of matches and minimising the number of gaps. Generally, default parameters are used, with a gap creation penalty equalling 12 and a gap extension penalty equalling 4.
- Use of GAP may be preferred but other algorithms may be used, e.g. BLAST (which uses the method of Altschul et al., 1990), FASTA (which uses the method of Pearson and Lipman, 1988), or the Smith-Waterman algorithm (Smith and Waterman, 1981), or the TBLASTN program, of Altschul et al., 1990 supra, generally employing default parameters.
- the psi-Blast algorithm Altschul et al., 1997) may be used.
- a specific binding member of the invention may also comprise a structural loop, CH3 domain, CH2 domain, CH2 and CH3 domain, CDR, VH domain, VL domain, light chain or heavy chain sequence which has one or more amino acid sequence alterations (addition, deletion, substitution and/or insertion of an amino acid residue), preferably 20 alterations or fewer, 15 alterations or fewer, 10 alterations or fewer, 5 alterations or fewer, 4 alterations or fewer, 3 alterations or fewer, 2 alterations or fewer, or 1 alteration compared with a structural loop, CH3 domain, CH2 domain, CH2 and CH3 domain, CDR, VH domain, VL domain, light chain or heavy chain sequence disclosed herein.
- alterations may be made in one or more framework regions of the specific binding member.
- the specific binding member of the invention may comprise a CH3 domain sequence with one or more amino acid sequence alterations (addition, deletion, substitution and/or insertion of an amino acid residue), preferably 20 alterations or fewer, 15 alterations or fewer, 10 alterations or fewer, 5 alterations or fewer, 4 alterations or fewer, 3 alterations or fewer, 2 alterations or fewer, or 1 alteration compared with the CH3 domain sequence set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79.
- the specific binding member of the invention comprises a CH2 domain sequence, with one or more amino acid sequence alterations (addition, deletion, substitution and/or insertion of an amino acid residue), preferably 20 alterations or fewer, 15 alterations or fewer, 10 alterations or fewer, 5 alterations or fewer, 4 alterations or fewer, 3 alterations or fewer, 2 alterations or fewer, or 1 alteration compared with the CH2 domain sequence set forth in SEQ ID NO: 5 or 6.
- the specific binding member of the invention comprises or consists of a sequence, with one or more amino acid sequence alterations (addition, deletion, substitution and/or insertion of an amino acid residue), preferably 40 alterations or fewer, 30 alterations or fewer, 20 alterations or fewer, 15 alterations or fewer, 10 alterations or fewer, 5 alterations or fewer, 4 alterations or fewer, 3 alterations or fewer, 2 alterations or fewer, or 1 alteration compared with the sequence set forth in SEQ ID NO: 25, 26, 29, 30, 33, 34, 37, 38, 40, 41, 45, 46, 49, 50, 72, 73, 76, 77, 80, or 81.
- a specific binding member which competes with a specific binding member of the invention for binding to PD-L1, or which binds to the same epitope on PD-L1 as a specific binding member of the invention, wherein the specific binding member preferably comprises a PD-L1 antigen binding site located in a CH3 domain of the specific binding member.
- Methods for determining competition for an antigen by two antibodies are known in the art. For example, competition of binding to an antigen by two antibodies can be determined using surface plasmon resonance, such as Biacore. Methods for mapping the epitope bound by an antibody are similarly known in the art.
- the specific binding member of the invention may bind to human PD-L1, and/or cynomolgus monkey PD-L1. Preferably, the specific binding member of the invention binds to human PD-1.
- the specific binding member of the present invention is preferably capable of binding to PD-L1 expressed on the surface of a cell.
- the cell is preferably a cancer cell.
- the specific binding member comprises a second antigen-binding site, such as a CDR-based antigen binding site, specific for a second antigen
- the specific binding member is preferably capable of simultaneously binding to PD-L1 and the second antigen.
- the specific binding member is capable of simultaneously binding to PD-L1 and the second antigen, wherein the PD-L1 and the second antigen are expressed on the surface of a single cell, or on the surface of two separate cells.
- the specific binding member of the invention preferably binds to monomeric PD-L1, preferably human monomeric PD-L1, with an affinity (K D ) of 5 nM, 4 nM, 3 nM, or 2 nM, or an affinity which is greater.
- the specific binding member of the invention binds to PD-L1, preferably human PD-L1, with an affinity (K D ) of 2 nM, or an affinity which is greater.
- the specific binding member of the invention preferably binds to PD-L1, preferably human PD-L1 expressed on the surface of a cell, with an affinity (K D ) of 20 nM, 19 nM, 18 nM, 17 nM, or 16 nM, or an affinity which is greater.
- the specific binding member of the invention binds to PD-L1, preferably human PD-L1, expressed on the surface of a cell, with an affinity (K D ) of 16 nM, or an affinity which is greater.
- the binding affinity of a specific binding member to a cognate antigen, such as PD-L1 can be determined by surface plasmon resonance (SPR), such as Biacore, for example.
- SPR surface plasmon resonance
- the binding affinity of a specific binding member to a cognate antigen, such as PD-L1, expressed on a cell surface can be determined by flow cytometry.
- Fcabs have a smaller binding interface than monoclonal antibodies as the binding sites of Fcabs form a relatively compact antibody fragment with two binding sites situated in close proximity.
- the Fab arms of a typical mAb are separated by a flexible hinge region.
- the two antigen binding sites of an Fcab are also spatially close to each other, as compared with those of a typical mAb. Based on this smaller binding interface and reduced flexibility of the two binding sites it was surprising that the anti-PD-L1 Fcabs were able to bind to and inhibit PD-L1 with similar affinity and potency as a monoclonal antibody specific for PD-L1.
- the specific binding member may have an EC 50 in a T cell activation assay, such as a DO11.10 assay, of 9 nM or less, 8 nM or less, 7 nM or less, 6 nM or less, 5 nM or less, 4 nM or less, 3 nM or less, or 2 nM or less, preferably 2 nM or less, when the specific binding member is in the form of a complete immunoglobulin molecule, also referred to herein as a mAb 2 .
- a T cell activation assay such as a DO11.10 assay, of 9 nM or less, 8 nM or less, 7 nM or less, 6 nM or less, 5 nM or less, 4 nM or less, 3 nM or less, or 2 nM or less, preferably 2 nM or less, when the specific binding member is in the form of a complete immunoglobulin molecule, also referred to herein as a mAb 2 .
- the specific binding member may have an EC 50 in a T cell activation assay, such as a DO11.10 assay, of 2 nM or less, 1 nM or less, or 0.5 nM or less, preferably 0.5 nM or less, when the specific binding member is in the form of an Fcab, consisting of a CH3 domain, CH2 domain and truncated immunoglobulin hinge region located at the N-terminus of the CH2 domain.
- a T cell activation assay such as a DO11.10 assay
- the DO11.10 assay is an IL-2 release assay based on the T-lymphocyte and B-lymphocyte hybridoma cell lines and may be use for functional screening of the specific binding members of the invention. IL-2 release is a marker of T cell activation.
- the DO11.10 assay may be a DO11.10 assay as described in Example 6 herein.
- the DO11.10 assay may comprise preparing dilutions of the specific binding member of interest, for example in experimental media, such as complete DO11.10 culture medium without puromycin.
- the specific binding member may be mixed 1:1 with 4 ⁇ 10 5 /ml B cell hybridoma cells transduced with a lentiviral vector containing human PD-L1 to overexpress human PD-L1 (referred to as “B cell hybridoma cells”) (e.g. LK35.2 hPD-L1 cells) in experimental media in presence of 2.46 ⁇ M OVA peptide (e.g.
- 2 ⁇ 10 5 DO11.10 T cell hybridoma cells transduced with an empty lentiviral vector (referred to as “DO11.10 T cells”; (e.g. DO11.10 ⁇ LVX cells) per ml in 100 ⁇ l volume experimental media may be added to 100 ⁇ l of the B cell hybridoma cells/specific binding member mix. The cells may then be mixed before being incubated at 37° C., 5% CO 2 for 24 hours.
- Supernatants may be collected and assayed with a mouse IL-2 ELISA kit (e.g.
- cytokine concentration may be based on four parameter logistic curve fit (such as Gen5 Software, BioTek).
- concentration of mouse IL-2 may be plotted versus the log concentration of the specific binding member.
- the resulting curves may be fitted using the log (agonist) versus response equation, for example using GraphPad Prism.
- DO11.10 T cell hybridoma cells transduced with an empty lentiviral vector may be prepared using lentiviral transduction methodology, for example to generate DO11.10 cells containing the empty lentiviral vector pLVX using the Lenti-X HTX Packaging System.
- Lenti-X expression vector pLVX
- pLVX Lenti-X expression vector
- the DO11.10 cell line may be transduced using the lentiviral particles produced with the Lenti-X HTX Packaging System.
- B cell hybridoma cells such as LK35.2 B cell lymphoma cells (ATCC, HB-98) transduced with a lentiviral vector containing human PD-L1 to overexpress human PD-L1 may be prepared using lentiviral transduction methodology, e.g. using the Lenti-X HTX Packaging System.
- a Lenti-X expression vector (pLVX) containing human PD-L1 cDNA, may be co-transfected with a Lenti-X HTX Packaging Mix into the Lenti-X 293T Cell Line to generate virus.
- the B cell hybridoma cell line may be transduced using the lentiviral vectors produced with the Lenti-X HTX Packaging System.
- the specific binding member may have an EC 50 in a Staphylococcal Enterotoxin B (SEB) assay, of 5 nM or less, 4 nM or less, 3 nM or less, or 2 nM or less, preferably 2 nM or less, when the specific binding member is in the form of a complete immunoglobulin molecule, also referred to as a mAb 2 herein.
- SEB Staphylococcal Enterotoxin B
- the specific binding member may have an EC 50 in a Staphylococcal Enterotoxin B (SEB) assay, of 5 nM or less, 4 nM or less, 3 nM or less, 2 nM or less, 1 nM or less, 0.5 nM or less, 0.3 nM or less, or 0.2 nM or less, preferably 0.2 nM or less, when the specific binding member is in the form of an Fcab, consisting of a CH3 domain, CH2 domain and truncated immunoglobulin hinge region located at the N-terminus of the CH2 domain.
- SEB Staphylococcal Enterotoxin B
- Staphylococcal Enterotoxin B is a superantigen, and binds to MHC class II molecules on antigen presenting cells (APCs) and the vp chain of the T cell receptor (TCR), causing non-specific activation of T cells and cytokine release. There is no requirement for antigen-specific TCRs to be present for T cell activation.
- the SEB assay uses stimulated human peripheral blood mononuclear cells (PBMCs) with physiological levels of checkpoint inhibitors, and can be used to confirm that T cell activation is enhanced by the specific binding member in a human system.
- PBMCs peripheral blood mononuclear cells
- the SEB assay may be an SEB assay as described in Example 7 herein.
- the SEB assay may comprise:
- the specific binding member may be capable of blocking the interaction between PD-L1 and PD-1, preferably human PD-L1 and human PD-1, with an EC 50 of 30 nM or less, 20 nM or less, 15 nM or less, 14 nM or less, 13 nM or less, 12 nM or less, or 11 nM or less, preferably 11 nM or less.
- the specific binding member may be capable of blocking the interaction between PD-L1 and CD80, preferably human PD-L1 and human CD80, with an EC 50 of 50 nM or less, 45 nM or less, 40 nM or less, or 30 nM or less, preferably 30 nM or less, when the specific binding member is in the form of a complete immunoglobulin molecule, also referred to herein as a mAb 2 .
- the specific binding member may be capable of blocking the interaction between PD-L1 and CD80, preferably human PD-L1 and human CD80, with an EC 50 of 20 nM or less, 15 nM or less, 14 nM or less, 13 nM or less, 12 nM or less, 11 nM or less, or 10 nM or less, preferably 10 nM or less, when the specific binding member is in the form of an Fcab, consisting of a CH3 domain, CH2 domain and truncated immunoglobulin hinge region located at the N-terminus of the CH2 domain.
- the level of bound biotinylated human PD-L1 on the cells may be detected using streptavidin 647 and fluorescence levels may be measured using FACS, whereby the level of fluorescence detected indicates the level of binding of PD-L1 to PD-1 or human CD80 expressed on the cells.
- the specific binding member may have a melting temperature of 60° C. or higher, 61° C. or higher, 62° C. or higher, 63° C. or higher, 64° C. or higher, 65° C. or higher, 66° C. or higher, 67° C. or higher, or 68° C. or higher, preferably 65° C. or higher, 66° C. or higher, 67° C. or higher, or 68° C. or higher, more preferably 66° C. or higher, 67° C. or higher, or 68° C. or higher.
- the specific binding member may be in the form of a complete immunoglobulin molecule, also referred to herein as a mAb 2 .
- the melting temperature of a specific binding member of the invention may be measured by known methods.
- the melting temperature of a specific binding member of the invention may be measured by differential scanning colorimetry (DSC) or differential scanning fluorimetry (DSF).
- the specific binding member may show no more than 5%, 4%, or 3%, preferably 3% aggregation, when the specific binding member is in an aqueous solution. Aggregation of the specific binding member in an aqueous solution can be determined using size exclusion chromatography (SEC), for example.
- SEC size exclusion chromatography
- the specific binding member of the present invention may be conjugated to a bioactive agent, therapeutic agent or detectable label.
- the specific binding member may be referred to as a conjugate.
- conjugates find application in the treatment of diseases and conditions as described herein.
- the specific binding member may be conjugated to an immune system modulator, cytotoxic molecule, radioisotope, or detectable label.
- the immune system modulator or cytotoxic molecule may be a cytokine.
- the immune system modulator may also be a cell-surface receptor, or a biologically active fragment thereof, e.g. a fragment comprising or consisting of the ligand-binding domain of the receptor.
- the immune system modulator may be a ligand, e.g. a peptide ligand, of a cell-surface receptor, or a biologically active fragment of the ligand, e.g. a fragment comprising or consisting of the receptor-binding domain of the ligand.
- the detectable label may be a radioisotope, e.g. a non-therapeutic radioisotope.
- the specific binding member may be conjugated to the bioactive agent, therapeutic agent or detectable label by means of a peptide bond or linker, i.e. within a fusion polypeptide comprising said bioactive agent, therapeutic agent or detectable label and the specific binding member or a polypeptide chain component thereof.
- Other means for conjugation include chemical conjugation, especially cross-linking using a bifunctional reagent (e.g. employing DOUBLE-REAGENTSTM Cross-linking Reagents Selection Guide, Pierce).
- the specific binding member and the bioactive agent, therapeutic agent or detectable label may thus be connected to each other directly, for example through any suitable chemical bond or through a linker, for example a peptide linker.
- the peptide linker may be a short (2-20, preferably 2-15, residue stretch of amino acids). Suitable examples of peptide linker sequences are known in the art. One or more different linkers may be used. The linker may be about 5 amino acids in length.
- the chemical bond may be, for example, a covalent or ionic bond.
- covalent bonds include peptide bonds (amide bonds) and disulphide bonds.
- the specific binding member and bioactive agent, therapeutic agent, or detectable label (diagnostic agent) may be covalently linked, for example, by peptide bonds (amide bonds).
- the bioactive agent, therapeutic agent, or detectable label may be connected by a covalent bond, e.g. a peptide bond (amide bond), directly to the C-terminal or N-terminal end of the specific binding member.
- the bioactive agent, therapeutic agent, or detectable label is connected by a peptide bond (amide bond) directly to the N-terminal end of the specific binding member.
- the specific binding member and bioactive agent, therapeutic agent, or detectable label (diagnostic agent) may be produced (secreted) as a single chain polypeptide.
- the invention also provides isolated nucleic acids encoding the antibody molecules of the invention.
- An isolated nucleic acid may be used to express the specific binding member of the invention, for example, by expression in a bacterial, yeast, insect or mammalian host cell.
- a preferred host cell is a mammalian cell such as a CHO, HEK or NSO cell.
- the nucleic acid will generally be provided in the form of a recombinant vector for expression.
- In vitro host cells comprising such nucleic acids and vectors are part of the invention, as is their use for expressing the specific binding members of the invention, which may subsequently be purified from cell culture and optionally formulated into a pharmaceutical composition.
- the present invention thus further provides a method of producing the specific binding member of the invention, comprising culturing the recombinant host cell of the invention under conditions for production of the specific binding member. Methods for culturing suitable host cells as mentioned above are well-known in the art.
- the method may further comprise isolating and/or purifying the specific binding member.
- the method may also comprise formulating the specific binding member into a pharmaceutical composition, optionally with a pharmaceutically acceptable excipient or other substance as described below.
- PD-L1 is known to be expressed on many cancer cells, as well as cells of the immune system.
- a specific binding member of the invention may be used in a method of treating cancer in a patient.
- the patient is preferably a human patient.
- Cells of the cancer to be treated using the specific binding member of the invention may express PD-L1, e.g. on their cell surface.
- cells of the cancer to be treated may have been determined to express PD-L1, e.g. on their cell surface.
- Methods for determining the expression of an antigen on a cell surface are known in the art and include, for example, flow cytometry.
- cancer such as ovarian cancer, prostate cancer, colorectal cancer, fibrosarcoma, renal cell carcinoma, melanoma (advanced and metastatic melanoma), pancreatic cancer, breast cancer, glioblastoma multiforme, lung cancer (such as non-small cell lung cancer and small cell lung cancer), head and neck cancer (such as head and neck squamous cell carcinoma), stomach cancer (gastric cancer), bladder cancer, cervical cancer, uterine cancer (uterine endometrial cancer, uterine cervical cancer), vulvar cancer, testicular cancer, penile cancer, esophageal cancer, hepatocellular carcinoma, nasopharyngeal cancer, Merkel cell carcinoma, mesothelioma, DNA mismatch repair deficient colorectal cancer, DNA mismatch repair deficient endometrial cancer, thyroid cancer, Hodgkin's lymph
- melanoma colorectal cancer
- breast cancer bladder cancer
- renal cell carcinoma gastric cancer
- head and neck cancer such as squamous cell carcinoma of the head and neck
- mesothelioma lung cancer (such as non-small-cell lung cancer)
- ovarian cancer Merkel-cell carcinoma, pancreatic cancer, melanoma and hepatocellular carcinoma using anti-PD-L1 antibodies
- the cancer to be treated using the antibody molecules of the present invention may be a melanoma, colorectal cancer, breast cancer, bladder cancer, renal cell carcinoma, bladder cancer, gastric cancer, head and neck cancer (such as squamous cell carcinoma of the head and neck), mesothelioma, lung cancer (such as non-small-cell lung cancer), ovarian cancer, Merkel-cell carcinoma, pancreatic cancer, melanoma, or hepatocellular carcinoma.
- cancer refers to a particular type of cancer, such as breast cancer
- a cancer which originates from malignant transformation of a different tissue, e.g. ovarian tissue, may result in metastatic lesions in another location in the body, such as the breast, but is not thereby a breast cancer as referred to herein but an ovarian cancer.
- the cancer may be a primary or secondary cancer.
- the specific binding member of the present invention may be for use in a method of treating cancer in a patient, wherein the cancer is a primary tumour and/or a tumour metastasis.
- the specific binding members of the invention are also expected to find application in the treatment of infectious diseases, such as viral, bacterial, fungal and/or parasitic infections.
- infectious diseases such as viral, bacterial, fungal and/or parasitic infections.
- the infectious disease is a viral, bacterial or fungal disease, more preferably a viral or bacterial disease, most preferably a viral disease.
- the infectious disease may be chronic or acute, but is preferably chronic.
- viral diseases which may be treated with a specific binding member according to the present invention include: human immunodeficiency virus (HIV), influenza virus, enterovirus, hepatitis B virus (HBV), hepatitis C virus (HCV), hepatitis A virus (HAV), hepatitis D virus (HDV), and hepatitis E virus (HEV), respiratory syncytial virus (RSV), herpesvirus (such as Epstein-Barr virus, herpes simplex virus 1 (HSV-1), herpes simplex virus 2 (HSV-2), cytomegalovirus (CMV)), and papillomavirus infection.
- HCV human immunodeficiency virus
- HBV hepatitis B virus
- HCV hepatitis C virus
- HAV hepatitis D virus
- HEV hepatitis E virus
- RSV respiratory syncytial virus
- herpesvirus such as Epstein-Barr virus, herpes simplex virus 1 (HSV
- bacterial diseases which may be treated with a specific binding member of the invention include: Mycobacterium tuberculosis , gram-negative bacteria (such as Acinetobacter, Klebisella, Enterobacter ), gram-positive bacteria (such as Clostridium difficile, Staphylococcus aureus ), and Listeria (e.g. Listeria monocytogenes ) infection.
- gram-negative bacteria such as Acinetobacter, Klebisella, Enterobacter
- gram-positive bacteria such as Clostridium difficile, Staphylococcus aureus
- Listeria e.g. Listeria monocytogenes
- Examples of parasitic diseases which may be treated with a specific binding member of the invention include: Malaria, Toxoplasma , and Leishmania infection.
- the specific binding members of the invention are also expected to find application in the treatment of inflammation, diseases and conditions associated with inflammation, and inflammatory diseases, such as stroke, stroke-related inflammation, and vascular inflammation or vasculitis, e.g., medium and large vessel vasculitis, or vasculitis of the central and/or peripheral nervous system.
- inflammatory diseases such as stroke, stroke-related inflammation, and vascular inflammation or vasculitis, e.g., medium and large vessel vasculitis, or vasculitis of the central and/or peripheral nervous system.
- the specific binding members of the invention are designed to be used in methods of treatment of patients, preferably human patients.
- Specific binding members will usually be administered in the form of a pharmaceutical composition, which may comprise at least one component in addition to the specific binding member, such as a pharmaceutically acceptable excipient.
- a pharmaceutical composition of the present invention may comprise, in addition to active ingredient, a pharmaceutically acceptable excipient, carrier, buffer, stabiliser or other materials well-known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient.
- the precise nature of the carrier or other material will depend on the route of administration, which may be by injection, e.g. intravenous or subcutaneous.
- the specific binding member may be administered intravenously, or subcutaneously.
- Liquid pharmaceutical compositions generally comprise a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil.
- a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil.
- Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.
- the specific binding member, or pharmaceutical composition comprising the specific binding member is preferably in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
- Preservatives, stabilisers, buffers, antioxidants and/or other additives may be employed, as required.
- Many methods for the preparation of pharmaceutical formulations are known to those skilled in the art. See, for example, Robinson ed., Sustained and Controlled Release Drug Delivery Systems, Marcel Dekker, Inc., New York, 1978.
- a composition comprising a specific binding member according to the present invention may be administered alone or in combination with other treatments, concurrently or sequentially or as a combined preparation with another therapeutic agent or agents, dependent upon the condition to be treated.
- a specific binding member of the invention may be administered in combination with an existing therapeutic agent for the disease to be treated, e.g. a cancer as mentioned above.
- a specific binding member of the present invention may be administered to the patient in combination with a second anti-cancer therapy, such as chemotherapy, anti-tumour vaccination (also referred to as a cancer vaccination), radiotherapy, immunotherapy, an oncolytic virus, chimeric antigen receptor (CAR) T-cell therapy, or hormone therapy.
- a second anti-cancer therapy such as chemotherapy, anti-tumour vaccination (also referred to as a cancer vaccination), radiotherapy, immunotherapy, an oncolytic virus, chimeric antigen receptor (CAR) T-cell therapy, or hormone therapy.
- the specific binding member of the invention may act as an adjuvant in anti-cancer therapy, such as chemotherapy, anti-tumour vaccination, or radiotherapy.
- anti-cancer therapy such as chemotherapy, anti-tumour vaccination, or radiotherapy.
- administration of the specific binding member to the patient as part of chemotherapy, anti-tumour vaccination, or radiotherapy will trigger a greater immune response against the cancer associated antigen PD-L1, than is achieved with chemotherapy, anti-tumour vaccination, or radiotherapy alone.
- a method of treating cancer in a patient may thus comprise administering to the patient a therapeutically effective amount of a specific binding member according to the present invention in combination with a chemotherapeutic agent, anti-tumour vaccine, radionuclide, immunotherapeutic agent, oncolytic virus, CAR-T cell, or agent for hormone therapy.
- a chemotherapeutic agent, anti-tumour vaccine, radionuclide, immunotherapeutic agent, oncolytic virus, CAR-T cell, or agent for hormone therapy is preferably a chemotherapeutic agent, anti-tumour vaccine, radionuclide, immunotherapeutic agent, oncolytic virus, CAR-T cell, or agent for hormone therapy for the cancer in question, i.e.
- a chemotherapeutic agent, anti-tumour vaccine, radionuclide, immunotherapeutic agent, oncolytic virus, CAR-T cell, or agent for hormone therapy which has been shown to be effective in the treatment of the cancer in question.
- the selection of a suitable chemotherapeutic agent, anti-tumour vaccine, radionuclide, immunotherapeutic agent, oncolytic virus, CAR-T cell, or agent for hormone therapy, which have been shown to be effective for the cancer in question is well within the capabilities of the skilled practitioner.
- the method comprises administering to the patient a therapeutically effective amount of a specific binding member according to the present invention in combination with a chemotherapeutic agent
- the chemotherapeutic agent may be selected from the group consisting of: taxanes, cyctotoxic antibiotics, tyrosine kinase inhibitors, PARP inhibitors, B_RAF enzyme inhibitors, alkylating agents, platinum analogues, nucleoside analogues, thalidomide derivatives, antineoplastic chemotherapeutic agents and others.
- Taxanes include docetaxel, paclitaxel and nab-paclitaxel; cytotoxic antibiotics include actinomycin, bleomycin, anthracyclines, doxorubicin and valrubicin; tyrosine kinase inhibitors include sunitinib, erlotinib, gefitinib, axitinib, PLX3397, imatinib, cobemitinib and trametinib; PARP inhibitors include piraparib; B-Raf enzyme inhibitors include vemurafenib and dabrafenib; alkylating agents include dacarbazine, cyclophosphamide, temozolomide; platinum analogues include carboplatin, cisplatin and oxaliplatin; nucleoside analogues include gemcitabine and azacitidine; antineoplastics include fludarabine.
- chemotherapeutic agents suitable for use in the present invention include methotrexate, defactinib, entinostat, pemetrexed, capecitabine, eribulin, irinotecan, fluorouracil, and vinblastine.
- Vaccination strategies for the treatment of cancers has been both implemented in the clinic and discussed in detail within scientific literature (such as Rosenberg, S., 2000). This mainly involves strategies to prompt the immune system to respond to various cellular markers expressed by autologous or allogenic cancer cells by using those cells as a vaccination method, both with or without granulocyte-macrophage colony-stimulating factor (GM-CSF). GM-CSF provokes a strong response in antigen presentation and works particularly well when employed with said strategies.
- GM-CSF granulocyte-macrophage colony-stimulating factor
- the immunotherapeutic agent may be selected from the group consisting of: antibodies binding to a checkpoint inhibitor, costimulatory molecule or soluble factor, such as antibodies binding to CTLA-4, LAG-3, TIGIT, TIM-3, VISTA, CD73, CSF-1R, KIR, OX40, CD40, HVEM, TGFB, IL-10, CSF-1.
- the immunotherapeutic agent may one or more cytokines or cytokine-based therapies selected from the group consisting of IL-2, prodrug of conjugated IL2, GM-CSF, IL-7, IL-12, IL-9, IL-15, IL-18, IL-21, and type I interferon.
- cytokines or cytokine-based therapies selected from the group consisting of IL-2, prodrug of conjugated IL2, GM-CSF, IL-7, IL-12, IL-9, IL-15, IL-18, IL-21, and type I interferon.
- Administration may be in a “therapeutically effective amount”, this being an amount which is sufficient to show benefit to a patient. Such benefit may be at least amelioration of at least one symptom.
- “treatment” of a specified disease refers to amelioration of at least one symptom.
- the actual amount administered, and rate and time-course of administration will depend on the nature and severity of what is being treated, the particular patient being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the composition, the type of specific binding member, the method of administration, the scheduling of administration and other factors known to medical practitioners. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors, and may depend on the severity of the symptoms and/or progression of a disease being treated.
- Appropriate doses of specific binding members are well known in the art (Ledermann et al., 1991; and Bagshawe et al., 1991). Specific dosages indicated herein, or in the Physician's Desk Reference (2003) as appropriate for a specific binding member being administered, may be used. A therapeutically effective amount or suitable dose of a specific binding member can be determined by comparing its in vitro activity and in vivo activity in an animal model. Methods for extrapolation of effective dosages in mice and other test animals to humans are known. The precise dose will depend upon a number of factors, including the size and location of the area to be treated, and the precise nature of the specific binding member. Treatments may be repeated at daily, twice-weekly, weekly or monthly intervals, at the discretion of the physician. Treatment may be given before and/or after surgery, and may be administered or applied directly at the anatomical site of surgical treatment.
- Na ⁇ ve phage libraries displaying the CH3 domain of human IgG1 (IMGT numbering 1.4-130) with randomisation within the AB (residues 11-18) and EF (residues 92-101) loops were used for selection with the PD-L1 antigen described above.
- the libraries were selected in three rounds using Streptavidin Dynabeads (Thermo Fisher, 11205D) and Neutravidin binding protein coupled to Dynabeads (Thermo Fisher, 31000) to isolate the phage bound to biotinylated PD-L1 Fc.
- an excess of IgG Fc fragment of human plasma was added to each selection step to avoid the isolation of Fc binders.
- the outputs were screened by ELISA for binding to PD-L1 and positive binders sub-cloned and expressed as soluble Fcabs (containing a truncated hinge) in Pichia pastoris using EasySelect Pichia Expression Kit (Life Technologies, K1740-01). Of the 30 unique Fcab clones selected, 18 clones expressed as soluble proteins when transferred from phage to a soluble expression platform.
- the ability of the human PD-L1-binding Fcabs to block the interaction between human PD-L1 Fc and PD-1 or CD80 was studied in an ELISA based Receptor Binding Assay (RBA) using recombinant biotinylated human PD-L1 (described in Example 1.1) and recombinant human PD-1 Fc (R&D Systems, 1086-PD) or CD80 Fc (R&D Systems, 140-B1).
- RBA Receptor Binding Assay
- recombinant human PD-1 Fc or CD80 Fc were coated onto a Maxisorp plate (Thermo Scientific, 439454) at 0.5 or 1.0 ⁇ g/ml, respectively.
- the plates were incubated overnight at 4° C., washed once in PBS and subsequently blocked with 300 ⁇ l PBS containing 1% Tween for 2 hours at room temperature.
- control mAbs used were anti-human PD-L1 mAb (MIH1, Affymetrix eBioscience, 14-5983-82) and PD-L1 mAb YW243.55.S70 (“S70”) (Patent Pub. No.: US 2013/0045202 A1).
- Blocking solution was discarded and the biotinylated PD-L1 Fc/Fcab or control antibody mix was added to the maxisorp plates and incubated for 1 hour at room temperature whilst shaking at 450 rpm. Plates were washed 3 ⁇ with 300 ⁇ l PBS/Tween 0.05%, followed by 3 washes with 1 ⁇ PBS. Streptavidin conjugated to Horseradish Peroxidase (HRP) was diluted 1:1000 in PBS and 100 ⁇ l was added to the wells and incubated for 1 hour at 4° C. whilst shaking at 450 rpm. Plates were washed 3 ⁇ with 300 ⁇ l PBS/Tween 0.05%, followed by 3 washes with 1 ⁇ PBS.
- HRP Horseradish Peroxidase
- TMB substrate 100 ⁇ l TMB substrate (eBioscience, 00-4201-56) was added to each well. The reaction was stopped between 2-10 minutes after addition of TMB by the addition of 50 ⁇ l 1 M sulphuric acid solution. OD was read at 450-630 nm in a 96-well plate reader within 30 minutes of sulphuric acid addition and analysed using GraphPad Prism software (GraphPad Software, Inc.) 18 clones were tested, three of which, FS17-19, FS17-26 and FS17-33, were able to block the interaction between human PD-L1 Fc and PD-1. For these clones, a full dose response RBA was performed and their ability to block PD-L1 interaction with CD80 was analysed. FS17-19, FS17-26 and FS17-33 all showed potent blocking activity towards both the PD-L1:PD-1 interaction and PD-L1:CD80 interaction (data not shown).
- a streptavidin sensor chip (GE Healthcare, BR100032) was used to coat human PD-L1 Fc (described in Example 1.1) on flow cell 2, mouse PD-L1 Fc (described in Example 1.1) on flow cell 4, and flow cell 1 was not coated and was used as a reference.
- Human PD-L1 Fc and mouse PD-L1 Fc were coupled at about 10000 RU.
- Fcabs diluted in HBS-EP buffer GE Healthcare, BR100669) were injected at 10 ⁇ M or 3.3 ⁇ M and 3-fold dilutions for 5 minutes and then allowed to dissociate in buffer for 3 minutes. Regeneration was not required as the Fcabs completely dissociated in buffer.
- Subtracted data (flow cell 2—flow cell 1 or flow cell 4—flow cell 1) was analysed using BIAevaluation 3.2 to identify binding.
- the binding data (not shown) demonstrated that FS17-19, FS17-26 and FS17-33 bound to human PD-L1 Fc.
- FS17-19 was also found to be weakly cross-reactive to mouse PD-L1 Fc, but FS17-26 and FS17-33 were not.
- Human, mouse, and cynomolgus PD-L1 sequences (SEQ ID Nos 61, 62 and 63) were subcloned into pcDNA5FRT vector (Life Technologies) using Kpnl and Notl restriction sites.
- pcDNA5FRT vector Life Technologies
- human and mouse CD80 and human PD-1 (SEQ ID Nos 65, 66 and 64) Hindlll and Notl restriction sites were used. These vectors were then transformed into Flp-In T-REx 293 cell line (Life Technologies, R780-07) using Lipofectamine 2000 (Life Technologies, 11668-019).
- Cells were detached using cell dissociation buffer, washed once with PBS and 2 ⁇ 10 5 cells were plated in wells of a 96-well plate and then incubated with antibody diluted 1:20 in PBS for 1 hour at 4° C. Cells were washed once in PBS and then measured on an Accuri C6 cytometer (BD Biosciences) and the data was analysed using FlowJoX. Expression of human, cynomolgus and mouse PD-L1, as well as human CD80, mouse CD80 and human PD-1, was detected in the respective cell lines.
- the FS17-19, FS17-26 and FS17-33 Fcab were then tested for binding to HEK 293 cell-expressed human PD-L1, human CD80, human PD-1, mouse CD80 or mouse PD-L1 (see Example 1.5 for details regarding production of these cell lines).
- HEK 293 cells overexpressing these proteins were grown in DMEM (Life Technologies, 61965-026) containing 10% FBS (Life Technologies, 10270-1-6), 100 ⁇ g/ml Hygromycin B (Melford Laboratories Ltd, Z2475), 15 ⁇ g/ml Blasticidin (Melford Laboratories Ltd, B1105) and were detached from tissue culture flasks using cell dissociation buffer (Life Technologies, 13151-014) and seeded in V-bottom 96-well plates at 2 ⁇ 10 5 cells/well. Fcabs were incubated with the cells at 1 ⁇ M in a 100 ⁇ l volume for 1 hour at 4° C.
- PE- or FITC conjugated control mAbs were added at concentrations as recommended by the manufacturer in a 100 ⁇ l volume for 1 hour at 4° C.
- the antibodies used in Example 1.5 were used as control antibodies in this experiment.
- the plates were washed once with PBS by centrifuging the plate at 1500 rpm for 3 minutes at 4° C. and the supernatant was removed.
- Secondary antibody Goat anti-human Fc Alexa Fluor 488, Jackson ImmunoResearch, 109-546-098
- FS17-19, FS17-26 and FS17-33 were found to bind specifically to cell-surface human PD-L1 and not to human PD-1, human CD80, mouse PD-L1 or mouse CD80.
- HEK 293 cells expressing human PD-1 were seeded at 1 ⁇ 10 5 cells per well in a V-bottom 96-well plate in PBS.
- the relevant concentrations of Fcab (78 to 10000 nM, 2-fold dilutions), control IgG Fc (10000 nM) or control antibody (500 nM) were incubated with 250 ng/ ⁇ l biotinylated PD-L1 Fc in 100 ⁇ l 1 ⁇ PBS for 1 hour at room temperature whilst shaking at 450 rpm.
- Anti-human PD-L1 mAb MIH1
- the plates were centrifuged at 1500 rpm for 3 minutes at 4° C. to pellet the cells.
- the PBS was discarded and the pre-incubated Fcab or control antibody/biotinylated hPD-L1 Fc mixture was added to the wells for 1 hour at 4° C.
- the plates were centrifuged at 1500 rpm for 3 minutes at 4° C. to pellet the cells, supernatant was discarded and the cells were resuspended in PBS.
- Streptavidin conjugated to Alexa 647 was diluted 1:1000 in PBS and 100 ⁇ l was added to the wells for 30 minutes at 4° C.
- the plates were centrifuged, supernatant discarded and the cells resuspended in PBS as performed previously.
- the plate was read on an Accuri C6 cytometer (BD Bioscience) and the data analysed using FlowJoX.
- FS17-19, FS17-26 and FS17-33 showed potent blocking activity at the concentrations tested.
- Fcabs FS17-19 and FS17-33 showed higher blocking activity than FS17-26 and were therefore selected for affinity maturation.
- Example 2 Affinity Maturation and Functional Improvement of Fcab Clones Identified in Example 1
- Fcab FS17-19 underwent multiple rounds of affinity maturation starting with an NNK walk of the AB and EF loops, using a similar method to that described in 2.2.1 below.
- the NNK walk resulted in clones derived from FS17-19 which had very low functional activity when measured in a DO11 T-cell activation assay (see Example 6 for methodology), with an EC 50 that was 300-fold less than the positive control anti-PD-L1 antibody S1.
- a randomisation of the AB, CD and EF loops using a similar method to that described in 3.1 below, was carried out. Clones containing mutations in the AB loop showed improved activity in the DO11 T-cell activation assay to within 80-fold of the control antibody S1.
- One Fcab clone selected from the AB loop library underwent a further round of affinity maturation, focusing on just the CD and EF loops. Clones from this maturation did not show any improvement in functional activity over the previous round's clones.
- Anti-human PD-L1 Fcab FS17-33 was isolated from na ⁇ ve phage selections, as described in Example 1 above. The objective of this study was to gain improvements in FS17-33 activity by randomising individual residues in the binding loops by performing an NNK walk through the AB and EF loops.
- parsimonious mutagenesis libraries were generated by diversifying one amino acid residue at a time in the AB or EF loop of Fcab FS17-33, leading to a total of 12 individual libraries (see Table 1 below).
- the libraries were made with low redundancy NNK codons to represent all possible amino acids in the position of interest.
- Forward and reverse primers were designed according to the guidelines of Quickchange Lightning Site-Directed Mutagenesis Kit (Agilent, 200518), which was used to create the libraries.
- the FS17-33 Fcab sequence (CH3, CH2 and truncated hinge, additionally containing a LALA mutation in the CH2 domain) was cloned into the pTT5 expression vector (National Research Council of Canada) resulting in vector pTT5-FS17-33AA.
- the introduction of the LALA mutation in the CH2 domain of human IgG1 is known to reduce Fc ⁇ receptor binding (Bruhns, P., et al., 2009 and Hezareh et al., 2001). This was used as template for the mutagenesis libraries.
- PCR reactions were treated with Dpnl for 5 min at 37° C. to remove any parental DNA before being transformed into E. coli (Mix and Go, Zymo research, T3009) and plated on ampicillin-containing LB plates. Transformants were picked the following day and sequenced to confirm the mutations.
- DNA for transfection was prepared using standard DNA isolation methods and the parsimonious libraries were expressed in HEK Expi293 cells (DNA transfected using ExpiFectamine 293 Transfection Kit (Life Technologies, A14524) into Expi293F cells (Life technologies, A14527).
- the Fcab concentration in transfected HEK supernatants was determined by BLI using Octet (ForteBio). Fcabs were purified using mAb Select SuRe protein A columns.
- the HEK 293 supernatants were subsequently analysed in an ELISA-based RBA at two concentrations (10 nM and 50 nM, see Example 1.3 for methodology).
- Fcabs with potentially improved PD-L1/PD-1 blocking activity compared to FS17-33 protein in this assay were selected and sequenced. This identified particular positions in the sequence of FS17-33 that were critical for binding PD-L1, i.e. where few or no alternative amino acids were identified as suitable substitutions (see Table 2), as well as well as positions at which several potential alternative amino acids were possible.
- Several mutants were identified multiple times, enforcing confidence in the assay results.
