US20220162655A1 - Engineered biosynthetic pathways for production of l-homocysteine by fermentation - Google Patents
Engineered biosynthetic pathways for production of l-homocysteine by fermentation Download PDFInfo
- Publication number
- US20220162655A1 US20220162655A1 US17/442,090 US202017442090A US2022162655A1 US 20220162655 A1 US20220162655 A1 US 20220162655A1 US 202017442090 A US202017442090 A US 202017442090A US 2022162655 A1 US2022162655 A1 US 2022162655A1
- Authority
- US
- United States
- Prior art keywords
- engineered microbial
- microbial cell
- fold
- cell
- homocysteine
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- FFFHZYDWPBMWHY-VKHMYHEASA-N L-homocysteine Chemical compound OC(=O)[C@@H](N)CCS FFFHZYDWPBMWHY-VKHMYHEASA-N 0.000 title claims abstract description 131
- FFFHZYDWPBMWHY-UHFFFAOYSA-N L-Homocysteine Natural products OC(=O)C(N)CCS FFFHZYDWPBMWHY-UHFFFAOYSA-N 0.000 title claims abstract description 128
- 238000004519 manufacturing process Methods 0.000 title abstract description 37
- 238000000855 fermentation Methods 0.000 title description 15
- 230000004151 fermentation Effects 0.000 title description 15
- 230000006696 biosynthetic metabolic pathway Effects 0.000 title description 5
- 230000000813 microbial effect Effects 0.000 claims abstract description 197
- 102000004190 Enzymes Human genes 0.000 claims description 144
- 108090000790 Enzymes Proteins 0.000 claims description 144
- 230000000694 effects Effects 0.000 claims description 89
- 230000037361 pathway Effects 0.000 claims description 75
- 238000011144 upstream manufacturing Methods 0.000 claims description 72
- 230000001965 increasing effect Effects 0.000 claims description 58
- 230000002829 reductive effect Effects 0.000 claims description 48
- 108010071218 3'-phosphoadenylyl-5'-phosphosulfate reductase Proteins 0.000 claims description 46
- 238000000034 method Methods 0.000 claims description 42
- 108010027912 Sulfite Oxidase Proteins 0.000 claims description 41
- 102000043440 Sulfite oxidase Human genes 0.000 claims description 41
- 102000004523 Sulfate Adenylyltransferase Human genes 0.000 claims description 31
- 108010022348 Sulfate adenylyltransferase Proteins 0.000 claims description 31
- 108090001033 Sulfotransferases Proteins 0.000 claims description 30
- 102000004896 Sulfotransferases Human genes 0.000 claims description 26
- 229930027945 nicotinamide-adenine dinucleotide Natural products 0.000 claims description 26
- 108010064711 Homoserine dehydrogenase Proteins 0.000 claims description 22
- XJLXINKUBYWONI-NNYOXOHSSA-N NADP zwitterion Chemical compound NC(=O)C1=CC=C[N+]([C@H]2[C@@H]([C@H](O)[C@@H](COP([O-])(=O)OP(O)(=O)OC[C@@H]3[C@H]([C@@H](OP(O)(O)=O)[C@@H](O3)N3C4=NC=NC(N)=C4N=C3)O)O2)O)=C1 XJLXINKUBYWONI-NNYOXOHSSA-N 0.000 claims description 18
- 230000005764 inhibitory process Effects 0.000 claims description 15
- 108010055400 Aspartate kinase Proteins 0.000 claims description 14
- 239000001963 growth medium Substances 0.000 claims description 13
- 239000002243 precursor Substances 0.000 claims description 13
- 108020004652 Aspartate-Semialdehyde Dehydrogenase Proteins 0.000 claims description 12
- FCXZBWSIAGGPCB-YFKPBYRVSA-N O-acetyl-L-homoserine Chemical compound CC(=O)OCC[C@H]([NH3+])C([O-])=O FCXZBWSIAGGPCB-YFKPBYRVSA-N 0.000 claims description 12
- 230000002103 transcriptional effect Effects 0.000 claims description 11
- 108010053763 Pyruvate Carboxylase Proteins 0.000 claims description 10
- 102100039895 Pyruvate carboxylase, mitochondrial Human genes 0.000 claims description 10
- 108091022908 Serine O-acetyltransferase Proteins 0.000 claims description 9
- 238000012258 culturing Methods 0.000 claims description 9
- BOPGDPNILDQYTO-NNYOXOHSSA-N nicotinamide-adenine dinucleotide Chemical compound C1=CCC(C(=O)N)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OC[C@@H]2[C@H]([C@@H](O)[C@@H](O2)N2C3=NC=NC(N)=C3N=C2)O)O1 BOPGDPNILDQYTO-NNYOXOHSSA-N 0.000 claims description 9
- 102000004625 Aspartate Aminotransferases Human genes 0.000 claims description 8
- 108010003415 Aspartate Aminotransferases Proteins 0.000 claims description 8
- 235000018417 cysteine Nutrition 0.000 claims description 8
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 claims description 8
- 108010054404 Adenylyl-sulfate kinase Proteins 0.000 claims description 7
- 108030001873 O-acetylhomoserine aminocarboxypropyltransferases Proteins 0.000 claims description 7
- 108090000472 Phosphoenolpyruvate carboxykinase (ATP) Proteins 0.000 claims description 7
- 101710083973 Homocysteine synthase Proteins 0.000 claims description 6
- 241001468197 Lactobacillus collinoides Species 0.000 claims description 6
- UKAUYVFTDYCKQA-UHFFFAOYSA-N -2-Amino-4-hydroxybutanoic acid Natural products OC(=O)C(N)CCO UKAUYVFTDYCKQA-UHFFFAOYSA-N 0.000 claims description 4
- 102000011848 5-Methyltetrahydrofolate-Homocysteine S-Methyltransferase Human genes 0.000 claims description 4
- 108010075604 5-Methyltetrahydrofolate-Homocysteine S-Methyltransferase Proteins 0.000 claims description 4
- 101000950981 Bacillus subtilis (strain 168) Catabolic NAD-specific glutamate dehydrogenase RocG Proteins 0.000 claims description 4
- 102100034976 Cystathionine beta-synthase Human genes 0.000 claims description 4
- 108010073644 Cystathionine beta-synthase Proteins 0.000 claims description 4
- 102000016901 Glutamate dehydrogenase Human genes 0.000 claims description 4
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-Homoserine Natural products OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 claims description 4
- 108010026217 Malate Dehydrogenase Proteins 0.000 claims description 4
- 102000013460 Malate Dehydrogenase Human genes 0.000 claims description 4
- 108010061618 O-succinylhomoserine (thiol)-lyase Proteins 0.000 claims description 4
- 102000018509 Sulfate Transporters Human genes 0.000 claims description 4
- 108010091582 Sulfate Transporters Proteins 0.000 claims description 4
- 102100033451 Thyroid hormone receptor beta Human genes 0.000 claims description 4
- 102000004357 Transferases Human genes 0.000 claims description 4
- 108090000992 Transferases Proteins 0.000 claims description 4
- 108010071598 homoserine kinase Proteins 0.000 claims description 4
- 229950006238 nadide Drugs 0.000 claims description 4
- 101000889837 Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) Protein CysO Proteins 0.000 claims description 3
- 101710116000 Phosphoadenosine phosphosulfate reductase Proteins 0.000 claims description 3
- 108010038555 Phosphoglycerate dehydrogenase Proteins 0.000 claims description 3
- 102100021762 Phosphoserine phosphatase Human genes 0.000 claims description 3
- 102000001253 Protein Kinase Human genes 0.000 claims description 3
- 108020005115 Pyruvate Kinase Proteins 0.000 claims description 3
- 102000013009 Pyruvate Kinase Human genes 0.000 claims description 3
- 229930029653 phosphoenolpyruvate Natural products 0.000 claims description 3
- DTBNBXWJWCWCIK-UHFFFAOYSA-N phosphoenolpyruvic acid Chemical compound OC(=O)C(=C)OP(O)(O)=O DTBNBXWJWCWCIK-UHFFFAOYSA-N 0.000 claims description 3
- 102000030592 phosphoserine aminotransferase Human genes 0.000 claims description 3
- 108010088694 phosphoserine aminotransferase Proteins 0.000 claims description 3
- 108010076573 phosphoserine phosphatase Proteins 0.000 claims description 3
- 101001092963 Lactobacillus acidophilus Serine O-acetyltransferase Proteins 0.000 claims description 2
- 238000012262 fermentative production Methods 0.000 abstract description 5
- 210000004027 cell Anatomy 0.000 description 269
- 241000186226 Corynebacterium glutamicum Species 0.000 description 53
- 108090000623 proteins and genes Proteins 0.000 description 42
- 235000000346 sugar Nutrition 0.000 description 23
- 150000001413 amino acids Chemical class 0.000 description 22
- 230000010354 integration Effects 0.000 description 22
- 239000013612 plasmid Substances 0.000 description 21
- 108091033319 polynucleotide Proteins 0.000 description 20
- 102000040430 polynucleotide Human genes 0.000 description 20
- 239000002157 polynucleotide Substances 0.000 description 20
- 230000014509 gene expression Effects 0.000 description 17
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 14
- 230000007423 decrease Effects 0.000 description 14
- 230000012010 growth Effects 0.000 description 14
- 239000002609 medium Substances 0.000 description 14
- 229910052717 sulfur Inorganic materials 0.000 description 14
- 239000011593 sulfur Substances 0.000 description 14
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 13
- 230000004077 genetic alteration Effects 0.000 description 13
- 231100000118 genetic alteration Toxicity 0.000 description 13
- 229920001184 polypeptide Polymers 0.000 description 13
- 102000004196 processed proteins & peptides Human genes 0.000 description 13
- 108090000765 processed proteins & peptides Proteins 0.000 description 13
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 12
- 239000008103 glucose Substances 0.000 description 12
- 108020004705 Codon Proteins 0.000 description 11
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 10
- 239000003550 marker Substances 0.000 description 10
- 239000013598 vector Substances 0.000 description 10
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 9
- 230000001580 bacterial effect Effects 0.000 description 9
- 229910052799 carbon Inorganic materials 0.000 description 9
- 238000006243 chemical reaction Methods 0.000 description 9
- 108020004414 DNA Proteins 0.000 description 8
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 8
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 8
- 238000013459 approach Methods 0.000 description 8
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 8
- 229910052760 oxygen Inorganic materials 0.000 description 8
- 239000001301 oxygen Substances 0.000 description 8
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 7
- 235000014469 Bacillus subtilis Nutrition 0.000 description 7
- 108091033409 CRISPR Proteins 0.000 description 7
- 108091028043 Nucleic acid sequence Proteins 0.000 description 7
- 241000235015 Yarrowia lipolytica Species 0.000 description 7
- 229940024606 amino acid Drugs 0.000 description 7
- 235000001014 amino acid Nutrition 0.000 description 7
- 239000000047 product Substances 0.000 description 7
- 241000894007 species Species 0.000 description 7
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 238000003306 harvesting Methods 0.000 description 6
- 229910052757 nitrogen Inorganic materials 0.000 description 6
- 239000002773 nucleotide Substances 0.000 description 6
- 125000003729 nucleotide group Chemical group 0.000 description 6
- 102000020018 Cystathionine gamma-Lyase Human genes 0.000 description 5
- 108010045283 Cystathionine gamma-lyase Proteins 0.000 description 5
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 5
- UCKMPCXJQFINFW-UHFFFAOYSA-N Sulphide Chemical compound [S-2] UCKMPCXJQFINFW-UHFFFAOYSA-N 0.000 description 5
- 229940041514 candida albicans extract Drugs 0.000 description 5
- 238000012423 maintenance Methods 0.000 description 5
- 230000001105 regulatory effect Effects 0.000 description 5
- 239000012138 yeast extract Substances 0.000 description 5
- 244000063299 Bacillus subtilis Species 0.000 description 4
- 240000001046 Lactobacillus acidophilus Species 0.000 description 4
- 235000013956 Lactobacillus acidophilus Nutrition 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 239000004202 carbamide Substances 0.000 description 4
- 238000013461 design Methods 0.000 description 4
- 229940039695 lactobacillus acidophilus Drugs 0.000 description 4
- 230000004108 pentose phosphate pathway Effects 0.000 description 4
- 239000012071 phase Substances 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 239000000758 substrate Substances 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- DHCDFWKWKRSZHF-UHFFFAOYSA-L thiosulfate(2-) Chemical compound [O-]S([S-])(=O)=O DHCDFWKWKRSZHF-UHFFFAOYSA-L 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- 108700010070 Codon Usage Proteins 0.000 description 3
- 241000186216 Corynebacterium Species 0.000 description 3
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 3
- BAWFJGJZGIEFAR-NNYOXOHSSA-N NAD zwitterion Chemical compound NC(=O)C1=CC=C[N+]([C@H]2[C@@H]([C@H](O)[C@@H](COP([O-])(=O)OP(O)(=O)OC[C@@H]3[C@H]([C@@H](O)[C@@H](O3)N3C4=NC=NC(N)=C4N=C3)O)O2)O)=C1 BAWFJGJZGIEFAR-NNYOXOHSSA-N 0.000 description 3
- 101150050575 URA3 gene Proteins 0.000 description 3
- RQVYBGPQFYCBGX-UHFFFAOYSA-N ametryn Chemical compound CCNC1=NC(NC(C)C)=NC(SC)=N1 RQVYBGPQFYCBGX-UHFFFAOYSA-N 0.000 description 3
- 229910021529 ammonia Inorganic materials 0.000 description 3
- 150000003863 ammonium salts Chemical class 0.000 description 3
- 230000010261 cell growth Effects 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 229960002737 fructose Drugs 0.000 description 3
- 230000002538 fungal effect Effects 0.000 description 3
- 238000012224 gene deletion Methods 0.000 description 3
- 230000003287 optical effect Effects 0.000 description 3
- AAEVYOVXGOFMJO-UHFFFAOYSA-N prometryn Chemical compound CSC1=NC(NC(C)C)=NC(NC(C)C)=N1 AAEVYOVXGOFMJO-UHFFFAOYSA-N 0.000 description 3
- 102000004169 proteins and genes Human genes 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 238000000926 separation method Methods 0.000 description 3
- 150000008163 sugars Chemical class 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 241001513093 Aspergillus awamori Species 0.000 description 2
- 241001480052 Aspergillus japonicus Species 0.000 description 2
- 241000351920 Aspergillus nidulans Species 0.000 description 2
- 241000228245 Aspergillus niger Species 0.000 description 2
- 240000006439 Aspergillus oryzae Species 0.000 description 2
- 238000010356 CRISPR-Cas9 genome editing Methods 0.000 description 2
- 241001464430 Cyanobacterium Species 0.000 description 2
- ILRYLPWNYFXEMH-UHFFFAOYSA-N D-cystathionine Natural products OC(=O)C(N)CCSCC(N)C(O)=O ILRYLPWNYFXEMH-UHFFFAOYSA-N 0.000 description 2
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- 108010042407 Endonucleases Proteins 0.000 description 2
- 102000004533 Endonucleases Human genes 0.000 description 2
- 229930091371 Fructose Natural products 0.000 description 2
- 239000005715 Fructose Substances 0.000 description 2
- 101100246753 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) pyrF gene Proteins 0.000 description 2
- ILRYLPWNYFXEMH-WHFBIAKZSA-N L-cystathionine Chemical compound [O-]C(=O)[C@@H]([NH3+])CCSC[C@H]([NH3+])C([O-])=O ILRYLPWNYFXEMH-WHFBIAKZSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- AFVFQIVMOAPDHO-UHFFFAOYSA-M Methanesulfonate Chemical compound CS([O-])(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-M 0.000 description 2
- 241000235088 Saccharomyces sp. Species 0.000 description 2
- 241000223261 Trichoderma viride Species 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 2
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 210000000349 chromosome Anatomy 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 238000002425 crystallisation Methods 0.000 description 2
- 230000008025 crystallization Effects 0.000 description 2
- 230000002074 deregulated effect Effects 0.000 description 2
- GUJOJGAPFQRJSV-UHFFFAOYSA-N dialuminum;dioxosilane;oxygen(2-);hydrate Chemical compound O.[O-2].[O-2].[O-2].[Al+3].[Al+3].O=[Si]=O.O=[Si]=O.O=[Si]=O.O=[Si]=O GUJOJGAPFQRJSV-UHFFFAOYSA-N 0.000 description 2
- VYFYYTLLBUKUHU-UHFFFAOYSA-N dopamine Chemical compound NCCC1=CC=C(O)C(O)=C1 VYFYYTLLBUKUHU-UHFFFAOYSA-N 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 230000009123 feedback regulation Effects 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 235000011389 fruit/vegetable juice Nutrition 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 229930182830 galactose Natural products 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 238000010362 genome editing Methods 0.000 description 2
- 150000004676 glycans Chemical class 0.000 description 2
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 2
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 2
- 238000005342 ion exchange Methods 0.000 description 2
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 239000002207 metabolite Substances 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 238000001471 micro-filtration Methods 0.000 description 2
- 239000006151 minimal media Substances 0.000 description 2
- 150000002772 monosaccharides Chemical class 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 229920001542 oligosaccharide Polymers 0.000 description 2
- 150000002482 oligosaccharides Chemical class 0.000 description 2
- 238000005457 optimization Methods 0.000 description 2
- 229920001282 polysaccharide Polymers 0.000 description 2
- 239000005017 polysaccharide Substances 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 238000011165 process development Methods 0.000 description 2
- 235000018102 proteins Nutrition 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 238000000108 ultra-filtration Methods 0.000 description 2
- 238000012795 verification Methods 0.000 description 2
- 101150084750 1 gene Proteins 0.000 description 1
- SEHFUALWMUWDKS-UHFFFAOYSA-N 5-fluoroorotic acid Chemical compound OC(=O)C=1NC(=O)NC(=O)C=1F SEHFUALWMUWDKS-UHFFFAOYSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 108050005273 Amino acid transporters Proteins 0.000 description 1
- 102000034263 Amino acid transporters Human genes 0.000 description 1
- 241000228215 Aspergillus aculeatus Species 0.000 description 1
- 241000131386 Aspergillus sojae Species 0.000 description 1
- 241000228257 Aspergillus sp. Species 0.000 description 1
- 241000193744 Bacillus amyloliquefaciens Species 0.000 description 1
- 241000193752 Bacillus circulans Species 0.000 description 1
- 241001328122 Bacillus clausii Species 0.000 description 1
- 241000193749 Bacillus coagulans Species 0.000 description 1
- 241000006382 Bacillus halodurans Species 0.000 description 1
- 241000193422 Bacillus lentus Species 0.000 description 1
- 241000194108 Bacillus licheniformis Species 0.000 description 1
- 241000194107 Bacillus megaterium Species 0.000 description 1
- 241000193388 Bacillus thuringiensis Species 0.000 description 1
- 241000149420 Bothrometopus brevis Species 0.000 description 1
- 238000010354 CRISPR gene editing Methods 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- 241000195627 Chlamydomonadales Species 0.000 description 1
- 241001147674 Chlorarachniophyceae Species 0.000 description 1
- 241001674013 Chrysosporium lucknowense Species 0.000 description 1
- 241000123350 Chrysosporium sp. Species 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 241000195493 Cryptophyta Species 0.000 description 1
- 238000007702 DNA assembly Methods 0.000 description 1
- 241000408659 Darpa Species 0.000 description 1
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 1