- the twenty-seven Fcabs with the highest activity in the ELISA based blocking assay were expressed, purified and tested in a cell-based blocking assay (see Example 2.2.2 for methodology).
- Four AB loop and three EF loop clones were then shuffled by splice overlap extension PCR to generate new combinations (Horton et al., 2013).
- Shuffled Fcabs were cloned into the pTT5 expression vector, expressed and tested again for PD-L1/PD-1 blocking in both ELISA based blocking (as described in 1.3) and cell based blocking assays (as described in 2.2.2 below).
- the blocking activity of the clones produced in Example 2.2.1 was analysed in a cell-based assay using HEK 293 cells overexpressing human PD-L1 (see 1.5 for development of the cell line). Briefly, HEK 293 cells expressing human PD-L1 were seeded at 1 ⁇ 10 5 cells per well in a V-bottom 96-well plate in PBS. The relevant concentrations of Fcab or positive control anti-PD-L1 mAb YW243.55.S1 (“S1”) (Patent Pub. No. US 2013/0045202 A1) were incubated with 500 ng/ml biotinylated PD-1 Fc in 100 ⁇ l 1 ⁇ PBS for 45 minutes whilst shaking at 450 rpm.
- S1 positive control anti-PD-L1 mAb YW243.55.S1
- the plates were centrifuged at 1500 rpm for 3 minutes at 4° C. to pellet the cells. PBS was discarded and the pre-incubated Fcab or positive control/biotinylated hPD-1 Fc mixture was added to the wells for 1 hour at 4° C. The plates were centrifuged at 1500 rpm for 3 minutes at 4° C. to pellet the cells, supernatant was discarded and the cells were resuspended in PBS. Streptavidin conjugated to Alexa 488 was diluted 1:1000 in PBS and 100 ⁇ l was added to the wells for 30 minutes at 4° C. The plates were centrifuged at 1500 rpm for 3 minutes at 4° C. to pellet the cells, supernatant discarded and the cells were resuspended in PBS with DAPI. The plate was read on FACS Canto (BD Bioscience) and the data analysed using FlowJoX.
- Fcab clones with improved activity compared with FS17-33 were identified. An example of this is illustrated in Table 4, below, which shows the improved blocking activity for FS17-33-37 compared to the parent FS17-33 clone. This binding activity was similar to the positive control S1 mAb.
- the 11 Fcab clones with the highest activity in the cell based blocking assays were tested for binding to HEK 293 cells overexpressing human or cynomolgus PD-L1 (see Example 1.5 for methodology). All Fcabs showed dose-dependent binding to human PD-L1 with EC 50 values around 5-10 nM and bound to cynomolgus PD-L1 with EC 50 values around 100-200 nM.
- Fcab clone FS17-33-37 was chosen for further affinity maturation based on its low/minimal non-specific activity (without OVA peptide) in the DO11.10 T cell activation assay and based on its size exclusion (SE)-HPLC profile. Size exclusion chromatography (SEC) profiles were assessed on percentage monomeric protein and the elution time, favoring clones with an elution time closer to that of wild type IgG Fc (see FIGS. 2 A- 2 C ). A full dose titration of FS17-33-37 in the cell binding, cell based blocking assay and DO11.10 T cell activation assays were performed to further characterise FS17-33-37 (data not shown). The results confirmed that FS17-33-37 showed potent cell binding and blocking activity but weak activity in the DO11.10 T cell activation assay.
- the NNK walk mutagenesis of the FS17-33 Fcab led to the identification of multiple clones with increased PD-L1:PD-1 blocking activity, to a level that is similar to the anti-PD-L1 positive control S1 mAb. Additionally, the anti-human PD-L1 binding FS17-33 derived Fcabs were cross-reactive to cynomolgus PD-L1.
- the FS17-33-derived Fcabs may be unable to bind to monomeric PD-L1 with a high enough affinity to result in functional activity when measured by the DO11.10 T cell activation assay.
- the results obtained from the blocking and binding assays may have been influenced by an avidity effect that was a result of the high levels of human PD-L1 used in these assays.
- FS17-33-37 was affinity matured to introduce the maximum diversity.
- the FS17-33-37 PTT5 plasmid DNA (see 2.2.1) was used as a template to prepare libraries containing randomized loops.
- a portion of the AB loop (residues 14-18), the CD loop (residues 45.1-78), and the EF loop (residues 92-94, and 97-101) was randomized using NNK primers (AB loop) or ELLA primers (CD and EF loop).
- ELLA primers specify the codons used for each amino acid and their relative abundance within the mix. Only cysteine was excluded from the mix and no bias was given to any other amino acid.
- the individual loop libraries (one library for each of the AB, CD and EF loops) went through several rounds of selection to enrich for Fcab clones with improved binding to biotinylated hPD-L1-his (comprising a his-tag) compared to the parent clone FS17-33-37.
- the outputs from each single loop library were shuffled in an unbiased manner to identify the loop combinations with the highest affinity for hPD-L1.
- the outputs from the selections were shuffled by isolating DNA from selected cells from each of the single loop libraries and shuffling DNA by splice overlap extension PCR to generate unbiased loop recombinations. This DNA was then used to create a new yeast display library. Yeast cells (EBY100, Invitrogen V835-01) were transformed using the amplified PCR product along with a yeast vector (pYD1dem, Invitrogen V835-01). The shuffled library then underwent multiple rounds of selection to enrich for the clones with the highest affinity for monomeric PD-L1.
- Soluble Fcabs were expressed in HEK cells from the pTT5 Fcab expression vector and purified using mAb Select SuRe protein A columns.
- Size exclusion chromatorgraphy was carried out to determine whether any of the affinity matured Fcabs identified in 3.1 showed aggregation. All purified Fcabs were analysed by SE-HPLC using an Agilent 1100 series HPLC with a Zorbax GF-250 column (Agilent). All clones containing an MFYGP motif in the EF loop showed excessive aggregation or did not enter the column at all. As a result, these clones were not considered to represent suitable candidate Fcabs and were not tested further. The remaining 40 clones did not show aggregate peaks, but they did have split peaks or shoulders. For example, as shown in FIGS.
- clone FS17-33-116 showed a split peak ( FIG. 2 B ) that wasn't present in the parent FS17-33-37 clone ( FIG. 2 A ). The potential cause of these deviations will be discussed later, but was not considered a reason to remove these Fcab clones from the candidate selection process.
- the Fcabs from the selection using the monomeric, His-tagged antigen were screened for their off-rate when bound to human PD-L1 using BIAcore. Briefly, biotinylated antigen was coated on the chip at 10 ⁇ g/mL to 585 RU and supernatant from the expressed clones was flowed over the chip at 30 ⁇ L/minute. This assay was carried out with both monomeric and dimeric PD-L1 antigen. The dissociation was carried out for 6 minutes. Analysis was carried out using the BIAevaluate software. Curves were double subtracted from the blank flow cell and from a run with no Fcab. Curves were then aligned and normalized for comparison.
- the 33 Fcab clones identified in 3.3 were tested for activity using the DO11.10 T cell activation assay and compared with the anti-PD-L1 antibody S70 as a positive control (see Example 6.1 for experimental details). A titration of each Fcab was used to calculate the EC 50 values for each Fcab in this assay to facilitate comparison. Five clones (FS17-33-85, FS17-33-87, FS17-33-114 and FS17-33-116) all had EC 50 values between 0.28 to 0.5 nM, which is comparable to the positive control, the S70 antibody.
- Clones FS17-33-85, FS17-33-87, FS17-33-114 and FS17-33-116 had very similar sequences with only 1 or 2 amino acid differences, none of which are in the AB or CD loops (see Table 5, which identifies the differences in sequence between these clones, all of which are located in the EF loop or the framework region).
- the AB loop sequence present in all clones from the shuffle library had not been identified in the screening of the individual AB loop library and contained an amino acid deletion, with the result that the AB loop sequence between residues 14 to 18 was only four amino acids in length, rather than five. The exact location of the deletion was not known.
- deletions at positions 17 and 18 of the AB loop could not be substituted with another amino acid without a significant worsening in the off-rate (faster) when the Fcab was bound to PD-L1 (see Table 9A below), the deletion had to be located at either residue 14, 15 or 16 of the AB loop.
- the deletion is thought to be an artefact in the shuffle library resulting from accidentally truncated mutagenesis primers. Fcab clones comprising such deletions in their loop regions are usually removed during the selection process, as deletions rarely result in Fcabs which retain antigen-binding activity.
- Fcab clone FS17-33-116 showed a strong improvement in affinity compared to the parental clone, FS17-33-37, as well as an improved affinity compared with the positive control antibody, S70 (see Table 6). This is primarily due to a slower off-rate of the Fcab when bound to PD-L1.
- PD-1 R&D systems 1086-PD
- PD-L2 R&D systems 1224-PL
- the Fcab was then flowed over the chip at a 1000-fold concentration range. No binding was observed to either PD-1 or PD-L2 at these concentrations. However, the Fcab did bind to PD-L1. This indicates that Fcab FS17-33-116 binds specifically to PD-L1.
- the Fcab was tested in an SEB assay (see Example 7.1 for experimental details). Since this assay uses cells donated from patients, the cells are expressing endogenous levels of PD-L1. These expression levels are considerably lower than the LK35.2 cells used in the DO11.10 assay.
- the SEB assay the FS17-33-116 Fcab matched the positive control S70 antibody in both potency and efficacy (see Table 7). No activity was seen with the anti-FITC antibody, 4420, which served as a negative control. Since the S70 antibody has been shown to have efficacy in the clinic, it is expected that the FS17-33-116 Fcab will similarly have clinical efficacy
- Fcabs may be incorporated into conventional immunoglobulin molecules to provide bispecific antibodies, comprising both the CDR-based antigen-binding site of the immunoglobulin molecule and an additional binding site in a constant domain of the immunoglobulin as a result of the incorporation of the Fcab.
- Such molecules are also referred to as mAb 2 molecules.
- “mock” mAb 2 may also be prepared.
- a “mock” mAb 2 is a mAb 2 where the Fcab of interest has been incorporated into an immunoglobulin molecule comprising a CDR-based antigen binding site for an antigen which is not expected to bind in the context in which the “mock” mAb 2 is to be used. This allows the Fcab to be tested in a format which is comparable to an intact immunoglobulin molecule without any effect from the CDR-based antigen binding site of the molecule.
- a “mock” mAb 2 consisting of an IgG1 comprising the FS17-33-116 anti-human PD-L1 Fcab described above was prepared in order to allow the characterisation of this Fcab in mAb 2 format.
- This mock mAb 2 was prepared by substituting part of the CH3 domain of the FS17-33-116 Fcab, comprising the AB, CD and EF loops, for the corresponding region of the CH3 domain of the anti-FITC antibody 4420, and also comprised the LALA mutation in the CH2 domain of the heavy chain of the antibody.
- the heavy and light chain sequences of antibody 4420 are shown in SEQ ID NOS 51 and 52, respectively (Bedzyk, W. D., et al., 1989 and Bedzyk, W.
- the mock mAb 2 was called FS17-33-116/4420 mAb 2 .
- the mock mAb 2 was produced by transient expression in HEK293-6E cells and purified using mAb Select SuRe protein A columns.
- the “mock” FS17-33-116/4420 mAb 2 was compared to Fcab FS17-33-116 to ensure the desired qualities were maintained.
- a SEC profile for the mAb 2 showed that the mAb 2 no longer had a split peak or shoulder (see FIG. 2 C ).
- a small amount of aggregation was observed, as expected for the 4420 mAb, as this antibody is known to aggregate.
- the FS17-33-116/4420 mAb 2 was then tested for binding and functional activity.
- the FS17-33-116/4420 mAb 2 was tested in a DO11.10 T cell activation assay (see Example 6 for methodology).
- the FS17-33-116/4420 mAb 2 showed a drop in activity in this assay compared with the FS17-33-116 Fcab. This drop was significant, but small.
- the EC 50 for FS17-33-116/4420 mAb 2 remained below 1 nM.
- FS17-33-37 The affinity maturation of FS17-33-37 produced Fcab clones with significant improvements in off-rate and functional activity.
- One of these clones, FS17-33-116 showed similar activity to the clinically-verified positive control S70 antibody in both the DO11.10 and SEB assays. Since the positive control mAb has been shown to have efficacy in the clinic, it is expected that the FS17-33-116 Fcab and molecules comprising this Fcab, such as mAb 2 molecules, will also have clinical efficacy.
- the FS17-33-116 Fcab was also inserted into a “mock” mAb 2 format and similar results were observed as reported for the Fcab format, albeit with a slight reduction in activity when measured in the DO11.10 T cell activation assay. Without wishing to be bound by theory, it is believed that the Fcabs, but not the mAb 2 , self-associate and form dimers in the context of a cell-based assay and that this could account for the difference in activity between the Fcab and mock mAb 2 formats of FS17-33-116.
- the FS17-33-116 Fcab described in Example 3 displayed a high affinity for PD-L1 and high activity in a DO11.10 T cell activation assay, it was considered that further improvements could be made to the Fcab to remove potential manufacturing sequence liabilities and to improve biophysical properties.
- the FS17-33-116 Fcab contained a methionine in the EF loop and showed a small degree of dimerization. Therefore, the FS17-33-116 clone was further engineered to address these issues.
- Site directed mutagenesis was carried out using primers that contain the degenerate codon NNK at IMGT position M98 in the EF loop of FS17-33-116.
- the primers did not include codons that code for cysteine and glycine, as these amino acids are also considered potential sequence liabilities.
- the Met substitution clones were expressed and tested as Fcabs in an off-rate screen to identify clones that had similar binding kinetics to human PD-L1 as clone FS17-33-116. From this experiment it was seen that hydrophobic residues replaced the Met with a minimal increase in the off-rate of the Fcab when bound to PD-L1 (within two fold of the off-rate of the parental clone FS17-33-116). The only exception was proline, which showed the fastest off-rate of all of the Fcab clones tested.
- Fcabs in which the methionine was substituted with phenylalanine or tyrosine showed significant aggregation and retention on the column. Thus, these clones were excluded from further analysis.
- Three Fcab clones were identified with an off-rate within two-fold of the parental clone. These contained leucine, isoleucine or valine in place of the methionine at position 98. These were Fcabs FS17-33-289, FS17-33-288, and FS17-33-296, respectively, as shown in FIGS. 1 A- 1 D and SEQ ID Nos 31, 27 and 35 below.
- an Fcab clone was prepared in which the framework mutation A38V was reverted back to the wild-type alanine to reduce the mutational load of the Fcab.
- the A38V mutation was observed in clone FS17-33-116 but not in sibling clones with similar activity (see Table 5). This reverse mutation was made based on the FS17-33-289 Fcab, and the resulting Fcab termed FS17-33-334.
- FIGS. 1 A- 1 D A summary of sequences for the AB, CD and EF loops and the residue at position 38 for these clones is provided in FIGS. 1 A- 1 D .
- FS17-33-289, FS17-33-288, FS17-33-296, and FS17-33-334 were then tested for their binding affinity to PD-L1, ability to block the PD-1/PD-L1 interaction and activity in a DO11.10 T cell activation assay in both a Fcab and mock mAb 2 formats (see 4.2 for details regarding generation of the mock mAb 2 ), as further described in Examples 6 and 7 below.
- “Mock” mAb 2 consisting of an IgG1 comprising Fcabs, including Facbs FS17-33-289, FS17-33-288, FS17-33-296, FS17-33-334, described in 4.1 above, and FS17-33-449 and FS17-33-451 described in 4.3 below, were prepared in order to allow the characterisation of these Fcabs in mAb 2 format.
- These mock mAb 2 were prepared by substituting part of the CH3 domain of the Fcabs, comprising the AB, CD and EF loops, for the corresponding region of the CH3 domain of the anti-hen egg white lysozyme antibody HeID1.3, either with or without the LALA mutation in the CH2 domain of the heavy chain of the antibody.
- the heavy and light chain sequences of antibody HeID1.3 with the LALA mutation are shown in SEQ ID Nos 53 and 54, respectively. Generation of the HeID1.3 antibody is described in Tello et al. 1993.
- the mock mAb 2 were produced by transient expression in HEK293-6E cells and purified using mAb Select SuRe protein A columns. The mock mAb 2 produced are listed in Table 8.
- “mock” mAb 2 comprising the FS17-33-449 and FS17-33-451 anti-human PD-L1 Fcabs described in 4.3 below were prepared as described in the preceding paragraph but using the anti-Cytomegalovirus (CMV) gH glycoprotein antibody MSL109. Generation of the MSL109 antibody is described in WO1994/016730 A1. These mAb 2 were prepared with the LALA mutation in the CH2 domain. The heavy and light chain sequences of antibody MSL109 with the LALA mutation are shown in SEQ ID Nos 55 and 56. The mAb 2 were produced by transient expression in HEK293-6E cells and purified using mAb Select SuRe protein A columns.
- CMV Cytomegalovirus
- mAb 2 comprising the FS17-33-289, FS17-33-449 and FS17-33-451 anti-human PD-L1 Fcabs described in 4.1 and 4.3 were prepared as described above but using the anti-CTLA-4 mAb ipilimumab. These mAb 2 were prepared without the LALA mutation in the CH2 domain. The heavy and light chain sequences of ipilimumab are shown in SEQ ID Nos 67 and 68. The CTLA-4 containing mAb 2 were produced by transient expression in HEK293-6E cells and purified using mAb Select SuRe protein A columns.
- each position in the AB, CD and EF loops of the parent Fcab clones (Fcab FS17-33-116 for the AB and EF loops, and mock mAb 2 F17-33-334AA/HeID1.3 for the CD loop) was mutated to all possible amino acid substitutions and the resulting Fcabs screened for binding to PD-L1 and functional activity followed by an assessment of their biophysical properties.
- Tables 9A-C list the number of different amino acid substitutions at each position of the AB, CD and EF loops, as well as the specific amino acid substitutions at the relevant positions, which resulted in no reduction in the off-rate of the Fcab/mAb 2 on PD-L1 greater than two-fold compared with the parent Fcabs, Fcab FS17-33-116 for the AB and EF loop mutants and mock mAb 2 F17-33-334AA/HeID1.3 for the CD loop mutants.
- residues at positions 95 and 96 in the EF loop were not mutated in the na ⁇ ve or affinity maturation libraries, as the residues at these positions are known to be important for the structural integrity of the EF loop (Hasenhindl et al., 2013).
- Binding to PD-L1 was measured using an Octet system. Binding of the AB and EF loop mutants to PD-L1 was tested in Fcab format, while the CD loop mutants were tested in mock mAb 2 format based on antibody HeID1.3. These mock mAb 2 were constructed as described in Example 4.2.1 above.
- the Fcabs and mock mAb 2 were captured via a protein A tip and then exposed to monomeric PD-L1-his.
- the off-rates of the Fcabs/mock mAb 2 when bound to PD-L1 were then calculated using the Octet analysis software and compared to the parental clone, FS17-33-116 or F17-33-334AA/HeID1.3.
- a two-fold difference in the off-rate is within the error of this type of assay and therefore clones that fell within this range were considered to have an equivalent off-rate when bound to PD-L1 as the parent clone, FS17-33-116 or F17-33-334AA/HeID1.3.
- the Fcab clones with a WT amino acid at that position were tested in mock mAb 2 format to determine their off-rate when bound to PD-L1.
- the mock mAb 2 were constructed based on the HeID1.3 antibody as described in Example 4.2.1 above. The off-rate was determined using a Biacore 3000 instrument, where the mock mAb 2 were captured on a protein A chip and monomeric hPD-L1 was flowed over the captured antibodies.
- Fcabs were prepared in which the deleted residues 14 and 101 in the AB and EF loops were restored to the WT residue and tested. Fcabs with WT reversions showing minimal to no worsening in the off-rate of the mock mAb 2 when bound to PD-L1 (faster) were also combined with deletions at residues 14 and 101 in the AB and EF loops. Surprisingly, restoring the deleted residue at position 14 in the AB loop resulted a significant worsening in the off-rate when the mock mAb 2 was bound to PD-L1 (faster) and no further studies were done with these Fcab clones.
- a subset of the Fcab clones in mock mAb 2 format (the mock mAb 2 were prepared based on FS17-33-334AA/HELD1.3) was selected from the NNK walk mutagenesis screen described above on the basis that the clones showed no loss in activity greater than 2-fold as measured in the DO11.10 T cell activation assay (see Example 6 for experimental details) compared with the parent clone FS17-33-334AA/HELD1.3 (see 4.2.1 for preparation of this mock mAb 2 ).
- the subset of Fcabs comprised Fcabs with mutations at position 15 of the AB loop and positions 93, 97 and 100 of the EF loop, whereby S could be changed to E, H, L, F or Y at position 15, N could be changed to A, Q or H at position 93, Q could be changed to R, H or S at position 97, and D could be changed to A at position 100.
- the subset of mock mAb 2 described above was then further modified by replacing the deleted amino acid at position 101 in the EF loop, thereby creating a second panel of mock mAb 2 molecules which comprised a reduced number of mutations compared with the WT Fcab (see FIGS. 1 A- 1 D ) and thus had a reduced mutational burden.
- This second panel of mock mAb 2 including FS17-33-449AA/HELD1.3 that contains a wild-type reversion at permissive position 15, were tested for function in a DO11.10 T cell activation assay (see Example 6 for experimental set-up) and binding to hPD-L1. The results are shown in Table 9E.
- Fcab and mAb 2 binding to human PD-L1 was assessed by both BIAcore and in a cell binding assay.
- the mAb 2 were captured using an anti-Fab antibody coated on a CM5 chip (GE 28-9582-20 AC) and Fcabs were captured using a Protein A chip (GE 29127556) using a Biacore T200 (GE).
- the capture level was minimized to 200RU and a fast flow rate of 75 ⁇ l/min was used.
- Cell binding assays were performed by incubating Fcabs or mAb 2 proteins with either control HEK293 cells or HEK293 cells overexpressing hPD-L1 or cynomolgus PD-L1 cells for 1 hour at 4° C. Fcab/mAb binding was subsequently detected using an anti-human Fc 488 detection antibody. Fluorescent signal intensities were measured using a FACS canto.
- Table 10 shows that all of the clones tested had a high affinity for monomeric and cell-expressed human and cynomolgus PD-L1.
- Table 11 shows that all of the clones tested were able to potently block hPD-1/hPD-L1 and hPD-L1/hCD80 interactions.
- the panel of Fcabs containing the LALA mutation was tested in a DO11.10 based T cell activation assay in Fcab and mAb 2 format.
- mAb 2 were produced as described in Example 4 and tested in a DO11.10 T cell assay as described below.
- IL-2 release assay based on the DO11.10 OVA-specific T-lymphocyte and LK35.2 B-lymphocyte hybridoma cell lines was used for functional screening of the mAb 2 .
- IL-2 release is a marker of T cell activation.
- T cells, expressing endogenous murine PD-1, were transfected with empty vector (pLVX).
- B-cells were transfected with human PD-L1 construct.
- the mAb 2 were tested with and without the LALA mutation (AA), depending on the mAb 2 in question.
- the Fab portion of the mAb 2 was either the variable region of a monoclonal antibody directed against hen egg white lysozyme (HeID1.3), the FITC molecule (4420), the human CTLA-4 (ipilimumab). Details regarding the construction of these mAb 2 are provided in Example 4.
- Lentiviral transduction methodology was used to generate DO11.10 cells (National Jewish Health) containing the empty lentiviral vector pLVX using the Lenti-X HTX Packaging System (Cat. No 631249).
- Lenti-X expression vector (pLVX) (Cat. No 631253) was co-transfected with a Lenti-X HTX Packaging Mix into the Lenti-X 293T Cell Line (Cat. No 632180) to generate virus.
- the DO11.10 cell line was transduced using the lentiviral particles produced with the Lenti-X HTX Packaging System.
- Lentiviral transduction methodology was used to generate LK35.2 B cell lymphoma cells (ATCC, HB-98) over-expressing human PD-L1 using the Lenti-X HTX Packaging System (Cat. No 631249).
- Lenti-X expression vector (pLVX) (Cat. No 631253), containing, human PD-L1 cDNA, was co-transfected with a Lenti-X HTX Packaging Mix into the Lenti-X 293T Cell Line (Cat. No 632180) to generate virus.
- the LK35.2 cell line was transduced using the lentiviral vectors produced with the Lenti-X HTX Packaging System.
- DMEM Gibco, 61965-026
- FBS Gibco, 10270-106
- mM Sodium Pyruvate Gibco, 11360-070
- puromycin Gibco, A11138-03
- Experimental medium complete DO11.10 culture medium without puromycin.
- the results are shown in FIGS. 3 A- 3 B and 4 A- 4 B and Table 12.
- the human Fcabs showed significant activity in the T cell activation assay with potencies (EC 50 ) in the range of 0.2 nM comparable to the positive control mAbS1 antibody.
- Both the Fcab and the mock mAb 2 released the PD-L1 mediated inhibition of the T cells.
- the conversion of the Fcab into a mock mAb 2 format resulted in a partial reduction of the IL-2 release.
- Staphylococcal Enterotoxin B assay Fcab, PD-L1 mock mAb 2 and PD-L1/CTLA-4 mAb 2 were tested in the human-PBMC based Staphylococcal Enterotoxin B assay (SEB assay).
- Staphylococcal Enterotoxin B is a superantigen, and binds to MHC class II molecules on antigen presenting cells (APCs) and the v ⁇ chain of the T cell receptor (TCR), causing non-specific activation of T cells and cytokine release. There is no requirement for antigen to be present to see T cell activation.
- the SEB assay uses stimulated human cells (PBMCs) with physiological levels of checkpoint inhibitors, and can be used to confirm that T cell activation is enhanced by the mAb 2 in a human system.
- PBMCs were isolated from leukocyte cones by Ficoll gradient separation.
- CD4+ T cells were isolated using human CD4+ T Cell Isolation Kit (Miltenyi Biotec Ltd, 130-096-533) according to the manufacturer's instruction.
- Human T-Activator CD3/CD28 Dynabeads (Life technologies, D) were resuspended by vortexing. Beads were transferred to a sterile 15 ml tube and 10 ml RPMI (Life Technologies, 61870044) with 10% FBS (Life Technologies, 10270106) and 1 ⁇ Penicillin Streptomycin (Life Technologies, 15140122) was added to wash Dynabeads. The supernatant was discarded.
- CD4+ T cells at 1.0 ⁇ 10 6 cells/ml in RPMI with 10% FBS and 1 ⁇ Penicillin Streptomycin Solution and 50 IU/ml recombinant human IL2 (Peprotech, 200-02-50 ⁇ g) with 3:1 bead to cell ratio were transferred to T75 flask (Greiner Bio-one, 690195) and incubated at 37° C.+5% CO 2 . After 3 days the cells were gently resuspended and counted. The cell density was maintained between 0.8-1 ⁇ 10 6 cells/ml by adding fresh media (RPMI-10% FBS+Penicillin Streptomycin Solution 1 ⁇ +50 IU/ml rhulL2) as needed.
- CD3/28 beads were removed and CD4+ T cells were rested overnight at 1 ⁇ 10 6 cells/ml fresh media RPMI-10% FBS+Penicillin Streptomycin Solution 1 ⁇ with reduced 10 IU/ml rhulL2. The cells were stored frozen until required.
- monocytes were isolated from human PBMCs using human Pan Monocyte Isolation Kit, (Miltenyi Biotec Ltd, 130-096-537) following the manufacturer's instructions. Monocytes were differentiated to iDCs using human Mo-DC Differentiation Medium (Miltenyi Biotec Ltd, 130-094-812) following the manufacturer's instructions.
- Expanded T cells and MoiDCs were thawed before the experiment, washed with AIM medium (Gibco, 12055-091) and incubated at 37° C., 5% CO 2 in AIM medium.
- Dilutions of Fcabs, mAb 2 , anti-human positive control mAb (S1 (with or without LALA mutation) or S70) or the human IgG1 isotype control mAb (anti-HELD1.3 or anti-FITC clone 4420) were prepared in AIM medium.
- MoiDCs were mixed with T cells from the same donor at a 1:10 ratio (5 ml of iDCs at 2 ⁇ 10 5 cells/ml were combined with 5 ml of T cells at 2 ⁇ 10 6 cells/ml). 20 ⁇ l of SEB (Sigma, S4881) at 0.1 ⁇ g/ml was added to 10 ml of the cells.
- the concentration of human IFN ⁇ was plotted vs the log concentration of mAb 2 or mAb and the resulting curves were fitted using the log (agonist) vs response equation in GraphPad Prism software.
- Table 13 shows the EC 50 values and the span of the IFN ⁇ release in the SEB assay with cells from individual cell donors.
- FIGS. 5 A- 5 C show representative plots of the SEB assay with a single donor. As shown in the DO11.10 T cell activation assay, some of the Fcab clones showed activity close to the anti-PD-L1 positive control (S70). However, the conversion of the Fcab into a mock mAb 2 format resulted in a partial reduction of the IFN ⁇ release.
- the PD-L1/CTLA-4 mAb 2 showed greater activation than the mock mAb 2 and ipilimumab as single agent or in combination.
- the FS17-33-449/CTLA-4 mAb 2 did show an activity not greater but comparable to the combination of the mock mAb 2 and ipilimumab. This result showed that a better synergistic activity can be achieved with the mAb 2 .
- a representative plot of the SEB assay illustrating these results is provided as FIG. 6 B .
- the Fcab molecules, FS17-33-449 and FS17-33-451 have improved biophysical properties as determined by dynamic light scattering (DLS), protein A purification and solubility analysis (see Example 4.3).
- DLS dynamic light scattering
- protein A purification and solubility analysis see Example 4.3.
- Tm melting temperature of the Fc domain of these molecules is lower than that of the wild-type Fc domain. The reduced melting temperature suggests that these molecules may be less stable than the wild-type Fc domain which might potentially impact the integrity and solubility of these molecules during manufacture and/or the stability of these molecules during long-term storage.
- Fcabs FS17-33-449 and FS17-33-451 were thermally stressed during selection of an error prone phage display library as described below.
- the aim of this selection campaign was to identify mutations that increase the melting temperature of the Fcab molecules and therefore their thermal stability without reducing target binding and activity of the Fcabs.
- the CH3 domain library was then subjected to selection for CH3 domains with higher melting temperatures, by first heating the phage to 80° C. for 10 minutes, followed by selection for binding to human PD-L1 (hPD-L1) antigen at a concentration of 20 nM.
- Human PD-L1-his (Acro biosciences, PD1-H5229), biotinylated as described in Example 3.1, was used as antigen source for the selections. After one round of selection, the output was screened for binding to hPD-L1 in a phage ELISA and hits were sequenced. 86 unique CH3 domain sequences were identified.
- the selected CH3 domain sequences were subcloned and expressed in “mock” (MSL109) mAb 2 format with the LALA mutation in the CH2 domain, as described in Example 4.2.1, for further screening.
- the parent FS17-33-449 and FS17-33-451 clones in “mock” (MSL109) mAb 2 format with the LALA mutation in the CH2 domain were used as controls.
- the supernatants were then tested for binding to hPD-L1 antigen using the Octet system and 29 clones were shown to retain binding to this antigen. These clones were then expressed on a larger scale and 21 of the clones could be purified following expression.
- the K D values for these 21 clones were then measured as described in Example 5.1, and the results are summarised in Table 14. 17 of the 21 clones were chosen on the basis that they had K D values for binding to hPD-L1 below 1 nM and tested for their activity in a DO11.10 T cell activation assay using the method described in Example 6 (see Table 14 for the assay results). The thermal stability of the six Fcab clones with the highest activity based on their EC 50 values in the DO11.10 assay was then assessed by determining the melting temperatures of these Fcabs using differential scanning calorimetry (DSC) (see Table 14 for results).
- DSC differential scanning calorimetry
- Tm of the CH2 and CH3 domains of the Fcab clones show only small differences, it is not possible to determine from the profiles which peak represents the CH2 domain and which represents the CH3 domain, respectively.
- Table 14 therefore reports the Tms for Peak 1 and Peak 2, with the lowest transition temperature being most representative of the Tm of the overall molecule.
- Three of the Fcabs showed a significant increase in melting temperature compared with the parent Fcab, namely Fcabs FS17-33-488, FS17-33-539 and FS17-33-548.
- Table 15 shows the EF loop sequences of these three Fcabs and any additional framework mutation in the CH3 domain that these Fcabs contained.
- Fcabs FS17-33-488 and FS17-33-539 both contained a mutation of the histidine (H) at position 113 of the CH3 domain to an arginine (R) residue.
- H histidine
- R arginine
- Fcab FS17-33-488 also comprised an alanine residue at position 101, as well as additional mutations in the CH3 domain framework (see Table 15 for details).
- Fcab clones FS17-33-539 and FS17-33-548 were chosen for further analysis from the panel of Fcabs tested, as these combined an improved melting temperature with a low mutational burden, compared with the FS17-33-488 Fcab which included a larger number of mutations.
- a greater improvement in the melting temperature was observed for these two clones (an increase of 3-4° C.) than for the FS17-33-488 clone (an increase of about 2° C.), as compared to the melting temperate of the relevant parental clone (FS17-33-449 or FS17-33-451; see Table 15 for details) (Table 14).
- Example 8.1 The Fcabs identified in Example 8.1, FS17-33-539AA/MSL109 and FS17-33-548AA/MSL109, were produced on a larger scale and purified as described in Example 4.2.1. Binding of the mock mAb 2 to hPD-L1 was assessed by both SPR, using a Biacore T200 system (GE Healthcare), and in a cell binding assay as described in Example 5.1. To measure the affinity of the clones to monomeric hPD-L1-his, the mock mAb 2 were captured using an anti-Fab antibody coated on a CM5 chip (GE 28-9582-20 AC) using a Biacore T200 system.
- CM5 chip GE 28-9582-20 AC
- the capture level was minimised to 200 RU and a fast flow rate of 75 ⁇ l/min was used.
- Both the human (Acro biosciences, PD1-H5229) and cynomolgus (Acro Biosciences, PD1-C52H4) monomeric antigens were titrated and flowed over the captured mock mAb 2 .
- the analysis of the data was done using the Biacore T200 evaluation software. Curves subtracted against a blank flow cell and a run with no antigen were analysed using a 1:1 fitting model with no bulk analysis and R max analysed locally.
- Cell binding assays were performed by incubating the mock mAb 2 with either control HEK293 cells or HEK293 cells overexpressing hPD-L1 or cynomolgus PD-L1 cells for 1 hour at 4° C. Mock mAb 2 binding was subsequently detected using an anti-human Fc 488 detection antibody. Fluorescent signal intensities were measured using a FACS Canto flow cytometer (BD Biosciences).
- Table 16 shows that all of the mock mAb 2 tested had a high affinity for monomeric and cell-expressed human and cynomolgus PD-L1.
- Binding EC 50 (nM) Binding affinity - K D (nM) Cell- Cell- Human Cynomolgus expressed expressed monomeric monomeric human cynomolgus Mock mAb 2 PD-L1 PD-L1 PD-L1 PD-L1 FS17-33-539AA/ 0.90 0.95 4.8 10 MSL109 FS17-33-548AA/ 0.6 0.45 1.5 2.1 MSL109
- the ability of the mock mAb 2 to block hPD-1/hPD-L1 and hPD-L1/hCD80 interactions was tested in cell-based Receptor Blocking Assays (RBA).
- RBA cell-based Receptor Blocking Assays
- the anti-PD-L1 antibody S70 in an IgG1 framework and comprising the LALA mutation (G1AA/S70) was used as a positive control.
- biotinylated hPD-L1-Fc-Avi was incubated for 1 hour with titrating concentrations of mock mAb 2 ranging from 2000 nM to 3 ⁇ M.
- the mix was incubated for another hour with HEK293 cells overexpressing either hPD-1 or hCD80.
- the level of bound biotinylated hPD-L1-Fc-Avi on the HEK293 cells was detected using streptavidin 647 and fluorescence levels were measured using the FACS Canto flow cytometer.
- Table 17 shows that all the clones tested were able to fully block hPD-1/hPD-L1 and hPD-L1/hCD80 interactions.
- the activity of the mock mAb 2 was tested in a DO11.10 cell-based T cell activation assay as described in Example 6.1, and in an SEB assay as described in Example 7.1. The results are shown in Table 18. Due to the potential for variability to be seen between assays, e.g. depending on the donor source of the stimulated PBMCs used in the SEB assay, one of the parental clones, FS17-33-451 (in “mock” MSL109 mAb 2 format and comprising the LALA mutation), was also included in both assays as a direct comparator. Both of the mock mAb 2 tested retained T cell activation activity in both assays. The EC 50 of the mock mAb 2 in these assays was either improved, or comparable, to that of the parental clone FS17-33-451AA/MSL109.
- the melting temperature (Tm) of the FS17-33-539 and FS1733-548 Fcabs was measured using a Microcal VP-capillary differential scanning calorimeter.
- the G1AA/MSL109 mAb 2 was included as positive control in this analysis as it contains wild-type CH3 domain and a LALA containing CH2 domain.
- Samples were measured in sample buffer at a concentration of 0.2 mg/ml. The scan rate was set at 60° C./hr and data collected between 35° C. and 100° C. Data analysis was performed with Origin 7.0 software. The results are shown in Table 19.
- the CH3 sequence is shown in bold (SEQ ID NO: 67) QVQLVESGGGVVQPGRSLRLSCAAS GFTFSSY TMHWVRQAPGKGLEWV TFISYDGNNK YYADSVKGR FTISRDNSKNTLYLQMNSLRAEDTAIYYC ARTGWLGPFDY WGQGTLVTVSSASTKGPSVFPLAPSSKSTS GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP SNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPRE PQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
Landscapes
- Health & Medical Sciences (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
The application relates to specific binding members which bind to programmed death-ligand 1 (PD-L1). The specific binding members preferably comprise a PD-L1 antigen-binding site located in structural loops of a constant domain of the specific binding member. The specific binding members find application, for example, in the treatment of cancer, as well as infectious diseases, inflammation, diseases and conditions associated with inflammation, and inflammatory diseases.
Description
- This application is a Continuation of U.S. application Ser. No. 16/955,450 filed Jun. 18, 2020, which is a national stage filing under 35 U.S.C. § 371 of International Patent Application No. PCT/EP2018/085834, filed Dec. 19, 2018, which claims priority under 35 U.S.C. § 119(e) to U.S. Provisional Application No. 62/657,195, filed Apr. 13, 2018, and U.S. Provisional Application No. 62/607,686, filed Dec. 19, 2017, the entire content of each of which are incorporated herein by reference in their entireties.
- The contents of the electronic sequence listing (F083170004US01-SEQ-ZJG.xml; Size: 114,976 bytes; and Date of Creation: Dec. 5, 2022) is herein incorporated by reference in its entirety.
- The present invention relates to specific binding members which bind to programmed death-ligand 1 (PD-L1). The specific binding members preferably comprise a PD-L1 antigen-binding site located in structural loops of a constant domain of the specific binding member. The specific binding members of the invention find application, for example, in the treatment of cancer, as well as infectious diseases and inflammation.
- Programmed cell death 1 (PD-1) and its ligands PD-L1 (CD274, B7-H1) and PD-L2 (B7-DC) deliver inhibitory signals that regulate the balance between T cell activation, tolerance, and immunopathology. PD-L1 is constitutively or transiently expressed on multiple immune cell types and certain tumour cells.
- PD-L1 is a type I transmembrane protein with two Ig-like domains within the extracellular region, a transmembrane domain and a short cytoplasmic domain. The complete human PD-L1 sequence can be found under UniProt accession no. Q9NZQ7. The cytoplasmic domain has no known signal transduction motif suggesting that there is no signaling by PD-L1 on interaction of the ligand with its receptor. The molecular weight of human PD-L1 is 40 kDa (290 amino acids) and it shares 70% and 93% amino acid identity with the murine and cynomolgus orthologs of PD-L1, respectively.
- Human PD-L1 binds to its receptor PD-1 with an affinity (KD) of 770 nM. PD-1 is expressed on activated T cells, B cells and myeloid cells, and modulates activation or inhibition of cellular immune responses. Binding of PD-L1 to PD-1 delivers an inhibitory signal, reducing cytokine production and proliferation of T cells. Consequently, PD-L1 expression by cells can mediate protection against cytotoxic T lymphocyte (CTL) killing and is a regulatory mechanism that dampens chronic immune responses during viral infections. Cancer, as a chronic and pro-inflammatory disease, subverts this immune-protective pathway through up-regulation of PD-L1 expression to evade the host immune response. In the context of an active immune response, IFNγ also upregulates the expression of PD-L1.
- PD-L1 also mediates immune suppression through interaction with another protein, B7.1 (also known as CD80), blocking its ability to deliver one of the secondary signals of activation on T cells through CD28.
- PD-L1 expression has been shown in a wide variety of solid tumours. Of 654 samples examined in one study, spanning 19 tumours from different sites, 14% were PD-L1 positive. The highest PD-L1 positive frequencies were seen in head and neck (31%), cervical (29%), cancer of unknown primary origin (CUP; 28%), glioblastoma multiforme (GBM; 25%), bladder cancer (21%), oesophageal cancer (20%), triple negative (TN) breast cancer (18%), and hepatocarcinoma (15%) (Grosso et al, 2013). Tumour-associated expression of PD-L1 has been shown to confer immune resistance and potentially protect tumour cells from T cell mediated apoptosis.
- Therapies targeting PD-L1 have shown excellent results in murine in vivo studies. In the B16 murine model of melanoma, treatment with anti-PD-L1 combined with either GVAX or FVAX vaccination strategies resulted in a significant effect both on survival (30 days for control vs 52 days for PD-L1-treated) and percentage of tumour-free (5%) animals upon conclusion of the study (Curran et al., 2010). Anti-PD-L1 therapy has also been used to study the mechanism of immune suppression in the P815 murine mastoma model. P815 cells injected into mice normally trigger a strong immune response, which results in their rejection. When PD-L1 is expressed on P815 cells, these cells escape immune attack, which in turn can be negated through administration of anti-PD-L1 antibodies (lwai et al, 2002). It is evident that targeting the PD-1/PD-L1 axis in immunogenic human cancers (Herbst et al., 2014) results in a survival advantage through stimulation of an anti-cancer immune response (Wolchok et al., 2013; Larkin et al., 2015).
- Clinical trials have shown the clinical benefit of targeting PD-L1 in patients leading to the approval of three anti-PD-L1 targeting monoclonal antibodies to date.
- Atezolizumab (Tecentriq™) is a humanised IgG1 antibody which binds to PD-L1. It is in clinical trials as a monotherapy and also in combination with other biologic and/or small molecule therapies for treatment of solid cancers, including colorectal cancer, breast cancer, non-small-cell lung cancer, small cell lung cancer, bladder cancer, and renal cell carcinoma.
- Avelumab (Bavencio™) is a fully human IgG1 antibody which binds to PD-L1 and is undergoing clinical testing in a number of cancers including bladder cancer, gastric cancer, head and neck cancer, mesothelioma, non-small-cell lung carcinoma, ovarian cancer, renal cancer, Merkel-cell carcinoma, and metastatic urothelial carcinoma (UC).
- Durvalumab (Imfinzi™) is a human IgG1 antibody which binds to PD-L1 and is being tested in clinical trials alone or in combination with tremelimumab in squamous cell carcinoma of the head and neck, bladder cancer, pancreatic cancer and with other biologic and small molecules in trials for additional solid cancers such as gastric cancers, melanoma and unresectable hepatocellular carcinoma.
- Durvalumab has been approved for the treatment of patients with locally advanced or metastatic urothelial carcinoma and unresectable stage Ill NSCLC.
- Further anti-PD-L1 antibodies, including BMS-936559 (NCT00729664), have been tested in clinical trials, and others are in preclinical testing.
- Infectious diseases show many parallels with oncology. It is thought that the role of PD-L1 in immune regulation could be harnessed to maximise the immune response against pathogens.
- Immunomodulation in infectious disease is an emerging area of medicine and early reviews suggest that PD-L1 blockade may improve biological responses to infection, in particular, helping to counteract T cell exhaustion, manage immune-mediated clearance, and generate long-term immunity (Wykes, M. N. and Lewin, S. R., 2018).
- Furthermore, recent studies also suggest that the PD-1/PD-L1 pathway may be a therapeutic target for the treatment of inflammation, diseases and conditions associated with inflammation, and inflammatory diseases, such as stroke and stroke-related inflammation (Bodhankar et al., 2015), and vascular inflammation or vasculitis, e.g., medium and large vessel vasculitis, or vasculitis of the central and/or peripheral nervous system (Hid Cadena et al., 2018 and Daxini et al., 2018).
- Whilst there are various anti-PD-L1 therapeutics in development, current data shows that overall treatment with existing anti-PD-L1 monotherapies results in a response in less than 50% of cancer patients. The spectrum and severity of reported adverse reactions differs between antibodies in clinical testing. To increase the objective response rate (ORR), and/or seek to reduce adverse effects, anti-PD-L1 antibodies may be combined with other biologics, such as antibodies against other checkpoint regulators, as well as with small molecule therapies and other immune system activating approaches, such as tumour vaccines.
- Thus, there remains a need in the art for additional molecules which can target PD-L1 and which find application in cancer therapy.
- In addition, there also remains a need in the art for additional molecules which can target PD-L1 and which find application in the treatment of infectious diseases.
- Furthermore, there also remains a need in the art for additional molecules which can target PD-L1 and which find application in the treatment of inflammation, diseases and conditions associated with inflammation, and inflammatory diseases.
- The present inventors have prepared a number of specific binding members comprising a non-native binding site for PD-L1 in the CH3 domain of the specific binding members. These specific binding members were isolated through an initial screen of a naïve CH3 domain phage library, followed by a complex programme of iterative rounds of mutagenesis, screening and selection to isolate variants of the specific binding members initially selected which had improved activity and affinity for PD-L1.
- The present inventors found that specific binding members, identified from an initial affinity maturation programme following the initial screen of the naïve CH3 domain phage library, showed increased affinity for PD-L1, as well as increased blocking of the interaction between PD-L1 and its ligand PD-1. However, the selected specific binding members unexpectedly had very weak activity in a T cell activation assay.
- Following additional rounds of mutagenesis, screening and selection, the inventors identified specific binding members which not only had high affinity for PD-L1 but also excellent activity in a T cell activation assay. These specific binding members surprisingly comprised CH3 domains which had a deletion in the AB structural loop sequence (located at either
residue - Further rounds of mutagenesis, screening and selection were performed by the inventors in order to remove potential manufacturing sequence liabilities and to improve the biophysical properties of the selected specific binding members.
- The above approach allowed the present inventors to identify a large number of specific binding members which comprise a binding site for PD-L1 in their CH3 domain, and which showed excellent binding to PD-L1, and were either shown, or are expected, to have high activity in T cell activation assays. Based on these characteristics, it is expected that the specific binding members of the invention will find application in the treatment of human cancers, as well as infectious diseases, inflammation, diseases and conditions associated with inflammation, and inflammatory diseases, through inhibition of PD-L1.
- The specific binding members were also shown to have a high affinity for cynomolgus PD-L1, which is comparable to the affinity for human PD-L1 and is expected to be useful in the evaluation of the properties of the specific binding members in cynomolgus monkey disease models. The reason for this is that the results obtained are more likely to be predictive of the effects of the specific binding member in human patients than when a specific binding member having a higher variability in its affinity for human and cynomolgus PD-L1 is tested in cynomolgus monkey models.
- Thus, in a first aspect the present invention provides a specific binding member which binds to PD-L1, and comprises a PD-L1 antigen-binding site located in a constant domain, such as CL, CH1, CH2 or CH3 domain, preferably a CH1, CH2 or CH3 domain, most preferably a CH3 domain of the specific binding member.
- The PD-L1 binding site of the specific binding member of the invention preferably comprises:
-
- (i) a first sequence located in the AB structural loop at
positions 14 to 18 of the CH3 domain, wherein the specific binding member comprises an amino acid deletion atposition - (a) amino acid sequence SGYW (SEQ ID NO: 23), or
- (b) a variant of SEQ ID NO: 23, wherein
- the serine (S) is substituted with amino acid A, E, F, G, H, I, L, P, R, T, V, or Y, and/or
- the glycine (G) is substituted with amino acid A, D, E, F, H, K, L, N, P, R, T, V, or Y;
- (ii) a second sequence located in the CD structural loop at positions 45.1 to 78 of the CH3 domain, wherein the second sequence consists of:
- (a) amino acid sequence EPQYWA (SEQ ID NO: 11), or
- (b) a variant of SEQ ID NO: 11, wherein
- the glutamic acid (E) is substituted with amino acid A, G, H, I, L, N, Q, R, S, or W, and/or
- the proline (P) is substituted with amino acid A, D, E, G, H, N, Q, W, or Y, and/or
- the glutamine (Q) is substituted with amino acid H, or N, and/or
- the tyrosine (Y) is substituted with amino acid A, D, H, T, or V, and/or
- the alanine (A) is substituted with amino acid D, E, G, L, R, S, or W; and
- (iii) a third sequence located in the EF structural loop at
positions 92 to 100 of the CH3 domain, wherein the third sequence consists of: - (a) amino acid sequence SNWRWQMDD (SEQ ID NO: 19), or
- (b) a variant of SEQ ID NO: 19, wherein
- the serine (S) at
position 92 is substituted with amino acid A, or G, and/or - the asparagine (N) at
position 93 is substituted with amino acid A, E, F, G, H, I, K, L, Q, R, S, T, or Y, and/or - the glutamine (Q) at
position 97 is substituted with amino acid A, D, E, F, G, H, K, L, N, R, S, or V, and/or - the methionine (M) at
position 98 is substituted with amino acid F, I, L, V, W, or Y, and/or - the aspartic acid (D) at
position 99 is substituted with amino acid E, A, I, L, R, S, T, V, W, or Y, and/or - the aspartic acid (D) at
position 100 is substituted with amino acid A, E, F, I, K, L, N, R, V, W, or Y; and
- the serine (S) at
- wherein the amino acid at
position 101 of the CH3 domain is valine (V) or is absent; wherein the amino acid residue numbering is according to the ImMunoGeneTics (IMGT) numbering scheme.
- (i) a first sequence located in the AB structural loop at
- The present invention therefore provides:
- [1] A specific binding member which binds to PD-L1, and comprises a PD-L1 antigen-binding site located in a CH3 domain of the specific binding member, wherein the PD-L1 binding site comprises:
-
- (i) a first sequence located in the AB structural loop at
positions 14 to 18 of the CH3 domain, wherein the specific binding member comprises an amino acid deletion atposition - (ii) a second sequence located in the CD structural loop at positions 45.1 to 78 of the CH3 domain, and
- (iii) a third sequence located in the EF structural loop at
positions 92 to 100 of the CH3 domain.
- (i) a first sequence located in the AB structural loop at
- [2] A specific binding member according to [1], wherein the first sequence consists of amino acid sequence SGYW (SEQ ID NO: 23), or a variant thereof.
- [3] A specific binding member according to [1] or [2], wherein the second sequence consists of amino acid sequence EPQYWA (SEQ ID NO: 11), or a variant thereof.
- [4] A specific binding member according to any one of [1] to [3], wherein the third sequence consists of amino acid sequence SNWRWQMDD (SEQ ID NO: 19), or a variant thereof.
- [5] A specific binding member according to any one of [1] to [4], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the serine (S) is substituted with amino acid A.
- [6] A specific binding member according to any one of [1] to [4], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the serine (S) is substituted with amino acid E.
- [7] A specific binding member according to any one of [1] to [4], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the serine (S) is substituted with amino acid F.
- [8] A specific binding member according to any one of [1] to [4], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the serine (S) is substituted with amino acid G.
- [9] A specific binding member according to any one of [1] to [4], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the serine (S) is substituted with amino acid H.
- [10] A specific binding member according to any one of [1] to [4], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the serine (S) is substituted with amino acid I.
- [11] A specific binding member according to any one of [1] to [4], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the serine (S) is substituted with amino acid L.
- [12] A specific binding member according to any one of [1] to [4], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the serine (S) is substituted with amino acid P.
- [13] A specific binding member according to any one of [1] to [4], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the serine (S) is substituted with amino acid R.
- [14] A specific binding member according to any one of [1] to [4], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the serine (S) is substituted with amino acid T.
- [15] A specific binding member according to any one of [1] to [4], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the serine (S) is substituted with amino acid V.
- [16] A specific binding member according to any one of [1] to [4], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the serine (S) is substituted with amino acid Y.
- [17] A specific binding member according to any one of [1] to [16], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the glycine (G) is substituted with amino acid A.
- [18] A specific binding member according to any one of [1] to [16], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the glycine (G) is substituted with amino acid D.
- [19] A specific binding member according to any one of [1] to [16], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the glycine (G) is substituted with amino acid E.
- [20] A specific binding member according to any one of [1] to [16], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the glycine (G) is substituted with amino acid F.
- [21] A specific binding member according to any one of [1] to [16], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the glycine (G) is substituted with amino acid H.
- [22] A specific binding member according to any one of [1] to [16], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the glycine (G) is substituted with amino acid K.
- [23] A specific binding member according to any one of [1] to [16], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the glycine (G) is substituted with amino acid L.
- [24] A specific binding member according to any one of [1] to [16], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the glycine (G) is substituted with amino acid N.
- [25] A specific binding member according to any one of [1] to [16], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the glycine (G) is substituted with amino acid P.
- [26] A specific binding member according to any one of [1] to [16], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the glycine (G) is substituted with amino acid R.
- [27] A specific binding member according to any one of [1] to [16], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the glycine (G) is substituted with amino acid T.
- [28] A specific binding member according to any one of [1] to [16], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the glycine (G) is substituted with amino acid V.
- [29] A specific binding member according to any one of [1] to [16], wherein the first sequence consists of a variant of SEQ ID NO: 23, in which the glycine (G) is substituted with amino acid Y.
- [30] A specific binding member according to any one of [1] to [29], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the glutamic acid (E) is substituted with amino acid A.
- [31] A specific binding member according to any one of [1] to [29], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the glutamic acid (E) is substituted with amino acid G.
- [32] A specific binding member according to any one of [1] to [29], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the glutamic acid (E) is substituted with amino acid H.
- [33] A specific binding member according to any one of [1] to [29], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the glutamic acid (E) is substituted with amino acid I.
- [34] A specific binding member according to any one of [1] to [29], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the glutamic acid (E) is substituted with amino acid L.
- [35] A specific binding member according to any one of [1] to [29], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the glutamic acid (E) is substituted with amino acid N.
- [36] A specific binding member according to any one of [1] to [29], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the glutamic acid (E) is substituted with amino acid Q.
- [37] A specific binding member according to any one of [1] to [29], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the glutamic acid (E) is substituted with amino acid R.
- [38] A specific binding member according to any one of [1] to [29], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the glutamic acid (E) is substituted with amino acid S.
- [39] A specific binding member according to any one of [1] to [29], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the glutamic acid (E) is substituted with amino acid W.
- [40] A specific binding member according to any one of [1] to [39], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the proline (P) is substituted with amino acid A.
- [41] A specific binding member according to any one of [1] to [39], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the proline (P) is substituted with amino acid D.
- [42] A specific binding member according to any one of [1] to [39], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the proline (P) is substituted with amino acid E.
- [43] A specific binding member according to any one of [1] to [39], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the proline (P) is substituted with amino acid G.
- [44] A specific binding member according to any one of [1] to [39], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the proline (P) is substituted with amino acid H.
- [45] A specific binding member according to any one of [1] to [39], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the proline (P) is substituted with amino acid N.
- [46] A specific binding member according to any one of [1] to [39], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the proline (P) is substituted with amino acid Q.
- [47] A specific binding member according to any one of [1] to [39], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the proline (P) is substituted with amino acid W.
- [48] A specific binding member according to any one of [1] to [39], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the proline (P) is substituted with amino acid Y.
- [49] A specific binding member according to any one of [1] to [48], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the glutamine (Q) is substituted with amino acid H.
- [50] A specific binding member according to any one of [1] to [48], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the glutamine (Q) is substituted with amino acid N.
- [51] A specific binding member according to any one of [1] to [50], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the tyrosine (Y) is substituted with amino acid A.
- [52] A specific binding member according to any one of [1] to [50], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the tyrosine (Y) is substituted with amino acid D.
- [53] A specific binding member according to any one of [1] to [50], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the tyrosine (Y) is substituted with amino acid H.
- [54] A specific binding member according to any one of [1] to [50], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the tyrosine (Y) is substituted with amino acid T.
- [55] A specific binding member according to any one of [1] to [50], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the tyrosine (Y) is substituted with amino acid V.
- [56] A specific binding member according to any one of [1] to [55], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the alanine (A) is substituted with amino acid D.
- [57] A specific binding member according to any one of [1] to [55], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the alanine (A) is substituted with amino acid E.
- [58] A specific binding member according to any one of [1] to [55], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the alanine (A) is substituted with amino acid G.
- [59] A specific binding member according to any one of [1] to [55], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the alanine (A) is substituted with amino acid L.
- [60] A specific binding member according to any one of [1] to [55], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the alanine (A) is substituted with amino acid R.
- [61] A specific binding member according to any one of [1] to [55], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the alanine (A) is substituted with amino acid S.
- [62] A specific binding member according to any one of [1] to [55], wherein the second sequence consists of a variant of SEQ ID NO: 11, in which the alanine (A) is substituted with amino acid W.
- [63] A specific binding member according to any one of [1] to [62], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the serine (S) at
position 92 of the CH3 domain is substituted with amino acid A. - [64] A specific binding member according to any one of [1] to [62], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the serine (S) at
position 92 of the CH3 domain is substituted with amino acid G. - [65] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at
position 93 of the CH3 domain is substituted with amino acid A. - [66] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at
position 93 of the CH3 domain is substituted with amino acid E. - [67] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at
position 93 of the CH3 domain is substituted with amino acid F. - [68] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at
position 93 of the CH3 domain is substituted with amino acid G. - [69] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at
position 93 of the CH3 domain is substituted with amino acid H. - [70] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at
position 93 of the CH3 domain is substituted with amino acid I. - [71] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at
position 93 of the CH3 domain is substituted with amino acid K. - [72] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at
position 93 of the CH3 domain is substituted with amino acid L. - [73] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at
position 93 of the CH3 domain is substituted with amino acid Q. - [74] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at
position 93 of the CH3 domain is substituted with amino acid R. - [75] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at
position 93 of the CH3 domain is substituted with amino acid S. - [76] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at
position 93 of the CH3 domain is substituted with amino acid T. - [77] A specific binding member according to any one of [1] to [64], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the asparagine (N) at
position 93 of the CH3 domain is substituted with amino acid Y. - [78] A specific binding member according to any one of [1] to [77], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the glutamine (Q) at
position 97 of the CH3 domain is substituted with amino acid A. - [79] A specific binding member according to any one of [1] to [77], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the glutamine (Q) at
position 97 of the CH3 domain is substituted with amino acid D. - [80] A specific binding member according to any one of [1] to [77], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the glutamine (Q) at
position 97 of the CH3 domain is substituted with amino acid E. - [81] A specific binding member according to any one of [1] to [77], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the glutamine (Q) at
position 97 of the CH3 domain is substituted with amino acid F. - [82] A specific binding member according to any one of [1] to [77], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the glutamine (Q) at
position 97 of the CH3 domain is substituted with amino acid G. - [83] A specific binding member according to any one of [1] to [77], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the glutamine (Q) at
position 97 of the CH3 domain is substituted with amino acid H. - [84] A specific binding member according to any one of [1] to [77], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the glutamine (Q) at
position 97 of the CH3 domain is substituted with amino acid K. - [85] A specific binding member according to any one of [1] to [77], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the glutamine (Q) at
position 97 of the CH3 domain is substituted with amino acid L. - [86] A specific binding member according to any one of [1] to [77], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the glutamine (Q) at
position 97 of the CH3 domain is substituted with amino acid N. - [87] A specific binding member according to any one of [1] to [77], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the glutamine (Q) at
position 97 of the CH3 domain is substituted with amino acid R. - [88] A specific binding member according to any one of [1] to [77], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the glutamine (Q) at
position 97 of the CH3 domain is substituted with amino acid S. - [89] A specific binding member according to any one of [1] to [77], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the glutamine (Q) at
position 97 of the CH3 domain is substituted with amino acid V. - [90] A specific binding member according to any one of [1] to [89], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the methionine (M) at
position 98 of the CH3 domain is substituted with amino acid F. - [91] A specific binding member according to any one of [1] to [89], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the methionine (M) at
position 98 of the CH3 domain is substituted with amino acid I. - [92] A specific binding member according to any one of [1] to [89], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the methionine (M) at
position 98 of the CH3 domain is substituted with amino acid L. - [93] A specific binding member according to any one of [1] to [89], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the methionine (M) at
position 98 of the CH3 domain is substituted with amino acid V. - [94] A specific binding member according to any one of [1] to [89], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the methionine (M) at
position 98 of the CH3 domain is substituted with amino acid W. - [95] A specific binding member according to any one of [1] to [89], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the methionine (M) at
position 98 of the CH3 domain is substituted with amino acid Y. - [96] A specific binding member according to any one of [1] to [95], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 99 of the CH3 domain is substituted with amino acid E. - [97] A specific binding member according to any one of [1] to [95], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 99 of the CH3 domain is substituted with amino acid A. - [98] A specific binding member according to any one of [1] to [95], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 99 of the CH3 domain is substituted with amino acid I. - [99] A specific binding member according to any one of [1] to [95], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 99 of the CH3 domain is substituted with amino acid L. - A specific binding member according to any one of [1] to [95], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 99 of the CH3 domain is substituted with amino acid R. - A specific binding member according to any one of [1] to [95], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 99 of the CH3 domain is substituted with amino acid S. - A specific binding member according to any one of [1] to [95], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 99 of the CH3 domain is substituted with amino acid T. - A specific binding member according to any one of [1] to [95], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 99 of the CH3 domain is substituted with amino acid V. - A specific binding member according to any one of [1] to [95], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 99 of the CH3 domain is substituted with amino acid W. - A specific binding member according to any one of [1] to [95], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 99 of the CH3 domain is substituted with amino acid Y. - A specific binding member according to any one of [1] to [105], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 100 of the CH3 domain is substituted with amino acid A. - A specific binding member according to any one of [1] to [105], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 100 of the CH3 domain is substituted with amino acid E. - A specific binding member according to any one of [1] to [105], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 100 of the CH3 domain is substituted with amino acid F. - A specific binding member according to any one of [1] to [105], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 100 of the CH3 domain is substituted with amino acid I. - A specific binding member according to any one of [1] to [105], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 100 of the CH3 domain is substituted with amino acid K. - A specific binding member according to any one of [1] to [105], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 100 of the CH3 domain is substituted with amino acid L. - A specific binding member according to any one of [1] to [105], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 100 of the CH3 domain is substituted with amino acid N. - A specific binding member according to any one of [1] to [105], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 100 of the CH3 domain is substituted with amino acid R. - A specific binding member according to any one of [1] to [105], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 100 of the CH3 domain is substituted with amino acid V. - A specific binding member according to any one of [1] to [105], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 100 of the CH3 domain is substituted with amino acid W. - A specific binding member according to any one of [1] to [105], wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 100 of the CH3 domain is substituted with amino acid Y. - A specific binding member according to any one of [1] to [116], wherein the amino acid at
position 101 of the CH3 domain is valine (V). - A specific binding member according to any one of [1] to [116], wherein the amino acid at
position 101 of the CH3 domain is absent. - A specific binding member according to any one of [1] to [118], wherein the amino acid at
position 38 of the CH3 domain is valine (V). - A specific binding member according to any one of [1] to [118], wherein the amino acid at
position 38 of the CH3 domain is alanine (A). - Amino acids may be referred to by their one letter or three letter codes, or by their full name. The one and three letter codes, as well as the full names, of each of the twenty standard amino acids are set out below.
-
Amino acid One letter code Three letter code alanine A ala arginine R arg asparagine N asn aspartic acid D asp cysteine C cys glutamic acid E glu glutamine Q gln glycine G gly histidine H his isoleucine I ile leucine L leu lysine K lys methionine M met phenylalanine F phe proline P pro serine S ser threonine T thr tryptophan W trp tyrosine Y tyr valine V val - The PD-L1 binding site of the specific binding member of the invention preferably comprises a first sequence, second sequence and third sequence, wherein:
-
- the first sequence consists of:
- (a) amino acid sequence SGYW (SEQ ID NO: 23), or
- (b) a variant of SEQ ID NO: 23, wherein the serine (S) is substituted with amino acid E, or T;
- the second sequence consists of amino acid sequence EPQYWA (SEQ ID NO: 11); and the third sequence consists of:
- (a) amino acid sequence SNWRWQMDD (SEQ ID NO: 19), or
- (b) a variant of SEQ ID NO: 19, wherein the methionine (M) at
position 98 is substituted with amino acid I, L, or V; and/or
- wherein the amino acid at
position 101 of the CH3 domain is valine (V) or is absent.
- the first sequence consists of:
- In a preferred embodiment, the binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-116, wherein the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 19.
- In another preferred embodiment, the binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-288, wherein the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 27.
- In another preferred embodiment, the binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-289 and Fcab FS17-33-334, wherein the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 31.
- In another preferred embodiment, the binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-296, wherein the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 35.
- In another preferred embodiment, the binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-449, wherein the first sequence has the sequence set forth in SEQ ID NO: 42, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 43.
- In another preferred embodiment, the binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-451, wherein the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 43.
- In addition to the experimental work described above, the present inventors performed a further mutagenesis programme in order to identify specific binding members comprising a non-native binding site for PD-L1 in the CH3 domain of the specific binding member which had an enhanced melting temperature and thus are expected to be more stable. This enhanced stability is expected to be beneficial in the manufacture and storage of the specific binding members.
- Specifically, the present inventors surprisingly found that reversion of the aspartic acid (D) residue at
position 99 of the CH3 domain of a specific binding member of the invention to the wild-type glycine (G) residue increased the melting temperature of the specific binding member. - In addition to increasing the melting temperature, this amino acid reversion has the added advantage that it reduces the mutational burden of the resulting specific binding member. The present inventors further found that substitution of the histidine (H) residue at
position 113 of the CH3 domain of the specific binding member with an arginine (R) residue, in addition to the reversion atposition 99, also resulted in a specific binding member with an increased melting temperature of the specific binding members. Both of these mutations arose independently twice, indicating that these amino acid changes may be important for the increase in the melting temperature of the specific binding members. - Thus, in a preferred embodiment the specific binding member of the invention comprises a PD-L1 binding site comprising a first, second and third sequence as disclosed herein, wherein the third sequence is located in the EF structural loop, preferably at
positions 92 to 100 of the CH3 domain, and consists of a variant of SEQ ID NO: 19, wherein the aspartic acid (D) atposition 99 is substituted with glycine (G), more preferably, where the aspartic acid (D) atposition 99 is substituted with glycine (G) and the methionine (M) atposition 98 is substituted with leucine (L). In addition, the histidine (H) atposition 113 of the CH3 domain of a specific binding member of the invention may be substituted with arginine (R). The specific binding member may further comprise the following additional mutations in the CH3 domain: -
- (i) the leucine (L) at position 84.1 may be substituted with proline (P); and/or
- (ii) the serine (S) at position 85.3 may be substituted with threonine (T); and/or
- (iii) the amino acid at
position 101 may be alanine (A).
- The present invention thus further provides:
- [121] A specific binding member according to any one of [1] to [95] or [106] to [120] above, wherein the third sequence consists of a variant of SEQ ID NO: 19, in which the aspartic acid (D) at
position 99 of the CH3 domain is substituted with amino acid G. - [122] A specific binding member according to any one of [1] to [116] or [119] to [121] above, wherein the amino acid at
position 101 of the CH3 domain is alanine (A). - [123] A specific binding member according to any one of [1] to [122] above, wherein the amino acid at
position 113 of the CH3 domain is arginine (R). - [124] A specific binding member according to any one of [1] to [123] above, wherein the amino acid at position 84.1 of the CH3 domain is proline (P).
- [125] A specific binding member according to any one of [1] to [124] above, wherein the amino acid at position 85.3 of the CH3 domain is threonine (T).
- In a preferred embodiment, the PD-L1 binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-488, wherein the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 70, wherein the residues at positions 84.1, 85.3, 101 and 113 of the CH3 domain of the specific binding member are proline (P), threonine (T), alanine (A) and arginine (R), respectively.
- In a further preferred embodiment, the PD-L1 binding site of the specific binding member of the invention comprises the first sequence, second sequence and third sequence of Fcab FS17-33-539, wherein the first sequence has the sequence set forth in SEQ ID NO: 42, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 74 and the residue at
position 113 of the CH3 domain of the specific binding member is arginine (R). - In a yet further preferred embodiment, the specific binding member comprises the first sequence, second sequence and third sequence of Fcab FS17-33-548, wherein the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 78.
- The binding site of the specific binding member of the invention may comprise a total of up to twelve, up to eleven, up to ten, up to nine, up to eight, up to seven, up to six, up to five, up to four, up to three, up to two, or one (further) amino acid modifications(s) in a first, second and third sequence, as disclosed herein. In a preferred embodiment, the specific binding member may comprise a total of up to three, up to two, or one (further) amino acid modifications(s) in a first, second and third sequence, as disclosed herein. In a more preferred embodiment, the specific binding member may comprise a total of up to two, or one (further) amino acid modification(s) in a first, second and third sequence, as disclosed herein. The total number of modifications in a first, second and third sequence refers to the total number of modifications made in these sequences combined.
- The binding site of the specific binding member of the invention may comprise up to two, or one (further) amino acid modification(s) in a first sequence, as disclosed herein. In addition, or alternatively, the specific binding member may comprise up to five, up to four, up to three, up to two, or one (further) amino acid modification(s) in a second sequence, as disclosed herein. In addition, or alternatively, the binding site of the specific binding member of the invention may comprise up to six, up to five, up to four, up to three, up to two, or one (further) amino acid modification(s) in a third sequence, as disclosed herein.
- In a preferred embodiment, the binding site of the specific binding member of the invention may comprise up to two, or one (further) amino acid modification(s) in a first sequence and/or up to two, or one (further) amino acid modification(s) in a third sequence, as disclosed herein. In a more preferred embodiment, the binding member may comprise one (further) amino acid modification in a first sequence and/or one (further) amino acid modification in a third sequence, as disclosed herein.
- In a preferred embodiment, the binding site of the specific binding member of the invention comprises one (further) amino acid modification in a first, second or third sequence, as disclosed herein.
- The binding site of the specific binding member of the invention may comprise a third sequence in which the methionine (M) at
position 98 is substituted with amino acid L. In addition, the binding site of the specific binding member of the invention may comprise one, two or three, preferably one or two, more preferably one, further amino acid modification(s) in the first, second or third sequence. - Where the specific binding member of the invention comprises one or more additional modifications in a first sequence, the amino acid deletion at
position positions - Where the specific binding member of the invention comprises one or more additional modifications in a second sequence, the amino acid(s) at
position 77, and optionally position 45.3, of the CH3 domain is (are) preferably unmodified compared with the parent sequence. - Where the specific binding member of the invention comprises one or more additional modifications in a third sequence, the amino acid(s) at
position 94, and optionally position 92, of the CH3 domain is (are) preferably unmodified compared with the parent sequence. - A modification may be an amino acid substitution, deletion or insertion. Preferably, the modification is a substitution.
- In a preferred embodiment, the amino acid at
position 101 of the CH3 domain of the specific binding member is valine (V). - In an alternative preferred embodiment, the amino acid at
position 101 of the CH3 domain of the specific binding member is alanine (A). - The present inventors showed that certain residues in the AB and EF loops, as well as the framework region could be converted back to the wild-type (WT) residue (see
FIGS. 1A-1D ) with a minimal effect on the off-rate (koff) of the specific binding member when bound to PD-L1, while reducing the mutational burden of the specific binding member. - Thus, in a preferred embodiment, the binding site of the specific binding member of the invention comprises a first sequence with:
-
- a substitution of the serine (S) with amino acid T and/or
- a substitution the glycine (G) with amino acid K.
- In another preferred embodiment, the binding site of the specific binding member of the invention comprises a third sequence with:
-
- a substitution of the asparagine (N) at
position 93 with amino acid K, and/or - a substitution of the aspartic acid (D) at
position 100 with amino acid N.
- a substitution of the asparagine (N) at
- The amino acid at
position 38 of the CH3 domain of the specific binding member may be a valine or alanine residue, preferably an alanine residue. - The sequence of the CH3 domain of the specific binding member, other than the sequences of the PD-L1 antigen-binding site, is not particularly limited. Preferably, the CH3 domain is a human immunoglobulin G domain, such as a human IgG1, IgG2, IgG3, or IgG4 CH3 domain, most preferably a human IgG1 CH3 domain. The sequences of human IgG1, IgG2, IgG3, or IgG4 CH3 domains are known in the art.
- In a preferred embodiment, the specific binding member comprises the CH3 domain set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, or 48, more preferably the CH3 domain set forth in SEQ ID NO: 28, 32, 36, 39, 44, or 48, most preferably the CH3 domain set forth in SEQ ID NO: 32, 44, or 48.
- In a further most preferred embodiment, the specific binding member comprises the CH3 domain set forth in SEQ ID NO: 71, 75 or 79.
- Alternatively, the specific binding member may comprise a CH3 domain with an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, or 48, preferably SEQ ID NO: 28, 32, 36, 39, 44, or 48, most preferably the CH3 domain set forth in SEQ ID NO: 32, 44, or 48.
- As a further most preferred embodiment, the specific binding member comprises a CH3 domain with an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 71, 75 or 79.
- The specific binding member may further comprise a CH2 domain. The CH2 domain is preferably located at the N-terminus of the CH3 domain, as in the case in a human IgG molecule. The CH2 domain of the specific binding member is preferably the CH2 domain of human IgG1, IgG2, IgG3, or IgG4, more preferably the CH2 domain of human IgG1. The sequences of human IgG domains are known in the art. In a preferred embodiment, the specific binding member comprises an IgG CH2 domain with the sequence set forth in SEQ ID NO: 5 or 6, or a CH2 domain with an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 5 or 6. Alternatively, the specific binding member comprises an IgG CH2 domain with the sequence set forth in SEQ ID NO: 82, or a CH2 domain with an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 82.
- In a preferred embodiment, the specific binding member comprises (i) the CH3 domain set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79 more preferably the CH3 domain set forth in SEQ ID NO: 28, 32, 36, 39, 44, 48, 71, 75 or 79 most preferably the CH3 domain set forth in SEQ ID NO: 32, 44, 48, 71, 75 or 79, and (ii) the CH2 domain set forth in SEQ ID NO: 5.
- In an alternative preferred embodiment, the specific binding member comprises (i) the CH3 domain set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79 more preferably the CH3 domain set forth in SEQ ID NO: 28, 32, 36, 39, 44, 48, 71, 75 or 79 most preferably the CH3 domain set forth in SEQ ID NO: 32, 44, 48, 71, 75 or 79, and (ii) the CH2 domain set forth in SEQ ID NO: 6.
- Preferably, the specific binding member comprises an immunoglobulin hinge region, or part thereof, at the N-terminus of the CH2 domain. The immunoglobulin hinge region allows the two CH2-CH3 domain sequences to associate and form a dimer. Preferably, the hinge region, or part thereof, is a human IgG1, IgG2, IgG3 or IgG4 hinge region, or part thereof. More preferably, the hinge region, or part thereof, is an IgG1 hinge region, or part thereof. The sequence of the human IgG1 hinge region is shown in SEQ ID NO: 69. A suitable truncated hinge region which may form part of specific binding member is shown in SEQ ID NO: 7. This hinge region was present in the Fcab molecules tested in the Examples, whereas a full-length hinge region was present in mock mAb2 format. Thus, the specific binding member preferably comprises an immunoglobulin hinge region, or part thereof, at the N-terminus of the CH2 domain, wherein the hinge region has the sequence set forth in SEQ ID NO: 69 or SEQ ID NO: 7, or wherein the hinge region has an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 69 or 7. Alternatively, the specific binding member may comprises an immunoglobulin hinge region, or part thereof, at the N-terminus of the CH2 domain, wherein the hinge region comprises the sequence set forth in SEQ ID NO: 69, or a fragment thereof, wherein said fragment comprises at least five, at least six, at least seven, at least eight, at least nine or more, at least ten, at least eleven, at least twelve, at least thirteen, or at least fourteen of the amino acid residues of SEQ ID NO: 69.
- In a preferred embodiment, the specific binding member comprises (i) the CH3 domain set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79 more preferably the CH3 domain set forth in SEQ ID NO: 28, 32, 36, 39, 44, 48, 71, 75 or 79 most preferably the CH3 domain set forth in SEQ ID NO: 32, 44, 48, 71, 75 or 79, (ii) the CH2 domain set forth in SEQ ID NO: 5, and (ii) an immunoglobulin hinge region, or part thereof, at the N-terminus of the CH2 domain, wherein the immunoglobulin hinge region has the sequence set forth in SEQ ID NO: 69.
- In an alternative preferred embodiment, the specific binding member comprises (i) the CH3 domain set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79 more preferably the CH3 domain set forth in SEQ ID NO: 28, 32, 36, 39, 44, 48, 71, 75 or 79 most preferably the CH3 domain set forth in SEQ ID NO: 32, 44, 48, 71, 75 or 79, (ii) the CH2 domain set forth in SEQ ID NO: 6, and (iii) an immunoglobulin hinge region, or part thereof, at the N-terminus of the CH2 domain, wherein the immunoglobulin hinge region has the sequence set forth in SEQ ID NO: 69.
- In a preferred embodiment, the specific binding member comprises the sequence set forth in SEQ ID NO: 25, 26, 29, 30, 33, 34, 37, 38, 40, 41, 45, 46, 49, or 50, or a sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 25, 26, 29, 33, 34, 30, 37, 38, 40, 41, 45, 46, 49, or 50. More preferably, the specific binding member comprises the sequence set forth in SEQ ID NO: 29, 30, 33, 34, 37, 38, 40, 41, 45, 46, 49, or 50, or a sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 29, 30, 33, 34, 37, 38, 40, 41, 45, 46, 49, or 50. Most preferably, the specific binding member comprises the sequence set forth in SEQ ID NO: 45, 46, 49, or 50, or a sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 45, 46, 49, or 50. In an alternative most preferred embodiment, the specific binding member comprises the sequence set forth in SEQ ID NO: 33, or 34, or a sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 33, or 34
- In a further most preferred embodiment, the specific binding member comprises the sequence set forth in SEQ ID NO: 72, 73, 76, 77, 80, or 81, or a sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 72, 73, 76, 77, 80, or 81.
- Monoclonal antibody-based cancer immunotherapies, such as anti-CTLA-4 or anti-PD-1/PD-L1 antibodies, have made a significant impact in the treatment of cancer patients in recent years. However, despite the remarkable clinical efficacy of these monotherapies in a number of malignancies, only a small subset of cancer patients responds to these treatments. Recently, combined inhibition of PD-1 and CTLA-4 in melanoma and non-small cell lung cancer, has highlighted the potential to further enhance the clinical benefits of such monotherapies by combining them with other agents which have a complementary mechanism of action. In addition, the inventors surprisingly found that when specific binding members of the invention were prepared which comprised the CDR-based antigen binding site for CTLA-4 from ipilimumab, in addition to a PD-L1 antigen-binding site located in the CH3 domain of the specific binding member, and these were tested in a Staphylococcal Enterotoxin B assay (SEB assay), the specific binding members showed greater T cell activation than (i) a specific binding member comprising the same PD-L1 antigen-binding site in the CH3 domain and a CDR-based antigen binding site for an irrelevant antigen, (ii) ipilimumab, or a combination of (i) and (ii). This demonstrates that the incorporation of both an anti-PD-L1 antigen binding site into the CH3 domain and a CDR-based antigen binding site for a second antigen into the same specific binding member can result in a synergistic increase in the activity of the specific binding member compared with the combined use of two separate molecules comprising the same antigen-binding sites.
- Thus, in addition to the PD-L1 antigen binding site in the CH3 domain of the specific binding member, the specific binding member may further comprise one or more additional antigen-binding sites to create a bi- or multi-specific molecule. Preferably, the specific binding member comprises a CDR-based antigen-binding site. CDR-based antigen binding sites are found in naturally-occurring immunoglobulin molecules and their structure is well-known in the art. Where the specific binding member comprises a CDR-based antigen binding site, the specific binding member is preferably an antibody molecule. The antibody molecule is not particularly limited, provided that it comprises a CH3 domain as herein defined and a CDR-based antigen binding site. In a preferred embodiment, the antibody molecule is a human immunoglobulin G molecule, such as a human IgG1, IgG2, IgG3 or IgG4 molecule, more preferably a human IgG1 molecule. The sequences of human immunoglobulin G molecules are known in the art and introducing a CH3 domain or a CH3 domain sequence, as disclosed herein, into such a molecule would not present any difficulty for the skilled person.