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 241000199914 Dinophyceae Species 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 241000088541 Emericella sp. Species 0.000 description 1
- 241001522957 Enterococcus casseliflavus Species 0.000 description 1
- 241000194032 Enterococcus faecalis Species 0.000 description 1
- 241000194031 Enterococcus faecium Species 0.000 description 1
- 241000194030 Enterococcus gallinarum Species 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 241000195623 Euglenida Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 241000567163 Fusarium cerealis Species 0.000 description 1
- 241000146406 Fusarium heterosporum Species 0.000 description 1
- 241000223221 Fusarium oxysporum Species 0.000 description 1
- 241000221779 Fusarium sambucinum Species 0.000 description 1
- 241000427940 Fusarium solani Species 0.000 description 1
- 241001149959 Fusarium sp. Species 0.000 description 1
- 241000567178 Fusarium venenatum Species 0.000 description 1
- 241000193385 Geobacillus stearothermophilus Species 0.000 description 1
- 241000768015 Gliocladium sp. Species 0.000 description 1
- 229920001503 Glucan Polymers 0.000 description 1
- 241000223199 Humicola grisea Species 0.000 description 1
- 241001480714 Humicola insolens Species 0.000 description 1
- 241000235649 Kluyveromyces Species 0.000 description 1
- 235000014663 Kluyveromyces fragilis Nutrition 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- 240000006024 Lactobacillus plantarum Species 0.000 description 1
- 241000186806 Listeria grayi Species 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical class CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 241001558145 Mucor sp. Species 0.000 description 1
- 241000221961 Neurospora crassa Species 0.000 description 1
- 241000088436 Neurospora sp. Species 0.000 description 1
- 241000192522 Nostocales Species 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 241000320412 Ogataea angusta Species 0.000 description 1
- 241000192494 Oscillatoriales Species 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 241000194109 Paenibacillus lautus Species 0.000 description 1
- 241000228168 Penicillium sp. Species 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 241000235648 Pichia Species 0.000 description 1
- 241000235061 Pichia sp. Species 0.000 description 1
- 241000511381 Pleurocapsales Species 0.000 description 1
- 241000157935 Promicromonospora citrea Species 0.000 description 1
- 241000168225 Pseudomonas alcaligenes Species 0.000 description 1
- 241000589774 Pseudomonas sp. Species 0.000 description 1
- LCTONWCANYUPML-UHFFFAOYSA-M Pyruvate Chemical compound CC(=O)C([O-])=O LCTONWCANYUPML-UHFFFAOYSA-M 0.000 description 1
- 241000235403 Rhizomucor miehei Species 0.000 description 1
- 241000952054 Rhizopus sp. Species 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 244000253911 Saccharomyces fragilis Species 0.000 description 1
- 235000018368 Saccharomyces fragilis Nutrition 0.000 description 1
- 240000000111 Saccharum officinarum Species 0.000 description 1
- 235000007201 Saccharum officinarum Nutrition 0.000 description 1
- 241000720795 Schizosaccharomyces sp. Species 0.000 description 1
- 240000006394 Sorghum bicolor Species 0.000 description 1
- 235000011684 Sorghum saccharatum Nutrition 0.000 description 1
- 101100166144 Staphylococcus aureus cas9 gene Proteins 0.000 description 1
- 241000191963 Staphylococcus epidermidis Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 241000063122 Streptacidiphilus griseus Species 0.000 description 1
- 244000057717 Streptococcus lactis Species 0.000 description 1
- 241000187432 Streptomyces coelicolor Species 0.000 description 1
- 241000187398 Streptomyces lividans Species 0.000 description 1
- 108091028113 Trans-activating crRNA Proteins 0.000 description 1
- 241000223260 Trichoderma harzianum Species 0.000 description 1
- 241000378866 Trichoderma koningii Species 0.000 description 1
- 241000223262 Trichoderma longibrachiatum Species 0.000 description 1
- 241001557886 Trichoderma sp. Species 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 238000011481 absorbance measurement Methods 0.000 description 1
- 230000003044 adaptive effect Effects 0.000 description 1
- 235000016127 added sugars Nutrition 0.000 description 1
- 230000004103 aerobic respiration Effects 0.000 description 1
- 230000003281 allosteric effect Effects 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 150000001370 alpha-amino acid derivatives Chemical class 0.000 description 1
- 235000008206 alpha-amino acids Nutrition 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 1
- 210000004507 artificial chromosome Anatomy 0.000 description 1
- 230000008970 bacterial immunity Effects 0.000 description 1
- 235000015191 beet juice Nutrition 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000001851 biosynthetic effect Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 239000006227 byproduct Substances 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000010908 decantation Methods 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000003831 deregulation Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 229960003638 dopamine Drugs 0.000 description 1
- 238000011143 downstream manufacturing Methods 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000009483 enzymatic pathway Effects 0.000 description 1
- -1 episomes Substances 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 230000004907 flux Effects 0.000 description 1
- 210000003918 fraction a Anatomy 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 238000003198 gene knock in Methods 0.000 description 1
- 238000003209 gene knockout Methods 0.000 description 1
- 238000012239 gene modification Methods 0.000 description 1
- 230000005017 genetic modification Effects 0.000 description 1
- 235000013617 genetically modified food Nutrition 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 229960004903 invert sugar Drugs 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 229940031154 kluyveromyces marxianus Drugs 0.000 description 1
- 238000004989 laser desorption mass spectroscopy Methods 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 101150035025 lysC gene Proteins 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 239000013028 medium composition Substances 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000037353 metabolic pathway Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000001728 nano-filtration Methods 0.000 description 1
- 229910000069 nitrogen hydride Inorganic materials 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 239000011574 phosphorus Substances 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 238000001953 recrystallisation Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 238000012827 research and development Methods 0.000 description 1
- 230000000284 resting effect Effects 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 239000000523 sample Substances 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 239000006152 selective media Substances 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 229960004016 sucrose syrup Drugs 0.000 description 1
- LSNNMFCWUKXFEE-UHFFFAOYSA-L sulfite Chemical class [O-]S([O-])=O LSNNMFCWUKXFEE-UHFFFAOYSA-L 0.000 description 1
- 150000003467 sulfuric acid derivatives Chemical class 0.000 description 1
- 239000013595 supernatant sample Substances 0.000 description 1
- 230000009469 supplementation Effects 0.000 description 1
- 150000003568 thioethers Chemical class 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000011282 treatment Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 230000004102 tricarboxylic acid cycle Effects 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
- 235000019156 vitamin B Nutrition 0.000 description 1
- 239000011720 vitamin B Substances 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
- C12N15/77—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora for Corynebacterium; for Brevibacterium
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0051—Oxidoreductases (1.) acting on a sulfur group of donors (1.8)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
- C12N9/1241—Nucleotidyltransferases (2.7.7)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P13/00—Preparation of nitrogen-containing organic compounds
- C12P13/04—Alpha- or beta- amino acids
- C12P13/12—Methionine; Cysteine; Cystine
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y108/00—Oxidoreductases acting on sulfur groups as donors (1.8)
- C12Y108/01—Oxidoreductases acting on sulfur groups as donors (1.8) with NAD+ or NADP+ as acceptor (1.8.1)
- C12Y108/01002—Sulfite reductase (NADPH) (1.8.1.2)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
- C12Y207/07—Nucleotidyltransferases (2.7.7)
- C12Y207/07004—Sulfate adenylyltransferase (2.7.7.4)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y108/00—Oxidoreductases acting on sulfur groups as donors (1.8)
- C12Y108/02—Oxidoreductases acting on sulfur groups as donors (1.8) with a cytochrome as acceptor (1.8.2)
- C12Y108/02001—Sulfite dehydrogenase (1.8.2.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y108/00—Oxidoreductases acting on sulfur groups as donors (1.8)
- C12Y108/04—Oxidoreductases acting on sulfur groups as donors (1.8) with a disulfide as acceptor (1.8.4)
- C12Y108/04008—Phosphoadenylyl-sulfate reductase (thioredoxin) (1.8.4.8)
Definitions
- the present disclosure relates generally to the area of engineering microbes for production of L-homocysteine by fermentation.