- In a preferred embodiment, the specific binding member of the invention comprises (i) the sequence set forth in SEQ ID NO: 45, 46, 49, 50, 72, 73, 76, 77, 80, 81, 33, 34, 25, 26, 29, 30, 37, 38, 40, or 41, preferably the sequence set forth in SEQ ID NO: 45, 46, 49, 50, 72, 73, 76, 77, 80, 81, 33, or 34, and (ii) a CDR-based antigen-binding site.
- The CDR-based antigen binding site may bind an antigen, where the binding of said antigen is expected to be beneficial in the context of cancer treatment.
- In one embodiment, where the specific binding member comprises a CDR-based antigen binding site, the CDR-based antigen binding site may bind to a non-redundant and complementary checkpoint inhibitor, such as CTLA-4, LAG-3, TIGIT, TIM-3, VISTA, CD73, CSF-1R, KIR. B7-H3, B7-H4, 2B4, NKG2A, CD47, SIRPa, BTLA, CCR4, CD200R, or TGFbeta.
- The inhibition of the PD-1/PD-L1 axis and the stimulation of costimulatory molecules represent complementary strategies to enhance immune responses in human patients. The reversal of T cell exhaustion through checkpoint blockade may allow these cells to be more potently activated and to develop full anti-tumour activity. Thus, in another embodiment, a specific binding member of the invention may comprise a CDR-based antigen-binding site which binds to, and is an agonist for, a costimulatory molecule expressed by T cells such as OX40, ICOS, CD40, HVEM, NKG2D, or TNFR2.
- In a further embodiment, the specific binding member of the invention may comprise a CDR-based antigen binding site which binds to a tumour associated antigen (TAA). Such specific binding members are expected to result in tumour-specific T cell responses through localised immune activation. Examples of TAAs are c-Met, B7-H3, B7-H4, EGFR, HER-2, EPCAM, CEACAM, FAP, VEGF, MSLN, GPC3, CD38, CD19, and CD20.
- As detailed above, infectious diseases show many parallels with oncology. The role of PD-L1 in immune regulation could be harnessed to maximise the immune response against pathogens. Immunomodulation in the context of treatment of infectious diseases is an emerging area of medicine and early reviews suggest that PD-L1 blockade may improve biological responses to infection, in particular, helping to counteract T-cell exhaustion, manage immune-mediated clearance, and generate long-term immunity (Wykes and Lewin, 2018).
- In some infectious diseases, exaggerated pro-inflammatory responses and suboptimal antigen-specific T-cell activity are the causes of severe tissue damage (Rao M. et al., 2017). Without wishing to be bound by theory, it is thought that the use of a specific binding member of the invention comprising a CDR-based antigen-binding site may find application in the treatment of these diseases by localising beneficial immunomodulatory activity to the pathogen environment.
- Alternatively, use of a specific binding member of the invention comprising a CDR-based antigen-binding site which binds to an immune cell target, either for agonism or antagonism, may result in increased T-cell specificity and activity.
- Thus, in one embodiment, where the specific binding member comprises a CDR-based antigen binding site, the CDR-based antigen binding site may bind to an immune cell target, such as PD-1, PD-L2, CTLA-4, LAG-3, TIGIT, TIM3, OX40, CD40, ICOS, CD28, or CD80.
- Alternatively, where the specific binding member comprises a CDR-based antigen binding site, the CDR-based antigen binding site may bind to a pathogenic target, namely an antigen expressed by a human pathogen. The pathogen may be a virus, bacterium, fungus, or parasite. Preferably the pathogen is a virus, bacterium or fungus. More preferably, the pathogen is a virus or bacterium. Most preferably, the pathogen is a virus. Examples of viral antigens include proteins p24, gp120, and gp41 expressed by human immunodeficiency virus (HIV), hepatitis B surface antigen (HBsAg) expressed by hepatitis B virus (HBV), and hemagglutinin and neuraminidase expressed by influenza virus. Examples of bacterial antigens include Rv1733, Rv2389 and Rv2435n expressed by Mycobacterium tuberculosis.
- In some embodiments, the CDR-based antigen-binding site of the specific binding member of the invention may not bind to OX40. In addition, or alternatively, the CDR-based antigen-binding site of the specific binding member of the invention may not bind to CD137. In addition, or alternatively, the CDR-based antigen-binding site of the specific binding member of the invention may not bind to CD27. In addition, or alternatively, the CDR-based antigen-binding site of the specific binding member of the invention may not bind to glucocorticoid-induced TNFR-related protein (GITR). In addition, or alternatively, the CDR-based antigen-binding site of the specific binding member of the invention may not bind to lymphocyte-activation gene 3 (LAG-3). In addition, or alternatively, the CDR-based antigen-binding site of the specific binding member of the invention may not bind to Inducible T-cell COStimulator (ICOS). For example, the CDR-based antigen-binding site of the specific binding member of the invention may not bind to ICOS where (i) the PD-L1 binding site of the specific binding member comprises a first sequence located in the AB structural loop at
positions 14 to 18 of the CH3 domain, wherein the specific binding member comprises an amino acid deletion atposition positions 92 to 100 of the CH3 domain, wherein the third sequence consists of the sequence set forth in SEQ ID NO: 31; (ii) the CH3 domain of the specific binding member comprises the sequence set forth in SEQ ID NO: 32; and/or (iii) where the specific binding member comprises the sequence set forth in SEQ ID NO: 33 or 34. - The specific binding member may further be conjugated to an immune system modulator, cytotoxic molecule, radioisotope, or detectable label. The immune system modulator may be a cytotoxic molecule, such as a cytokine.
- The present invention also provides a nucleic acid encoding a specific binding member or antibody molecule of the invention, as well as a vector comprising such a nucleic acid. A recombinant host cell comprising a nucleic acid or the vector of the invention is also provided.
- Such a recombinant host cell may be used to produce a specific binding member of the invention. Thus, also provided is a method of producing a specific binding member or antibody molecule of the invention, the method comprising culturing the recombinant host cell under conditions for production of the specific binding member or antibody molecule. The method may further comprise a step of isolating and/or purifying the specific binding member or antibody molecule.
- The specific binding members and antibodies of the present invention are expected to find application in therapeutic applications, in particular therapeutic applications in humans, such as cancer treatment, the treatment of infectious diseases, and the treatment of inflammation, diseases and conditions associated with inflammation, and inflammatory diseases. Thus, also provided is a pharmaceutical composition comprising a specific binding member or antibody molecule according to the invention and a pharmaceutically acceptable excipient.
- The present invention further provides a specific binding member or antibody molecule of the invention, for use in a method of treatment. Also provided is a method of treating a patient, wherein the method comprises administering to the patient a therapeutically effective amount of a specific binding member or antibody molecule according to the invention. Further provided is the use of a specific binding member or antibody molecule according to the invention for use in the manufacture of a medicament. A patient, as referred to herein, is preferably a human patient.
- The present invention also provides a specific binding member or antibody molecule of the invention, for use in a method of treating cancer in a patient. Also provided is a method of treating cancer in a patient, wherein the method comprises administering to the patient a therapeutically effective amount of a specific binding member or antibody molecule according to the invention. Further provided is the use of a specific binding member or antibody molecule according to the invention for use in the manufacture of a medicament for the treatment of cancer in a patient. The treatment may further comprise administering to the patient a second anti-cancer agent and/or therapy, such as an anti-tumour vaccine and/or a chemotherapeutic agent. The second anti-cancer agent and/or therapy may be administered to the patient simultaneously, separately, or sequentially to the specific binding member or antibody molecule of the invention.
- The present invention also provides a specific binding member or antibody molecule of the invention, for use in a method of treating an infectious disease in a patient. Also provided is a method of treating an infectious disease in a patient, wherein the method comprises administering to the patient a therapeutically effective amount of a specific binding member or antibody molecule according to the invention. Further provided is the use of a specific binding member or antibody molecule according to the invention for use in the manufacture of a medicament for the treatment of an infectious disease in a patient. The treatment may further comprise administering to the patient a second agent and/or therapy for the treatment of the infectious disease. The second agent and/or therapy may be administered to the patient simultaneously, separately, or sequentially to the specific binding member or antibody molecule of the invention.
- The present invention also provides a specific binding member or antibody molecule of the invention, for use in a method of treating inflammation, a disease or condition associated with inflammation, or an inflammatory disease in a patient. Also provided is a method of treating inflammation, a disease or condition associated with inflammation, or an inflammatory disease in a patient, wherein the method comprises administering to the patient a therapeutically effective amount of a specific binding member or antibody molecule according to the invention. Further provided is the use of a specific binding member or antibody molecule according to the invention for use in the manufacture of a medicament for the treatment of inflammation, a disease or condition associated with inflammation, or an inflammatory disease in a patient. The treatment may further comprise administering to the patient a second agent and/or therapy for the treatment of the inflammation, disease or condition associated with inflammation, or inflammatory disease. The second agent and/or therapy may be administered to the patient simultaneously, separately, or sequentially to the specific binding member or antibody molecule of the invention.
-
FIG. 1A shows the sequences of the AB, CD and EF loops andframework position 38, 84.1, 85.3 and 113 of the CH3 domain of Fcabs FS17-33, FS17-33-37, FS17-33-116; FS17-33-288, FS17-33-289, FS17-33-296, FS17-33-334, FS17-33-449, FS17-33-451, FS17-33-488, FS17-33-539 and FS17-33-548, as well as the wild-type (WT) Fcab. The numbering of the residues according to the IMGT numbering system is indicated.FIGS. 1B-1C show a concordance of antibody residue numbering systems, including the IMGT, consecutive numbering (IMGT exon numbering), EU numbering, and Kabat numbering systems for the CH3 domain residues of an IgG1 CH3 domain, as well as the wild-type IgG1 CH3 domain amino acid sequence.FIG. 1D shows an alignment of the CH3 domain sequences of the Fcabs FS17-33, FS17-33-37, FS17-33-116; FS17-33-288, FS17-33-289, FS17-33-296, FS17-33-334, FS17-33-449, FS17-33-451, FS17-33-488, FS17-33-539 and FS17-33-548, as well as the wild-type (WT) Fcab. -
FIGS. 2A-2C show size exclusion chromatography (SEC) profiles of two Fcabs (FIGS. 2A-2B ) and a mAb2 (FIG. 2C ). The parental Fcab FS17-33 shows a single peak with a shoulder (FIG. 2A ). Fcab FS17-33-116 shows a split peak (FIG. 2B ). SEC analysis shows the mAb2 FS17-33-116/4420 (FIG. 2C ) had a small amount of aggregation, typical of what is seen with the parental 4420 mAb. Unlike the Fcabs, there is no apparent split peak or shoulder. -
FIG. 3A shows that the anti-PD-L1 Fcab, FS17-33-116AA, inhibits human PD-L1 activity leading to release of IL-2 in a DO11.10 T cell activation assay. This release was comparable to the positive control anti-PD-L1 mAb, YW243.55.S1 (S1). The anti-PD-L1 Fcab, FS17-33-37AA, and a wild-type (WT) Fcab showed no significant T cell activation in this assay.FIG. 3B shows that the anti-PD-L1 Fcabs, FS17-33-288AA, FS17-33-289AA and FS17-33-296AA, all showed IL-2 release in the DO11.10 T cell activation assay that was comparable to that of the positive control mAb, S1. All Fcabs tested contained the LALA mutation in the CH2 domain, as indicated by “AA” in the clone name. -
FIG. 4A shows that the anti-PD-L1 Fcabs, FS17-33-288AA, FS17-33-289AA and FS17-33-296AA and FS17-33-334AA, in Fcab and mock mAb2 format inhibit human PD-L1, leading to release of IL-2 in a DO11.10 T cell activation assay. The conversion of the Fcab into a mock mAb2 format resulted in a partial reduction in IL-2 release in this assay.FIG. 4B shows that the anti-PD-L1 Fcabs, FS17-33-449 and FS17-33-451, in a mock mAb2 format were also able to inhibit PD-L1 and release IL-2 in a DO11.10 T cell activation assay. -
FIGS. 5A-5C show representative plots from the SEB assay. Both the Fcabs and the mock mAb2 showed enhanced IFNγ release by the T cells as compared to the IgG1 isotype control mAb HeID1.3 (FIGS. 5A-5B ). The activities of the Fcabs were close or comparable to the anti-PD-L1 positive control mAb, YW243.55.S70 (S70). The Fcabs in a mock mAb2 format showed a slight reduction in IFNγ release in this assay.FIG. 5C shows that the presence of the LALA mutation (AA) in the Fcabs did not interfere with their activities in the SEB assay. -
FIGS. 6A-6B show representative plots from the SEB assay. As compared to ipilimumab (anti-CTLA-4), both the mock mAb2 and the PD-L1/CTLA-4 mAb2 showed an enhanced IFNγ release by the T cells. - The present invention relates to specific binding members which bind to PD-L1. Specifically, the specific binding members of the present invention comprise a PD-L1 antigen binding site located in a constant domain of the specific binding member. The term “PD-L1” may refer to human PD-L1, and/or cynomolgus monkey PD-L1, unless the context requires otherwise. Preferably, the term “PD-L1” refers to human PD-L1.
- The term “specific binding member” describes an immunoglobulin, or fragment thereof, comprising a constant domain, preferably a CH3 domain, comprising a PD-L1 antigen-binding site. Preferably, the specific binding member comprises a CH2 and CH3 domain, wherein the CH2 or CH3 domain, preferably the CH3 domain, comprises a PD-L1 antigen-binding site. In a preferred embodiment, the specific binding member further comprises an immunoglobulin hinge region, or part thereof, at the N-terminus of the CH2 domain. Such a molecule is also referred to herein as an antigen-binding Fc fragment, or Fcab™. The specific binding member may be partly, or wholly, synthetically produced.
- The term “specific binding member”, as used herein, thus includes fragments, provided said fragments comprise a PD-L1 antigen binding site located in a constant domain, such as a CL, CH1, CH2, or CH3 domain, preferably a CH1, CH2, or CH3 domain, most preferably a CH3 domain, of the specific binding member. Unless the context requires otherwise, the term “specific binding member”, as used herein, is thus equivalent to “specific binding member or fragment thereof”.
- In a preferred embodiment, the specific binding member is an antibody molecule. The term “antibody molecule” encompasses fragments of antibody molecules, provided such fragments comprise a constant domain, such as a CH1, CH2, or CH3 domain, preferably a CH3 domain, comprising a PD-L1 antigen-binding site. The antibody molecule may be human or humanised. The antibody molecule is preferably a monoclonal antibody molecule. Examples of antibody molecules are the immunoglobulin isotypes, such as immunoglobulin G, and their isotypic subclasses, such as IgG1, IgG2, IgG3 and IgG4, as well as fragments thereof.
- It is possible to take monoclonal and other antibodies and use techniques of recombinant DNA technology to produce other antibodies or chimeric molecules which retain the specificity of the original antibody. Such techniques may involve introducing the CDRs, or variable regions, into a different immunoglobulin. Introduction of the CDRs of one immunoglobulin into another immunoglobulin is described, for example, in EP-A-184187, GB 2188638A and EP-A-239400. Similar techniques could be employed for the relevant constant domain sequences by introducing the PD-L1 antigen binding site into another constant domain, such as a different CH3 domain, or a CH1 or CH2 domain.
- As antibodies can be modified in a number of ways, the term “specific binding member” should be construed as covering antibody fragments, derivatives, functional equivalents and homologues of antibodies, whether natural or wholly or partially synthetic. An example of an antibody fragment comprising a CH3 domain is an Fc domain of an antibody. An example of an antibody fragment comprising both CDR sequences and CH3 domain is a minibody, which comprises an scFv joined to a CH3 domain (Hu et al., 1996).
- The specific binding member of the present invention binds to PD-L1. Binding in this context may refer to specific binding. The term “specific” may refer to the situation in which the specific binding member will not show any significant binding to molecules other than its specific binding partner(s), here PD-L1. The term “specific” is also applicable where the specific binding member is specific for particular epitopes, such as epitopes on PD-L1, that are carried by a number of antigens, in which case the specific binding member will be able to bind to the various antigens carrying the epitope. The specific binding member may not bind, or may not show any significant binding, to programmed death-ligand 1 (PD-1) and CD80, such as human and mouse CD80, and human and mouse PD-1.
- A specific binding member of the invention preferably comprises a PD-L1 antigen binding site.
- The PD-L1 antigen binding site is located in a constant domain of the specific binding member, such as a CH1, CH2, CH3 or CH4 domain. Preferably, the PD-L1 antigen binding site is located in the CH3 domain of the specific binding member.
- The PD-L1 binding site preferably comprises:
-
- (i) a first sequence located in the AB structural loop, wherein the specific binding member comprises an amino acid deletion at
position - (a) amino acid sequence SGYW (SEQ ID NO: 23), or
- (b) a variant of SEQ ID NO: 23, wherein the serine (S) is substituted with amino acid A, E, F, G, H, I, L, P, R, T, V, or Y, and/or the glycine (G) is substituted with amino acid A, D, E, F, H, K, L, N, P, R, T, V, or Y;
- (ii) a second sequence located in the CD structural loop, wherein the second sequence consist of:
- (a) amino acid sequence EPQYWA (SEQ ID NO: 11), or
- (b) a variant of SEQ ID NO: 11, wherein
- the glutamic acid (E) is substituted with amino acid A, G, H, I, L, N, Q, R, S, or W, and/or
- the proline (P) is substituted with amino acid A, D, E, G, H, N, Q, W, or Y, and/or
- the glutamine (Q) is substituted with amino acid H, or N, and/or
- the tyrosine (Y) is substituted with amino acid A, D, H, T, or V, and/or
- the alanine (A) is substituted with amino acid D, E, G, L, R, S, or W; and
- (iii) a third sequence located in the EF structural loop, wherein the third sequence consists of:
- (a) amino acid sequence SNWRWQMD1D2(SEQ ID NO: 19), or
- (b) a variant of SEQ ID NO: 19, wherein
- the serine (S) is substituted with amino acid A, or G, and/or
- the asparagine (N) is substituted with amino acid A, E, F, G, H, I, K, L, Q, R, S, T, or Y, and/or
- the glutamine (Q) is substituted with amino acid A, D, E, F, G, H, K, L, N, R, S, or V, and/or
- the methionine (M) is substituted with amino acid H, S, F, I, L, V, W, or Y, and/or
- the aspartic acid (D1) is substituted with amino acid E, A, I, L, R, S, T, V, W, Y, or G, and/or
- the aspartic acid (D2) is substituted with amino acid A, E, F, I, K, L, N, R, V, W, or Y; and
- wherein the amino acid at
position 101 of the CH3 domain is valine (V), alanine (A), or is absent.
- (i) a first sequence located in the AB structural loop, wherein the specific binding member comprises an amino acid deletion at
- In an alternative preferred embodiment, the PD-L1 binding site comprises:
-
- (i) a first sequence located in the AB structural loop, wherein the specific binding member comprises an amino acid deletion at
position - (a) amino acid sequence SGYW (SEQ ID NO: 23), or
- (b) a variant of SEQ ID NO: 23, wherein
- the serine (S) is substituted with amino acid A, E, F, G, H, I, L, P, R, T, V, or Y, and/or
- the glycine (G) is substituted with amino acid A, D, E, F, H, K, L, N, P, R, T, V, or Y;
- (ii) a second sequence located in the CD structural loop, wherein the second sequence consist of:
- (a) amino acid sequence EPQYWA (SEQ ID NO: 11), or
- (b) a variant of SEQ ID NO: 11, wherein
- the glutamic acid (E) is substituted with amino acid A, G, H, I, L, N, Q, R, S, or W, and/or
- the proline (P) is substituted with amino acid A, D, E, G, H, N, Q, W, or Y, and/or
- the glutamine (Q) is substituted with amino acid H, or N, and/or
- the tyrosine (Y) is substituted with amino acid A, D, H, T, or V, and/or
- the alanine (A) is substituted with amino acid D, E, G, L, R, S, or W; and
- (iii) a third sequence located in the EF structural loop, wherein the third sequence consists of:
- (a) amino acid sequence SNWRWQMD1D2(SEQ ID NO: 19), or
- (b) a variant of SEQ ID NO: 19, wherein
- the serine (S) is substituted with amino acid A, or G, and/or
- the asparagine (N) is substituted with amino acid A, E, F, G, H, I, K, L, Q, R, S, T, or Y, and/or
- the glutamine (Q) is substituted with amino acid A, D, E, F, G, H, K, L, N, R, S, or V, and/or
- the methionine (M) is substituted with amino acid H, S, F, I, L, V, W, or Y, and/or
- the aspartic acid (D1) is substituted with amino acid E, A, I, L, R, S, T, V, W, or Y, and/or
- the aspartic acid (D2) is substituted with amino acid A, E, F, I, K, L, N, R, V, W, or Y; and
- wherein the amino acid at
position 101 of the CH3 domain is valine (V), or is absent.
- (i) a first sequence located in the AB structural loop, wherein the specific binding member comprises an amino acid deletion at
- The specific binding member of the invention may further comprise an arginine (R) at
position 113 of the CH3 domain of the specific binding member. In addition, or alternatively, the specific binding member of the invention may comprise the following additional mutations: -
- (i) the amino acid at position 84.1 of the CH3 domain may be proline (P); and/or
- (ii) the amino acid at position 85.3 of the CH3 domain may be threonine (T); and/or
- (iii) the amino acid at
position 101 of the CH3 domain may be alanine (A).
- Amino acid residues are numbered herein according to the ImMunoGeneTics (IMGT) numbering scheme unless otherwise indicated. The IMGT numbering scheme is described in Lefranc et al., 2005.
- Preferably, the first sequence is located at
residues 14 to 18 of the CH3 domain, the second sequence is located at positions 45.1 to 78 of the CH3 domain, and/or the third sequence is located atpositions 92 to 100 or 92 to 101, of the CH3 domain, wherein the amino acid residue numbering is according to the ImMunoGeneTics (IMGT) numbering scheme. - As an alternative to IMGT numbering, the position of the residues of the CH3 domain, including the modifications described herein, may alternatively be indicated according to consecutive numbering, also referred to as IMGT exon numbering, EU numbering, or Kabat numbering of the residues in the wild-type IgG1 CH3 domain sequence set forth in SEQ ID NO: 4.
- The concordance between IMGT numbering, consecutive numbering (IMGT exon numbering), EU numbering, and Kabat numbering of the residues of the WT IgG1 CH3 domain (SEQ ID NO: 4) are shown in
FIGS. 1B-1C . - The concordance between IMGT numbering and consecutive numbering of the residue positions modified in the CH3 domain of Fcabs FS17-33, FS17-33-37, FS17-33-116; FS17-33-288, FS17-33-289, FS17-33-296, FS17-33-334, FS17-33-449, FS17-33-451, FS17-33-488, FS17-33-539 and FS17-33-548 relative to the wild-type CH3 domain sequence set forth in SEQ ID NO: 4, is shown in
FIG. 1A . - Thus, for example, where the present application refers to modification of the AB structural loop at
positions 14 to 18, the CD structural loop at positions 45.1 to 78, and/or the EF structural loop atpositions 92 to 100 of the CH3 domain, where the residue numbering is according to the IMGT numbering scheme, the positions modified in accordance with consecutive numbering of the amino acid residues of SEQ ID NO: 4 arepositions 18 to 22, 46 to 51, and 73 to 81 of the CH3 domain, respectively, as shown inFIG. 1A . - In preferred embodiments, the PD-L1 binding site comprises a first sequence located in the AB loop, a second sequence located in CD loop and a third sequence located in the EF loop,
-
- wherein the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 19;
- the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 27;
- the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 31;
- the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 35;
- the first sequence has the sequence set forth in SEQ ID NO: 42, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 43;
- the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 43;
- the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 78; or
- the first sequence has the sequence set forth in SEQ ID NO: 42, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 74 and the residue at
position 113 of the CH3 domain of the specific binding member is arginine (R).
- Most preferably, the PD-L1 binding site comprises a first sequence located in the AB loop, a second sequence located in CD loop and a third sequence located in the EF loop, wherein
-
- the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 31;
- the first sequence has the sequence set forth in SEQ ID NO: 42, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 43; or
- the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 43.
- In an alternative most preferred embodiment, the PD-L1 binding site of the specific binding member of the invention may comprise a first sequence located in the AB loop, a second sequence located in CD loop and a third sequence located in the EF loop,
-
- wherein the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 78; or
- the first sequence has the sequence set forth in SEQ ID NO: 42, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 74 and the residue at
position 113 of the CH3 domain of the specific binding member is arginine (R); or - the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 70, wherein the residues at positions 84.1, 85.3, 101 and 113 of the CH3 domain of the specific binding member are proline (P), threonine (T), alanine (A) and arginine (R), respectively.
- The first, second and third sequences are preferably located in structural loops of the constant domain of the specific binding member. The introduction of sequences into the structural loop regions of antibody constant domains to create new antigen-binding sites is described, for example, in WO2006/072620 and WO2009/132876.
- The structural loops of antibody constant domains include the AB, CD and EF loops. In the CH3 domain, the AB, CD, and EF loops are located at residues 11-18, 43-78 and 92-101 of the CH3 domain. Preferably, the first sequence is located at
residues 14 to 18 of the CH3 domain, the second sequence is located at positions 45.1 to 78 of the CH3 domain, and/or the third sequence is located atpositions 92 to 100 or 92 to 101, of the CH3 domain. - A specific binding member of the invention may further comprise an alanine or valine residue at
position 38, preferably an alanine residue. In particular, a specific binding member which comprises a first, second and third sequence, wherein -
- the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 31;
- the first sequence has the sequence set forth in SEQ ID NO: 42, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 43;
- the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 43;
- the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 78;
- the first sequence has the sequence set forth in SEQ ID NO: 42, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 74, and the residue at
position 113 of the CH3 domain of the specific binding member is arginine (R); or - the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 70, wherein the residues at positions 84.1, 85.3, 101 and 113 of the CH3 domain of the specific binding member are proline (P), threonine (T), alanine (A) and arginine (R), respectively;
- may further comprise an alanine residue at
position 38.
- Similarly, a specific binding member which comprises a first, second and third sequence, wherein
-
- the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 19;
- the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 27;
- the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 31; or
- the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 35,
- may further comprise a valine residue at
position 38.
- In addition, or alternatively, the specific binding member of the invention may further comprise a valine residue, or an amino acid deletion, at
position 101 of the CH3 domain (as shown inFIG. 1A ). In particular, a specific binding member which comprises a first, second and third sequence, wherein -
- the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 19;
- the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 27;
- the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 31;
- the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 35;
- may comprise an amino acid deletion at
position 101 of the CH3 domain.
- Alternatively, the specific binding member of the invention may further comprise an alanine residue (A) at
position 101 of the CH3 domain (as shown inFIG. 1A ). In particular, a specific binding member which comprises a first, second and third sequence, wherein -
- the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 70, wherein the residues at positions 84.1, 85.3, and 113 of the CH3 domain of the specific binding member are proline (P), threonine (T), and arginine (R), respectively, may comprise an alanine residue (A) at
position 101 of the CH3 domain.
- the first sequence has the sequence set forth in SEQ ID NO: 47, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 70, wherein the residues at positions 84.1, 85.3, and 113 of the CH3 domain of the specific binding member are proline (P), threonine (T), and arginine (R), respectively, may comprise an alanine residue (A) at
- In a preferred embodiment, the specific binding member of the invention comprises a CH3 domain which comprises, has, or consists of the sequence set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79, preferably a CH3 domain with the sequence set forth in SEQ ID NO: 28, 32, 36, 39, 44, 48, 75 or 79.
- The specific binding member of the invention may comprise a CH3 domain which comprises, has, or consists of the sequence set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79, wherein the lysine residue (K) at the immediate C-terminus of the sequence shown in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79 has been deleted.
- In addition, the specific binding member of the invention may comprise a CH2 domain of an immunoglobulin G molecule, such as a CH2 domain of an IgG1, IgG2, IgG3, or IgG4 molecule. Preferably the specific binding member of the invention comprises a CH2 domain of an IgG1 molecule. The CH2 domain may have the sequence set forth in SEQ ID NO: 6.
- The CH2 domain of the specific binding member may comprise one or more mutations that reduce or abrogate binding of the CH2 domain to one or more Fcγ receptors, such as FcγRI, FcγRIIa, FcγRIIb, FcγRIII and/or to complement. The inventors postulate that reducing or abrogating binding to Fcγ receptors will decrease or eliminate antibody-dependent cell-mediated cytotoxicity (ADCC) mediated by the antibody molecule. Similarly, reducing or abrogating binding to complement is expected to reduce or eliminate complement-dependent cytotoxicity (CDC) mediated by the antibody molecule. Mutations to reduce or abrogate binding of the CH2 domain to one or more Fcγ receptors and/or complement are known in the art (Wang et al., 2018). These mutations include the “LALA mutation” described in Bruhns, et al., 2009 and Hezareh et al., 2001, which involves substitution of the leucine residues at IMGT positions 1.3 and 1.2 of the CH2 domain with alanine (L1.3A and L1.2A). Alternatively, the generation of aglycosylated antibodies through mutation of the conserved N-linked glycosylation site by mutating the asparagine (N) at IMGT position 84.4 of the CH2 domain to alanine, glycine or glutamine (N84.4A, N84.4G or N84.4Q) is also known to decrease IgG1 effector function (Wang et al., 2018). As a further alternative, complement activation (Clq binding) and ADCC are known to be reduced through mutation of the proline at
IMGT position 114 of the CH2 domain to alanine or glycine (P114A or P114G) (Idusogie et al., 2000; Klein et al., 2016). These mutations may also be combined in order to generate antibody molecules with further reduced or no ADCC or CDC activity. - Thus, the specific binding member may comprise a CH2 domain, wherein the CH2 domain comprises:
-
- (i) alanine residues at positions 1.3 and 1.2; and/or
- (ii) an alanine or glycine at
position 114; and/or - (iii) an alanine, glutamine or glycine at position 84.4;
- wherein the amino acid residue numbering is according to the IMGT numbering scheme.
- In a preferred embodiment, the specific binding member comprises a CH2 domain, wherein the CH2 domain comprises:
-
- (i) an alanine residue at position 1.3; and
- (ii) an alanine residue at position 1.2;
- wherein the amino acid residue numbering is according to the IMGT numbering scheme.
- For example, the CH2 domain may have the sequence set forth in SEQ ID NO: 5.
- In an alternative preferred embodiment, the antibody molecule comprises a CH2 domain, wherein the CH2 domain comprises:
-
- (i) an alanine residue at position 1.3;
- (ii) an alanine residue at position 1.2; and
- (iii) an alanine at
position 114; - wherein the amino acid residue numbering is according to the IMGT numbering scheme.
- For example, the CH2 domain may have the sequence set forth in SEQ ID NO: 82.
- In a preferred embodiment, the specific binding member may comprise one or more further antigen-binding sites that bind one or more further antigens, in addition to the PD-L1 antigen-binding site located in the constant domain of the specific binding member. The one or more further antigen-binding sites preferably bind their cognate antigens specifically.
- The one or more further antigen-binding sites may bind PD-L1 or another antigen. The specific binding member may thus be a multispecific, for example a bispecific, trispecific, or tetraspecific molecule, preferably a bispecific molecule. In a preferred embodiment, the specific binding member is capable of simultaneously binding to PD-L1 and the one or more further antigens.
- Antibody molecules are known to have a modular architecture comprising discrete domains, which can be combined in a multitude of different ways to create multispecific, e.g. bispecific, trispecific, or tetraspecific antibody formats. Exemplary multispecific antibody formats are described in Spiess et al. (2015) and Kontermann (2012), for example. The specific binding members of the present invention may be employed in such multispecific antibody formats. This has the additional advantage of introducing a further antigen-binding site into such multispecific antibody format through the presence of the antigen-binding site in the constant domain, e.g. the CH3 domain, of the specific binding member.
- For example, the specific binding member of the invention may be a heterodimeric antibody molecule, such as a heterodimeric complete immunoglobulin molecule, or a fragment thereof. In this case, one part of the antibody molecule will have a sequence or sequences as described herein. For example, where the specific binding member of the invention is a bispecific heterodimeric antibody molecule, the specific binding member may comprise a heavy chain comprising a CH3 domain as described herein paired with a heavy chain which binds an antigen other than PD-L1. Techniques for preparing heterodimeric antibodies are known in the art and include knobs-into-holes (KIHs) technology, which involves engineering the CH3 domains of an antibody molecule to create either a “knob” or a “hole” to promote chain heterodimerization. Alternatively, heterodimeric antibodies can be prepared through the introduction of charge pairs into the antibody molecule to avoid homodimerization of CH3 domains by electrostatic repulsion and to direct heterodimerization by electrostatic attraction. Examples of heterodimeric antibody formats include CrossMab, mAb-Fv, SEED-body, and KIH IgG.
- Alternatively, a multispecific specific binding member of the invention may comprise a complete immunoglobulin molecule or a fragment thereof and an additional antigen-binding moiety or moieties. The antigen-binding moiety may for example be an Fv, scFv or single domain antibody, and may be fused to the complete immunoglobulin molecule or a fragment thereof. Examples of multispecific antibody molecules comprising additional antigen-binding moieties fused to a complete immunoglobulin molecule include DVD-IgG, DVI-IgG, scFv4-IgG, IgG-scFv, and scFv-IgG molecules (Spiess et al., 2015;
FIG. 1 ). Examples of multispecific antibody molecules comprising additional antigen-binding moieties fused to an immunoglobulin fragment comprising a CH3 domain include scDiabody-CH3, Diabody-CH3, and scFv-CH3 KIH, for example (Spiess et al., 2015;FIG. 1 ). - Other suitable multispecific formats would be readily apparent to the skilled person.
- In a preferred embodiment, the specific binding member according to the present invention comprises a second antigen-binding site, wherein the second antigen-binding site preferably is a CDR-based antigen binding site. The term “CDR-based antigen binding site” refers to the antigen-binding site of a specific binding member variable region which is composed of six CDR residues.
- The second antigen-binding site is preferably specific to a checkpoint inhibitor, costimulatory molecule or tumour associated antigen.
- The antibody molecules against a given antigen, such as a tumour associated antigen, and determination of the CDR sequences of such an antibody molecule, is well within the capabilities of the skilled person and many suitable techniques are known in the art. Furthermore, antibodies, including the CDR sequences, against various immune system modulators are known in the art. Thus, the skilled person would have no difficulty in preparing a specific binding member comprising, in addition to a PD-L1 binding site as described herein, a CDR-based antigen-binding site for a second antigen.
- In certain examples, the specific binding member of the invention does not comprise a CDR-based antigen binding site.
- The specific binding members of the present invention may also comprise variants of the structural loop, CH3 domain, CH2 domain, CH2 and CH3 domain, CDR, VH domain, VL domain, light chain or heavy chain sequences disclosed herein. Suitable variants can be obtained by means of methods of sequence alteration, or mutation, and screening. In a preferred embodiment, a specific binding member comprising one or more variant sequences retains one or more of the functional characteristics of the parent specific binding member, such as binding specificity and/or binding affinity for PD-L1. For example, a specific binding member comprising one or more variant sequences preferably binds to PD-L1 with the same affinity as, or a higher affinity than, the (parent) specific binding member. The parent specific binding member is a specific binding member which does not comprise the amino acid substitution(s), deletion(s), and/or insertion(s) which has (have) been incorporated into the variant specific binding member.
- For example, a specific binding member of the invention may comprise a structural loop, CH3 domain, CH2 domain, CH2 and CH3 domain, CDR, VH domain, VL domain, light chain or heavy chain sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity to a structural loop, CH3 domain, CH2 domain, CH2 and CH3 domain, CDR, VH domain, VL domain, light chain or heavy chain sequence disclosed herein.
- In a preferred embodiment, the specific binding member of the invention comprises a CH3 domain sequence which has at least 96%, at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity to the CH3 domain sequence set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79, preferably SEQ ID NO: 28, 32, 36, 39, 44, 48, 71, 75 or 79, most preferably 32, 44, 48, 71, 75 or 79. In particular, the specific binding member of the invention comprises a CH3 domain having at least 96% sequence identity to the CH3 domain sequence set forth in SEQ ID NO: 24.
- In a further preferred embodiment, the specific binding member of the invention comprises a CH2 domain sequence, which has at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity to the CH2 domain sequence set forth in SEQ ID NO: 5 or 6.
- In another preferred embodiment, the specific binding member of the invention comprises, or consists of, a sequence, which has at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity to sequence set forth in SEQ ID NO: 25, 26, 29, 30, 33, 34, 37, 38, 40, 41, 45, 46, 49, 50, 72, 73, 76, 77, 80, or 81, most preferably SEQ ID NO: 45, 46, 49, 50, 72, 73, 76, 77, 80, or 81. In an alternative most preferred embodiment, the specific binding member of the invention comprises, or consists of, a sequence, which has at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity to sequence set forth in SEQ ID NO: 33 or 34.
- Tables 9A, B and C show that in the context of the molecules prepared in the examples, certain residues in the structural loops could not be modified without an increase in the off-rate of the Fcab when bound to PD-L1 as compared with the off-rate of the parent molecule.
- Thus, where the specific binding member:
-
- (i) comprises a CH3 domain sequence defined by its sequence identity to the (parent) sequence set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79; or
- (ii) comprises, or consist of, a sequence defined by its sequence identity to the (parent) sequence set forth in SEQ ID NO: 25, 26, 29, 30, 33, 34, 37, 38, 40, 41, 45, 46, 49, 50, 72, 73, 76, 77, 80, or 81, as set out in the preceding paragraphs and elsewhere herein,
- the amino acid deletion at
position positions - the amino acids at
position 77, and optionally position 45.3 of the CH3 domain are preferably unmodified compared with the parent sequence; and/or - the amino acid(s) at
position 94, and optionally position 92, of the CH3 domain is(are) preferably unmodified compared with the parent sequence.
- the amino acid deletion at
- Sequence identity is commonly defined with reference to the algorithm GAP (Wisconsin GCG package, Accelerys Inc, San Diego USA). GAP uses the Needleman and Wunsch algorithm to align two complete sequences, maximising the number of matches and minimising the number of gaps. Generally, default parameters are used, with a gap creation penalty equalling 12 and a gap extension penalty equalling 4. Use of GAP may be preferred but other algorithms may be used, e.g. BLAST (which uses the method of Altschul et al., 1990), FASTA (which uses the method of Pearson and Lipman, 1988), or the Smith-Waterman algorithm (Smith and Waterman, 1981), or the TBLASTN program, of Altschul et al., 1990 supra, generally employing default parameters. In particular, the psi-Blast algorithm (Altschul et al., 1997) may be used.
- A specific binding member of the invention may also comprise a structural loop, CH3 domain, CH2 domain, CH2 and CH3 domain, CDR, VH domain, VL domain, light chain or heavy chain sequence which has one or more amino acid sequence alterations (addition, deletion, substitution and/or insertion of an amino acid residue), preferably 20 alterations or fewer, 15 alterations or fewer, 10 alterations or fewer, 5 alterations or fewer, 4 alterations or fewer, 3 alterations or fewer, 2 alterations or fewer, or 1 alteration compared with a structural loop, CH3 domain, CH2 domain, CH2 and CH3 domain, CDR, VH domain, VL domain, light chain or heavy chain sequence disclosed herein. In particular, alterations may be made in one or more framework regions of the specific binding member.
- In a preferred embodiment, the specific binding member of the invention may comprise a CH3 domain sequence with one or more amino acid sequence alterations (addition, deletion, substitution and/or insertion of an amino acid residue), preferably 20 alterations or fewer, 15 alterations or fewer, 10 alterations or fewer, 5 alterations or fewer, 4 alterations or fewer, 3 alterations or fewer, 2 alterations or fewer, or 1 alteration compared with the CH3 domain sequence set forth in SEQ ID NO: 24, 28, 32, 36, 39, 44, 48, 71, 75 or 79.
- In a further preferred embodiment, the specific binding member of the invention comprises a CH2 domain sequence, with one or more amino acid sequence alterations (addition, deletion, substitution and/or insertion of an amino acid residue), preferably 20 alterations or fewer, 15 alterations or fewer, 10 alterations or fewer, 5 alterations or fewer, 4 alterations or fewer, 3 alterations or fewer, 2 alterations or fewer, or 1 alteration compared with the CH2 domain sequence set forth in SEQ ID NO: 5 or 6.