- Homocysteine is a non-proteinogenic ⁇ -amino acid. It is a homologue of the amino acid cysteine, differing by an additional methylene bridge (—CH 2 —). It is produced from methionine by the removal of its terminal C ⁇ methyl group. Homocysteine can be recycled into methionine or converted into cysteine with the aid of certain B-vitamins Homocysteine also acts as an allosteric antagonist at Dopamine D 2 receptors.
- the disclosure provides engineered microbial cells, cultures of the microbial cells, and methods for the production of L-homocysteine, including the following:
- Embodiment 1 An engineered microbial cell that includes increased activity of at least one upstream pathway enzyme leading to L-homocysteine, wherein the at least one upstream pathway enzyme is selected from the group consisting of: (a) 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase); (b) sulfite reductase, and (c) sulfate adenylyltransferase (ATP sulfurase), said increased activity being increased relative to a control cell, wherein the engineered microbial cell produces L-homocysteine.
- PAPS reductase 3-phosphoadenosine-5-phosphosulfate sulfotransferase
- ATP sulfurase sulfate adenylyltransferase
- Embodiment 2 The engineered microbial cell of embodiment 1, wherein the engineered microbial cell expresses at least two of said upstream pathway enzymes, wherein the at least two upstream pathway enzymes are selected from the group consisting of: (a) a 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase) and a sulfite reductase; (b) a sulfite reductase and a sulfate adenylyltransferase (ATP sulfurase); and (c) a 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase) and a sulfate adenylyltransferase (ATP sulfurase).
- PAPS reductase 3-phosphoadenosine-5-phosphosulfate sulfotransferase
- Embodiment 3 The engineered microbial cell of embodiment 1 or embodiment 2, wherein said upstream pathway enzymes are heterologous enzymes.
- Embodiment 4 The engineered microbial cell of embodiment 3, wherein the engineered microbial cell expresses: (a) a heterologous 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase); (b) a heterologous sulfite reductase, and (c) a heterologous sulfate adenylyltransferase (ATP sulfurase).
- PAPS reductase a heterologous 3-phosphoadenosine-5-phosphosulfate sulfotransferase
- ATP a heterologous sulfate adenylyltransferase
- Embodiment 5 The engineered microbial cell of any one of embodiments 1-4, wherein the engineered microbial cell includes increased activity of one or more additional upstream pathway enzyme(s) leading to L-homocysteine that is/are selected from the group consisting of phosphoadenosine phosphosulfate reductase (PAPS reductase), and homocysteine synthase, said increased activity being increased relative to a control cell.
- PAPS reductase phosphoadenosine phosphosulfate reductase
- homocysteine synthase said increased activity being increased relative to a control cell.
- Embodiment 6 The engineered microbial cell of any one of embodiments 1-5, wherein the engineered microbial cell includes increased activity of a sulfate transporter, said increased activity being increased relative to a control cell.
- Embodiment 7 The engineered microbial cell of any one of embodiments 1-6, wherein the engineered microbial cell includes increased activity of one or more upstream pathway enzymes leading to O-acetyl-L-homoserine, said increased activity being increased relative to a control cell.
- Embodiment 8 The engineered microbial cell of embodiment 7, wherein the one or more upstream pathway enzymes leading to O-acetyl-L-homoserine is/are selected from the group consisting of phosphoenolpyruvate carboxykinase (PEP carboxykinase), pyruvate kinase, pyruvate carboxylase, glutamate dehydrogenase, aspartate transaminase (aspartate aminotransferase), aspartate kinase (aspartokinase), aspartate-semialdehyde dehydrogenase, homoserine dehydrogenase, and L-homoserine-O-acetyltransferase.
- PEP carboxykinase phosphoenolpyruvate carboxykinase
- pyruvate kinase pyruvate carboxylase
- glutamate dehydrogenase aspart
- Embodiment 9 The engineered microbial cell of embodiment 8, the one or more upstream pathway enzymes leading to O-acetyl-L-homoserine includes PEP carboxykinase, and the activity of pyruvate carboxylase is reduced relative to a control cell.
- Embodiment 10 The engineered microbial cell of any one of embodiments 1-9, wherein the activity of malate dehydrogenase is reduced relative to a control cell.
- Embodiment 11 The engineered microbial cell of any one of embodiments 1-10, wherein the activity of the one or more upstream pathway enzymes is increased by expressing one or more feedback-deregulated enzyme(s).
- Embodiment 12 The engineered microbial cell of embodiment 11, where the one or more feedback-deregulated enzyme (s) is/are selected from the group consisting of a feedback-deregulated aspartate kinase, a feedback-deregulated homoserine dehydrogenase, a feedback-deregulated aspartate-semialdehyde dehydrogenase, and a feedback-deregulated pyruvate carboxylase.
- the one or more feedback-deregulated enzyme (s) is/are selected from the group consisting of a feedback-deregulated aspartate kinase, a feedback-deregulated homoserine dehydrogenase, a feedback-deregulated aspartate-semialdehyde dehydrogenase, and a feedback-deregulated pyruvate carboxylase.
- Embodiment 13 The engineered microbial cell of any one of embodiments 1-10, wherein the activity of the one or more upstream pathway enzymes is increased by expressing one or more upstream pathway enzyme(s) that is/are normally subject to feedback inhibition at the transcriptional level so as to reduce said feedback inhibition at the transcriptional level.
- Embodiment 14 The engineered microbial cell of embodiment 13, wherein reduced feedback inhibition at the transcriptional level is achieved by a method including expressing aspartate kinase from a constitutive promoter.
- Embodiment 15 The engineered microbial cell of any one of embodiments 1-14, wherein the engineered microbial cell includes reduced activity of one or more enzyme(s) that consume one or more upstream pathway precursors, said reduced activity being reduced relative to a control cell.
- Embodiment 16 The engineered microbial cell of embodiment 15, wherein the one or more enzyme(s) that consume one or more upstream pathway precursors is/are selected from the group consisting of cystathionine gamma-synthase, homoserine kinase, and L-homoserine succinyl transferase.
- Embodiment 17 The engineered microbial cell of any one of embodiments 1-16, wherein the engineered microbial cell includes reduced activity of one or more enzyme(s) that consume L-homocysteine, said reduced activity being reduced relative to a control cell.
- Embodiment 18 The engineered microbial cell of embodiment 17, wherein the one or more enzyme(s) that consume L-homocysteine is/are selected from the group consisting of cystathionine beta-synthase and methionine synthase.
- Embodiment 19 The engineered microbial cell of any one of embodiments 15-18, wherein the reduced activity is achieved by one or more means selected from the group consisting of gene deletion, gene disruption, altering regulation of a gene, and replacing a native promoter with a less active promoter.
- Embodiment 20 The engineered microbial cell of any one of embodiments 1-19, wherein the engineered microbial cell includes reduced activity of one or more upstream pathway enzymes leading to cysteine, said reduced activity being reduced relative to a control cell.
- Embodiment 21 The engineered microbial cell of embodiment 20, wherein the one or more upstream pathway enzymes leading to cysteine is/are selected from the group consisting of 3-phosphoglycerate dehydrogenase, phosphoserine transaminase, phosphoserine phosphatase, serine-O-acetyltransferase, and cysteine synthase.
- Embodiment 22 The engineered microbial cell of any of embodiments 1-21, wherein the engineered microbial cell includes altered cofactor specificity of one or more upstream pathway enzyme(s) from the reduced form of nicotinamide adenine dinucleotide phosphate (NADPH) to the reduced from of nicotinamide adenine dinucleotide (NADH).
- NADPH nicotinamide adenine dinucleotide phosphate
- NADH nicotinamide adenine dinucleotide
- Embodiment 23 The engineered microbial cell of embodiment 22, wherein the one or more upstream pathway enzyme(s) whose cofactor specificity is altered is/are selected from the group consisting of aspartate semi-aldehyde dehydrogenase, PAPS reductase, and sulfite reductase.
- Embodiment 24 An engineered microbial cell that includes means for increasing the activity of at least one upstream pathway enzyme leading to L-homocysteine, wherein the at least one upstream pathway enzyme is selected from the group consisting of: (a) 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase); (b) sulfite reductase, and (c) sulfate adenylyltransferase (ATP sulfurase), said increased activity being increased relative to a control cell, wherein the engineered microbial cell produces L-homocysteine.