- In a further preferred embodiment, the specific binding member of the invention comprises or consists of a sequence, with one or more amino acid sequence alterations (addition, deletion, substitution and/or insertion of an amino acid residue), preferably 40 alterations or fewer, 30 alterations or fewer, 20 alterations or fewer, 15 alterations or fewer, 10 alterations or fewer, 5 alterations or fewer, 4 alterations or fewer, 3 alterations or fewer, 2 alterations or fewer, or 1 alteration compared with the sequence set forth in SEQ ID NO: 25, 26, 29, 30, 33, 34, 37, 38, 40, 41, 45, 46, 49, 50, 72, 73, 76, 77, 80, or 81.
- Also contemplated is a specific binding member which competes with a specific binding member of the invention for binding to PD-L1, or which binds to the same epitope on PD-L1 as a specific binding member of the invention, wherein the specific binding member preferably comprises a PD-L1 antigen binding site located in a CH3 domain of the specific binding member. Methods for determining competition for an antigen by two antibodies are known in the art. For example, competition of binding to an antigen by two antibodies can be determined using surface plasmon resonance, such as Biacore. Methods for mapping the epitope bound by an antibody are similarly known in the art.
- The specific binding member of the invention may bind to human PD-L1, and/or cynomolgus monkey PD-L1. Preferably, the specific binding member of the invention binds to human PD-1. The specific binding member of the present invention is preferably capable of binding to PD-L1 expressed on the surface of a cell. The cell is preferably a cancer cell.
- Where the specific binding member comprises a second antigen-binding site, such as a CDR-based antigen binding site, specific for a second antigen, the specific binding member is preferably capable of simultaneously binding to PD-L1 and the second antigen. Preferably, the specific binding member is capable of simultaneously binding to PD-L1 and the second antigen, wherein the PD-L1 and the second antigen are expressed on the surface of a single cell, or on the surface of two separate cells.
- The specific binding member of the invention preferably binds to monomeric PD-L1, preferably human monomeric PD-L1, with an affinity (KD) of 5 nM, 4 nM, 3 nM, or 2 nM, or an affinity which is greater. Preferably, the specific binding member of the invention binds to PD-L1, preferably human PD-L1, with an affinity (KD) of 2 nM, or an affinity which is greater.
- The specific binding member of the invention preferably binds to PD-L1, preferably human PD-L1 expressed on the surface of a cell, with an affinity (KD) of 20 nM, 19 nM, 18 nM, 17 nM, or 16 nM, or an affinity which is greater. Preferably, the specific binding member of the invention binds to PD-L1, preferably human PD-L1, expressed on the surface of a cell, with an affinity (KD) of 16 nM, or an affinity which is greater.
- The binding affinity of a specific binding member to a cognate antigen, such as PD-L1 can be determined by surface plasmon resonance (SPR), such as Biacore, for example. The binding affinity of a specific binding member to a cognate antigen, such as PD-L1, expressed on a cell surface can be determined by flow cytometry.
- Fcabs have a smaller binding interface than monoclonal antibodies as the binding sites of Fcabs form a relatively compact antibody fragment with two binding sites situated in close proximity. In contrast, the Fab arms of a typical mAb are separated by a flexible hinge region. The two antigen binding sites of an Fcab are also spatially close to each other, as compared with those of a typical mAb. Based on this smaller binding interface and reduced flexibility of the two binding sites it was surprising that the anti-PD-L1 Fcabs were able to bind to and inhibit PD-L1 with similar affinity and potency as a monoclonal antibody specific for PD-L1. The specific binding member may have an EC50 in a T cell activation assay, such as a DO11.10 assay, of 9 nM or less, 8 nM or less, 7 nM or less, 6 nM or less, 5 nM or less, 4 nM or less, 3 nM or less, or 2 nM or less, preferably 2 nM or less, when the specific binding member is in the form of a complete immunoglobulin molecule, also referred to herein as a mAb2.
- The specific binding member may have an EC50 in a T cell activation assay, such as a DO11.10 assay, of 2 nM or less, 1 nM or less, or 0.5 nM or less, preferably 0.5 nM or less, when the specific binding member is in the form of an Fcab, consisting of a CH3 domain, CH2 domain and truncated immunoglobulin hinge region located at the N-terminus of the CH2 domain.
- The DO11.10 assay is an IL-2 release assay based on the T-lymphocyte and B-lymphocyte hybridoma cell lines and may be use for functional screening of the specific binding members of the invention. IL-2 release is a marker of T cell activation. The DO11.10 assay may be a DO11.10 assay as described in Example 6 herein.
- For example, the DO11.10 assay may comprise preparing dilutions of the specific binding member of interest, for example in experimental media, such as complete DO11.10 culture medium without puromycin. The specific binding member may be mixed 1:1 with 4×105/ml B cell hybridoma cells transduced with a lentiviral vector containing human PD-L1 to overexpress human PD-L1 (referred to as “B cell hybridoma cells”) (e.g. LK35.2 hPD-L1 cells) in experimental media in presence of 2.46 μM OVA peptide (e.g. 100 μL B cell hybridoma cells/specific binding member) mix per well, for example in a 96-round bottom plate, and may be incubated at 37° C., 5% CO2 for 1 hour. 2×105 DO11.10 T cell hybridoma cells transduced with an empty lentiviral vector (referred to as “DO11.10 T cells”; (e.g. DO11.10 μLVX cells) per ml in 100 μl volume experimental media may be added to 100 μl of the B cell hybridoma cells/specific binding member mix. The cells may then be mixed before being incubated at 37° C., 5% CO2 for 24 hours. Supernatants may be collected and assayed with a mouse IL-2 ELISA kit (e.g. from eBioscience, 88-7024-88 or R&D systems, SM2000). Plates may be read at 450 nm using a plate reader, such as a plate reader with the Gen5 Software, BioTek. Absorbance values of 570 nm may be subtracted from those of 450 nm for correction purposes. The standard curve for calculation of cytokine concentration may be based on four parameter logistic curve fit (such as Gen5 Software, BioTek). The concentration of mouse IL-2 may be plotted versus the log concentration of the specific binding member. The resulting curves may be fitted using the log (agonist) versus response equation, for example using GraphPad Prism.
- In the context of a DO11.10 T cell activation assay, DO11.10 T cell hybridoma cells transduced with an empty lentiviral vector may be prepared using lentiviral transduction methodology, for example to generate DO11.10 cells containing the empty lentiviral vector pLVX using the Lenti-X HTX Packaging System. Lenti-X expression vector (pLVX) may be co-transfected with a Lenti-X HTX Packaging Mix into the Lenti-X 293T Cell Line to generate virus. The DO11.10 cell line may be transduced using the lentiviral particles produced with the Lenti-X HTX Packaging System.
- In the context of a DO11.10 T cell activation assay, B cell hybridoma cells, such as LK35.2 B cell lymphoma cells (ATCC, HB-98), transduced with a lentiviral vector containing human PD-L1 to overexpress human PD-L1 may be prepared using lentiviral transduction methodology, e.g. using the Lenti-X HTX Packaging System. A Lenti-X expression vector (pLVX), containing human PD-L1 cDNA, may be co-transfected with a Lenti-X HTX Packaging Mix into the Lenti-X 293T Cell Line to generate virus. The B cell hybridoma cell line may be transduced using the lentiviral vectors produced with the Lenti-X HTX Packaging System.
- The specific binding member may have an EC50 in a Staphylococcal Enterotoxin B (SEB) assay, of 5 nM or less, 4 nM or less, 3 nM or less, or 2 nM or less, preferably 2 nM or less, when the specific binding member is in the form of a complete immunoglobulin molecule, also referred to as a mAb2 herein.
- The specific binding member may have an EC50 in a Staphylococcal Enterotoxin B (SEB) assay, of 5 nM or less, 4 nM or less, 3 nM or less, 2 nM or less, 1 nM or less, 0.5 nM or less, 0.3 nM or less, or 0.2 nM or less, preferably 0.2 nM or less, when the specific binding member is in the form of an Fcab, consisting of a CH3 domain, CH2 domain and truncated immunoglobulin hinge region located at the N-terminus of the CH2 domain.
- Staphylococcal Enterotoxin B is a superantigen, and binds to MHC class II molecules on antigen presenting cells (APCs) and the vp chain of the T cell receptor (TCR), causing non-specific activation of T cells and cytokine release. There is no requirement for antigen-specific TCRs to be present for T cell activation. The SEB assay uses stimulated human peripheral blood mononuclear cells (PBMCs) with physiological levels of checkpoint inhibitors, and can be used to confirm that T cell activation is enhanced by the specific binding member in a human system.
- The SEB assay may be an SEB assay as described in Example 7 herein.
- For example, the SEB assay may comprise:
-
- (i) isolating PBMCs from leukocyte cones, e.g. by Ficoll gradient separation. CD4+ T cells may be isolated, e.g. using a human CD4+ T Cell Isolation Kit (e.g. from Miltenyi Biotec Ltd, 130-096-533). Human T-Activator CD3/CD28 Dynabeads (e.g. from Life technologies, D) may be resuspended by vortexing. Beads may be transferred to a sterile 15 ml tube and 10 ml RPMI (e.g. from Life Technologies, 61870044) with 10% FBS (e.g. from Life Technologies, 10270106) and 1× Penicillin Streptomycin (e.g. from Life Technologies, 15140122) may be added to wash the Dynabeads. The supernatant may be discarded. The required amount of CD4+ T cells at 1.0×106 cells/ml in RPMI with 10% FBS and 1× Penicillin Streptomycin Solution and 50 IU/ml recombinant human IL2 (e.g. from Peprotech, 200-02-50 μg) with 3:1 bead to cell ratio may be transferred to T75 flask (e.g. from Greiner Bio-one, 690195) and incubated at 37° C.+5% CO2. After 3 days the cells may be gently resuspended and counted. The cell density may be maintained between 0.8-1×106 cells/ml by adding fresh media (e.g. RPMI-10% FBS+
Penicillin Streptomycin Solution 1×+50 IU/ml rhulL2). Onday Penicillin Streptomycin Solution 1× with reduced 10 IU/ml rhulL2; - (ii) isolating untouched monocytes from human PBMCs, e.g. using human Pan Monocyte Isolation Kit (such as from Miltenyi Biotec Ltd, 130-096-537) e.g. using the method described in (i). Monocytes may be differentiated to iDCs, e.g. using human Mo-DC Differentiation Medium (such as from Miltenyi Biotec Ltd, 130-094-812); and/or
- (iii) preparation of dilutions of the specific binding member of interest, e.g. in AIM medium (such as from Gibco, 12055-091). MoiDCs, e.g. prepared as set out in (ii), may be mixed with T cells from the same donor at a 1:10 ratio (5 ml of iDCs at 2×105 cells/ml may be combined with 5 ml of T cells at 2×106 cells/ml). 20 μl of SEB (e.g. from Sigma, S4881) at 0.1 μg/ml may be added to 10 ml of the cells. In a round bottom 96 well plate, 100 μl of the cell/SEB mixture may be added to 100 μl of the specific binding member dilution, giving a ratio of 104 iDC cells to 105 T cells with 0.1 ng/ml SEB in 200 μl of media (e.g. AIM media) per well. Cells may be incubated at 37° C., 5% CO2 for 4 days. Supernatants may be assayed for IFNγ using an ELISA, such as the human IFNγ ELISA kit (e.g. from R&D Systems, PDIF50). The assay may be performed using supernatants diluted 1:30 with PBA (DPBS, 2% BSA (such as from Sigma, A7906-100G)). The concentration of human IFNγ may be plotted versus the log concentration of the specific binding member. The resulting curves may be fitted using the log (agonist) versus response equation, e.g. in GraphPad Prism software.
- (i) isolating PBMCs from leukocyte cones, e.g. by Ficoll gradient separation. CD4+ T cells may be isolated, e.g. using a human CD4+ T Cell Isolation Kit (e.g. from Miltenyi Biotec Ltd, 130-096-533). Human T-Activator CD3/CD28 Dynabeads (e.g. from Life technologies, D) may be resuspended by vortexing. Beads may be transferred to a sterile 15 ml tube and 10 ml RPMI (e.g. from Life Technologies, 61870044) with 10% FBS (e.g. from Life Technologies, 10270106) and 1× Penicillin Streptomycin (e.g. from Life Technologies, 15140122) may be added to wash the Dynabeads. The supernatant may be discarded. The required amount of CD4+ T cells at 1.0×106 cells/ml in RPMI with 10% FBS and 1× Penicillin Streptomycin Solution and 50 IU/ml recombinant human IL2 (e.g. from Peprotech, 200-02-50 μg) with 3:1 bead to cell ratio may be transferred to T75 flask (e.g. from Greiner Bio-one, 690195) and incubated at 37° C.+5% CO2. After 3 days the cells may be gently resuspended and counted. The cell density may be maintained between 0.8-1×106 cells/ml by adding fresh media (e.g. RPMI-10% FBS+
- The specific binding member may be capable of blocking the interaction between PD-L1 and PD-1, preferably human PD-L1 and human PD-1, with an EC50 of 30 nM or less, 20 nM or less, 15 nM or less, 14 nM or less, 13 nM or less, 12 nM or less, or 11 nM or less, preferably 11 nM or less.
- The specific binding member may be capable of blocking the interaction between PD-L1 and CD80, preferably human PD-L1 and human CD80, with an EC50 of 50 nM or less, 45 nM or less, 40 nM or less, or 30 nM or less, preferably 30 nM or less, when the specific binding member is in the form of a complete immunoglobulin molecule, also referred to herein as a mAb2.
- The specific binding member may be capable of blocking the interaction between PD-L1 and CD80, preferably human PD-L1 and human CD80, with an EC50 of 20 nM or less, 15 nM or less, 14 nM or less, 13 nM or less, 12 nM or less, 11 nM or less, or 10 nM or less, preferably 10 nM or less, when the specific binding member is in the form of an Fcab, consisting of a CH3 domain, CH2 domain and truncated immunoglobulin hinge region located at the N-terminus of the CH2 domain.
- Methods for testing the ability of a specific binding member of the invention to block the interaction between human PD-L1 and human PD-1 or human CD80 are known in the art and are described herein. For example, blocking of the interaction between human PD-L1 and human PD-1 or human CD80 may be tested using a cell-based Receptor Binding Assay. 2 μg/mL biotinylated human PD-L1 may be incubated for 1 hour with titrating concentrations of Fcabs ranging from 400 nM to 3 μM. The mix may be incubated for another hour with cells, such as HEK293 cells, overexpressing either human PD-1 or human CD80. The level of bound biotinylated human PD-L1 on the cells may be detected using streptavidin 647 and fluorescence levels may be measured using FACS, whereby the level of fluorescence detected indicates the level of binding of PD-L1 to PD-1 or human CD80 expressed on the cells.
- The specific binding member may have a melting temperature of 60° C. or higher, 61° C. or higher, 62° C. or higher, 63° C. or higher, 64° C. or higher, 65° C. or higher, 66° C. or higher, 67° C. or higher, or 68° C. or higher, preferably 65° C. or higher, 66° C. or higher, 67° C. or higher, or 68° C. or higher, more preferably 66° C. or higher, 67° C. or higher, or 68° C. or higher. When the melting temperature is measured, the specific binding member may be in the form of a complete immunoglobulin molecule, also referred to herein as a mAb2.
- The melting temperature of a specific binding member of the invention may be measured by known methods. For example, the melting temperature of a specific binding member of the invention may be measured by differential scanning colorimetry (DSC) or differential scanning fluorimetry (DSF).
- Aggregation of therapeutic antibodies may result results in the loss of drug potency and may cause unnecessary immunogenicity. Antibodies which show little or no aggregation are therefore preferred for this purpose. The specific binding member may show no more than 5%, 4%, or 3%, preferably 3% aggregation, when the specific binding member is in an aqueous solution. Aggregation of the specific binding member in an aqueous solution can be determined using size exclusion chromatography (SEC), for example.
- The specific binding member of the present invention may be conjugated to a bioactive agent, therapeutic agent or detectable label. In this case, the specific binding member may be referred to as a conjugate. Such conjugates find application in the treatment of diseases and conditions as described herein.
- For example, the specific binding member may be conjugated to an immune system modulator, cytotoxic molecule, radioisotope, or detectable label. The immune system modulator or cytotoxic molecule may be a cytokine. The immune system modulator may also be a cell-surface receptor, or a biologically active fragment thereof, e.g. a fragment comprising or consisting of the ligand-binding domain of the receptor. Alternatively, the immune system modulator may be a ligand, e.g. a peptide ligand, of a cell-surface receptor, or a biologically active fragment of the ligand, e.g. a fragment comprising or consisting of the receptor-binding domain of the ligand. The detectable label may be a radioisotope, e.g. a non-therapeutic radioisotope.
- The specific binding member may be conjugated to the bioactive agent, therapeutic agent or detectable label by means of a peptide bond or linker, i.e. within a fusion polypeptide comprising said bioactive agent, therapeutic agent or detectable label and the specific binding member or a polypeptide chain component thereof. Other means for conjugation include chemical conjugation, especially cross-linking using a bifunctional reagent (e.g. employing DOUBLE-REAGENTS™ Cross-linking Reagents Selection Guide, Pierce).
- The specific binding member and the bioactive agent, therapeutic agent or detectable label may thus be connected to each other directly, for example through any suitable chemical bond or through a linker, for example a peptide linker.
- The peptide linker may be a short (2-20, preferably 2-15, residue stretch of amino acids). Suitable examples of peptide linker sequences are known in the art. One or more different linkers may be used. The linker may be about 5 amino acids in length.
- The chemical bond may be, for example, a covalent or ionic bond. Examples of covalent bonds include peptide bonds (amide bonds) and disulphide bonds. For example, the specific binding member and bioactive agent, therapeutic agent, or detectable label (diagnostic agent) may be covalently linked, for example, by peptide bonds (amide bonds). The bioactive agent, therapeutic agent, or detectable label may be connected by a covalent bond, e.g. a peptide bond (amide bond), directly to the C-terminal or N-terminal end of the specific binding member. In a particular embodiment, the bioactive agent, therapeutic agent, or detectable label is connected by a peptide bond (amide bond) directly to the N-terminal end of the specific binding member. Thus, the specific binding member and bioactive agent, therapeutic agent, or detectable label (diagnostic agent) may be produced (secreted) as a single chain polypeptide.
- The invention also provides isolated nucleic acids encoding the antibody molecules of the invention. The skilled person would have no difficulty in preparing such nucleic acids using methods well-known in the art. An isolated nucleic acid may be used to express the specific binding member of the invention, for example, by expression in a bacterial, yeast, insect or mammalian host cell. A preferred host cell is a mammalian cell such as a CHO, HEK or NSO cell. The nucleic acid will generally be provided in the form of a recombinant vector for expression.
- In vitro host cells comprising such nucleic acids and vectors are part of the invention, as is their use for expressing the specific binding members of the invention, which may subsequently be purified from cell culture and optionally formulated into a pharmaceutical composition. The present invention thus further provides a method of producing the specific binding member of the invention, comprising culturing the recombinant host cell of the invention under conditions for production of the specific binding member. Methods for culturing suitable host cells as mentioned above are well-known in the art. The method may further comprise isolating and/or purifying the specific binding member. The method may also comprise formulating the specific binding member into a pharmaceutical composition, optionally with a pharmaceutically acceptable excipient or other substance as described below.
- PD-L1 is known to be expressed on many cancer cells, as well as cells of the immune system.
- Thus, a specific binding member of the invention may be used in a method of treating cancer in a patient. The patient is preferably a human patient.
- Cells of the cancer to be treated using the specific binding member of the invention may express PD-L1, e.g. on their cell surface. In one embodiment, cells of the cancer to be treated may have been determined to express PD-L1, e.g. on their cell surface. Methods for determining the expression of an antigen on a cell surface are known in the art and include, for example, flow cytometry.
- Treatment against various types of cancer using anti-PD-L1 or anti-PD-1 antibodies has been investigated in clinical trials and shown promising results. These include solid tumours such as ovarian cancer, prostate cancer, colorectal cancer, fibrosarcoma, renal cell carcinoma, melanoma (advanced and metastatic melanoma), pancreatic cancer, breast cancer, glioblastoma multiforme, lung cancer (such as non-small cell lung cancer and small cell lung cancer), head and neck cancer (such as head and neck squamous cell carcinoma), stomach cancer (gastric cancer), bladder cancer, cervical cancer, uterine cancer (uterine endometrial cancer, uterine cervical cancer), vulvar cancer, testicular cancer, penile cancer, esophageal cancer, hepatocellular carcinoma, nasopharyngeal cancer, Merkel cell carcinoma, mesothelioma, DNA mismatch repair deficient colorectal cancer, DNA mismatch repair deficient endometrial cancer, thyroid cancer, Hodgkin's lymphoma, non-Hodgkin's lymphoma (such as diffuse large B-cell lymphoma, follicular lymphoma, indolent non-Hodgkin's lymphoma, mantle cell lymphoma), leukaemia (such as chronic lymphocytic leukaemia, myeloid leukaemia, acute lymphoblastoid leukaemia, or chronic lymphoblastoid leukaemia), multiple myeloma, and peripheral T-cell lymphoma. The specific binding members of the present invention thus may find application in the treatment of these cancers. Tumours of these cancers are known, or expected, to contain immune cells, such as TILs, expressing PD-L1.
- In particular, treatment of melanoma, colorectal cancer, breast cancer, bladder cancer, renal cell carcinoma, gastric cancer, head and neck cancer (such as squamous cell carcinoma of the head and neck), mesothelioma, lung cancer (such as non-small-cell lung cancer), ovarian cancer, Merkel-cell carcinoma, pancreatic cancer, melanoma and hepatocellular carcinoma using anti-PD-L1 antibodies has been investigated in clinical trials and shown promising results. Thus, the cancer to be treated using the antibody molecules of the present invention may be a melanoma, colorectal cancer, breast cancer, bladder cancer, renal cell carcinoma, bladder cancer, gastric cancer, head and neck cancer (such as squamous cell carcinoma of the head and neck), mesothelioma, lung cancer (such as non-small-cell lung cancer), ovarian cancer, Merkel-cell carcinoma, pancreatic cancer, melanoma, or hepatocellular carcinoma.
- Where the application refers to a particular type of cancer, such as breast cancer, this refers to a malignant transformation of the relevant tissue, in this case a breast tissue. A cancer which originates from malignant transformation of a different tissue, e.g. ovarian tissue, may result in metastatic lesions in another location in the body, such as the breast, but is not thereby a breast cancer as referred to herein but an ovarian cancer.
- The cancer may be a primary or secondary cancer. Thus, the specific binding member of the present invention may be for use in a method of treating cancer in a patient, wherein the cancer is a primary tumour and/or a tumour metastasis.
- The specific binding members of the invention are also expected to find application in the treatment of infectious diseases, such as viral, bacterial, fungal and/or parasitic infections. Preferably, the infectious disease is a viral, bacterial or fungal disease, more preferably a viral or bacterial disease, most preferably a viral disease. The infectious disease may be chronic or acute, but is preferably chronic.
- Examples of viral diseases which may be treated with a specific binding member according to the present invention include: human immunodeficiency virus (HIV), influenza virus, enterovirus, hepatitis B virus (HBV), hepatitis C virus (HCV), hepatitis A virus (HAV), hepatitis D virus (HDV), and hepatitis E virus (HEV), respiratory syncytial virus (RSV), herpesvirus (such as Epstein-Barr virus, herpes simplex virus 1 (HSV-1), herpes simplex virus 2 (HSV-2), cytomegalovirus (CMV)), and papillomavirus infection.
- Examples of bacterial diseases which may be treated with a specific binding member of the invention include: Mycobacterium tuberculosis, gram-negative bacteria (such as Acinetobacter, Klebisella, Enterobacter), gram-positive bacteria (such as Clostridium difficile, Staphylococcus aureus), and Listeria (e.g. Listeria monocytogenes) infection.
- Examples of fungal diseases which may be treated with a specific binding member of the invention include: Aspergillus and Candidia infection.
- Examples of parasitic diseases which may be treated with a specific binding member of the invention include: Malaria, Toxoplasma, and Leishmania infection.
- The specific binding members of the invention are also expected to find application in the treatment of inflammation, diseases and conditions associated with inflammation, and inflammatory diseases, such as stroke, stroke-related inflammation, and vascular inflammation or vasculitis, e.g., medium and large vessel vasculitis, or vasculitis of the central and/or peripheral nervous system.
- The specific binding members of the invention are designed to be used in methods of treatment of patients, preferably human patients. Specific binding members will usually be administered in the form of a pharmaceutical composition, which may comprise at least one component in addition to the specific binding member, such as a pharmaceutically acceptable excipient. For example, a pharmaceutical composition of the present invention, may comprise, in addition to active ingredient, a pharmaceutically acceptable excipient, carrier, buffer, stabiliser or other materials well-known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient. The precise nature of the carrier or other material will depend on the route of administration, which may be by injection, e.g. intravenous or subcutaneous. The specific binding member may be administered intravenously, or subcutaneously.
- Liquid pharmaceutical compositions generally comprise a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.
- For intravenous injection, or injection at the site of affliction, the specific binding member, or pharmaceutical composition comprising the specific binding member, is preferably in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability. Those of relevant skill in the art are well able to prepare suitable solutions using, for example, isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection. Preservatives, stabilisers, buffers, antioxidants and/or other additives may be employed, as required. Many methods for the preparation of pharmaceutical formulations are known to those skilled in the art. See, for example, Robinson ed., Sustained and Controlled Release Drug Delivery Systems, Marcel Dekker, Inc., New York, 1978.
- A composition comprising a specific binding member according to the present invention may be administered alone or in combination with other treatments, concurrently or sequentially or as a combined preparation with another therapeutic agent or agents, dependent upon the condition to be treated. For example, a specific binding member of the invention may be administered in combination with an existing therapeutic agent for the disease to be treated, e.g. a cancer as mentioned above. For example, a specific binding member of the present invention may be administered to the patient in combination with a second anti-cancer therapy, such as chemotherapy, anti-tumour vaccination (also referred to as a cancer vaccination), radiotherapy, immunotherapy, an oncolytic virus, chimeric antigen receptor (CAR) T-cell therapy, or hormone therapy.
- It is expected that the specific binding member of the invention may act as an adjuvant in anti-cancer therapy, such as chemotherapy, anti-tumour vaccination, or radiotherapy. Without wishing to be bound by theory, it is thought that administration of the specific binding member to the patient as part of chemotherapy, anti-tumour vaccination, or radiotherapy will trigger a greater immune response against the cancer associated antigen PD-L1, than is achieved with chemotherapy, anti-tumour vaccination, or radiotherapy alone.
- A method of treating cancer in a patient may thus comprise administering to the patient a therapeutically effective amount of a specific binding member according to the present invention in combination with a chemotherapeutic agent, anti-tumour vaccine, radionuclide, immunotherapeutic agent, oncolytic virus, CAR-T cell, or agent for hormone therapy. The chemotherapeutic agent, anti-tumour vaccine, radionuclide, immunotherapeutic agent, oncolytic virus, CAR-T cell, or agent for hormone therapy is preferably a chemotherapeutic agent, anti-tumour vaccine, radionuclide, immunotherapeutic agent, oncolytic virus, CAR-T cell, or agent for hormone therapy for the cancer in question, i.e. a chemotherapeutic agent, anti-tumour vaccine, radionuclide, immunotherapeutic agent, oncolytic virus, CAR-T cell, or agent for hormone therapy which has been shown to be effective in the treatment of the cancer in question. The selection of a suitable chemotherapeutic agent, anti-tumour vaccine, radionuclide, immunotherapeutic agent, oncolytic virus, CAR-T cell, or agent for hormone therapy, which have been shown to be effective for the cancer in question, is well within the capabilities of the skilled practitioner.
- For example, where the method comprises administering to the patient a therapeutically effective amount of a specific binding member according to the present invention in combination with a chemotherapeutic agent, the chemotherapeutic agent may be selected from the group consisting of: taxanes, cyctotoxic antibiotics, tyrosine kinase inhibitors, PARP inhibitors, B_RAF enzyme inhibitors, alkylating agents, platinum analogues, nucleoside analogues, thalidomide derivatives, antineoplastic chemotherapeutic agents and others. Taxanes include docetaxel, paclitaxel and nab-paclitaxel; cytotoxic antibiotics include actinomycin, bleomycin, anthracyclines, doxorubicin and valrubicin; tyrosine kinase inhibitors include sunitinib, erlotinib, gefitinib, axitinib, PLX3397, imatinib, cobemitinib and trametinib; PARP inhibitors include piraparib; B-Raf enzyme inhibitors include vemurafenib and dabrafenib; alkylating agents include dacarbazine, cyclophosphamide, temozolomide; platinum analogues include carboplatin, cisplatin and oxaliplatin; nucleoside analogues include gemcitabine and azacitidine; antineoplastics include fludarabine. Other chemotherapeutic agents suitable for use in the present invention include methotrexate, defactinib, entinostat, pemetrexed, capecitabine, eribulin, irinotecan, fluorouracil, and vinblastine.
- Vaccination strategies for the treatment of cancers has been both implemented in the clinic and discussed in detail within scientific literature (such as Rosenberg, S., 2000). This mainly involves strategies to prompt the immune system to respond to various cellular markers expressed by autologous or allogenic cancer cells by using those cells as a vaccination method, both with or without granulocyte-macrophage colony-stimulating factor (GM-CSF). GM-CSF provokes a strong response in antigen presentation and works particularly well when employed with said strategies.
- Where the method comprises administering to the patient a therapeutically effective amount of a specific binding member according to the present invention in combination with an immunotherapeutic agent, the immunotherapeutic agent may be selected from the group consisting of: antibodies binding to a checkpoint inhibitor, costimulatory molecule or soluble factor, such as antibodies binding to CTLA-4, LAG-3, TIGIT, TIM-3, VISTA, CD73, CSF-1R, KIR, OX40, CD40, HVEM, TGFB, IL-10, CSF-1. Alternatively, the immunotherapeutic agent may one or more cytokines or cytokine-based therapies selected from the group consisting of IL-2, prodrug of conjugated IL2, GM-CSF, IL-7, IL-12, IL-9, IL-15, IL-18, IL-21, and type I interferon.
- Administration may be in a “therapeutically effective amount”, this being an amount which is sufficient to show benefit to a patient. Such benefit may be at least amelioration of at least one symptom. Thus, “treatment” of a specified disease refers to amelioration of at least one symptom. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated, the particular patient being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the composition, the type of specific binding member, the method of administration, the scheduling of administration and other factors known to medical practitioners. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors, and may depend on the severity of the symptoms and/or progression of a disease being treated. Appropriate doses of specific binding members are well known in the art (Ledermann et al., 1991; and Bagshawe et al., 1991). Specific dosages indicated herein, or in the Physician's Desk Reference (2003) as appropriate for a specific binding member being administered, may be used. A therapeutically effective amount or suitable dose of a specific binding member can be determined by comparing its in vitro activity and in vivo activity in an animal model. Methods for extrapolation of effective dosages in mice and other test animals to humans are known. The precise dose will depend upon a number of factors, including the size and location of the area to be treated, and the precise nature of the specific binding member. Treatments may be repeated at daily, twice-weekly, weekly or monthly intervals, at the discretion of the physician. Treatment may be given before and/or after surgery, and may be administered or applied directly at the anatomical site of surgical treatment.
- Further aspects and embodiments of the invention will be apparent to those skilled in the art given the present disclosure, including the following experimental exemplification.
- “and/or” where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. For example, “A and/or B” is to be taken as specific disclosure of each of (i) A, (ii) B and (iii) A and B, just as if each is set out individually herein.
- Unless context dictates otherwise, the descriptions and definitions of the features set out above are not limited to any particular aspect or embodiment of the invention and apply equally to all aspects and embodiments which are described.
- Certain aspects and embodiments of the invention will now be illustrated by way of example and with reference to the figures described above.
- 1.1 Protein Biotinylation
- Recombinant human PD-L1 (R&D Systems, 157-B7), human PD-1 (R&D Systems, 1086-PD) and mouse PD-L1 (R&D Systems, 1019-B7) with a C-terminal human IgG tag were purchased and biotinylated using the Lightning Link Type A Biotinylation kit (Innova Biosciences, 370-0010). Briefly, 100 μg of lyophilised protein was reconstituted in 100 μl PBS to a final concentration of 1 mg/ml and 10 μl of Modifier Reagent was added to the diluted protein and gently mixed. The solution was added to a vial of Lightning-Link mix and gently resuspended and the mixture was incubated overnight at room temperature. The Quencher solution (10 μl) was added and incubated for 30 minutes at room temperature, before storing the biotinylated protein at −80° C. in 10 μl aliquots.
- 1.2 Phage Libraries
- Naïve phage libraries displaying the CH3 domain of human IgG1 (IMGT numbering 1.4-130) with randomisation within the AB (residues 11-18) and EF (residues 92-101) loops were used for selection with the PD-L1 antigen described above. The libraries were selected in three rounds using Streptavidin Dynabeads (Thermo Fisher, 11205D) and Neutravidin binding protein coupled to Dynabeads (Thermo Fisher, 31000) to isolate the phage bound to biotinylated PD-L1 Fc. In addition, an excess of IgG Fc fragment of human plasma was added to each selection step to avoid the isolation of Fc binders.
- The outputs were screened by ELISA for binding to PD-L1 and positive binders sub-cloned and expressed as soluble Fcabs (containing a truncated hinge) in Pichia pastoris using EasySelect Pichia Expression Kit (Life Technologies, K1740-01). Of the 30 unique Fcab clones selected, 18 clones expressed as soluble proteins when transferred from phage to a soluble expression platform.
- 1.3 ELISA Based Blocking Assay
- The ability of the human PD-L1-binding Fcabs to block the interaction between human PD-L1 Fc and PD-1 or CD80 was studied in an ELISA based Receptor Binding Assay (RBA) using recombinant biotinylated human PD-L1 (described in Example 1.1) and recombinant human PD-1 Fc (R&D Systems, 1086-PD) or CD80 Fc (R&D Systems, 140-B1).
- Briefly, recombinant human PD-1 Fc or CD80 Fc were coated onto a Maxisorp plate (Thermo Scientific, 439454) at 0.5 or 1.0 μg/ml, respectively. The plates were incubated overnight at 4° C., washed once in PBS and subsequently blocked with 300 μl PBS containing 1% Tween for 2 hours at room temperature. Relevant concentrations of Fcab (0.5 to 500 nM, 2-fold dilutions), control IgG Fc (10-10000 nM, 2-fold dilutions) or control antibodies (0.010 to 10 nM, 2-fold dilutions) were incubated with 250 ng/μl biotinylated PD-L1 Fc in 100 μl PBS for 1 hour at room temperature whilst shaking at 450 rpm. Control IgG Fc was tested up to a concentration of 10000 nM to determine any non-specific blocking activity. The control mAbs used were anti-human PD-L1 mAb (MIH1, Affymetrix eBioscience, 14-5983-82) and PD-L1 mAb YW243.55.S70 (“S70”) (Patent Pub. No.: US 2013/0045202 A1).
- Blocking solution was discarded and the biotinylated PD-L1 Fc/Fcab or control antibody mix was added to the maxisorp plates and incubated for 1 hour at room temperature whilst shaking at 450 rpm. Plates were washed 3× with 300 μl PBS/Tween 0.05%, followed by 3 washes with 1× PBS. Streptavidin conjugated to Horseradish Peroxidase (HRP) was diluted 1:1000 in PBS and 100 μl was added to the wells and incubated for 1 hour at 4° C. whilst shaking at 450 rpm. Plates were washed 3× with 300 μl PBS/Tween 0.05%, followed by 3 washes with 1×PBS. 100 μl TMB substrate (eBioscience, 00-4201-56) was added to each well. The reaction was stopped between 2-10 minutes after addition of TMB by the addition of 50 μl 1 M sulphuric acid solution. OD was read at 450-630 nm in a 96-well plate reader within 30 minutes of sulphuric acid addition and analysed using GraphPad Prism software (GraphPad Software, Inc.) 18 clones were tested, three of which, FS17-19, FS17-26 and FS17-33, were able to block the interaction between human PD-L1 Fc and PD-1. For these clones, a full dose response RBA was performed and their ability to block PD-L1 interaction with CD80 was analysed. FS17-19, FS17-26 and FS17-33 all showed potent blocking activity towards both the PD-L1:PD-1 interaction and PD-L1:CD80 interaction (data not shown).
- 1.4 Binding of Fcabs to Recombinant PD-L1
- The binding of FS17-19, FS17-26 and FS17-33 to human and mouse PD-L1 Fc was measured by Surface Plasmon Resonance using BIAcore 3000 (GE Healthcare).
- Briefly, a streptavidin sensor chip (GE Healthcare, BR100032) was used to coat human PD-L1 Fc (described in Example 1.1) on
flow cell 2, mouse PD-L1 Fc (described in Example 1.1) onflow cell 4, and flowcell 1 was not coated and was used as a reference. Human PD-L1 Fc and mouse PD-L1 Fc were coupled at about 10000 RU. Fcabs diluted in HBS-EP buffer (GE Healthcare, BR100669) were injected at 10 μM or 3.3 μM and 3-fold dilutions for 5 minutes and then allowed to dissociate in buffer for 3 minutes. Regeneration was not required as the Fcabs completely dissociated in buffer. Subtracted data (flowcell 2—flowcell 1 or flowcell 4—flow cell 1) was analysed using BIAevaluation 3.2 to identify binding. - The binding data (not shown) demonstrated that FS17-19, FS17-26 and FS17-33 bound to human PD-L1 Fc. FS17-19 was also found to be weakly cross-reactive to mouse PD-L1 Fc, but FS17-26 and FS17-33 were not.
- 1.5 Development of HEK 293 Cells Expressing Human PD-L1, Cynomolgus PD-L1, Mouse PD-L1, Human CD80, Mouse CD80 and Human PD-1
- Human, mouse, and cynomolgus PD-L1 sequences (
SEQ ID Nos SEQ ID Nos - 1.6 Cell Based Binding Assay
- The FS17-19, FS17-26 and FS17-33 Fcab were then tested for binding to HEK 293 cell-expressed human PD-L1, human CD80, human PD-1, mouse CD80 or mouse PD-L1 (see Example 1.5 for details regarding production of these cell lines).
- Briefly, HEK 293 cells overexpressing these proteins were grown in DMEM (Life Technologies, 61965-026) containing 10% FBS (Life Technologies, 10270-1-6), 100 μg/ml Hygromycin B (Melford Laboratories Ltd, Z2475), 15 μg/ml Blasticidin (Melford Laboratories Ltd, B1105) and were detached from tissue culture flasks using cell dissociation buffer (Life Technologies, 13151-014) and seeded in V-bottom 96-well plates at 2×105 cells/well. Fcabs were incubated with the cells at 1 μM in a 100 μl volume for 1 hour at 4° C. PE- or FITC conjugated control mAbs were added at concentrations as recommended by the manufacturer in a 100 μl volume for 1 hour at 4° C. The antibodies used in Example 1.5 were used as control antibodies in this experiment. The plates were washed once with PBS by centrifuging the plate at 1500 rpm for 3 minutes at 4° C. and the supernatant was removed. Secondary antibody (Goat anti-human Fc Alexa Fluor 488, Jackson ImmunoResearch, 109-546-098) was diluted 1:1000 in PBS and 100 μl was added to the cells for 30 minutes at 4° C. (plates were kept in the dark). After washing the plates once with PBS, as before, the pellet was resuspended in 100 μl PBS containing 1 μg/ml DAPI (Biotium, 40043). The plate was read on an Accuri C6 cytometer (BD Bioscience) and the data analysed using FlowJoX.
- FS17-19, FS17-26 and FS17-33 were found to bind specifically to cell-surface human PD-L1 and not to human PD-1, human CD80, mouse PD-L1 or mouse CD80.
- 1.7 Cell Based Blocking Assay
- The ability of Fcabs FS17-19, FS17-26 and FS17-33 to block the binding of recombinant PD-L1 to cell-bound PD-1 was determined in a cell based blocking assay.