- PAPS reductase 3-phosphoadenosine-5-phosphosulfate sulfotransferase
- ATP sulfurase sulfate adenylyltransferase
- Embodiment 25 The engineered microbial cell of embodiment 24, wherein the engineered microbial cell includes means for expressing at least two of said upstream pathway enzymes, wherein the at least two upstream pathway enzymes are selected from the group consisting of: (a) a 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase) and a sulfite reductase; (b) a sulfite reductase and a sulfate adenylyltransferase (ATP sulfurase); and (c) a 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase) and a sulfate adenylyltransferase (ATP sulfurase).
- PAPS reductase 3-phosphoadenosine-5-phosphosulfate sulfotransferase
- Embodiment 26 The engineered microbial cell of embodiment 24 or embodiment 25, wherein said upstream pathway enzymes are heterologous enzymes.
- Embodiment 27 The engineered microbial cell of embodiment 26, wherein the engineered microbial cell includes means for expressing: (a) a heterologous 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase); (b) a heterologous sulfite reductase, and (c) a heterologous sulfate adenylyltransferase (ATP sulfurase).
- PAPS reductase a heterologous 3-phosphoadenosine-5-phosphosulfate sulfotransferase
- ATP a heterologous sulfate adenylyltransferase
- Embodiment 28 The engineered microbial cell of any one of embodiments 24-27, wherein the engineered microbial cell includes means for increasing the activity of one or more additional upstream pathway enzyme(s) leading to L-homocysteine that is/are selected from the group consisting of phosphoadenosine phosphosulfate reductase (PAPS reductase) and homocysteine synthase, said increased activity being increased relative to a control cell.
- PAPS reductase phosphoadenosine phosphosulfate reductase
- homocysteine synthase homocysteine synthase
- Embodiment 29 The engineered microbial cell of any one of embodiments 24-28, wherein the engineered microbial cell includes means for increasing the activity of a sulfate transporter, said increased activity being increased relative to a control cell.
- Embodiment 30 The engineered microbial cell of any one of embodiments 24-29, wherein the engineered microbial cell includes means for increasing the activity of one or more upstream pathway enzymes leading to O-acetyl-L-homoserine, said increased activity being increased relative to a control cell.
- Embodiment 31 The engineered microbial cell of embodiment 30, wherein the one or more upstream pathway enzymes leading to O-acetyl-L-homoserine is/are selected from the group consisting of phosphoenolpyruvate carboxykinase (PEP carboxykinase), pyruvate kinase, pyruvate carboxylase, glutamate dehydrogenase, aspartate transaminase (aspartate aminotransferase), aspartate kinase (aspartokinase), aspartate-semialdehyde dehydrogenase, homoserine dehydrogenase, and L-homoserine-O-acetyltransferase.
- PEP carboxykinase phosphoenolpyruvate carboxykinase
- pyruvate kinase pyruvate carboxylase
- glutamate dehydrogenase aspart
- Embodiment 32 The engineered microbial cell of embodiment 31, the one or more upstream pathway enzymes leading to O-acetyl-L-homoserine includes PEP carboxykinase, and the engineered microbial cell includes means for reducing the activity of pyruvate carboxylase relative to a control cell.
- Embodiment 33 The engineered microbial cell of any one of embodiments 24-32, wherein the engineered microbial cell includes means for reducing the activity of malate dehydrogenase relative to a control cell.
- Embodiment 34 The engineered microbial cell of any one of embodiments 24-33, wherein the engineered microbial cell includes means for expressing one or more feedback-deregulated enzyme(s).
- Embodiment 35 The engineered microbial cell of embodiment 34, where the one or more feedback-deregulated enzyme (s) is/are selected from the group consisting of a feedback-deregulated aspartate kinase, a feedback-deregulated homoserine dehydrogenase, a feedback-deregulated aspartate-semialdehyde dehydrogenase, and a feedback-deregulated pyruvate carboxylase.
- the one or more feedback-deregulated enzyme (s) is/are selected from the group consisting of a feedback-deregulated aspartate kinase, a feedback-deregulated homoserine dehydrogenase, a feedback-deregulated aspartate-semialdehyde dehydrogenase, and a feedback-deregulated pyruvate carboxylase.
- Embodiment 36 The engineered microbial cell of any one of embodiments 24-33, wherein the activity of the one or more upstream pathway enzymes is increased by expressing one or more upstream pathway enzyme(s) that is/are normally subject to feedback inhibition at the transcriptional level so as to reduce said feedback inhibition at the transcriptional level.
- Embodiment 37 The engineered microbial cell of embodiment 36, wherein reduced feedback inhibition at the transcriptional level is achieved by a method including expressing aspartate kinase from a constitutive promoter.
- Embodiment 38 The engineered microbial cell of any one of embodiments 24-37, wherein the engineered microbial cell includes means for reducing the activity of one or more enzyme(s) that consume one or more upstream pathway precursors, said reduced activity being reduced relative to a control cell.
- Embodiment 39 The engineered microbial cell of embodiment 38, wherein the one or more enzyme(s) that consume one or more upstream pathway precursors is/are selected from the group consisting of cystathionine gamma-synthase, homoserine kinase, and L-homoserine succinyl transferase.
- Embodiment 40 The engineered microbial cell of any one of embodiments 24-39, wherein the engineered microbial cell includes means for reducing the activity of one or more enzyme(s) that consume(s) L-homocysteine, said reduced activity being reduced relative to a control cell.
- Embodiment 41 The engineered microbial cell of embodiment 40, wherein the one or more enzyme(s) that consume L-homocysteine is/are selected from the group consisting of cystathionine beta-synthase and methionine synthase.
- Embodiment 42 The engineered microbial cell of any one of embodiments 24-41, wherein the engineered microbial cell includes means for reducing the activity of one or more upstream pathway enzymes leading to cysteine, said reduced activity being reduced relative to a control cell.
- Embodiment 43 The engineered microbial cell of embodiment 42, wherein the one or more upstream pathway enzymes leading to cysteine is/are selected from the group consisting of 3-phosphoglycerate dehydrogenase, phosphoserine transaminase, phosphoserine phosphatase, serine-O-acetyltransferase, and cysteine synthase.
- Embodiment 44 The engineered microbial cell of any of embodiments 24-43, wherein the engineered microbial cell includes means for altering the cofactor specificity of one or more upstream pathway enzyme(s) from the reduced form of nicotinamide adenine dinucleotide phosphate (NADPH) to the reduced from of nicotinamide adenine dinucleotide (NADH).
- NADPH nicotinamide adenine dinucleotide phosphate
- NADH nicotinamide adenine dinucleotide
- Embodiment 45 The engineered microbial cell of embodiment 44, wherein the one or more upstream pathway enzyme(s) whose cofactor specificity is altered is/are selected from the group consisting of aspartate semi-aldehyde dehydrogenase, PAPS reductase, and sulfite reductase.
- Embodiment 46 The engineered microbial cell of any one of embodiments 1-45, wherein the engineered microbial cell is a bacterial cell.
- Embodiment 47 The engineered microbial cell of embodiment 46, wherein the bacterial cell is a cell of the genus Corynebacteria.
- Embodiment 48 The engineered microbial cell of embodiment 47, wherein the bacterial cell is a cell of the species glutamicum.
- Embodiment 49 The engineered microbial cell of embodiment 48, wherein the engineered microbial cell includes a heterologous 3-phosphoadenosine-5-phosphposulfate sulfotransferase (PAPS reductase) having at least 70% amino acid sequence identity with a Corynebacteria glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase (PAPS reductase) including SEQ ID NO:2.
- PAPS reductase heterologous 3-phosphoadenosine-5-phosphposulfate sulfotransferase having at least 70% amino acid sequence identity with a Corynebacteria glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase (PAPS reductase) including SEQ ID NO:2.
- Embodiment 50 The engineered microbial cell of embodiment 48 or embodiment 49, wherein the engineered microbial cell additionally includes a heterologous sulfite reductase having at least 70% amino acid sequence identity with a Corynebacteria glutamicum sulfite reductase hemoprotein beta-component including SEQ ID NO:3.
- Embodiment 51 The engineered microbial cell of any one of embodiments 48-50, wherein the engineered microbial cell additionally includes a heterologous sulfate adenylyltransferase (ATP sulfurase) having at least 70% amino acid sequence identity with a Corynebacteria glutamicum sulfate adenylyltransferase subunit 1 including SEQ ID NO:1.
- ATP sulfurase a heterologous sulfate adenylyltransferase having at least 70% amino acid sequence identity with a Corynebacteria glutamicum sulfate adenylyltransferase subunit 1 including SEQ ID NO:1.
- Embodiment 52 The engineered microbial cell of embodiment 51, wherein the engineered microbial cell is a Corynebacteria glutamicum cell that expresses: (a) a heterologous Corynebacteria glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase (PAPS reductase) including SEQ ID NO:2; (b) a heterologous Corynebacteria glutamicum sulfite reductase hemoprotein beta-component including SEQ ID NO:3; and (c) a heterologous Corynebacteria glutamicum sulfate adenylyltransferase subunit 1 including SEQ ID NO:1.