- Briefly, HEK 293 cells expressing human PD-1 (see Example 1.5) were seeded at 1×105 cells per well in a V-bottom 96-well plate in PBS. The relevant concentrations of Fcab (78 to 10000 nM, 2-fold dilutions), control IgG Fc (10000 nM) or control antibody (500 nM) were incubated with 250 ng/μl biotinylated PD-L1 Fc in 100
μl 1×PBS for 1 hour at room temperature whilst shaking at 450 rpm. Anti-human PD-L1 mAb (MIH1) was used as control. The plates were centrifuged at 1500 rpm for 3 minutes at 4° C. to pellet the cells. The PBS was discarded and the pre-incubated Fcab or control antibody/biotinylated hPD-L1 Fc mixture was added to the wells for 1 hour at 4° C. The plates were centrifuged at 1500 rpm for 3 minutes at 4° C. to pellet the cells, supernatant was discarded and the cells were resuspended in PBS. Streptavidin conjugated to Alexa 647 was diluted 1:1000 in PBS and 100 μl was added to the wells for 30 minutes at 4° C. The plates were centrifuged, supernatant discarded and the cells resuspended in PBS as performed previously. The plate was read on an Accuri C6 cytometer (BD Bioscience) and the data analysed using FlowJoX. - Consistent with the results of the ELISA based blocking assay, FS17-19, FS17-26 and FS17-33 showed potent blocking activity at the concentrations tested. Fcabs FS17-19 and FS17-33 showed higher blocking activity than FS17-26 and were therefore selected for affinity maturation.
- 1.8 Summary of Naïve Selection Procedure
- From the 30 Fcabs identified by the initial screen of the naïve phage libraries, three anti-human PD-L1 Fcabs (FS17-19, FS17-26 and FS17-33) showed potent PD-L1/PD-1 and PD-L1/CD80 blocking activity. Both Fcabs FS17-19 and FS17-33 showed higher blocking activity in both an ELISA assay and in a cell-based assay than Fcab FS17-26, as well as specific binding to recombinant and cell-surface PD-L1 Fc, and were therefore selected for further affinity maturation as described in Example 2 below.
- 2.1 Affinity Maturation and Functional Improvement of Fcab FS17-19
- Fcab FS17-19 underwent multiple rounds of affinity maturation starting with an NNK walk of the AB and EF loops, using a similar method to that described in 2.2.1 below. The NNK walk resulted in clones derived from FS17-19 which had very low functional activity when measured in a DO11 T-cell activation assay (see Example 6 for methodology), with an EC50 that was 300-fold less than the positive control anti-PD-L1 antibody S1. With a view to improving functional activity, a randomisation of the AB, CD and EF loops, using a similar method to that described in 3.1 below, was carried out. Clones containing mutations in the AB loop showed improved activity in the DO11 T-cell activation assay to within 80-fold of the control antibody S1. One Fcab clone selected from the AB loop library underwent a further round of affinity maturation, focusing on just the CD and EF loops. Clones from this maturation did not show any improvement in functional activity over the previous round's clones.
- Despite the extensive affinity maturation strategy described above, it was not possible to identify clones from the FS17-19 lineage that had an acceptable level of functional activity in a D011 T-cell activation assay, and work on this lineage was therefore abandoned.
- 2.2 Affinity Maturation and Functional Improvement of Fcab FS17-33
- Anti-human PD-L1 Fcab FS17-33 was isolated from naïve phage selections, as described in Example 1 above. The objective of this study was to gain improvements in FS17-33 activity by randomising individual residues in the binding loops by performing an NNK walk through the AB and EF loops.
- 2.2.1 NNK Walk of Binding Loop
- To identify mutations in Fcab FS17-33 that improved PD-L1/PD-1 blocking activity, parsimonious mutagenesis libraries were generated by diversifying one amino acid residue at a time in the AB or EF loop of Fcab FS17-33, leading to a total of 12 individual libraries (see Table 1 below). The libraries were made with low redundancy NNK codons to represent all possible amino acids in the position of interest. Forward and reverse primers were designed according to the guidelines of Quickchange Lightning Site-Directed Mutagenesis Kit (Agilent, 200518), which was used to create the libraries.
-
TABLE 1 Amino acid sequence of the AB and EF binding loops of FS17-33. The ‘~’ symbol indicates a deletion in the FS17-33 sequence compared to the wild-type IgG1 Fc. The X indicates the single amino acid scanned at that time in the NNK walk. AB loop EF loop FS17-33 Q S G Y W S N W R W Q M G D ~ Library 1 X Library 2 X Library 3 X Library 4 X Library 5 X Library 6 X Library 7 X Library 8 X Library 9 X Library 10 X Library 11 X Library 12 X - Briefly, the FS17-33 Fcab sequence (CH3, CH2 and truncated hinge, additionally containing a LALA mutation in the CH2 domain) was cloned into the pTT5 expression vector (National Research Council of Canada) resulting in vector pTT5-FS17-33AA. The introduction of the LALA mutation in the CH2 domain of human IgG1 is known to reduce Fc γ receptor binding (Bruhns, P., et al., 2009 and Hezareh et al., 2001). This was used as template for the mutagenesis libraries. PCR reactions were treated with Dpnl for 5 min at 37° C. to remove any parental DNA before being transformed into E. coli (Mix and Go, Zymo research, T3009) and plated on ampicillin-containing LB plates. Transformants were picked the following day and sequenced to confirm the mutations.
- DNA for transfection was prepared using standard DNA isolation methods and the parsimonious libraries were expressed in HEK Expi293 cells (DNA transfected using ExpiFectamine 293 Transfection Kit (Life Technologies, A14524) into Expi293F cells (Life technologies, A14527). The Fcab concentration in transfected HEK supernatants was determined by BLI using Octet (ForteBio). Fcabs were purified using mAb Select SuRe protein A columns.
- The HEK 293 supernatants were subsequently analysed in an ELISA-based RBA at two concentrations (10 nM and 50 nM, see Example 1.3 for methodology). Fcabs with potentially improved PD-L1/PD-1 blocking activity compared to FS17-33 protein in this assay were selected and sequenced. This identified particular positions in the sequence of FS17-33 that were critical for binding PD-L1, i.e. where few or no alternative amino acids were identified as suitable substitutions (see Table 2), as well as well as positions at which several potential alternative amino acids were possible. Several mutants were identified multiple times, enforcing confidence in the assay results.
-
TABLE 2 Number of amino acid substitutions identified for each position mutated within the AB and EF loop of FS17-33. Residue numbering according to IMGT numbering. AB loop (14-18) EF loop (92-100) FS17-33 Q S G Y W S N W R W Q M G D Mutants 4 15 7 4 0 0 4 1 9 1 7 10 (#) - The twenty-seven Fcabs with the highest activity in the ELISA based blocking assay were expressed, purified and tested in a cell-based blocking assay (see Example 2.2.2 for methodology). Four AB loop and three EF loop clones were then shuffled by splice overlap extension PCR to generate new combinations (Horton et al., 2013). Shuffled Fcabs were cloned into the pTT5 expression vector, expressed and tested again for PD-L1/PD-1 blocking in both ELISA based blocking (as described in 1.3) and cell based blocking assays (as described in 2.2.2 below).
- One of the clones identified following loop shuffling was FS17-33-37, which, compared to FS17-33, had a single change in the AB loop (S15V) and a single change in the EF loop (G99D). The AB and EF loops of clone FS17-33-37 are shown in Table 3.
-
TABLE 3 Comparison of residues within AB and EF loops for the FS17-33-37 and FS17-33 Fcabs. Residue numbering according to IMGT numbering. The ‘~’ symbol indicates a deletion in the FS17-33 sequenced compared to the wild-type IgG1 Fc. AB loop (14-18) EF loop (92-101) FS17-33 Q S G Y W S N W R W Q M G D ~ FS17-33-37 Q V G Y W S N W R W Q M D D ~ - 2.2.2 Blocking Activity
- The blocking activity of the clones produced in Example 2.2.1 was analysed in a cell-based assay using HEK 293 cells overexpressing human PD-L1 (see 1.5 for development of the cell line). Briefly, HEK 293 cells expressing human PD-L1 were seeded at 1×105 cells per well in a V-bottom 96-well plate in PBS. The relevant concentrations of Fcab or positive control anti-PD-L1 mAb YW243.55.S1 (“S1”) (Patent Pub. No. US 2013/0045202 A1) were incubated with 500 ng/ml biotinylated PD-1 Fc in 100
μl 1×PBS for 45 minutes whilst shaking at 450 rpm. The plates were centrifuged at 1500 rpm for 3 minutes at 4° C. to pellet the cells. PBS was discarded and the pre-incubated Fcab or positive control/biotinylated hPD-1 Fc mixture was added to the wells for 1 hour at 4° C. The plates were centrifuged at 1500 rpm for 3 minutes at 4° C. to pellet the cells, supernatant was discarded and the cells were resuspended in PBS. Streptavidin conjugated to Alexa 488 was diluted 1:1000 in PBS and 100 μl was added to the wells for 30 minutes at 4° C. The plates were centrifuged at 1500 rpm for 3 minutes at 4° C. to pellet the cells, supernatant discarded and the cells were resuspended in PBS with DAPI. The plate was read on FACS Canto (BD Bioscience) and the data analysed using FlowJoX. - Fcab clones with improved activity compared with FS17-33 were identified. An example of this is illustrated in Table 4, below, which shows the improved blocking activity for FS17-33-37 compared to the parent FS17-33 clone. This binding activity was similar to the positive control S1 mAb.
-
TABLE 4 PD-L1/PD-1 blocking activity of the FS17-33-37 Fcab compared to the parent FS17-33 Fcab. Clone PD-L1/PD-1 blocking activity (IC50) FS17-33 17.7 nM FS17-33-37 8.1 nM - 2.2.3 Cell Binding to Human and Cynomolgus PD-L1
- To test binding to cell-surface human and cynomolgus PD-L1, the 11 Fcab clones with the highest activity in the cell based blocking assays, including FS17-33-37, were tested for binding to HEK 293 cells overexpressing human or cynomolgus PD-L1 (see Example 1.5 for methodology). All Fcabs showed dose-dependent binding to human PD-L1 with EC50 values around 5-10 nM and bound to cynomolgus PD-L1 with EC50 values around 100-200 nM.
- 2.2.4 DO11.10 T Cell Activation Assay
- Inhibition of the PD-L1/PD-1 interaction is known to lead to increased T cell activation (Stewart et al., 2015). As FS17-33-derived Fcabs showed potent blocking activity of the PD-L1/PD-1 interaction, they were expected to also increase T cell activation. In order to test this, 20 FS17-33 derived Fcabs were tested using a DO11.10 T cell activation assay and compared with anti-PD-L1 mAb S1 as a positive control. The assay is described in more detail in Example 6.
- The results showed that the FS17-33 derived clones were able to enhance T cell activation in this assay but the activity was very weak compared to the anti-PD-L1 positive control antibody S1 (data not shown). This was unexpected, as the difference in the PD-L1/PD-1 blocking activity of the Fcab clones tested was within 3-10 fold of the positive control.
- 2.2.5 Characterisation of FS17-33-37
- Fcab clone FS17-33-37 was chosen for further affinity maturation based on its low/minimal non-specific activity (without OVA peptide) in the DO11.10 T cell activation assay and based on its size exclusion (SE)-HPLC profile. Size exclusion chromatography (SEC) profiles were assessed on percentage monomeric protein and the elution time, favoring clones with an elution time closer to that of wild type IgG Fc (see
FIGS. 2A-2C ). A full dose titration of FS17-33-37 in the cell binding, cell based blocking assay and DO11.10 T cell activation assays were performed to further characterise FS17-33-37 (data not shown). The results confirmed that FS17-33-37 showed potent cell binding and blocking activity but weak activity in the DO11.10 T cell activation assay. - 2.2.6 Summary of the Affinity Maturation and Functional Improvement of Fcab FS17-33
- The NNK walk mutagenesis of the FS17-33 Fcab led to the identification of multiple clones with increased PD-L1:PD-1 blocking activity, to a level that is similar to the anti-PD-L1 positive control S1 mAb. Additionally, the anti-human PD-L1 binding FS17-33 derived Fcabs were cross-reactive to cynomolgus PD-L1.
- However, surprisingly activity of the FS17-33 lineage in the D011.10 T cell activation assay was very weak compared with the positive control S1 mAb. This data seemed inconsistent with the blocking data. As the D011.10 T cell activation assay is a more physiologically-relevant potency assay than the blocking assay, FS17-33 derived Fcabs clones were over 1000-fold lower in functional activity compared to the positive control antibodies.
- Without wishing to be bound by theory, it was hypothesized that the FS17-33-derived Fcabs may be unable to bind to monomeric PD-L1 with a high enough affinity to result in functional activity when measured by the DO11.10 T cell activation assay. The results obtained from the blocking and binding assays may have been influenced by an avidity effect that was a result of the high levels of human PD-L1 used in these assays.
- More substantial randomisation of the binding loops was therefore conducted with the aim of identifying Fcabs with higher affinity for PD-L1 and functional activity. Based on its specific activity and SEC-HPLC profile, FS17-33-37 was selected as the parental clone for further affinity maturations, as described in Example 3 below.
- 3.1 Affinity Maturation
- In order to obtain an Fcab with improved activity, FS17-33-37 was affinity matured to introduce the maximum diversity. Specifically, the FS17-33-37 PTT5 plasmid DNA (see 2.2.1) was used as a template to prepare libraries containing randomized loops. A portion of the AB loop (residues 14-18), the CD loop (residues 45.1-78), and the EF loop (residues 92-94, and 97-101) was randomized using NNK primers (AB loop) or ELLA primers (CD and EF loop). ELLA primers specify the codons used for each amino acid and their relative abundance within the mix. Only cysteine was excluded from the mix and no bias was given to any other amino acid. The individual loop libraries (one library for each of the AB, CD and EF loops) went through several rounds of selection to enrich for Fcab clones with improved binding to biotinylated hPD-L1-his (comprising a his-tag) compared to the parent clone FS17-33-37.
- To further improve the affinity of the matured clones for PD-L1, the outputs from each single loop library were shuffled in an unbiased manner to identify the loop combinations with the highest affinity for hPD-L1. The outputs from the selections were shuffled by isolating DNA from selected cells from each of the single loop libraries and shuffling DNA by splice overlap extension PCR to generate unbiased loop recombinations. This DNA was then used to create a new yeast display library. Yeast cells (EBY100, Invitrogen V835-01) were transformed using the amplified PCR product along with a yeast vector (pYD1dem, Invitrogen V835-01). The shuffled library then underwent multiple rounds of selection to enrich for the clones with the highest affinity for monomeric PD-L1.
- Selected Fcabs were screened for binding to recombinant protein both monomeric and dimeric PD-L1 antigen. Monomeric His-tagged antigen (Acro biosystems Cat #PD1-H5229) was biotinylated using the Pierce LC-LC biotinylation kit (Thermo Fisher Scientific 21338) whilst the biotinylated dimeric antigen is available commercially (BPS Bioscience #71105)
- From the screening, 104 Fcab clones were chosen for soluble expression. Soluble Fcabs were expressed in HEK cells from the pTT5 Fcab expression vector and purified using mAb Select SuRe protein A columns.
- 3.2 SEC Profiles
- Size exclusion chromatorgraphy (SEC) was carried out to determine whether any of the affinity matured Fcabs identified in 3.1 showed aggregation. All purified Fcabs were analysed by SE-HPLC using an Agilent 1100 series HPLC with a Zorbax GF-250 column (Agilent). All clones containing an MFYGP motif in the EF loop showed excessive aggregation or did not enter the column at all. As a result, these clones were not considered to represent suitable candidate Fcabs and were not tested further. The remaining 40 clones did not show aggregate peaks, but they did have split peaks or shoulders. For example, as shown in
FIGS. 2A-2B , clone FS17-33-116 showed a split peak (FIG. 2B ) that wasn't present in the parent FS17-33-37 clone (FIG. 2A ). The potential cause of these deviations will be discussed later, but was not considered a reason to remove these Fcab clones from the candidate selection process. - 3.3 Off-Rate Screening of Expressed Fcabs
- Following soluble expression in HEK cells, the Fcabs from the selection using the monomeric, His-tagged antigen were screened for their off-rate when bound to human PD-L1 using BIAcore. Briefly, biotinylated antigen was coated on the chip at 10 μg/mL to 585 RU and supernatant from the expressed clones was flowed over the chip at 30 μL/minute. This assay was carried out with both monomeric and dimeric PD-L1 antigen. The dissociation was carried out for 6 minutes. Analysis was carried out using the BIAevaluate software. Curves were double subtracted from the blank flow cell and from a run with no Fcab. Curves were then aligned and normalized for comparison. It was hypothesised that clones with slower off-rates when bound to PD-L1 would have enhanced T cell activation activity due to continuous blocking of PD-L1 binding to its ligands. 33 of the 40 Fcab clones tested showed a significantly improved (slower) dissociation (off) rate compared with the parent clone FS17-33-37 when bound to PD-L1 and were selected for further functional screening as described in 3.4 below.
- 3.4 Functional Screening
- In order to determine whether the affinity maturation described in 3.1 resulted in an improvement in functional activity, the 33 Fcab clones identified in 3.3 were tested for activity using the DO11.10 T cell activation assay and compared with the anti-PD-L1 antibody S70 as a positive control (see Example 6.1 for experimental details). A titration of each Fcab was used to calculate the EC50 values for each Fcab in this assay to facilitate comparison. Five clones (FS17-33-85, FS17-33-87, FS17-33-114 and FS17-33-116) all had EC50 values between 0.28 to 0.5 nM, which is comparable to the positive control, the S70 antibody.
- Clones FS17-33-85, FS17-33-87, FS17-33-114 and FS17-33-116 had very similar sequences with only 1 or 2 amino acid differences, none of which are in the AB or CD loops (see Table 5, which identifies the differences in sequence between these clones, all of which are located in the EF loop or the framework region). Surprisingly, the AB loop sequence present in all clones from the shuffle library (see 3.1) had not been identified in the screening of the individual AB loop library and contained an amino acid deletion, with the result that the AB loop sequence between
residues 14 to 18 was only four amino acids in length, rather than five. The exact location of the deletion was not known. As the residues atpositions residue FIGS. 1A-1D . Furthermore, as described in more detail in 4.3 below, restoring this deleted residue in the AB loop produced a significant loss in binding affinity. The presence of this deletion in the AB loop was therefore important for binding of the Fcabs to PD-L1. -
TABLE 5 D011.10 T cell activity Other assay muta- EC50 EF loop (92-101) tions (nM) FS17- S N W R W Q M E Q ~ A38V 0.47 33-85 FS17- S N W R W Q M D D ~ 0.32 33-87 FS17- S N W R W R M D D ~ 0.39 33-114 FS17- S N W R W Q M D D ~ A38V 0.28 33-116 - 3.5 Further Characterisation of Fcab FS17-33-116
- Since all of the Fcab clones identified in 3.4 had contained very similar sequences, a representative clone (FS17-33-116) was chosen for further characterisation. Any of the other Fcab clones listed in Table 5 could equally be chosen for further characterisation given that all of these Fcab clones had EC50 comparable to that of the positive control, the S70 antibody, in the DO11.10 T cell activation assay. Affinity of FS17-33-116 for PD-L1 was measured using Biacore, employing protein A to capture the Fcab. The monomeric PD-L1-his human antigen was flowed over the chip in titrating concentrations at a high flow rate to minimise mass transport limitations. The KDS were measured using a 1:1 fitting analysis with no refractive index correction and Rmax set to local. Fcab clone FS17-33-116 showed a strong improvement in affinity compared to the parental clone, FS17-33-37, as well as an improved affinity compared with the positive control antibody, S70 (see Table 6). This is primarily due to a slower off-rate of the Fcab when bound to PD-L1.
-
TABLE 6 Clone ID KD (nM) Kd (1/s) Ka (1/Ms) FS17-33-37 270 0.02 7.6 × 104 FS17-33-116 0.49 4.4 × 10−4 1.5 × 106 S70 mAb 1.1 3.0 × 10−4 2.7 × 105 - To test the specificity of clone FS17-33-116 for PD-L1, PD-1 (R&D systems 1086-PD) and PD-L2 (R&D systems 1224-PL) were coated onto a Biacore chip along with PD-L1. The Fcab was then flowed over the chip at a 1000-fold concentration range. No binding was observed to either PD-1 or PD-L2 at these concentrations. However, the Fcab did bind to PD-L1. This indicates that Fcab FS17-33-116 binds specifically to PD-L1.
- To further assess the functional activity of FS17-33-116, the Fcab was tested in an SEB assay (see Example 7.1 for experimental details). Since this assay uses cells donated from patients, the cells are expressing endogenous levels of PD-L1. These expression levels are considerably lower than the LK35.2 cells used in the DO11.10 assay. In the SEB assay, the FS17-33-116 Fcab matched the positive control S70 antibody in both potency and efficacy (see Table 7). No activity was seen with the anti-FITC antibody, 4420, which served as a negative control. Since the S70 antibody has been shown to have efficacy in the clinic, it is expected that the FS17-33-116 Fcab will similarly have clinical efficacy
-
TABLE 7 SEB Assay Clone ID EC50 (nM) Negative control 4420 mAb No activity FS17-33-116 0.07527 Positive control S70 mAb 0.07605 - 3.6 Construction and Expression of FS17-33-116 in a mAb2 Format
- Fcabs may be incorporated into conventional immunoglobulin molecules to provide bispecific antibodies, comprising both the CDR-based antigen-binding site of the immunoglobulin molecule and an additional binding site in a constant domain of the immunoglobulin as a result of the incorporation of the Fcab. Such molecules are also referred to as mAb2 molecules. “mock” mAb2 may also be prepared. A “mock” mAb2 is a mAb2 where the Fcab of interest has been incorporated into an immunoglobulin molecule comprising a CDR-based antigen binding site for an antigen which is not expected to bind in the context in which the “mock” mAb2 is to be used. This allows the Fcab to be tested in a format which is comparable to an intact immunoglobulin molecule without any effect from the CDR-based antigen binding site of the molecule.
- A “mock” mAb2 consisting of an IgG1 comprising the FS17-33-116 anti-human PD-L1 Fcab described above was prepared in order to allow the characterisation of this Fcab in mAb2 format. This mock mAb2 was prepared by substituting part of the CH3 domain of the FS17-33-116 Fcab, comprising the AB, CD and EF loops, for the corresponding region of the CH3 domain of the anti-FITC antibody 4420, and also comprised the LALA mutation in the CH2 domain of the heavy chain of the antibody. The heavy and light chain sequences of antibody 4420 are shown in
SEQ ID NOS - The “mock” FS17-33-116/4420 mAb2 was compared to Fcab FS17-33-116 to ensure the desired qualities were maintained. A SEC profile for the mAb2 showed that the mAb2 no longer had a split peak or shoulder (see
FIG. 2C ). A small amount of aggregation was observed, as expected for the 4420 mAb, as this antibody is known to aggregate. The FS17-33-116/4420 mAb2 was then tested for binding and functional activity. - The FS17-33-116/4420 mAb2 was tested in a DO11.10 T cell activation assay (see Example 6 for methodology). The FS17-33-116/4420 mAb2 showed a drop in activity in this assay compared with the FS17-33-116 Fcab. This drop was significant, but small. The EC50 for FS17-33-116/4420 mAb2 remained below 1 nM. Since the intrinsic affinity of FS17-33-116/4420 mAb2 and FS17-33-116 for PD-L1 was the same, it is thought that the most likely cause for the drop in activity observed with FS17-33-116/4420 mAb2 in the DO11.10 assay was due to a higher avidity of the FS17-33-116 Fcab compared with the S17-33-116/4420 mAb2. Since the Fcab, but not the mAb2, showed a split peak when analysed using SEC, it is postulated that the Fcab was forming dimers that, in the context of a cell based assay such as the DO11.10 assay, could boost the activity of the Fcab via avidity. To address this, the molecules were analysed via analytical ultracentrifugation using a Beckman Optima XL-1 instrument.
- Data from this experiment showed two peaks for the Fcab and only a single peak for the mAb2. The calculated masses for the Fcab were consistent with a monomer for the first peak and a dimer for the second peak. The amount of dimerization was concentration dependent and the KD for the interaction was estimated to be 2 μM. Although this interaction is weak, these data support the notion that the Fcab was boosted in activity in the cell-based functional assay via avidity on the cell surface mediated through self-interactions. In addition, the positive control antibody S70 had an intrinsic affinity for PD-L1 similar to FS17-33-116 and activity in a Mixed Lymphocyte Reaction (MLR) assay equivalent to FS17-33-116. As antibodies are bivalent, it is postulated that a monovalent Fab would have similar activity to the mAb2 as a result of the loss of avidity. To test this hypothesis the S70 Fab arms were digested away from the Fc portion above the hinge resulting in monovalent Fab domains. These domains were then purified using protein A to remove Fc domains, anti-his to remove enzymes and finally subjected to SEC to purify the monomeric fraction. These Fab arms were then tested in an MLR assay and showed a loss of activity equivalent to the drop in activity observed between the Fcab and mAb2 in this assay, providing additional support for the hypothesis that the reduction in activity between the Fcab and mAb2 was due to the avidity of the Fcab.
- 3.7 Summary of Affinity Maturation and Functional Improvement of Fcab Clone FS17-33-37
- The affinity maturation of FS17-33-37 produced Fcab clones with significant improvements in off-rate and functional activity. One of these clones, FS17-33-116, showed similar activity to the clinically-verified positive control S70 antibody in both the DO11.10 and SEB assays. Since the positive control mAb has been shown to have efficacy in the clinic, it is expected that the FS17-33-116 Fcab and molecules comprising this Fcab, such as mAb2 molecules, will also have clinical efficacy.
- The FS17-33-116 Fcab was also inserted into a “mock” mAb2 format and similar results were observed as reported for the Fcab format, albeit with a slight reduction in activity when measured in the DO11.10 T cell activation assay. Without wishing to be bound by theory, it is believed that the Fcabs, but not the mAb2, self-associate and form dimers in the context of a cell-based assay and that this could account for the difference in activity between the Fcab and mock mAb2 formats of FS17-33-116.
- Whilst the FS17-33-116 Fcab described in Example 3 displayed a high affinity for PD-L1 and high activity in a DO11.10 T cell activation assay, it was considered that further improvements could be made to the Fcab to remove potential manufacturing sequence liabilities and to improve biophysical properties. In particular, the FS17-33-116 Fcab contained a methionine in the EF loop and showed a small degree of dimerization. Therefore, the FS17-33-116 clone was further engineered to address these issues.
- 4.1 Methionine Substitution
- A methionine appeared in the EF loop of the FS17-33 lineage at the naïve selection stage. Since this may be a sequence liability and this residue was retained through multiple rounds of affinity maturation, the likelihood of finding a substitution that would improve activity was therefore very small. Instead the goal was to find a residue that could replace the methionine with minimal loss in activity and worsening in the binding of the resulting Fcab to PD-L1.
- Site directed mutagenesis was carried out using primers that contain the degenerate codon NNK at IMGT position M98 in the EF loop of FS17-33-116. The primers did not include codons that code for cysteine and glycine, as these amino acids are also considered potential sequence liabilities.
- The Met substitution clones were expressed and tested as Fcabs in an off-rate screen to identify clones that had similar binding kinetics to human PD-L1 as clone FS17-33-116. From this experiment it was seen that hydrophobic residues replaced the Met with a minimal increase in the off-rate of the Fcab when bound to PD-L1 (within two fold of the off-rate of the parental clone FS17-33-116). The only exception was proline, which showed the fastest off-rate of all of the Fcab clones tested.
- All of the Fcab clones were then purified on Protein A columns for further testing. Ten of the Fcab clones did not elute off the Protein A column and were therefore not included in further analysis. This included the Fcab in which tryptophan was substituted for methionine, which had shown an off-rate within two-fold of the parental clone.
- The purified Fcab clones were then put onto a SEC column to assess aggregation. From this analysis, Fcabs in which the methionine was substituted with phenylalanine or tyrosine showed significant aggregation and retention on the column. Thus, these clones were excluded from further analysis. Three Fcab clones were identified with an off-rate within two-fold of the parental clone. These contained leucine, isoleucine or valine in place of the methionine at
position 98. These were Fcabs FS17-33-289, FS17-33-288, and FS17-33-296, respectively, as shown inFIGS. 1A-1D andSEQ ID Nos - In addition, an Fcab clone was prepared in which the framework mutation A38V was reverted back to the wild-type alanine to reduce the mutational load of the Fcab. The A38V mutation was observed in clone FS17-33-116 but not in sibling clones with similar activity (see Table 5). This reverse mutation was made based on the FS17-33-289 Fcab, and the resulting Fcab termed FS17-33-334. A summary of sequences for the AB, CD and EF loops and the residue at
position 38 for these clones is provided inFIGS. 1A-1D . - FS17-33-289, FS17-33-288, FS17-33-296, and FS17-33-334 were then tested for their binding affinity to PD-L1, ability to block the PD-1/PD-L1 interaction and activity in a DO11.10 T cell activation assay in both a Fcab and mock mAb2 formats (see 4.2 for details regarding generation of the mock mAb2), as further described in Examples 6 and 7 below.
- 4.2 Construction and Expression of Fcabs FS17-33-289, FS17-33-288, FS17-33-296, FS17-33-334, FS17-33-449 and FS17-33-451 in mAb2 Format
- In order to test the PD-L1 binding affinity, PD-1/PD-L1 blocking activity, and functional activity in a DO11.10 T-cell activation assay of Fcabs in the format of a complete immunoglobulin molecule, various mAb2 comprising the Fcabs were constructed and expressed as described below.
- 4.2.1 “Mock” mAb2 Construction and Expression
- “Mock” mAb2 consisting of an IgG1 comprising Fcabs, including Facbs FS17-33-289, FS17-33-288, FS17-33-296, FS17-33-334, described in 4.1 above, and FS17-33-449 and FS17-33-451 described in 4.3 below, were prepared in order to allow the characterisation of these Fcabs in mAb2 format. These mock mAb2 were prepared by substituting part of the CH3 domain of the Fcabs, comprising the AB, CD and EF loops, for the corresponding region of the CH3 domain of the anti-hen egg white lysozyme antibody HeID1.3, either with or without the LALA mutation in the CH2 domain of the heavy chain of the antibody. The heavy and light chain sequences of antibody HeID1.3 with the LALA mutation are shown in
SEQ ID Nos - Additionally, “mock” mAb2 comprising the FS17-33-449 and FS17-33-451 anti-human PD-L1 Fcabs described in 4.3 below were prepared as described in the preceding paragraph but using the anti-Cytomegalovirus (CMV) gH glycoprotein antibody MSL109. Generation of the MSL109 antibody is described in WO1994/016730 A1. These mAb2 were prepared with the LALA mutation in the CH2 domain. The heavy and light chain sequences of antibody MSL109 with the LALA mutation are shown in
SEQ ID Nos - 4.2.2 Anti-CTLA-4 mAb2 Construction and Expression
- mAb2 comprising the FS17-33-289, FS17-33-449 and FS17-33-451 anti-human PD-L1 Fcabs described in 4.1 and 4.3 were prepared as described above but using the anti-CTLA-4 mAb ipilimumab. These mAb2 were prepared without the LALA mutation in the CH2 domain. The heavy and light chain sequences of ipilimumab are shown in
SEQ ID Nos - A summary of the mAb2 generated and expressed is provided in Table 8.
-
TABLE 8 Contains mAb2 name Fcab clone Fab clone LALA? F17-33-288AA/HelD1.3 F17-33-288 HelD1.3 Yes F17-33-289AA/HelD1.3 F17-33-289 HelD1.3 Yes F17-33-296AA/HelD1.3 F17-33-296 HelD1.3 Yes FS17-33-296/HelD1.3 F17-33-296 HelD1.3 No F17-33-334AA/HelD1.3 F17-33-334 HelD1.3 Yes F17-33-449AA/HelD1.3 F17-33-449 HelD1.3 Yes FS17-33-449/HelD1.3 F17-33-449 HelD1.3 No F17-33-451AA/HelD1.3 F17-33-451 HelD1.3 Yes FS17-33-449AA/MSL F17-33-449 MSL109 Yes FS17-33-451AA/MSL F17-33-451 MSL109 Yes FS17-33-289/CTLA-4 F17-33-289 CTLA-4 No FS17-33-449/CTLA-4 F17-33-449 CTLA-4 No FS17-33-451/CTLA-4 F17-33-451 CTLA-4 No - 4.3 NNK Walk of Binding Loops
- To identify Fcabs with improved biophysical properties, reduced mutational load, and optimized affinity for PD-L1, each position in the AB, CD and EF loops of the parent Fcab clones (Fcab FS17-33-116 for the AB and EF loops, and mock mAb2 F17-33-334AA/HeID1.3 for the CD loop) was mutated to all possible amino acid substitutions and the resulting Fcabs screened for binding to PD-L1 and functional activity followed by an assessment of their biophysical properties.
- Tables 9A-C list the number of different amino acid substitutions at each position of the AB, CD and EF loops, as well as the specific amino acid substitutions at the relevant positions, which resulted in no reduction in the off-rate of the Fcab/mAb2 on PD-L1 greater than two-fold compared with the parent Fcabs, Fcab FS17-33-116 for the AB and EF loop mutants and mock mAb2 F17-33-334AA/HeID1.3 for the CD loop mutants. Note that residues at
positions - Binding to PD-L1 was measured using an Octet system. Binding of the AB and EF loop mutants to PD-L1 was tested in Fcab format, while the CD loop mutants were tested in mock mAb2 format based on antibody HeID1.3. These mock mAb2 were constructed as described in Example 4.2.1 above.
- The Fcabs and mock mAb2 were captured via a protein A tip and then exposed to monomeric PD-L1-his. The off-rates of the Fcabs/mock mAb2 when bound to PD-L1 were then calculated using the Octet analysis software and compared to the parental clone, FS17-33-116 or F17-33-334AA/HeID1.3. Generally, a two-fold difference in the off-rate is within the error of this type of assay and therefore clones that fell within this range were considered to have an equivalent off-rate when bound to PD-L1 as the parent clone, FS17-33-116 or F17-33-334AA/HeID1.3.
- Two positions in the AB loop, two in the CD loop and three in the EF loop (
residues -
TABLE 9A AB loop (14-18) Residue position (IMGT) 14 15 16 17 18 Sequence of parent Fcab FS17-33-116 ~ S G Y W Number of substitutions resulting in 1 13 17 16 17 expressed Fcabs Number of substitutions resulting in an 0 13 13 0 0 Fcab retaining binding to PD-L1 within 2-fold of the parent Fcab Identity of substitutions resulting in an AEFGHILPRTVY ADEFHKLNPRTVY Fcab retaining binding to PD-L1 within 2-fold of the parent Fcab -
TABLE 9B CD loop (45.1-78) Residue position (IMGT) 45.1 45.2 45.3 45.4 77 78 Sequence of parent mock mAb2 E P Q Y W A F17-33-334AA/HelD1.3 Number of substitutions 16 17 17 15 17 17 resulting in expressed Fcabs Number of substitutions 10 9 2 5 0 7 resulting in an Fcab retaining binding to PD-L1 within 2-fold of the parent Fcab Identity of substitutions resulting AGHILNQRS ADEGHNQWY HN ADHTV DEGLRSW in an Fcab retaining binding to W PD-L1 within 2-fold of the parent Fcab -
TABLE 9C EF loop (92-101) Residue position (IMGT) 92 93 94 97 98 99 100 101 Sequence of parent Fcab S N W Q M D D ~ FS17-33-116 Number of substitutions 17 16 14 16 19 16 14 1 resulting in expressed Fcabs Number of substitutions 2 13 0 12 6 9 11 1 resulting in an Fcab retaining binding to PD-L1 within 2-fold of the parent Fcab Identity of substitutions AG AEFGHIKLQ ADEFGH FILV AILRS AEFIKL V resulting in an Fcab retaining RSTY KLNRSV WY TVWY NRVWY binding to PD-L1 within 2-fold of the parent Fcab - Next, at each permissive position where the parent clones did not already comprise the wild-type (WT) amino acid (
residues FIGS. 1A-1D for the sequence of the “WT Fcab”), the Fcab clones with a WT amino acid at that position were tested in mock mAb2 format to determine their off-rate when bound to PD-L1. The mock mAb2 were constructed based on the HeID1.3 antibody as described in Example 4.2.1 above. The off-rate was determined using aBiacore 3000 instrument, where the mock mAb2 were captured on a protein A chip and monomeric hPD-L1 was flowed over the captured antibodies. Off-rates were then calculated using the Biaevaluate software from GE. It was found that WT reversions atpositions - In addition, Fcabs were prepared in which the deleted
residues residues position 14 in the AB loop resulted a significant worsening in the off-rate when the mock mAb2 was bound to PD-L1 (faster) and no further studies were done with these Fcab clones. However, restoring the deleted residue in the EF loop had no impact on PD-L1 binding by itself but, combining this with any other WT reversion in the EF loop did result in a significant drop in affinity. Finally, the WT reversions in the AB loop atpositions position 101 of the EF loop. One of these clones FS17-33-449 comprising the WT reversions atposition 15 in the AB loop andposition 101 of the EF loop showed binding to PD-L1 comparable to the parent clone and was further analysed as described below. - A subset of the Fcab clones in mock mAb2 format (the mock mAb2 were prepared based on FS17-33-334AA/HELD1.3) was selected from the NNK walk mutagenesis screen described above on the basis that the clones showed no loss in activity greater than 2-fold as measured in the DO11.10 T cell activation assay (see Example 6 for experimental details) compared with the parent clone FS17-33-334AA/HELD1.3 (see 4.2.1 for preparation of this mock mAb2). A two-fold difference in activity is within the error of this assay and therefore mock mAb2 that fell within this range were considered to have comparable activity in the DO11.10 T cell activation assay to the parent clone FS17-33-334AA/HELD1.3. This subset of mock mAb2 clones also showed no indication of aggregation greater than 3% of total protein, as measured by SEC analysis (see 3.2 for experimental details). The results are shown in Table 9D.
- The subset of Fcabs, comprised Fcabs with mutations at
position 15 of the AB loop and positions 93, 97 and 100 of the EF loop, whereby S could be changed to E, H, L, F or Y atposition 15, N could be changed to A, Q or H atposition 93, Q could be changed to R, H or S atposition 97, and D could be changed to A atposition 100. -
TABLE 9D Amino acid Residue substi- DO11.10 SEC % Clone ID modified tution Kd (1/s) EC50 (nM) monomer FS17-33-334AA/ N/A 3.72E−04 0.4027 99% HELD1.3 FS17-33-157AA/ 15 E 5.59E−04 0.4813 98% HELD1.3 FS17-33-159AA/ 15 H 4.27E−04 0.2632 98% HELD1.3 FS17-33-161AA/ 15 L 5.78E−04 0.4528 99% HELD1.3 FS17-33-163AA/ 15 F 3.72E−04 0.3704 99% HELD1.3 FS17-33-166AA/ 15 Y 5.23E−04 0.2382 99% HELD1.3 FS17-33-235AA/ 93 A 7.09E−04 0.5613 100% HELD1.3 FS17-33-239AA/ 93 Q 6.93E−04 0.5875 100% HELD1.3 FS17-33-241AA/ 93 H 5.92E−04 0.3038 100% HELD1.3 FS17-33-266AA/ 97 R 3.77E−04 0.4342 97% HELD1.3 FS17-33-271AA/ 97 H 5.18E−04 0.254 99% HELD1.3 FS17-33-277AA/ 97 S 4.15E−04 0.3192 100% HELD1.3 FS17-33-316AA/ 100 A 5.66E−04 0.5633 97% HELD1.3 - The subset of mock mAb2 described above was then further modified by replacing the deleted amino acid at
position 101 in the EF loop, thereby creating a second panel of mock mAb2 molecules which comprised a reduced number of mutations compared with the WT Fcab (seeFIGS. 1A-1D ) and thus had a reduced mutational burden. This second panel of mock mAb2, including FS17-33-449AA/HELD1.3 that contains a wild-type reversion atpermissive position 15, were tested for function in a DO11.10 T cell activation assay (see Example 6 for experimental set-up) and binding to hPD-L1. The results are shown in Table 9E. All clones showed equivalent functional activity in the DO11.10 assay to the parent mAb2 FS17-33-334AA/HELD1.3 (except for FS17-33-456AA/HELD1.3, FS17-33-457AA/HELD1.3 and FS17-33-462AA/HELD1.3, which were excluded from further analysis), demonstrating that the introduction of a valine atposition 101 of the EF loop in the CH3 domain was well tolerated. Two clones exhibited improved biophysical characteristics when analysed by dynamic light scattering (DLS), protein A purification and solubility analysis. These clones were FS17-33-449AA/HELD1.3 and FS17-33-451AA/HELD1.3, which were therefore chosen as the lead candidates from this final panel. -
TABLE 9E Residues Amino acid DO11 Clone ID modified substitution EC50 Kd 1/s FS17-33-334AA/HELD1.3 N/A N/A 0.6721 2.91E−04 FS17-33-449AA/HELD1.3 15/101 T/V 0.7665 3.11E−04 FS17-33-451AA/HELD1.3 15/101 E/V 0.9079 2.53E−04 FS17-33-452AA/HELD1.3 15/101 H/V 0.5646 3.38E−04 FS17-33-453AA/HELD1.3 15/101 L/V 0.6323 3.03E−04 FS17-33-454AA/HELD1.3 15/101 F/V 0.5094 2.69E−04 FS17-33-455AA/HELD1.3 15/101 Y/V 0.6801 3.43E−04 FS17-33-456AA/HELD1.3 93/101 A/V 1.891 6.19E−04 FS17-33-457AA/HELD1.3 93/101 Q/V 1.005 5.89E−04 FS17-33-458AA/HELD1.3 93/101 H/V 0.741 4.56E−04 FS17-33-459AA/HELD1.3 97/101 R/V 0.6632 3.80E−04 FS17-33-460AA/HELD1.3 97/101 H/V 0.5217 2.02E−04 FS17-33-461AA/HELD1.3 97/101 S/V 0.593 3.59E−04 FS17-33-462AA/HELD1.3 100/101 NV 2.025 8.99E−04 - The FS17-33-288, FS17-33-289, FS17-33-296, FS17-33-334, FS17-33-449 and FS17-33-451 Fcab clones, in both an Fcab (see 4.1 and 4.2 for details) and mAb2 format (see Example 4 for details), were then tested for their ability to bind human PD-L1 and block PD-1/PD-L1 interaction. As described in Example 4, the aim behind generating these Fcabs and mAb2 was to remove sequence liabilities and to improve biophysical properties, whilst maintaining the binding, blocking and functional properties of Fcab FS17-33-116. 5.1 Binding to PD-L1
- Fcab and mAb2 binding to human PD-L1 was assessed by both BIAcore and in a cell binding assay. To measure the affinity of the clones to monomeric hPD-L1-his, the mAb2 were captured using an anti-Fab antibody coated on a CM5 chip (GE 28-9582-20 AC) and Fcabs were captured using a Protein A chip (GE 29127556) using a Biacore T200 (GE). To minimize mass transport effects, the capture level was minimized to 200RU and a fast flow rate of 75 μl/min was used. Both the human (Acro biosciences PD1-H5229) and cynomolgus (Acro Biosciences PD1-C52H4) monomeric antigens were titrated and flowed over the captured mAb2. The analysis of the data was done using the Biacore T200 evaluation software. Curves subtracted against a blank flow cell and a run with no antigen were analysed using a 1:1 fitting model with no bulk analysis and Rmax analysed locally.