- PAPS reductase a heterologous Corynebacteria glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase
- PAPS reductase
- Embodiment 52-1 The engineered microbial cell of embodiment 51, wherein the engineered microbial cell is a Corynebacteria glutamicum cell that expresses: (a) a heterologous Corynebacteria glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase (PAPS reductase) including SEQ ID NO:2; (b) a heterologous Corynebacteria glutamicum sulfite reductase hemoprotein beta-component including SEQ ID NO:3; and (c) a heterologous Corynebacteria glutamicum sulfate adenylyltransferase including SEQ ID NO:7.
- PAPS reductase a heterologous Corynebacteria glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase
- PAPS reductase a
- Embodiment 52-2 The engineered microbial cell of embodiment 52-1, wherein the engineered microbial cell additionally expresses: (a) a heterologous Lactobacillus acidophilus serine O-acetyltransferase comprising SEQ ID NO:4; (b) a heterologous Corynebacteria glutamicum homoserine dehydrogenase comprising SEQ ID NO:11; and (c) a heterologous Lactobacillus collinoides O-acetylhomoserine aminocarboxypropyltransferase comprising SEQ ID NO:6.
- Embodiment 53 The engineered microbial cell of any one of embodiments 1-52, wherein, when cultured, the engineered microbial cell produces L-homocysteine at a level of at least 5 mg/L of culture medium.
- Embodiment 54 The engineered microbial cell of embodiment 53, wherein, when cultured, the engineered microbial cell produces L-homocysteine at a level of at least 15 mg/L of culture medium.
- Embodiment 55 A culture of engineered microbial cells according to any one of embodiments 1-54.
- Embodiment 56 The culture of embodiment 55, wherein the culture includes a sulfur source that is in a reduced form, relative to sulfate.
- Embodiment 57 The culture of embodiment 56, wherein the sulfur source includes a sulfur source selected from the group consisting of a sulfide, a thiosulfate, a methylsulfonate, an ametryne, a prometryne, and any combination thereof.
- the sulfur source includes a sulfur source selected from the group consisting of a sulfide, a thiosulfate, a methylsulfonate, an ametryne, a prometryne, and any combination thereof.
- Embodiment 58 The culture of any one of embodiments 55-57, wherein the substrate includes a carbon source and a nitrogen source selected from the group consisting of urea, an ammonium salt, ammonia, and any combination thereof.
- Embodiment 59 The culture of any one of embodiments 55-58, wherein the engineered microbial cells are present in a concentration such that the culture has an optical density at 600 nm of 10-500.
- Embodiment 60 The culture of any one of embodiments 55-59, wherein the culture includes L-homocysteine.
- Embodiment 61 The culture of any one of embodiments 55-60, wherein the culture includes L-homocysteine at a level of at least 15 mg/L of culture medium.
- Embodiment 62 A method of culturing engineered microbial cells according to any one of embodiments 1-54, the method including culturing the cells under conditions suitable for producing L-homocysteine.
- Embodiment 63 The method of embodiment 62, wherein the method includes culturing the engineered microbial cells in the presence of a sulfur source that is in a reduced form, relative to sulfate.
- Embodiment 64 The culture of embodiment 63, wherein the sulfur source includes a sulfur source selected from the group consisting of a sulfide, a thiosulfate, a methylsulfonate, an ametryne, a prometryne, and any combination thereof.
- the sulfur source includes a sulfur source selected from the group consisting of a sulfide, a thiosulfate, a methylsulfonate, an ametryne, a prometryne, and any combination thereof.
- Embodiment 65 The method of any one of embodiments 62-64, wherein the method includes fed-batch culture, with an initial glucose level in the range of 1-100 g/L, followed by controlled sugar feeding.
- Embodiment 66 The method of any one of embodiments 62-65, wherein the fermentation substrate includes glucose and a nitrogen source selected from the group consisting of urea, an ammonium salt, ammonia, and any combination thereof.
- Embodiment 67 The method of any one of embodiments 62-66, wherein the culture is pH-controlled during culturing.
- Embodiment 68 The method of any one of embodiments 62-67, wherein the culture is aerated during culturing.
- Embodiment 69 The method of any one of embodiments 62-68, wherein the engineered microbial cells produce L-homocysteine at a level of at least 15 mg/L of culture medium.
- Embodiment 70 The method of any one of embodiments 62-69, wherein the method additionally includes recovering L-homocysteine from the culture.
- FIG. 1 Biosynthetic pathway for L-homocysteine.
- FIG. 2 Fermentation processes for producing L-homocysteine in engineered strains of Corynebacteria glutamicum . (See also Example 1.)
- FIG. 3 Integration of Promoter-Gene-Terminator into Saccharomyces cerevisiae and Yarrowia lipolytica.
- FIG. 4 Promoter replacement in Saccharomyces cerevisiae and Yarrowia lipolytica.
- FIG. 5 Targeted gene deletion in Saccharomyces cerevisiae and Yarrowia lipolytica.
- FIG. 6 Integration of Promoter-Gene-Terminator into Corynebacteria glutamicum and Bacillus subtilis.
- This disclosure describes a method for the production of the small molecule L-homocysteine via fermentation by a microbial host from simple carbon and nitrogen sources, such as glucose and urea, respectively.
- a titer of about 18 mg/L L-homocysteine was achieved in engineered Corynebacteria glutamicum.
- fixation is used herein to refer to a process whereby a microbial cell converts one or more substrate(s) into a desired product (such as L-homocysteine) by means of one or more biological conversion steps, without the need for any chemical conversion step.
- engineered is used herein, with reference to a cell, to indicate that the cell contains at least one targeted genetic alteration introduced by man that distinguishes the engineered cell from the naturally occurring cell.
- native is used herein to refer to a cellular component, such as a polynucleotide or polypeptide, that is naturally present in a particular cell.
- a native polynucleotide or polypeptide is endogenous to the cell.
- non-native refers to a polynucleotide or polypeptide that is not naturally present in a particular cell.
- non-native refers to a gene expressed in any context other than the genomic and cellular context in which it is naturally expressed.
- a gene expressed in a non-native manner may have the same nucleotide sequence as the corresponding gene in a host cell, but may be expressed from a vector or from an integration point in the genome that differs from the locus of the native gene.
- heterologous is used herein to describe a polynucleotide or polypeptide introduced into a host cell. This term encompasses a polynucleotide or polypeptide, respectively, derived from a different organism, species, or strain than that of the host cell. In this case, the heterologous polynucleotide or polypeptide has a sequence that is different from any sequence(s) found in the same host cell.
- the term also encompasses a polynucleotide or polypeptide that has a sequence that is the same as a sequence found in the host cell, wherein the polynucleotide or polypeptide is present in a different context than the native sequence (e.g., a heterologous polynucleotide can be linked to a different promotor and inserted into a different genomic location than that of the native sequence).
- heterologous expression thus encompasses expression of a sequence that is non-native to the host cell, as well as expression of a sequence that is native to the host cell in a non-native context.
- wild-type refers to any polynucleotide having a nucleotide sequence, or polypeptide having an amino acid, sequence present in a polynucleotide or polypeptide from a naturally occurring organism, regardless of the source of the molecule; i.e., the term “wild-type” refers to sequence characteristics, regardless of whether the molecule is purified from a natural source; expressed recombinantly, followed by purification; or synthesized.
- wild-type is also used to denote naturally occurring cells.
- control cell is a cell that is otherwise identical to an engineered cell being tested, including being of the same genus and species as the engineered cell, but lacks the specific genetic modification(s) being tested in the engineered cell.
- Enzymes are identified herein by the reactions they catalyze and, unless otherwise indicated, refer to any polypeptide capable of catalyzing the identified reaction. Unless otherwise indicated, enzymes may be derived from any organism and may have a native or mutated amino acid sequence. As is well known, enzymes may have multiple functions and/or multiple names, sometimes depending on the source organism from which they derive. The enzyme names used herein encompass orthologs, including enzymes that may have one or more additional functions or a different name.
- feedback-deregulated is used herein with reference to an enzyme that is normally negatively regulated by a downstream product of the enzymatic pathway (i.e., feedback-inhibition) in a particular cell.
- a “feedback-deregulated” enzyme is a form of the enzyme that is less sensitive to feedback-inhibition than the enzyme native to the cell or a form of the enzyme that is native to the cell, but is naturally less sensitive to feedback inhibition than one or more other natural forms of the enzyme.
- a feedback-deregulated enzyme may be produced by introducing one or more mutations into a native enzyme.
- a feedback-deregulated enzyme may simply be a heterologous, native enzyme that, when introduced into a particular microbial cell, is not as sensitive to feedback-inhibition as the native, native enzyme. In some embodiments, the feedback-deregulated enzyme shows no feedback-inhibition in the microbial cell.
- L-homocysteine refers to a chemical compound of the formula C 4 H 9 NO 2 S also known as “2-amino-4-sulfanylbutanoic acid” (CAS #6027-13-0 [L-isomer]).