- Cell binding assays were performed by incubating Fcabs or mAb2 proteins with either control HEK293 cells or HEK293 cells overexpressing hPD-L1 or cynomolgus PD-L1 cells for 1 hour at 4° C. Fcab/mAb binding was subsequently detected using an anti-human Fc 488 detection antibody. Fluorescent signal intensities were measured using a FACS canto.
- The results of these binding experiments are summarised in Table 10. Table 10 shows that all of the clones tested had a high affinity for monomeric and cell-expressed human and cynomolgus PD-L1.
-
TABLE 10 Binding affinity - KD (nM) Cell Cell Human Cynomolgus binding binding monomeric monomeric human cynomolgus Clone ID Format PD-L1 PD-L1 PD-L1 PD-L1 FS17-33-116 Fcab 0.33 0.42 1.68 0.6651 FS17-33-288 Fcab 1.6 2.1 2.5 2.6 FS17-33- mAb2 1.43 2.0 15.2 7.8 288AA/ HelD1.3 FS17-33-289 Fcab 0.54 0.66 1.0 0.44 FS17-33- mAb2 not not 3.9 2.2 289AA/ tested tested HelD1.3 FS17-33-296 Fcab 0.73 0.87 1.0 0.50 FS17-33- mAb2 not not 2.7 2.0 296AA/ tested tested HelD1.3 FS17-33-334 Fcab 1.93 2.18 2.06 0.68 FS17-33- mAb2 1.45 1.9 8.9 0.91 334AA/ HelD1.3 FS17-33- mAb2 0.38 0.6 7.88 3.6 449AA/ MSL FS17-33- mAb2 0.49 0.9 449AA/ HELD1.3 FS17-33- mAb2 0.34 0.5 11.7 4.52 451AA/ MSL FS17-33- mAb2 0.45 0.63 451AA/ HELD1.3 S70 mAb 0.11 7.8 1.74 0.75 comprising LALA mutation - 5.2 Blocking Activity
- The ability of the Fcabs and mock mAb2 to block hPD-1/hPD-L1 and hPD-L1/hCD80 interactions was tested in cell-based Receptor Binding Assays (RBA). In brief, biotinylated hPD-L1-Fc-Avi was incubated for 1 hour with titrating concentrations of Fcabs ranging from 400 nM to 3 μM. The mix was incubated for another hour with HEK293 cells overexpressing either hPD-1 or hCD80. The level of bound biotinylated hPD-L1-Fc-Avi on the HEK293 cells was detected using streptavidin 647 and fluorescence levels were measured using the FACS Canto (BD Biosciences).
- The results of these blocking experiments are shown in Table 11. Table 11 shows that all of the clones tested were able to potently block hPD-1/hPD-L1 and hPD-L1/hCD80 interactions.
-
TABLE 11 Blocking activity - EC50 (nM) Clone ID Format PD-L1/PD-1 PD-L1/CD80 FS17-33-116 Fcab 9.5 8.4 FS17-33-288 Fcab 2.8 0.79 FS17-33-289 Fcab 10.1 9.2 FS17-33-296 Fcab 9.0 8.8 FS17-33-334 Fcab 0.99 0.55 FS17-33-449AA/MSL mAb2 1.96 194* FS17-33-451AA/MSL mAb2 0.92 190* S70 mAb 0.63 9.6 (74.5*) *The PD-L1 concentration was increased from 2 μg/mL to 50 μg/mL in these experiments resulting in higher EC50 values. - 6.1 Activity of the Fcabs in a Human PD-L1 DO11.10 T Cell Activation Assay
- The panel of Fcabs containing the LALA mutation was tested in a DO11.10 based T cell activation assay in Fcab and mAb2 format. mAb2 were produced as described in Example 4 and tested in a DO11.10 T cell assay as described below.
- An IL-2 release assay based on the DO11.10 OVA-specific T-lymphocyte and LK35.2 B-lymphocyte hybridoma cell lines was used for functional screening of the mAb2. IL-2 release is a marker of T cell activation. T cells, expressing endogenous murine PD-1, were transfected with empty vector (pLVX). B-cells were transfected with human PD-L1 construct.
- The mAb2 were tested with and without the LALA mutation (AA), depending on the mAb2 in question. The Fab portion of the mAb2 was either the variable region of a monoclonal antibody directed against hen egg white lysozyme (HeID1.3), the FITC molecule (4420), the human CTLA-4 (ipilimumab). Details regarding the construction of these mAb2 are provided in Example 4.
- 6.1.1 Production of T Cell Lines with an Empty Vector
- Lentiviral transduction methodology was used to generate DO11.10 cells (National Jewish Health) containing the empty lentiviral vector pLVX using the Lenti-X HTX Packaging System (Cat. No 631249). Lenti-X expression vector (pLVX) (Cat. No 631253) was co-transfected with a Lenti-X HTX Packaging Mix into the Lenti-X 293T Cell Line (Cat. No 632180) to generate virus. The DO11.10 cell line was transduced using the lentiviral particles produced with the Lenti-X HTX Packaging System.
- 6.1.2 Production of Antigen Presenting Cells Over-Expressing PD-L1
- Lentiviral transduction methodology was used to generate LK35.2 B cell lymphoma cells (ATCC, HB-98) over-expressing human PD-L1 using the Lenti-X HTX Packaging System (Cat. No 631249). Lenti-X expression vector (pLVX) (Cat. No 631253), containing, human PD-L1 cDNA, was co-transfected with a Lenti-X HTX Packaging Mix into the Lenti-X 293T Cell Line (Cat. No 632180) to generate virus. The LK35.2 cell line was transduced using the lentiviral vectors produced with the Lenti-X HTX Packaging System.
- 6.1.3 Media and Peptide
- Cell culture medium: DMEM (Gibco, 61965-026) 10% FBS (Gibco, 10270-106), 1 mM Sodium Pyruvate (Gibco, 11360-070), 1 μg/ml puromycin (Gibco, A11138-03)
- Experimental medium: complete DO11.10 culture medium without puromycin.
- OVA peptide (MW=1773.9 Da): H-ISQAVHAAHAEINEAGR-OH (Pepscan) Cells:
-
- DO11.10 μLVX: DO11.10 T cell hybridoma transduced with an empty lentiviral vector;
- LK 35.2 hPD-L1: B cell hybridoma transduced with a lentiviral vector containing hPD-L1 to overexpress human PD-L1
- Dilutions of Fcabs, mAb2, anti-human positive control mAb (S1 or S70) or the human IgG1 isotype control mAb (anti-HELD1.3 or MSL) were prepared in experimental media. Fcabs, mAb2 or control mAbs were mixed 1:1 with 4×105/ml LK35.2 hPD-L1 cells in experimental media in presence of 2.46 μM OVA peptide (100 μL LK35.2 hPD-L1/(Fcab, mAb2 or control mAbs) mix per well in 96-round bottom plate) and incubated at 37° C., 5% CO2 for 1 hour. 2×105 DO11.10 μLVX cells/ml in 100 μl volume experimental media were added to 100 μl of the LK35.2 hPD-L1/(Fcab, mAb2 or control mAbs) mix. The cells were then mixed before being incubated at 37° C., 5% CO2 for 24 hours. Supernatants were collected and assayed with mouse IL-2 ELISA kit (eBioscience, 88-7024-88 or R&D systems, SM2000) following the manufacturer's instructions. Plates were read at 450 nm using the plate reader with the Gen5 Software, BioTek. Absorbance values of 570 nm were subtracted from those of 450 nm (Correction). The standard curve for calculation of cytokine concentration was based on four parameter logistic curve fit (Gen5 Software, BioTek). The concentration of mouse IL-2 was plotted vs the log concentration of Fcab, mAb2 or positive control mAb and the resulting curves were fitted using the log (agonist) vs response equation in GraphPad Prism.
- The results are shown in
FIGS. 3A-3B and 4A-4B and Table 12. The human Fcabs showed significant activity in the T cell activation assay with potencies (EC50) in the range of 0.2 nM comparable to the positive control mAbS1 antibody. Both the Fcab and the mock mAb2 released the PD-L1 mediated inhibition of the T cells. However, the conversion of the Fcab into a mock mAb2 format resulted in a partial reduction of the IL-2 release. -
TABLE 12 EC50 values of anti-human PD-L1 Fcabs and mock mAb2 in DO11.10 T cell activation assay Anti-human PD-L1 Fcabs (with LALA mutation) and positive control anti-human PD-L1 mAb, EC50 Std S1 and S70 (nM) Dev FS17-33-37AA — — FS17-33-116AA 0.28 (n = 1) — FS17-33-288AA 0.137 (n = 2) 0.116 FS17-33-289AA 0.228 (n = 3) 0.032 FS17-33-296AA 0.166 (n = 3) 0.119 F17-33-334AA 0.381 (n = 2) 0.128 F17-33-288AA/HELD1.3 0.428 (n = 2) 0.029 F17-33-289AA/HELD1.3 1.555 (n = 2) 1.209 F17-33-296AA/HELD1.3 1.122 (n = 2) 0.027 F17-33-334AA/HELD1.3 0.934 (n = 2) 0.741 F17-33-449AA/HELD1.3 0.95 (n = 2) 0.467 F17-33-451AA/HELD1.3 1.035 (n = 2) 0.177 S1 0.257 (n = 2) 0.092 S70 0.323 (n = 2) 0.118 - Next, the activity of these Fcabs in a mAb2 format was tested in an SEB assay. mAb2 were produced as described in Example 4.
- 7.1 Staphylococcal Enterotoxin B Assay
- Fcab, PD-L1 mock mAb2 and PD-L1/CTLA-4 mAb2 were tested in the human-PBMC based Staphylococcal Enterotoxin B assay (SEB assay). Staphylococcal Enterotoxin B is a superantigen, and binds to MHC class II molecules on antigen presenting cells (APCs) and the vβ chain of the T cell receptor (TCR), causing non-specific activation of T cells and cytokine release. There is no requirement for antigen to be present to see T cell activation. The SEB assay uses stimulated human cells (PBMCs) with physiological levels of checkpoint inhibitors, and can be used to confirm that T cell activation is enhanced by the mAb2 in a human system.
- 7.1.1 Generation of Expanded T Cells
- PBMCs were isolated from leukocyte cones by Ficoll gradient separation. CD4+ T cells were isolated using human CD4+ T Cell Isolation Kit (Miltenyi Biotec Ltd, 130-096-533) according to the manufacturer's instruction. Human T-Activator CD3/CD28 Dynabeads (Life technologies, D) were resuspended by vortexing. Beads were transferred to a sterile 15 ml tube and 10 ml RPMI (Life Technologies, 61870044) with 10% FBS (Life Technologies, 10270106) and 1× Penicillin Streptomycin (Life Technologies, 15140122) was added to wash Dynabeads. The supernatant was discarded. The required amount of CD4+ T cells at 1.0×106 cells/ml in RPMI with 10% FBS and 1× Penicillin Streptomycin Solution and 50 IU/ml recombinant human IL2 (Peprotech, 200-02-50 μg) with 3:1 bead to cell ratio were transferred to T75 flask (Greiner Bio-one, 690195) and incubated at 37° C.+5% CO2. After 3 days the cells were gently resuspended and counted. The cell density was maintained between 0.8-1×106 cells/ml by adding fresh media (RPMI-10% FBS+
Penicillin Streptomycin Solution 1×+50 IU/ml rhulL2) as needed. Onday Penicillin Streptomycin Solution 1× with reduced 10 IU/ml rhulL2. The cells were stored frozen until required. - 7.1.2 Generation of MoiDCs
- Untouched monocytes were isolated from human PBMCs using human Pan Monocyte Isolation Kit, (Miltenyi Biotec Ltd, 130-096-537) following the manufacturer's instructions. Monocytes were differentiated to iDCs using human Mo-DC Differentiation Medium (Miltenyi Biotec Ltd, 130-094-812) following the manufacturer's instructions.
- 7.1.3 SEB Assay
- Expanded T cells and MoiDCs were thawed before the experiment, washed with AIM medium (Gibco, 12055-091) and incubated at 37° C., 5% CO2 in AIM medium.
- Dilutions of Fcabs, mAb2, anti-human positive control mAb (S1 (with or without LALA mutation) or S70) or the human IgG1 isotype control mAb (anti-HELD1.3 or anti-FITC clone 4420) were prepared in AIM medium. MoiDCs were mixed with T cells from the same donor at a 1:10 ratio (5 ml of iDCs at 2×105 cells/ml were combined with 5 ml of T cells at 2×106 cells/ml). 20 μl of SEB (Sigma, S4881) at 0.1 μg/ml was added to 10 ml of the cells. In a round bottom 96 well plate, 100 μl of the cell/SEB mixture was added to 100 μl of the antibody dilution, giving a ratio of 104 iDC cells to 105 T cells with 0.1 ng/ml SEB in 200 μl of AIM media per well. Cells were incubated at 37° C., 5% CO2 for 4 days. Supernatants were collected and assayed immediately with human IFNγ ELISA kit (R&D Systems, PDIF50) or frozen down at −20° C. for further analysis. The assay was performed according to the kit manufacturer's instructions using supernatants diluted 1:30 with PBA (DPBS, 2% BSA (Sigma, A7906-100G)). The concentration of human IFNγ was plotted vs the log concentration of mAb2 or mAb and the resulting curves were fitted using the log (agonist) vs response equation in GraphPad Prism software. Table 13 shows the EC50 values and the span of the IFNγ release in the SEB assay with cells from individual cell donors.
FIGS. 5A-5C show representative plots of the SEB assay with a single donor. As shown in the DO11.10 T cell activation assay, some of the Fcab clones showed activity close to the anti-PD-L1 positive control (S70). However, the conversion of the Fcab into a mock mAb2 format resulted in a partial reduction of the IFNγ release. In addition, the results demonstrate that the presence of the LALA mutation in the Fcabs did not interfere with their activities, as shown inFIG. 5C . As explained in 3.6 above, the Fcab self-associate, leading to the formation of dimers. In the mock mAb2 format, this self-association is abrogated. Without wishing to be bound by theory, it is thought that the formation of dimeric Fcabs could boost the activity of the Fcabs in cell-based assays, such as the SEB assay, via avidity. -
TABLE 13 Fcab/mAb2/control mAbs EC50 (nM) Std Dev FS17-33-116AA 0.100 (n = 3) 0.0383 FS17-33-288AA 0.08987 (n = 1) — FS17-33-288AA/HelD1.3 1.016 (n = 1) — FS17-33-289AA 0.108385 (n = 4) 0.045634 FS17-33-289AA/HelD1.3 0.56615 (n = 2) 0.054801 FS17-33-289/HelD1.3 0.969 (n = 3) 0.423315 FS17-33-289 0.08855 (n = 2) 0.00487 FS17-33-289/CTLA-4 0.444 (n = 3) 0.202808 FS17-33-296AA 0.1242 (n = 3) 0.032628 FS17-33-296AA/HelD1.3 1.772 (n = 1) — FS17-33-296/HelD1.3 1.714 (n = 3) 0.081132 FS17-33-296 0.08692 (n = 1) — FS17-33-334AA 0.14385 (n = 2) 0.032173 FS17-33-334AA/HelD1.3 0.761067 (n = 3) 0.204171 FS17-33-449AA/HelD1.3 0.55 (n = 2) 0.19799 FS17-33-449/HelD1.3 0.644 (n = 4) 0.353366 FS17-33-451AA/HelD1.3 1.125 (n = 2) 0.997021 FS17-33-451/HelD1.3 0.852 (n = 3) 0.732615 FS17-33-449/CTLA-4 0.975 (n = 3) 0.338388 FS17-33-451/CTLA-4 0.662 (n = 2) 0.164897 S70 0.100 (n = 8) 0.033012 - The PD-L1 Fcabs, FS17-33-449 and FS17-33-451, were also paired with the anti-CTLA-4 Fab ipilimumab (see Example 4 for construction details) and the activity of the mAb2 were assessed in the SEB assay in comparison to the mock mAb2 (with FS17-33-449/HELD1.3 or FS17-33-451/HELD1.3) and ipilimumab alone or to the combination of the mock mAb2 and ipilimumab. The PD-L1/CTLA-4 mAb2 showed greater activation than the mock mAb2 and ipilimumab as single agent or in combination. In one assay out of three, the FS17-33-449/CTLA-4 mAb2 did show an activity not greater but comparable to the combination of the mock mAb2 and ipilimumab. This result showed that a better synergistic activity can be achieved with the mAb2. A representative plot of the SEB assay illustrating these results is provided as
FIG. 6B . - The Fcab molecules, FS17-33-449 and FS17-33-451, have improved biophysical properties as determined by dynamic light scattering (DLS), protein A purification and solubility analysis (see Example 4.3). However, the melting temperature (Tm) of the Fc domain of these molecules is lower than that of the wild-type Fc domain. The reduced melting temperature suggests that these molecules may be less stable than the wild-type Fc domain which might potentially impact the integrity and solubility of these molecules during manufacture and/or the stability of these molecules during long-term storage.
- To identify molecules with increased melting temperatures, Fcabs FS17-33-449 and FS17-33-451, were thermally stressed during selection of an error prone phage display library as described below. The aim of this selection campaign was to identify mutations that increase the melting temperature of the Fcab molecules and therefore their thermal stability without reducing target binding and activity of the Fcabs.
- 8.1 Selection of Anti-PD-L1 Fcab Molecules with Improved Stability from Error Prone Libraries
- Since mutations in the binding loops and the framework could potentially improve the stability of the clones, error prone PCR (Diversify® PCR Random Mutagenesis Kit (Takara Clontech, 630703) was performed across the entire CH3 domain to generate a CH3 domain library from each of the Fcab clones, FS17-33-449 and FS17-33-451. Two consecutive rounds of PCR were performed to achieve an average 6±2 mutations per CH3 fragment. The mutated CH3 domains were then ligated into the phagemid vector pADL-23c (licensed from Antibody Design Laboratories) and transformed into E. Coli (TG1, Lucigen, 60502-PQ997-A). The CH3 domain library was then subjected to selection for CH3 domains with higher melting temperatures, by first heating the phage to 80° C. for 10 minutes, followed by selection for binding to human PD-L1 (hPD-L1) antigen at a concentration of 20 nM. Human PD-L1-his (Acro biosciences, PD1-H5229), biotinylated as described in Example 3.1, was used as antigen source for the selections. After one round of selection, the output was screened for binding to hPD-L1 in a phage ELISA and hits were sequenced. 86 unique CH3 domain sequences were identified. One mutation, the change of the aspartic acid residue (D) at
position 99 of the CH3 domain (in the EF loop) to a glycine residue (G), was overrepresented in the resulting clone population. Interestingly, this mutation represents a reversion to the wild-type sequence atposition 99 of the CH3 domain (see, for example,FIG. 1A ). - The selected CH3 domain sequences were subcloned and expressed in “mock” (MSL109) mAb2 format with the LALA mutation in the CH2 domain, as described in Example 4.2.1, for further screening. The parent FS17-33-449 and FS17-33-451 clones in “mock” (MSL109) mAb2 format with the LALA mutation in the CH2 domain were used as controls. The supernatants were then tested for binding to hPD-L1 antigen using the Octet system and 29 clones were shown to retain binding to this antigen. These clones were then expressed on a larger scale and 21 of the clones could be purified following expression. The KD values for these 21 clones were then measured as described in Example 5.1, and the results are summarised in Table 14. 17 of the 21 clones were chosen on the basis that they had KD values for binding to hPD-L1 below 1 nM and tested for their activity in a DO11.10 T cell activation assay using the method described in Example 6 (see Table 14 for the assay results). The thermal stability of the six Fcab clones with the highest activity based on their EC50 values in the DO11.10 assay was then assessed by determining the melting temperatures of these Fcabs using differential scanning calorimetry (DSC) (see Table 14 for results). As the Tm of the CH2 and CH3 domains of the Fcab clones show only small differences, it is not possible to determine from the profiles which peak represents the CH2 domain and which represents the CH3 domain, respectively. Table 14 therefore reports the Tms for
Peak 1 andPeak 2, with the lowest transition temperature being most representative of the Tm of the overall molecule. Three of the Fcabs showed a significant increase in melting temperature compared with the parent Fcab, namely Fcabs FS17-33-488, FS17-33-539 and FS17-33-548. Table 15 shows the EF loop sequences of these three Fcabs and any additional framework mutation in the CH3 domain that these Fcabs contained. All three of the Fcabs contained the reversion of the aspartic acid (D) atposition 99 of the CH3 domain to the wild-type glycine (G). In addition, Fcabs FS17-33-488 and FS17-33-539 both contained a mutation of the histidine (H) atposition 113 of the CH3 domain to an arginine (R) residue. As these two Fcabs have different parental clones (see Table 15 for details), this mutation, and also the D99G reversion, arose independently twice, indicating that these mutations may play an important role in increasing the melting temperature, and therefore stability, of these Fcabs. Fcab FS17-33-488 also comprised an alanine residue atposition 101, as well as additional mutations in the CH3 domain framework (see Table 15 for details). - Fcab clones FS17-33-539 and FS17-33-548 were chosen for further analysis from the panel of Fcabs tested, as these combined an improved melting temperature with a low mutational burden, compared with the FS17-33-488 Fcab which included a larger number of mutations. In addition, a greater improvement in the melting temperature was observed for these two clones (an increase of 3-4° C.) than for the FS17-33-488 clone (an increase of about 2° C.), as compared to the melting temperate of the relevant parental clone (FS17-33-449 or FS17-33-451; see Table 15 for details) (Table 14).
39E 84 -
TABLE 14 Tm (° C.) measured by DO11.10 DSC KD, EC50 Peak 1 Peak 2 Mock mAb2 nM Kd, 1/s (nM) CH2/3 FS17-33-449AA/MSL109 63.8 65.9 (parent 1) FS17-33-451AA/MSL109 0.30 3.29E−04 4.83 63.4 65.5 (parent 2) FS17-33-469AA/MSL109 6.0 6.27E−03 FS17-33-475AA/MSL109 0.77 9.87E−04 12.87 FS17-33-477AA/MSL109 0.26 3.41E−04 12.81 FS17-33-488AA/MSL109 0.36 3.60E−04 3.253 65.7 67.8 FS17-33-491AA/MSL109 0.27 3.21E−04 11.31 FS17-33-492AA/MSL109 0.51 6.60E−04 76.46 FS17-33-498AA/MSL109 2.2 2.22E−03 FS17-33-499AA/MSL109 0.75 8.63E−04 18.69 FS17-33-501AA/MSL109 3.8 3.81E−03 FS17-33-507AA/MSL109 0.28 3.50E−04 8.576 62.1 64.2 FS17-33-514AA/MSL109 0.35 4.16E−04 3.326 FS17-33-515AA/MSL109 0.35 4.78E−04 10.62 FS17-33-517AA/MSL109 0.32 3.72E−04 11.1 FS17-33-523AA/MSL109 0.63 8.28E−04 23.18 FS17-33-532AA/MSL109 3.7 4.66E−03 FS17-33-533AA/MSL109 0.30 4.49E−04 67.65 FS17-33-537AA/MSL109 0.28 3.31E−04 5.179 64.1 66.4 FS17-33-539AA/MSL109 0.39 4.27E−04 3.14 66.9 69.0 FS17-33-540AA/MSL109 0.45 5.60E−04 8.481 FS17-33-543AA/MSL109 0.24 3.34E−04 8.355 63.1 65.5 FS17-33-548AA/MSL109 0.43 4.37E−04 8.513 67.1 69.4 -
TABLE 15 CH3 domain Parent framework Mock mAb2 Clone EF loop (92-101) mutations FS17-33-488AA/ FS17-33- S N W R W Q L G D A L84.1P, MSL109 451 S85.3T, H113R FS17-33-539AA/ FS17-33- S N W R W Q L G D V H113R MSL109 449 FS17-33-548AA/ FS17-33- S N W R W Q L G D V none MSL109 451 - 8.2 Binding to PD-L1 of Fcab Molecules with Improved Stability
- The Fcabs identified in Example 8.1, FS17-33-539AA/MSL109 and FS17-33-548AA/MSL109, were produced on a larger scale and purified as described in Example 4.2.1. Binding of the mock mAb2 to hPD-L1 was assessed by both SPR, using a Biacore T200 system (GE Healthcare), and in a cell binding assay as described in Example 5.1. To measure the affinity of the clones to monomeric hPD-L1-his, the mock mAb2 were captured using an anti-Fab antibody coated on a CM5 chip (GE 28-9582-20 AC) using a Biacore T200 system. To minimise mass transport effects, the capture level was minimised to 200 RU and a fast flow rate of 75 μl/min was used. Both the human (Acro biosciences, PD1-H5229) and cynomolgus (Acro Biosciences, PD1-C52H4) monomeric antigens were titrated and flowed over the captured mock mAb2. The analysis of the data was done using the Biacore T200 evaluation software. Curves subtracted against a blank flow cell and a run with no antigen were analysed using a 1:1 fitting model with no bulk analysis and Rmax analysed locally.
- Cell binding assays were performed by incubating the mock mAb2 with either control HEK293 cells or HEK293 cells overexpressing hPD-L1 or cynomolgus PD-L1 cells for 1 hour at 4° C. Mock mAb2 binding was subsequently detected using an anti-human Fc 488 detection antibody. Fluorescent signal intensities were measured using a FACS Canto flow cytometer (BD Biosciences).
- The results of these binding experiments are summarised in Table 16. Table 16 shows that all of the mock mAb2 tested had a high affinity for monomeric and cell-expressed human and cynomolgus PD-L1.
-
TABLE 16 Binding EC50 (nM) Binding affinity - KD (nM) Cell- Cell- Human Cynomolgus expressed expressed monomeric monomeric human cynomolgus Mock mAb2 PD-L1 PD-L1 PD-L1 PD-L1 FS17-33-539AA/ 0.90 0.95 4.8 10 MSL109 FS17-33-548AA/ 0.6 0.45 1.5 2.1 MSL109 - 8.3 Blocking Activity of Fcab Molecules with Improved Stability
- The ability of the mock mAb2 to block hPD-1/hPD-L1 and hPD-L1/hCD80 interactions was tested in cell-based Receptor Blocking Assays (RBA). The anti-PD-L1 antibody S70 in an IgG1 framework and comprising the LALA mutation (G1AA/S70) was used as a positive control. In brief, biotinylated hPD-L1-Fc-Avi was incubated for 1 hour with titrating concentrations of mock mAb2 ranging from 2000 nM to 3 μM. The mix was incubated for another hour with HEK293 cells overexpressing either hPD-1 or hCD80. The level of bound biotinylated hPD-L1-Fc-Avi on the HEK293 cells was detected using streptavidin 647 and fluorescence levels were measured using the FACS Canto flow cytometer.
- The results of these blocking experiments are shown in Table 17. Table 17 shows that all the clones tested were able to fully block hPD-1/hPD-L1 and hPD-L1/hCD80 interactions.
-
TABLE 17 Blocking activity - EC50 (nM) Mock mAb2/mAb PD-L1/PD-1 PD-L1/CD80 FS17-33-539AA/MSL109 49.67 118.6 FS17-33-548AA/MSL109 43.17 129.9 G1AA/S70 42.93 477.1 - 8.4 Activity of Fcabs with Improved Stability in Human T Cell Activation Assays
- The activity of the mock mAb2 was tested in a DO11.10 cell-based T cell activation assay as described in Example 6.1, and in an SEB assay as described in Example 7.1. The results are shown in Table 18. Due to the potential for variability to be seen between assays, e.g. depending on the donor source of the stimulated PBMCs used in the SEB assay, one of the parental clones, FS17-33-451 (in “mock” MSL109 mAb2 format and comprising the LALA mutation), was also included in both assays as a direct comparator. Both of the mock mAb2 tested retained T cell activation activity in both assays. The EC50 of the mock mAb2 in these assays was either improved, or comparable, to that of the parental clone FS17-33-451AA/MSL109.
-
TABLE 18 DO11.10 SEB mAb2 EC50 (nM) EC50 (nM) FS17-33-539AA/MSL109 2.91 0.97 FS17-33-548AA/MSL109 7.59 3.21 FS17-33-451AA/MSL109 8.28 1.11 (parent) - 8.5 Assessment of Thermal Stability by Differential Scanning Colorimetry (DSC)
- The melting temperature (Tm) of the FS17-33-539 and FS1733-548 Fcabs (in mock MSL109 mAb2 format and with the LALA mutation) was measured using a Microcal VP-capillary differential scanning calorimeter. The G1AA/MSL109 mAb2 was included as positive control in this analysis as it contains wild-type CH3 domain and a LALA containing CH2 domain. Samples were measured in sample buffer at a concentration of 0.2 mg/ml. The scan rate was set at 60° C./hr and data collected between 35° C. and 100° C. Data analysis was performed with Origin 7.0 software. The results are shown in Table 19. As was seen when the clones were produced at smaller scale (see Table 14), the FS17-33-539 and FS1733-548 Fcab molecules in mock mAb2 format exhibited an improvement in the melting temperature of the Fc domain by 3-4° C. compared with the relevant parental clone.
-
TABLE 19 Tm (° C.) of CH2/CH3 domain measured by DSC mAb2/ control mAb Peak 1 Peak 2FS17-33-449AA/MSL109 (parent 1) 63.8 65.9 FS17-33-451AA/MSL109 (parent 2) 63.4 65.5 FS17-33-539AA/MSL109 67.3 68.9 FS17-33-548AA/MSL109 67.2 68.9 G1AA/MSL109 73.6 84.8 - All documents mentioned in this specification are incorporated herein by reference in their entirety.
- Altschul et al., Basic local alignment search tool. J. Mol. Biol. 215(3), 403-10 (1990).
- Altschul et al., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res. 25(17), 3389-402 (1997).
- Bagshawe et al., Antibody-enzyme conjugates can generate cytotoxic drugs from inactive precursors at tumor sites. Antibody, Immunoconjugates and
Radiopharmaceuticals 4, 915-22 (1991). - Bedzyk et al., Comparison of variable region primary structures within an anti-fluorescein idiotype family. J. Biol. Chem. 264(3), 1565-69 (1989).
- Bedzyk et al., Immunological and structural characterization of a high affinity anti-fluorescein single-chain antibody. J. Biol. Chem. 265(30), 18615-20 (1990).
- Bodhankar et al., PD-L1 Monoclonal Antibody Treats Ischemic Stroke by Controlling Central Nervous System Inflammation. Stroke 46(10), 2926-2934 (2015).
- Bruhns et al., Specificity and affinity of human Fcγ receptors and their polymorphic variants for human IgG subclasses. Blood 113(16), 3716-25 (2009).
- Curran et al., PD-1 and CTLA-4 combination blockade expands infiltrating T cells and reduces regulatory T and myeloid cells within B16 melanoma tumors. Proc. Natl. Acad. Sci. U.S.A. 107(9), 4275-80 (2010).
- Daxini et al., Vasculitis associated with immune checkpoint inhibitors-a systematic review. Clin.
- Rheumatol. 37(9), 2579-2584 (2018).
- Grosso et al., Programmed death-ligand 1 (PD-L1) expression in various tumor types. Journal for Immunotherapy of Cancer. 1(Suppl 1):P53. (2013).
- Hasenhindl et al., Stability assessment on a library scale: a rapid method for the evaluation of the commutability and insertion of residues in C-terminal loops of the CH3 domains of IgG1-Fc., Protein Eng. Des. Sel., 26(10), 675-82 (2013).
- Herbst et al., Predictive correlates of response to the anti-PD-L1 antibody MPDL3280A in cancer patients. Nature. 515(7528), 563-7 (2014).
- Hezareh et al., Effector function activities of a panel of mutants of a broadly neutralizing antibody against human
immunodeficiency virus type 1. J. Virol. 75(24), 12161-8 (2001). - Hid Cadena et al., Checks and Balances in Autoimmune Vasculitis. Front. Immunol. 9, 315 (2018).
- Horton et al., Gene splicing by overlap extension: tailor-made genes using the polymerase chain reaction. BioTechniques 8(5):528-535 (November 1990). BioTechniques 54(3), 129-33 (2013).
- Hu et al., Minibody: A novel engineered anti-carcinoembryonic antigen antibody fragment (single-chain Fv-CH3) which exhibits rapid, high-level targeting of xenografts. Cancer Res. 56(13), 3055-61 (1996).
- Idusogie et al., Mapping of the Clq binding site on rituxan, a chimeric antibody with a human IgG1 Fc. J. Immunol. 164(8), 4178-84 (2000).
- Iwai et al., Involvement of PD-L1 on tumor cells in the escape from host immune system and tumor immunotherapy by PD-L1 blockade. Proc. Natl. Acad. Sci. U.S.A. 99(19), 12293-7 (2002).
- Klein et al., The use of CrossMAb technology for the generation of bi- and multispecific antibodies. MAbs. 8(6), 1010-20 (2016).
- Kontermann, Dual targeting strategies with bispecific antibodies. MAbs 4(2):182-97 (2012).
- Larkin et al., Combined Nivolumab and Ipilimumab or Monotherapy in Untreated Melanoma. N.
- Engl. J. Med. 373(13), 1270-1 (2015).
- Ledermann et al., A phase-I study of repeated therapy with radiolabelled antibody to carcinoembryonic antigen using intermittent or continuous administration of cyclosporin A to supress the immune response. Int. J. Cancer 47(5), 659-64 (1991).
- Lefranc et al., IMGT unique numbering for immunoglobulin and T cell receptor constant domains and Ig superfamily C-like domains. Dev. Comp. Immunol. 29(3), 185-203 (2005).
- Pearson and Lipman, Improved tools for biological sequence comparison. Proc. Natl. Acad. Sci. U.S.A. 85(8), 2444-8 (1988).
- Rao M. et al., Anti-PD-1/PD-L1 therapy for infectious diseases: learning from the cancer paradigm. Int. J. Infect. Dis. 56, 221-228 (2017.)
- Rosenberg, S., Development of Cancer Vaccines, ASCO Educational Book Spring: 60-62 (2000).
- Smith and Waterman, Identification of common molecular subsequences. J. Mol. Biol. 147(1), 195-197 (1981).
- Spiess et al., Alternative molecular formats and therapeutic applications for bispecific antibodies. Molecular Immunology. 67:95-106 (2015).
- Stewart et al., Identification and Characterization of MED14736, an Antagonistic Anti-PD-L1 Monoclonal Antibody. Cancer Immunol. Res. 3(9), 1052-62 (2015).
- Tello et al., Three-dimensional structure and thermodynamics of antigen binding by anti-Iysozyme antibodies. Biochem. Soc. Trans. 21(4), 943-6 (1993).
- Wang et al., IgG Fc engineering to modulate antibody effector functions. Protein Cell. 9(1), 63-73(2018).
- Wolchok J et al., Nivolumab plus ipilimumab in advanced melanoma. N. Engl. J. Med. 369(2), 122-33 (2013).
- Wykes and Lewin, Immune checkpoint blockade in infectious diseases. Nat. Rev. Immunol. 18(2), 91-104 (2018).