- sequence identity in the context of two or more amino acid or nucleotide sequences, refers to two or more sequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection.
- sequence comparison For sequence comparison to determine percent nucleotide or amino acid sequence identity, typically one sequence acts as a “reference sequence,” to which a “test” sequence is compared.
- test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
- sequence comparison algorithm calculates the percent sequence identity for the test sequence relative to the reference sequence, based on the designated program parameters. Alignment of sequences for comparison can be conducted using BLAST set to default parameters.
- titer refers to the mass of a product (e.g., L-homocysteine) produced by a culture of microbial cells divided by the culture volume.
- a product e.g., L-homocysteine
- “recovering” refers to separating the L-homocysteine from at least one other component of the cell culture medium.
- L-homocysteine can be produced in one enzymatic step, requiring either the enzyme L-homocysteine synthase or the enzyme cystathionine gamma-lyase.
- the L-homocysteine biosynthesis pathway is shown in FIG. 1 . Not all microbes have these enzymes. For example, homocysteine synthases have been identified in Corynebacteria glutamicum and Saccharomyces cerevisiae , whereas this enzyme is absent in Bacillus subtilis . Cystathionine gamma-lyases are naturally present in B. subtilis, S. cerevisiae , and Y. lipolytica , but absent in C. glutamicum .
- L-homocysteine production can be enabled in a host that does not naturally produce it, or potentially improved in one that does, by the addition of one or more L-homocysteine synthases and/or one or more cystathionine gamma-lyases.
- Any L-homocysteine synthase and/or cystathionine gamma-lyase that is active in the microbial cell being engineered may be introduced into the cell, typically by introducing and expressing the gene(s) encoding the enzyme(s)s using standard genetic engineering techniques.
- Suitable L-homocysteine beta-synthases and/or cystathionine gamma-lyases may be derived from any source, including plant, archaeal, fungal, gram-positive bacterial, and gram-negative bacterial sources.
- One or more copies of any of these genes can be introduced into a selected microbial host cell. If more than one copy of a gene is introduced, the copies can have the same or different nucleotide sequences.
- one or both (or all) of the heterologous gene(s) is/are expressed from a strong, constitutive promoter.
- the heterologous gene(s) is/are expressed from an inducible promoter.
- the heterologous gene(s) can optionally be codon-optimized to enhance expression in the selected microbial host cell.
- Upstream pathway enzymes include all enzymes involved in the conversions from a feedstock all the way to a metabolite that can be directly converted to L-homocysteine (e.g., O-acetyl-L-homoserine or L-cystathionine).
- Illustrative enzymes, for this purpose include, but are not limited to, those shown in FIG. 1 in the pathways leading to these metabolites.
- Suitable upstream pathway genes encoding these enzymes may be derived from any available source, including, for example, those disclosed herein.
- the activity of one or more upstream pathway enzymes is increased by modulating the expression or activity of the native enzyme(s).
- native regulators of the expression or activity of such enzymes can be exploited to increase the activity of suitable enzymes.
- one or more promoters can be substituted for native promoters using, for example, a technique such as that illustrated in FIG. 4 .
- the replacement promoter is stronger than the native promoter and/or is a constitutive promoter.
- the activity of one or more upstream pathway enzymes is supplemented by introducing one or more of the corresponding genes into the engineered microbial host cell.
- An introduced upstream pathway gene may be from an organism other than that of the host cell or may simply be an additional copy of a native gene.
- one or more such genes are introduced into a microbial host cell capable of L-homocysteine production and expressed from a strong constitutive promoter and/or can optionally be codon-optimized to enhance expression in the selected microbial host cell.
- enzyme activity can be upregulated by blocking or bypassing the normal feedback inhibition.
- a recombinant construct in which the native promoter for this gene is replaced with a strong constitutive promoter can be introduced into an engineered microbial cell to produce more of the enzyme under conditions where expression of the enzyme would normally be inhibited.
- LysC for example, encodes aspartate kinase and is feedback-inhibited at the transcriptional level.
- the engineering of a L-homocysteine-producing microbial cell to increase the activity of one or more upstream pathway enzymes increases the L-homocysteine titer by at least 10, 20, 30, 40, 50, 60, 70, 80, or 90 percent or by at least 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 5.5-fold, 6-fold, 6.5-fold, 7-fold, 7.5-fold, 8-fold, 8.5-fold, 9-fold, 9.5-fold, 10-fold, 11-fold, 12-fold, 13-fold, 14-fold, 15-fold, 16-fold, 17-fold, 18-fold, 19-fold, 20-fold, 21-fold, 22-fold, 23-fold, 24-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95-fold
- the increase in L-homocysteine titer is in the range of 10-fold to 1000-fold, 20-fold to 500-fold, 50-fold to 400-fold, 10-fold to 300-fold, or any range bounded by any of the values listed above. (Ranges herein include their endpoints.) These increases are determined relative to the L-homocysteine titer observed in a L-homocysteine-producing microbial cell that lacks any increase in activity of upstream pathway enzymes. This reference cell may have one or more other genetic alterations aimed at increasing L-homocysteine production.
- the L-homocysteine titers achieved by increasing the activity of one or more upstream pathway enzymes are at least 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 600, 700, 800, or 900 ⁇ g/L or at least 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, or 150 mg/L.
- the titer is in the range of 50 ⁇ g/L to 100 mg/L, 75 ⁇ g/L to 75 mg/L, 100 ⁇ g/L to 50 mg/L, 200 ⁇ g/L to 40 gm/L, 300 ⁇ g/L to 30 gm/L, 500 ⁇ g/L to 25 mg/L, 1 mg/L to 20 mg/L, or any range bounded by any of the values listed above.
- a sulfate adenylyltransferase subunit 1 gene also called “ATP sulfurylase,” enzyme 17 in FIG. 1
- a 3-phosphoadenosine-5-phosphposulfate sulfotransferase gene also called “PAPS reductase,” enzyme 19 in FIG. 1
- a sulfite reductase hemoprotein beta-component gene also called “sulfite reductase,” enzyme 20 in FIG. 1 ) from C. glutamicum (see Example 1).
- a feedback-deregulated form can be a heterologous, native enzyme that is less sensitive to feedback inhibition than the native enzyme in the particular microbial host cell.
- a feedback-deregulated form can be a variant of a native or heterologous enzyme that has one or more mutations or truncations rendering it less sensitive to feedback inhibition than the corresponding native enzyme.
- the feedback-deregulated enzyme need not be “introduced,” in the traditional sense. Rather, the microbial host cell selected for engineering can be one that has a native enzyme that is naturally insensitive to feedback inhibition.
- the engineering of a L-homocysteine-producing microbial cell to include one or more feedback-regulated enzymes increases the L-homocysteine titer by at least 10, 20, 30, 40, 50, 60, 70, 80, or 90 percent or by at least 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 5.5-fold, 6-fold, 6.5-fold, 7-fold, 7.5-fold, 8-fold, 8.5-fold, 9-fold, 9.5-fold, 10-fold, 11-fold, 12-fold, 13-fold, 14-fold, 15-fold, 16-fold, 17-fold, 18-fold, 19-fold, 20-fold, 21-fold, 22-fold, 23-fold, 24-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95-fold, 100-
- the increase in L-homocysteine titer is in the range of 10-fold to 1000-fold, 20-fold to 500-fold, 50-fold to 400-fold, 10-fold to 300-fold, or any range bounded by any of the values listed above.
- These increases are determined relative to the L-homocysteine titer observed in a L-homocysteine-producing microbial cell that does not include genetic alterations to reduce feedback regulation.
- This reference cell may (but need not) have other genetic alterations aimed at increasing L-homocysteine production, i.e., the cell may have increased activity of an upstream pathway enzyme.
- the L-homocysteine titers achieved by reducing feedback deregulation are at least 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 600, 700, 800, or 900 ⁇ g/L or at least 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, or 150 mg/L.
- the titer is in the range of 50 ⁇ g/L to 100 mg/L, 75 ⁇ g/L to 75 mg/L, 100 ⁇ g/L to 50 mg/L, 200 ⁇ g/L to 40 gm/L, 300 ⁇ g/L to 30 gm/L, 500 ⁇ g/L to 25 mg/L, 1 mg/L to 20 mg/L, or any range bounded by any of the values listed above.
- Another approach to increasing L-homocysteine production in a microbial cell that is capable of such production is to decrease the activity of one or more enzymes that consume one or more L-homocysteine pathway precursors or that consume L-homocysteine itself (see those discussed above in the Summary)
- the activity of one or more such enzymes is reduced by modulating the expression or activity of the native enzyme(s).
- the activity of such enzymes can be decreased, for example, by substituting the native promoter of the corresponding gene(s) with a less active or inactive promoter or by deleting the corresponding gene(s). See FIGS. 4 and 5 for examples of schemes for promoter replacement and targeted gene deletion, respectively, in S. cervisiae and Y. lipolytica.