-
Sequence Listing Amino acid sequences of WT Fcab CH3 domain structural loops WT Fcab AB loop (SEQ ID NO: 1) LTKNQ WT Fcab CD loop (SEQ ID NO: 2) QPENNY WT Fcab EF loop (SEQ ID NO: 3) DKSRWQQGNV Amino acid sequence of WT Fcab CH3 domain (SEQ ID NO: 4) GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of the CH2 domain of the WT Fcab, FS17-33, and FS17-33-37/116/288/289/296/334/449/451/488/539/548 with LALA mutation The location of the LALA mutation is underlined (SEQ ID NO: 5) APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK Consensus sequences of Fcab FS17-33-116/288/289/296/334/449/451 CH3 domain structural loops AB loop (SEQ ID NO: 10) X1GYW CD loop (SEQ ID NO: 11) EPQYWA EF loop (SEQ ID NO: 12) SNWRWQX2DDX3 X1 = V, S, T, or E X2 = M, I, L, V X3 = V or absent Amino acid sequences of Fcab FS17-33 CH3 domain structural loops FS17-33 AB loop (SEQ ID NO: 13) QSGYW FS17-33 CD loop (SEQ ID NO: 2) QPENNY FS17-33 EF loop (SEQ ID NO: 14) SNWRWQMGD Amino acid sequence of Fcab FS17-33 CH3 domain (SEQ ID NO: 15) GQPREPQVYTLPPSRDEQSGYWVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVSNWRWQMGDFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33 with LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 16) TCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDEQSG YWVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVSNWRWQMGDFSCSVMH EALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33 without LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 17) TCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNVVYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDEQSG YWVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVSNWRWQMGDFSCSVMH EALHNHYTQKSLSLSPGK Amino acid sequence of the CH2 domain of the WT Fcab, FS17-33, and FS17-33- 37/116/288/289/296/334/449/451/488/539/548 without LALA mutation (SEQ ID NO: 6) APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK Amino acid sequence of the truncated hinge region of the WT Fcab, FS17-33, and FS17-33-37/116/288/289/296/334/449/451/488/539/548 (SEQ ID NO: 7) TCPPCP Amino acid sequence of WT Fcab with LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 8) TCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDELTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK Amino acid sequence of WT Fcab without LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 9) TCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDELTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK Amino acid sequences of Fcab FS17-33-37 CH3 domain structural loops FS17-33 AB loop (SEQ ID NO: 18) QVGYW FS17-33 CD loop (SEQ ID NO: 2) QPENNY FS17-33 EF loop (SEQ ID NO: 19) SNWRWQMDD Amino acid sequence of Fcab FS17-33-37 CH3 domain (SEQ ID NO: 20) GQPREPQVYTLPPSRDEQVGYWVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVSNWRWQMDDFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-37 with LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 21) TCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDEQVG YWVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVSNWRWQMDDFSCSVMH EALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-37 without LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 22) TCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDEQVG YWVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVSNWRWQMDDFSCSVMH EALHNHYTQKSLSLSPGK Amino acid sequences of Fcab FS17-33-116 CH3 domain structural loops FS17-33-116 AB loop (SEQ ID NO: 23) SGYW FS17-33-116 CD loop (SEQ ID NO: 11) EPQYWA FS17-33-116 EF loop (SEQ ID NO: 19) SNWRWQMDD Amino acid sequence of Fcab FS17-33-116 CH3 domain (SEQ ID NO: 24) GQPREPQVYTLPPSRDESGYWVSLTCLVKGFYPSDIVVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKL TVSNWRWQMDDFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-1 16 with LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 25) TCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDESGY WVSLTCLVKGFYPSDIVVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQMDDFSCSVMH EALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-1 16 without LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 26) TCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNVVYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDESGY WVSLTCLVKGFYPSDIVVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQMDDFSCSVMH EALHNHYTQKSLSLSPGK Amino acid sequences of Fcab FS17-33-288 CH3 domain structural loops FS17-33-288 AB loop (SEQ ID NO: 23) SGYW FS17-33-288 CD loop (SEQ ID NO: 11) EPQYWA FS17-33-288 EF loop (SEQ ID NO: 27) SNWRWQIDD Amino acid sequence of FS17-33-288 CH3 domain (SEQ ID NO: 28) GQPREPQVYTLPPSRDESGYWVSLTCLVKGFYPSDIVVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKL TVSNWRWQIDDFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-288 with LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 29) TCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDESGY WVSLTCLVKGFYPSDIVVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQIDDFSCSVMHE ALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-288 without LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 30) TCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDESGY WVSLTCLVKGFYPSDIVVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQIDDFSCSVMHE ALHNHYTQKSLSLSPGK Amino acid sequences of Fcab FS17-33-289 CH3 domain structural loops FS17-33-289 AB loop (SEQ ID NO: 23) SGYW FS17-33-289 CD loop (SEQ ID NO: 11) EPQYWA FS17-33-289 EF loop (SEQ ID NO: 31) SNWRWQLDD Amino acid sequence of Fcab FS17-33-289 CH3 domain (SEQ ID NO: 32) GQPREPQVYTLPPSRDESGYWVSLTCLVKGFYPSDIVVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKL TVSNWRWQLDDFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-289 with LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 33) TCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDESGY WVSLTCLVKGFYPSDIVVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQLDDFSCSVMHE ALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-289 without LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 34) TCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDESGY WVSLTCLVKGFYPSDIVVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQLDDFSCSVMHE ALHNHYTQKSLSLSPGK Amino acid sequences of Fcab FS17-33-296 CH3 domain structural loops FS17-33-296 AB loop (SEQ ID NO: 23) SGYW FS17-33-296 CD loop (SEQ ID NO: 11) EPQYWA FS17-33-296 EF loop (SEQ ID NO: 35) SNWRWQVDD Amino acid sequence of Fcab FS17-33-296 CH3 domain (SEQ ID NO: 36) GQPREPQVYTLPPSRDESGYWVSLTCLVKGFYPSDIVVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKL TVSNWRWQVDDFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-296 with LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 37) TCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDESGY WVSLTCLVKGFYPSDIVVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQVDDFSCSVMHE ALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-296 without LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 38) TCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDESGY WVSLTCLVKGFYPSDIVVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQVDDFSCSVMHE ALHNHYTQKSLSLSPGK Amino acid sequences of Fcab FS17-33-334 CH3 domain structural loops FS17-33-334 AB loop (SEQ ID NO: 23) SGYW FS17-33-334 CD loop (SEQ ID NO: 11) EPQYWA FS17-33-334 EF loop (SEQ ID NO: 31) SNWRWQLDD Amino acid sequence of Fcab FS17-33-334 CH3 domain (SEQ ID NO: 39) GQPREPQVYTLPPSRDESGYWVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKL TVSNWRWQLDDFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-334 with LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 40) TCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDESGY WVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQLDDFSCSVMHE ALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-334 without LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 41) TCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDESGY WVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQLDDFSCSVMHE ALHNHYTQKSLSLSPGK Amino acid sequences of Fcab FS17-33-449 CH3 domain structural loops FS17-33-449 AB loop (SEQ ID NO: 42) TGYW FS17-33-449 CD loop (SEQ ID NO: 11) EPQYWA FS17-33-449 EF loop (SEQ ID NO: 43) SNWRWQLDDV Amino acid sequence of Fcab FS17-33-449 CH3 domain (SEQ ID NO: 44) GQPREPQVYTLPPSRDETGYWVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKL TVSNWRWQLDDVFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-449 with LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 45) TCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDETGY WVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQLDDVFSCSVMH EALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-449 without LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 46) TCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDETGY WVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQLDDVFSCSVMH EALHNHYTQKSLSLSPGK Amino acid sequences of Fcab FS17-33-451 CH3 domain structural loops FS17-33-451 AB loop (SEQ ID NO: 47) EGYW FS17-33-451 CD loop (SEQ ID NO: 11) EPQYWA FS17-33-451 EF loop (SEQ ID NO: 43) SNWRWQLDDV Amino acid sequence of Fcab FS17-33-451 CH3 domain (SEQ ID NO: 48) GQPREPQVYTLPPSRDEEGYWVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKL TVSNWRWQLDDVFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-451 with LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 49) TCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDEEGY WVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQLDDVFSCSVMH EALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-451 without LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 50) TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDEEGY WVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQLDDVFSCSVMH EALHNHYTQKSLSLSPGK Amino acid sequence of the heavy chain of the IgG1 4420 antibody with LALA mutation In the below heavy chain sequence, as well as the heavy chain sequences for antibodies HelD1.3, MSL109, S70, and S1 listed below, the sequence of the variable domain is shown in italics, the sequence of the CH1 domain is underlined, the sequence of the hinge region is doubly underlined, the sequence of the CH2 domain is shown in bold, and the sequence of the CH3 domain is shown in plain font. (SEQ ID NO: 51) EVKLDETGGGLVQPGRPMKLSCVASGFTFSDYWMNWVRQSPEKGLEWVAQIRNKPYNYETYYSDSVK GRFTISRDDSKSSVYLQMNNLRVEDMGIYYCTGSYYGMDYWGQGTSVTVSS ASTKGPSVFPLAPSSKST SGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHK PSNTKVDKKV EPKSCDKTHTCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK FNVVYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of the light chain of the IgG1 4420 antibody with LALA mutation In the below light chain sequence, as well as the light chain sequences for antibodies HelD1.3, MSL109, S70, and S1 listed below, the sequence of the variable domain is shown in italics, and the sequence of the constant domain is underlined. (SEQ ID NO: 52) DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLRWYLQKPGQSPKVLIYKVSNRFSGVPDRFSG SGSGTDFTLKISRVEAEDLGVYFCSQSTHVPWTFGGGTKLEIK RTVAAPSVFIFPPSDEQLKSGTASVVCL LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP VTKSFNRGEC Amino acid sequence of the heavy chain of the HelD1.3 antibody with LALA mutation (SEQ ID NO: 53) QVQLQESGPGLVRPSQTLSLTCTVSGSTFSGYGVNWVRQPPGRGLEWIGMIWGDGNTDYNSALKSRVT MLVDTSKNQFSLRLSSVTAADTAVYYCARERDYRLDYWGQGSLVTVSS ASTKGPSVFPLAPSSKSTSGG TAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSN TKVDKKV EPKSCDKTHTCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of the light chain of the HelD1.3 antibody with LALA mutation (SEQ ID NO: 54) DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGT QYSLKINSLQPEDFGSYYCQHFWSTPRTFGGGTKLEIK RTVAAPSVFIFPPSDEQLKSGTASVVOLLNNFY PREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF NRGEC Amino acid sequence of the heavy chain of the MSL109 antibody with LALA mutation (SEQ ID NO: 55) EEQVLESGGGLVKPGGSLRLSCAASGFTFSPYSVFWVRQAPGKGLEWVSSINSDSTYKYYADSVKGRF TISRDNAENSIFLQMNSLRAEDTAVYYCARDRSYYAFSSGSLSDYYYGLDVWGQGTTVIVSS ASTKGPSV FPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT QTYICNVNHKPSNTKVDKKV EPKSCDKTHTCPP CPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAP IEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of the light chain of the MSL109 antibody with LALA mutation (SEQ ID NO: 56) DIVMTQSPLSLSVTPGEPASISCRSSQSLLHTNGYNYLDWYVQKPGQSPQLLIYLASNRASGVPDRFSGS GSGTDFTLKISRVETEDVGVYYCMQALQIPRTFGQGTKVEIK RTVAAPSVFIFPPSDEQLKSGTASVVCLL NNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP VTKSFNRGEC Amino acid sequence of the heavy chain of the S70 antibody with LALA mutation (SEQ ID NO: 57) EVQLVESGGGLVQPGGSLRLSCAASGFTFSDSWIHWVRQAPGKGLEWVAWISPYGGSTYYADSVKGRF TISADTSKNTAYLQMNSLRAEDTAVYYCARRHWPGGFDYWGQGTLVTVSA ASTKGPSVFPLAPSSKSTS GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP SNTKVDKKV EPKSCDKTHTCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of the light chain of the S70 antibody with LALA mutation (SEQ ID NO: 58) DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSGSGTD FTLTISSLQPEDFATYYCQQYLYHPATFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYP REAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFN RGEC Amino acid sequence of the heavy chain of the S1 antibody with LALA mutation (SEQ ID NO: 59) EVQLVESGGGLVQPGGSLRLSCAASGFTFSDSWIHWVRQAPGKGLEWVAWISPYGGSTYYADSVKGRF TISADTSKNTAYLQMNSLRAEDTAVYYCARRHWPGGFDYWGQGTLVTVSA ASTKGPSVFPLAPSSKSTS GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP SNTKVDKKV EPKSCDKTHTCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of the light chain of the S1 antibody with LALA mutation (SEQ ID NO: 60) DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSGSGTD FTLTISSLQPEDFATYYCQQYLFTPPTFGQGTKVEIK RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPR EAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR GEC Amino acid sequence of human PD-L1 (SEQ ID NO: 61) MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHG EEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQ RILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCT FRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKK QSDTHLEET Amino acid sequence of murine PD-L1 (SEQ ID NO: 62) MRIFAGIIFTACCHLLRAFTITAPKDLYVVEYGSNVTMECRFPVERELDLLALVVYWEKEDEQVIQFVAGE EDLKPQHSNFRGRASLPKDQLLKGNAALQITDVKLQDAGVYCCIISYGGADYKRITLKVNAPYRKINQRI SVDPATSEHELICQAEGYPEAEVIWTNSDHQPVSGKRSVTTSRTEGMLLNVTSSLRVNATANDVFYCT FWRSQPGQNHTAELIIPELPATHPPQNRTHWVLLGSILLFLIVVSTVLLFLRKQVRMLDVEKCGVEDTSS KNRNDTQFEET Amino acid sequence of cynomolgus PD-L1 (SEQ ID NO: 63) MRIFAVFIFTIYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGE EDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQR ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIF RRLDPEENHTAELVIPELPLALPPNERTHLVILGAIFLLLGVALTFIFYLRKGRMMDMKKCGIRVTNSKKQ RDTQLEET Amino acid sequence of human PD-1 (SEQ ID NO: 64) MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVV TEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPN GRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSP RPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPV FSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQP LRPEDGHCSWPL Amino acid sequence of human CD80 (SEQ ID NO: 65) MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKE VATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIV ILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRI ICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLI KYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRR NERLRRESVRPV Amino acid sequence of mouse CD80 (SEQ ID NO: 66) MACNCQLMQDTPLLKFPCPRLILLFVLLIRLSQVSSDVDEQLSK SVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTY SLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADT KRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIK CLIKYGDAHVSEDFTWEKPPEDPPDSKNTLVLFGAGFGAVITVVVIVVIIKCFCKHRS CFRRNEASRETNNSLTFGPEEALAEQTVFL Amino acid sequence of the heavy chain of the Ipilimumab antibody without LALA mutation The CDRs are underlined. The CH3 sequence is shown in bold (SEQ ID NO: 67) QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYYADSVKGR FTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTS GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP SNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of the light chain of the Ipilimumab antibody without LALA mutation The CDR sequences are underlined (SEQ ID NO: 68) EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGT DFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFY PREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF NRGEC Amino acid sequence of the human IgG1 hinge region (SEQ ID NO: 69) EPKSCDKTHTCPPCP Amino acid sequences of Fcab FS17-33-488 CH3 domain structural loops FS17-33-488 AB loop (SEQ ID NO: 47) EGYW FS17-33-488 CD loop (SEQ ID NO: 11) EPQYWA FS17-33-488 EF loop (SEQ ID NO: 70) SNWRWQLGDA Amino acid sequence of Fcab FS17-33-488 CH3 domain (SEQ ID NO: 71) GQPREPQVYTLPPSRDEEGYWVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVPDSDGTFFLYSKL TVSNWRWQLGDAFSCSVMHEALRNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-488 with LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 72) TCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDEEGY WVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVPDSDGTFFLYSKLTVSNWRWQLGDAFSCSVMH EALRNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-488 without LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 73) TCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDEEGY WVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVPDSDGTFFLYSKLTVSNWRWQLGDAFSCSVMH EALRNHYTQKSLSLSPGK Amino acid sequences of Fcab FS17-33-539 CH3 domain structural loops FS17-33-539 AB loop (SEQ ID NO: 42) TGYW FS17-33-539 CD loop (SEQ ID NO: 11) EPQYWA FS17-33-539 EF loop (SEQ ID NO: 74) SNWRWQLGDV Amino acid sequence of Fcab FS17-33-539 CH3 domain (SEQ ID NO: 75) GQPREPQVYTLPPSRDETGYWVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKL TVSNWRWQLGDVFSCSVMHEALRNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-539 with LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 76) TCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDETGY WVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQLGDVFSCSVMH EALRNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-539 without LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 77) TCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDETGY WVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQLGDVFSCSVMH EALRNHYTQKSLSLSPGK Amino acid sequences of Fcab FS17-33-548 CH3 domain structural loops FS17-33-548 AB loop (SEQ ID NO: 47) EGYW FS17-33-548 CD loop (SEQ ID NO: 11) EPQYWA FS17-33-548 EF loop (SEQ ID NO: 78) SNWRWQLGDV Amino acid sequence of Fcab FS17-33-548 CH3 domain (SEQ ID NO: 79) GQPREPQVYTLPPSRDEEGYWVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKL TVSNWRWQLGDVFSCSVMHEALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-548 with LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 80) TCPPCP APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDEEGY WVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQLGDVFSCSVMH EALHNHYTQKSLSLSPGK Amino acid sequence of Fcab FS17-33-548 without LALA mutation Hinge region (underlined), CH2 domain (bold) and CH3 domain (italics) (SEQ ID NO: 81) TCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDEEGY WVSLTCLVKGFYPSDIAVEWESNGEPQYWAKTTPPVLDSDGSFFLYSKLTVSNWRWQLGDVFSCSVMH EALHNHYTQKSLSLSPGK Amino acid sequence of the CH2 domain with LALA mutation and P114A mutation LALA mutation underlined; P114A mutation bold and underlined (SEQ ID NO: 82) APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKAL A APIEKTISKAK
Claims (30)
1. An antibody molecule, or fragment thereof, which binds to programmed death-ligand 1 (PD-L1), comprising a PD-L1 antigen-binding site located in a CH3 domain of the antibody molecule, or fragment thereof, wherein the PD-L1 binding site comprises:
(i) a first sequence located in the AB structural loop at positions 14 to 18 of the CH3 domain, wherein the antibody molecule, or fragment thereof, comprises an amino acid deletion at position 14, 15 or 16 of the CH3 domain, and wherein the first sequence consists of:
(a) amino acid sequence SGYW (SEQ ID NO: 23), or
(b) a variant of SEQ ID NO: 23, wherein
the serine (S) is substituted with amino acid A, E, F, G, H, I, L, P, R, T, V, or Y, and/or
the glycine (G) is substituted with amino acid A, D, E, F, H, K, L, N, P, R, T, V, or Y;
(ii) a second sequence located in the CD structural loop at positions 45.1 to 78 of the CH3 domain, wherein the second sequence consists of:
(a) amino acid sequence EPQYWA (SEQ ID NO: 11), or
(b) a variant of SEQ ID NO: 11, wherein
the glutamic acid (E) is substituted with amino acid A, G, H, I, L, N, Q, R, S, or W, and/or
the proline (P) is substituted with amino acid A, D, E, G, H, N, Q, W, or Y, and/or
the glutamine (Q) is substituted with amino acid H, or N, and/or
the tyrosine (Y) is substituted with amino acid A, D, H, T, or V, and/or
the alanine (A) is substituted with amino acid D, E, G, L, R, S, or W; and
(iii) a third sequence located in the EF structural loop at positions 92 to 100 of the CH3 domain, wherein the third sequence consists of:
(a) amino acid sequence SNWRWQMDD (SEQ ID NO: 19), or
(b) a variant of SEQ ID NO: 19, wherein
the serine (S) at position 92 is substituted with amino acid A, or G, and/or
the asparagine (N) at position 93 is substituted with amino acid A, E, F, G, H, I, K, L, Q, R, S, T, or Y, and/or
the glutamine (Q) at position 97 is substituted with amino acid A, D, E, F, G, H, K, L, N, R, S, or V, and/or
the methionine (M) at position 98 is substituted with amino acid F, I, L, V, W, or Y, and/or
the aspartic acid (D) at position 99 is substituted with amino acid A, I, L, R, S, T, V, W, Y, or G, and/or
the aspartic acid (D) at position 100 is substituted with amino acid A, E, F, I, K, L, N, R, V, W, or Y; and
wherein the amino acid at position 101 of the CH3 domain is valine (V), alanine (A) or is absent;
wherein the amino acid residue numbering is according to the ImMunoGeneTics (IMGT) numbering scheme; and
wherein the antibody molecule, or antigen-binding fragment thereof, is not an antibody molecule, or antigen-binding fragment thereof, which comprises a CDR-based antigen-binding site which binds Inducible T-cell COStimulator (ICOS) and a PD-L1 binding site comprising a first sequence located in the AB structural loop at positions 14 to 18 of the CH3 domain, wherein the antibody molecule, or antigen-binding fragment thereof, comprises an amino acid deletion at position 14, 15 or 16 of the CH3 domain, and wherein the first sequence consists of the sequence set forth in SEQ ID NO: 23, a second sequence located in the CD structural loop at positions 45.1 to 78 of the CH3 domain, wherein the second sequence consists of the sequence set forth in SEQ ID NO: 11, and a third sequence located in the EF structural loop at positions 92 to 100 of the CH3 domain, wherein the third sequence consists of the sequence set forth in SEQ ID NO: 31.
2.-4. (canceled)
5. The antibody molecule, or fragment thereof, according to claim 1 , wherein:
(i) the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 19;
(ii) the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 27;
(iii) the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 35; or
(iv) the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 31, and the residue at position 38 of the CH3 domain of the antibody molecule, or fragment thereof, is valine (V) or alanine (A).
6.-11. (canceled)
12. The antibody molecule, or fragment thereof, according to claim 5 , wherein the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 19.
13. The antibody molecule, or fragment thereof, according to claim 5 , wherein the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 27.
14. The antibody molecule, or fragment thereof, according to claim 5 , wherein the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 35.
15. (canceled)
16. The antibody molecule, or fragment thereof, according to claim 1 , wherein the CH3 domain is a human IgG1 CH3 domain.
17. The antibody molecule, or fragment thereof, according to claim 1 , wherein the amino acid at position 38 of the CH3 domain is a valine or an alanine residue.
18. The antibody molecule, or fragment thereof, according to claim 1 , wherein the amino acid at position 38 of the CH3 domain is an alanine residue.
19. The antibody molecule, or fragment thereof, according to claim 1 , wherein the antibody molecule, or fragment thereof, comprises the CH3 domain set forth in SEQ ID NO: 24, 28, 36, or 39.
20. (canceled)
21. The antibody molecule, or fragment thereof, according to claim 19 , wherein the antibody molecule, or fragment thereof, further comprises a CH2 domain.
22.-23. (canceled)
24. The antibody molecule, or fragment thereof, according to claim 21 , wherein the CH2 domain has the sequence set forth in SEQ ID NO: 5, 6, or 82.
25. The antibody molecule, or fragment thereof, according to claim 21 , wherein the antibody molecule, or fragment thereof, further comprises an immunoglobulin hinge region, or part thereof, at the N-terminus of the CH2 domain.
26.-27. (canceled)
28. The antibody molecule, or fragment thereof, according to claim 25 , wherein the hinge region comprises or consists of the sequence set forth in SEQ ID NO: 7.
29. The antibody molecule, or fragment thereof, according to claim 25 , wherein the antibody molecule, or fragment thereof, comprises or consists of the sequence set forth in SEQ ID NO: 25, 26, 29, 30, 37, 38, 40, or 41.
30. (canceled)
31. The antibody molecule, or fragment thereof, according to claim 1 , wherein the antibody molecule, or fragment thereof, further comprises a second antigen-binding site.
32. The antibody molecule, or fragment thereof, according to claim 5 , wherein the antibody molecule, or fragment thereof, further comprises a second antigen-binding site, wherein the second antigen-binding site is a CDR-based antigen-binding site.
33.-35. (canceled)
36. The antibody molecule, or fragment thereof, according to claim 32 , wherein the CDR-based antigen-binding site binds to a checkpoint inhibitor, costimulatory molecule, or tumour-associated antigen.
37.-39. (canceled)
40. The antibody molecule, or fragment thereof, according to claim 31 , wherein the second antigen-binding site is a CDR-based antigen-binding site, and wherein the antibody molecule, or fragment thereof, is conjugated to an immune system modulator, cytotoxic molecule, radioisotope, or detectable label.
41.-55. (canceled)
56. The antibody molecule, or fragment thereof, according to claim 5 , wherein the first sequence has the sequence set forth in SEQ ID NO: 23, the second sequence has the sequence set forth in SEQ ID NO: 11, and the third sequence has the sequence set forth in SEQ ID NO: 31, and the residue at position 38 of the CH3 domain of the antibody molecule, or fragment thereof, is valine (V) or alanine (A).
57. The antibody molecule, or fragment thereof, according to claim 19 , wherein the lysine residue (K) at the immediate C-terminus of the sequence shown in SEQ ID NO: 24, 28, 36, or 39 has been deleted.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US18/063,521 US20230406935A1 (en) | 2017-12-19 | 2022-12-08 | Fc binding fragments comprising a pd-l1 antigen-binding site |
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201762607686P | 2017-12-19 | 2017-12-19 | |
US201862657195P | 2018-04-13 | 2018-04-13 | |
PCT/EP2018/085834 WO2019121906A1 (en) | 2017-12-19 | 2018-12-19 | Specific pd-l1 binding sequences inserted in a ch3 domain |
US202016955450A | 2020-06-18 | 2020-06-18 | |
US18/063,521 US20230406935A1 (en) | 2017-12-19 | 2022-12-08 | Fc binding fragments comprising a pd-l1 antigen-binding site |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/955,450 Continuation US11548948B2 (en) | 2017-12-19 | 2018-12-19 | FC binding fragments comprising a PD-L1 antigen-binding site |
PCT/EP2018/085834 Continuation WO2019121906A1 (en) | 2017-12-19 | 2018-12-19 | Specific pd-l1 binding sequences inserted in a ch3 domain |
Publications (1)
Publication Number | Publication Date |
---|---|
US20230406935A1 true US20230406935A1 (en) | 2023-12-21 |
Family
ID=65011961
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/955,450 Active 2039-03-09 US11548948B2 (en) | 2017-12-19 | 2018-12-19 | FC binding fragments comprising a PD-L1 antigen-binding site |
US18/063,521 Pending US20230406935A1 (en) | 2017-12-19 | 2022-12-08 | Fc binding fragments comprising a pd-l1 antigen-binding site |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/955,450 Active 2039-03-09 US11548948B2 (en) | 2017-12-19 | 2018-12-19 | FC binding fragments comprising a PD-L1 antigen-binding site |
Country Status (8)
Country | Link |
---|---|
US (2) | US11548948B2 (en) |
EP (1) | EP3728316A1 (en) |
JP (1) | JP7489316B2 (en) |
CN (1) | CN111741976A (en) |
AU (1) | AU2018387741A1 (en) |
CA (1) | CA3086098A1 (en) |
TW (1) | TW201930355A (en) |
WO (1) | WO2019121906A1 (en) |
Families Citing this family (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP7085708B2 (en) | 2016-06-20 | 2022-06-17 | エフ-スター セラピューティクス リミテッド | LAG-3 binding element |
LT3472207T (en) | 2016-06-20 | 2021-05-10 | F-Star Delta Limited | Binding molecules binding pd-l1 and lag-3 |
GB201612520D0 (en) | 2016-07-19 | 2016-08-31 | F-Star Beta Ltd | Binding molecules |
JP7198752B2 (en) | 2016-08-09 | 2023-01-04 | カイマブ・リミテッド | Anti-ICOS antibody |
US11629189B2 (en) * | 2017-12-19 | 2023-04-18 | Kymab Limited | Bispecific antibody for ICOS and PD-L1 |
CA3098374A1 (en) | 2018-04-25 | 2019-10-31 | Prometheus Biosciences, Inc. | Optimized anti-tl1a antibodies |
KR20220103721A (en) | 2019-10-24 | 2022-07-22 | 프로메테우스 바이오사이언시즈, 인크. | Humanized Antibodies to TNF-Like Ligand 1A (TL1A) and Uses Thereof |
Family Cites Families (73)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DE2245404C3 (en) | 1972-09-15 | 1978-08-31 | Robert Bosch Gmbh, 7000 Stuttgart | Ground resistance, especially for spark plugs, and methods of manufacturing the same |
JPS531908B2 (en) | 1973-11-12 | 1978-01-23 | ||
JPS5746634B2 (en) | 1974-05-10 | 1982-10-04 | ||
JPS5146628A (en) | 1974-10-17 | 1976-04-21 | Nippon Denso Co | TEIKOIRISUPAAKUPURAGU |
JPS61134325A (en) | 1984-12-04 | 1986-06-21 | Teijin Ltd | Expression of hybrid antibody gene |
GB8607679D0 (en) | 1986-03-27 | 1986-04-30 | Winter G P | Recombinant dna product |
WO1994016730A1 (en) | 1993-01-28 | 1994-08-04 | Sandoz Pharmaceutical Corporation | Human monoclonal antibodies to cytomegalovirus |
DE19818214A1 (en) | 1998-04-24 | 1999-10-28 | Bosch Gmbh Robert | Spark plug for combustion engine |
JP4578025B2 (en) | 2001-07-06 | 2010-11-10 | 日本特殊陶業株式会社 | Spark plug |
CA2594356C (en) | 2005-01-05 | 2018-07-17 | F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. | Synthetic immunoglobulin domains with binding properties engineered in regions of the molecule different from the complementarity determining regions |
WO2006099141A2 (en) | 2005-03-10 | 2006-09-21 | Morphotek, Inc. | Anti-mesothelin antibodies |
CN101248089A (en) | 2005-07-01 | 2008-08-20 | 米德列斯公司 | Human monoclonal antibodies to programmed death ligand 1(PD-L1) |
WO2009000006A1 (en) | 2007-06-26 | 2008-12-31 | F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. | Display of binding agents |
JP5608091B2 (en) | 2007-11-26 | 2014-10-15 | バイエル・インテレクチュアル・プロパティ・ゲゼルシャフト・ミット・ベシュレンクテル・ハフツング | Anti-mesothelin antibodies and uses thereof |
AU2009212747B2 (en) | 2008-01-31 | 2013-11-07 | The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Engineered antibody constant domain molecules |
EP2113255A1 (en) | 2008-05-02 | 2009-11-04 | f-star Biotechnologische Forschungs- und Entwicklungsges.m.b.H. | Cytotoxic immunoglobulin |
AR072999A1 (en) | 2008-08-11 | 2010-10-06 | Medarex Inc | HUMAN ANTIBODIES THAT JOIN GEN 3 OF LYMPHOCYTARY ACTIVATION (LAG-3) AND THE USES OF THESE |
UA109108C2 (en) | 2008-12-09 | 2015-07-27 | Дженентек, Інк. | Anti-pd-ll antibody and its use to enhance t-cell function |
AU2010230063B2 (en) | 2009-03-24 | 2015-06-25 | The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services | Anti-mesothelin antibodies |
EP2407487A1 (en) | 2010-07-14 | 2012-01-18 | F-Star Biotechnologische Forschungs - und Entwicklungsges. M.B.H. | Multispecific modular antibody |
UA113838C2 (en) | 2010-12-20 | 2017-03-27 | ANTIBODY Binding Mesothelin and Immunoconjugate | |
EP2546268A1 (en) | 2011-07-13 | 2013-01-16 | F-Star Biotechnologische Forschungs - und Entwicklungsges. M.B.H. | Internalising immunoglobulin |
WO2014004549A2 (en) | 2012-06-27 | 2014-01-03 | Amgen Inc. | Anti-mesothelin binding proteins |
AR091649A1 (en) | 2012-07-02 | 2015-02-18 | Bristol Myers Squibb Co | OPTIMIZATION OF ANTIBODIES THAT FIX THE LYMPHOCYTE ACTIVATION GEN 3 (LAG-3) AND ITS USES |
JP5276742B1 (en) | 2012-08-09 | 2013-08-28 | 日本特殊陶業株式会社 | Spark plug |
JP6224739B2 (en) | 2013-03-15 | 2017-11-01 | グラクソスミスクライン、インテレクチュアル、プロパティー、ディベロップメント、リミテッドGlaxosmithkline Intellectual Property Development Limited | Anti-LAG-3 binding protein |
EP3049442A4 (en) | 2013-09-26 | 2017-06-28 | Costim Pharmaceuticals Inc. | Methods for treating hematologic cancers |
CU24481B1 (en) | 2014-03-14 | 2020-03-04 | Immutep Sas | ANTIBODY MOLECULES THAT JOIN LAG-3 |
JP5902757B2 (en) | 2014-06-24 | 2016-04-13 | 日本特殊陶業株式会社 | Spark plug |
WO2015198312A1 (en) | 2014-06-24 | 2015-12-30 | Ccam Therapeutics Ltd. | Compositions comprising antibodies to ceacam-1 and lag-3 for cancer therapy |
TWI693232B (en) | 2014-06-26 | 2020-05-11 | 美商宏觀基因股份有限公司 | Covalently bonded diabodies having immunoreactivity with pd-1 and lag-3, and methods of use thereof |
BR112017002596A2 (en) | 2014-08-10 | 2018-01-30 | Federal-Mogul Ignition Company | improved sealing spark plug |
JO3663B1 (en) | 2014-08-19 | 2020-08-27 | Merck Sharp & Dohme | Anti-lag3 antibodies and antigen-binding fragments |
GB201500319D0 (en) | 2015-01-09 | 2015-02-25 | Agency Science Tech & Res | Anti-PD-L1 antibodies |
TW201632559A (en) | 2015-02-22 | 2016-09-16 | 索倫多醫療公司 | Antibody therapeutics that bind CD137 |
TW201642897A (en) * | 2015-04-08 | 2016-12-16 | F 星生物科技有限公司 | HER2 binding agent therapies |
CN114316067A (en) | 2015-05-04 | 2022-04-12 | 皮里斯制药有限公司 | Anti-cancer fusion polypeptides |
MX2017014699A (en) | 2015-05-21 | 2018-04-11 | Alligator Bioscience Ab | Novel polypeptides. |
TWI773646B (en) | 2015-06-08 | 2022-08-11 | 美商宏觀基因股份有限公司 | Lag-3-binding molecules and methods of use thereof |
JP6025921B1 (en) | 2015-06-22 | 2016-11-16 | 日本特殊陶業株式会社 | Spark plug |
US10501510B2 (en) | 2015-07-15 | 2019-12-10 | Pieris Pharmaceuticals Gmbh | Muteins of human tear lipocalin capable of binding lymphocyte-activation gene 3 (LAG-3) and methods of use thereof |
AR105444A1 (en) | 2015-07-22 | 2017-10-04 | Sorrento Therapeutics Inc | THERAPEUTIC ANTIBODIES THAT JOIN THE PROTEIN CODIFIED BY THE GENOPHYPE ACTIVATION GEN 3 (LAG3) |
JP2018526989A (en) | 2015-08-07 | 2018-09-20 | ピエリス ファーマシューティカルズ ゲーエムベーハー | Novel fusion polypeptide specific for LAG-3 and PD-1 |
AR105654A1 (en) | 2015-08-24 | 2017-10-25 | Lilly Co Eli | ANTIBODIES PD-L1 (LINKING 1 OF PROGRAMMED CELL DEATH) |
KR101782487B1 (en) | 2015-09-24 | 2017-09-27 | 재단법인 목암생명과학연구소 | Novel Antibody Binding to Mesothelin(MSLN), and Composition Comprising the Same |
TWI756187B (en) | 2015-10-09 | 2022-03-01 | 美商再生元醫藥公司 | Anti-lag3 antibodies and uses thereof |
GB201519481D0 (en) | 2015-11-04 | 2015-12-16 | Cancer Rec Tech Ltd | Immunomodulatory antibodies |
KR102194188B1 (en) | 2015-11-18 | 2020-12-24 | 머크 샤프 앤드 돔 코포레이션 | PD1 and/or LAG3 binder |
WO2017087901A2 (en) | 2015-11-19 | 2017-05-26 | Sutro Biopharma, Inc. | Anti-lag3 antibodies, compositions comprising anti-lag3 antibodies and methods of making and using anti-lag3 antibodies |
EP3402823A4 (en) | 2016-01-11 | 2019-09-18 | Inhibrx, Inc. | Multivalent and multispecific 41bb-binding fusion proteins |
ES2910365T3 (en) | 2016-04-22 | 2022-05-12 | Alligator Bioscience Ab | New bispecific polypeptides against CD137 |
EP3464367B1 (en) | 2016-05-27 | 2020-09-09 | AbbVie Biotherapeutics Inc. | Bispecific binding proteins binding an immunomodulatory protein and a tumor antigen |
US20190106494A1 (en) | 2016-06-13 | 2019-04-11 | Askgene Pharma Inc. | PD-L1 Specific Monoclonal Antibodies for Disease Treatment and Diagnosis |
CN109475603B (en) | 2016-06-20 | 2023-06-13 | 科马布有限公司 | anti-PD-L1 antibodies |
LT3472207T (en) | 2016-06-20 | 2021-05-10 | F-Star Delta Limited | Binding molecules binding pd-l1 and lag-3 |
US9567399B1 (en) | 2016-06-20 | 2017-02-14 | Kymab Limited | Antibodies and immunocytokines |
JP7085708B2 (en) | 2016-06-20 | 2022-06-17 | エフ-スター セラピューティクス リミテッド | LAG-3 binding element |
GB201612520D0 (en) | 2016-07-19 | 2016-08-31 | F-Star Beta Ltd | Binding molecules |
JP2019528251A (en) | 2016-07-20 | 2019-10-10 | エスティーキューブ,インコーポレイテッド | Methods of treating and treating cancer using a combination of antibodies that bind to glycosylated PD-L1 |
NZ751956A (en) | 2016-09-23 | 2022-01-28 | Merus Nv | Binding molecules that modulate a biological activity expressed by a cell |
GB201616699D0 (en) | 2016-09-30 | 2016-11-16 | Mab Designs Ltd | Antibodies |
GB201700345D0 (en) | 2017-01-09 | 2017-02-22 | F-Star Beta Ltd | Conditional agonists of immune responses |
JP7220161B2 (en) | 2017-05-26 | 2023-02-09 | ノビミューン エスアー | Anti-CD47x anti-mesothelin antibodies and methods of using same |
EP4245375A3 (en) | 2017-05-30 | 2023-12-06 | Bristol-Myers Squibb Company | Compositions comprising a combination of an anti-lag-3 antibody, a pd-1 pathway inhibitor, and an immunotherapeutic agent |
BR112020001944A2 (en) | 2017-08-04 | 2020-08-04 | Genmab A/S | binding agent, nucleic acid, expression vector, cell, composition, methods for treating a disease and for producing a bispecific antibody, using a binding agent, and anti-idiotypic antibody. |
US11629189B2 (en) * | 2017-12-19 | 2023-04-18 | Kymab Limited | Bispecific antibody for ICOS and PD-L1 |
GB201811450D0 (en) | 2018-07-12 | 2018-08-29 | F Star Delta Ltd | Mesothelin and CD137 binding molecules |
GB201811410D0 (en) | 2018-07-12 | 2018-08-29 | F Star Beta Ltd | OX40 Binding molecules |
GB201811408D0 (en) | 2018-07-12 | 2018-08-29 | F Star Beta Ltd | CD137 Binding Molecules |
GB201811404D0 (en) | 2018-07-12 | 2018-08-29 | F Star Beta Ltd | Anti-CD137 Antibodies |
US20220048996A1 (en) | 2018-07-12 | 2022-02-17 | F-Star Beta Limited | Antibody molecules that bind cd137 and ox40 |
EP3820569A1 (en) | 2018-07-12 | 2021-05-19 | F-Star Beta Limited | Antibody molecules that bind pd-l1 and cd137 |
GB201811403D0 (en) | 2018-07-12 | 2018-08-29 | F Star Beta Ltd | Antibody molecules |
-
2018
- 2018-12-19 TW TW107145960A patent/TW201930355A/en unknown
- 2018-12-19 CN CN201880089663.1A patent/CN111741976A/en active Pending
- 2018-12-19 JP JP2020533846A patent/JP7489316B2/en active Active
- 2018-12-19 AU AU2018387741A patent/AU2018387741A1/en active Pending
- 2018-12-19 CA CA3086098A patent/CA3086098A1/en active Pending
- 2018-12-19 WO PCT/EP2018/085834 patent/WO2019121906A1/en unknown
- 2018-12-19 US US16/955,450 patent/US11548948B2/en active Active
- 2018-12-19 EP EP18833200.1A patent/EP3728316A1/en active Pending
-
2022
- 2022-12-08 US US18/063,521 patent/US20230406935A1/en active Pending
Also Published As
Publication number | Publication date |
---|---|
WO2019121906A1 (en) | 2019-06-27 |
CN111741976A (en) | 2020-10-02 |
JP2021508449A (en) | 2021-03-11 |
US20210139590A1 (en) | 2021-05-13 |
TW201930355A (en) | 2019-08-01 |
AU2018387741A1 (en) | 2020-07-23 |
JP7489316B2 (en) | 2024-05-23 |
EP3728316A1 (en) | 2020-10-28 |
CA3086098A1 (en) | 2019-06-27 |
WO2019121906A9 (en) | 2020-04-16 |
US11548948B2 (en) | 2023-01-10 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20230406935A1 (en) | Fc binding fragments comprising a pd-l1 antigen-binding site | |
KR102309950B1 (en) | Checkpoint inhibitor bispecific antibody | |
JP2022126847A (en) | Antibodies to tigit | |
US20170304437A1 (en) | Bispecific molecules capable of specifically binding to both ctla-4 and cd40 | |
JP7360440B2 (en) | Antibody molecules that bind to PD-L1 and CD137 | |
JP2019520797A (en) | Bispecific binding protein and use thereof | |
US20210301022A1 (en) | Antibody molecules | |
KR20230008181A (en) | Proteins that bind to NKG2D, CD16 and CLEC12A | |
JP2021524267A (en) | Antibody molecule that binds to CD137 and OX40 | |
CA3106051A1 (en) | Fc binding fragments comprising an ox40 antigen-binding site | |
EP3873611A1 (en) | Anti-tim-3 antibodies | |
CA3105994A1 (en) | Fc binding fragments comprising a cd137 antigen-binding site | |
KR20220091490A (en) | PD1 and VEGFR2 double binding agent | |
CA3181591A1 (en) | Antibodies specific to abcb5 and uses thereof | |
KR20230027267A (en) | Anti-PD-1 Antibodies and Fusion Proteins | |
WO2023052541A1 (en) | Combination of an anti-btn3a activating antibody and an il-2 agonist for use in therapy | |
CA3228137A1 (en) | Cldn18.2-targeting antibody, bispecific antibody and use thereof | |
KR20230080437A (en) | Antibodies capable of binding ROR2 and bispecific antibodies binding ROR2 and CD3 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
AS | Assignment |
Owner name: F-STAR THERAPEUTICS LIMITED, UNITED KINGDOM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:F-STAR BETA LIMITED;REEL/FRAME:064914/0466 Effective date: 20210624 Owner name: F-STAR BETA LIMITED, UNITED KINGDOM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:TUNA, MIHRIBAN;VAN HORCK, FRANCISCA WOLLERTON;FIEHLER, RYAN;AND OTHERS;SIGNING DATES FROM 20171208 TO 20180508;REEL/FRAME:064914/0417 |