- the engineering of a L-homocysteine-producing microbial cell to reduce precursor consumption by one or more side pathways increases the L-homocysteine titer by at least 10, 20, 30, 40, 50, 60, 70, 80, or 90 percent or by at least 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 5.5-fold, 6-fold, 6.5-fold, 7-fold, 7.5-fold, 8-fold, 8.5-fold, 9-fold, 9.5-fold, 10-fold, 11-fold, 12-fold, 13-fold, 14-fold, 15-fold, 16-fold, 17-fold, 18-fold, 19-fold, 20-fold, 21-fold, 22-fold, 23-fold, 24-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95-fold, 100-
- the increase in L-homocysteine titer is in the range of 10-fold to 1000-fold, 20-fold to 500-fold, 50-fold to 400-fold, 10-fold to 300-fold, or any range bounded by any of the values listed above.
- These increases are determined relative to the L-homocysteine titer observed in a L-homocysteine-producing microbial cell that does not include genetic alterations to reduce precursor consumption.
- This reference cell may (but need not) have other genetic alterations aimed at increasing L-homocysteine production, i.e., the cell may have increased activity of an upstream pathway enzyme.
- the L-homocysteine titers achieved by reducing precursor consumption are at least 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 600, 700, 800, or 900 ⁇ g/L or at least 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, or 150 mg/L.
- the titer is in the range of 50 ⁇ g/L to 100 mg/L, 75 ⁇ g/L to 75 mg/L, 100 ⁇ g/L to 50 mg/L, 200 ⁇ g/L to 40 gm/L, 300 ⁇ g/L to 30 gm/L, 500 ⁇ g/L to 25 mg/L, 1 mg/L to 20 mg/L, or any range bounded by any of the values listed above.
- Another approach to increasing L-homocysteine production in a microbial cell that is capable of such production is to alter the cofactor specificity of an upstream pathway enzyme that typically prefers the reduced form of nicotinamide adenine dinucleotide phosphate (NADPH) to the reduced from of nicotinamide adenine dinucleotide (NADH) (see those discussed above in the Summary).
- NADPH nicotinamide adenine dinucleotide phosphate
- NADH nicotinamide adenine dinucleotide
- This can be achieved, for example, by expressing one or more variants of such enzymes that have the desired altered cofactor specificity.
- upstream pathway enzymes that rely on NADPH, and for which suitable variants are known, include aspartate semi-aldehyde dehydrogenase, homoserine dehydrogenase, and glyceraldehyde 3-phosphate dehydrogenase (GAPDH).
- aspartate semi-aldehyde dehydrogenase homoserine dehydrogenase
- GPDH glyceraldehyde 3-phosphate dehydrogenase
- the engineering of a L-homocysteine-producing microbial cell to alter the cofactor specificity of one or more of such enzymes increases the L-homocysteine titer by at least 10, 20, 30, 40, 50, 60, 70, 80, or 90 percent or by at least 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 5.5-fold, 6-fold, 6.5-fold, 7-fold, 7.5-fold, 8-fold, 8.5-fold, 9-fold, 9.5-fold, 10-fold, 11-fold, 12-fold, 13-fold, 14-fold, 15-fold, 16-fold, 17-fold, 18-fold, 19-fold, 20-fold, 21-fold, 22-fold, 23-fold, 24-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95
- the increase in L-homocysteine titer is in the range of 10-fold to 1000-fold, 20-fold to 500-fold, 50-fold to 400-fold, 10-fold to 300-fold, or any range bounded by any of the values listed above. (Ranges herein include their endpoints.) These increases are determined relative to the L-homocysteine titer observed in a L-homocysteine-producing microbial cell that lacks any increase in activity of such enzymes. This reference cell may have one or more other genetic alterations aimed at increasing L-homocysteine production.
- the L-homocysteine titers achieved by altering the cofactor specificity of one or more enzymes that typically rely on NADPH as a cofactor are at least 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 600, 700, 800, or 900 ⁇ g/L or at least 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, or 150 mg/L.
- the titer is in the range of 50 ⁇ g/L to 100 mg/L, 75 ⁇ g/L to 75 mg/L, 100 ⁇ g/L to 50 mg/L, 200 ⁇ g/L to 40 gm/L, 300 ⁇ g/L to 30 gm/L, 500 ⁇ g/L to 25 mg/L, 1 mg/L to 20 mg/L, or any range bounded by any of the values listed above.
- SEQ ID NO Cross-Reference Table AA or DNA Enzyme Description
- any microbe that can be used to express introduced genes can be engineered for fermentative production of L-homocysteine as described above.
- the microbe is one that is naturally incapable of fermentative production of L-homocysteine.
- the microbe is one that is readily cultured, such as, for example, a microbe known to be useful as a host cell in fermentative production of compounds of interest.
- Bacteria cells including gram-positive or gram-negative bacteria can be engineered as described above. Examples include, in addition to C. glutamicum cells, Bacillus subtilus, B. licheniformis, B. lentus, B. brevis, B. stearothermophilus, B. alkalophilus, B.
- amyloliquefaciens B. clausii, B. halodurans, B. megaterium, B. coagulans, B. circulans, B. lautus, B. thuringiensis, S. albus, S. lividans, S. coelicolor, S. griseus, Pseudomonas sp., P. alcaligenes, P. citrea, Lactobacilis spp. (such as L. lactis, L. plantarum ), L. grayi, E. coli, E. faecium, E. gallinarum, E. casseliflavus , and/or E. faecalis cells.
- anaerobic cells there are numerous types of anaerobic cells that can be used as microbial host cells in the methods described herein.
- the microbial cells are obligate anaerobic cells.
- Obligate anaerobes typically do not grow well, if at all, in conditions where oxygen is present. It is to be understood that a small amount of oxygen may be present, that is, there is some level of tolerance level that obligate anaerobes have for a low level of oxygen.
- Obligate anaerobes engineered as described above can be grown under substantially oxygen-free conditions, wherein the amount of oxygen present is not harmful to the growth, maintenance, and/or fermentation of the anaerobes.
- the microbial host cells used in the methods described herein can be facultative anaerobic cells. Facultative anaerobes can generate cellular ATP by aerobic respiration (e.g., utilization of the TCA cycle) if oxygen is present. However, facultative anaerobes can also grow in the absence of oxygen. Facultative anaerobes engineered as described above can be grown under substantially oxygen-free conditions, wherein the amount of oxygen present is not harmful to the growth, maintenance, and/or fermentation of the anaerobes, or can be alternatively grown in the presence of greater amounts of oxygen.
- the microbial host cells used in the methods described herein are filamentous fungal cells.
- filamentous fungal cells See, e.g., Berka & Barnett, Biotechnology Advances, (1989), 7(2):127-154).
- Examples include Trichoderma longibrachiatum, T. viride, T. koningii, T. harzianum, Penicillium sp., Humicola insolens, H. lanuginose, H. grisea, Chrysosporium sp., C. lucknowense, Gliocladium sp., Aspergillus sp. (such as A. oryzae, A. niger, A. sojae, A. japonicus, A.
- the fungal cell engineered as described above is A. nidulans, A. awamori, A. oryzae, A. aculeatus, A. niger, A. japonicus, T reesei, T. viride, F. oxysporum , or F. solani .
- Illustrative plasmids or plasmid components for use with such hosts include those described in U.S. Patent Pub. No. 2011/0045563.
- Yeasts can also be used as the microbial host cell in the methods described herein. Examples include: Saccharomyces sp., Schizosaccharomyces sp., Pichia sp., Hansenula polymorpha, Pichia stipites, Kluyveromyces marxianus, Kluyveromyces spp., Yarrowia lipolytica and Candida sp.
- Saccharomyces sp. is S. cerevisiae (See, e.g., Romanos et al., Yeast, (1992), 8(6):423-488).
- Illustrative plasmids or plasmid components for use with such hosts include those described in U.S. Pat. No. 7,659,097 and U.S. Patent Pub. No. 2011/0045563.
- the host cell can be an algal cell derived, e.g., from a green alga, red alga, a glaucophyte, a chlorarachniophyte, a euglenid, a chromista, or a dinoflagellate.
- algal cell derived e.g., from a green alga, red alga, a glaucophyte, a chlorarachniophyte, a euglenid, a chromista, or a dinoflagellate.
- Illustrative plasmids or plasmid components for use in algal cells include those described in U.S. Patent Pub. No. 2011/0045563.
- the host cell is a cyanobacterium, such as cyanobacterium classified into any of the following groups based on morphology: Chlorococcales, Pleurocapsales, Oscillatoriales, Nostocales, Synechosystic or Stigonematales (See, e.g., Lindberg et al., Metab. Eng., (2010) 12(1):70-79).
- Illustrative plasmids or plasmid components for use in cyanobacterial cells include those described in U.S. Patent Pub. Nos. 2010/0297749 and 2009/0282545 and in Intl. Pat. Pub. No. WO 2011/034863.
- Microbial cells can be engineered for fermentative L-homocysteine production using conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, and biochemistry, which are within the skill of the art. Such techniques are explained fully in the literature, see e.g., “Molecular Cloning: A Laboratory Manual,” fourth edition (Sambrook et al., 2012); “Oligonucleotide Synthesis” (M. J. Gait, ed., 1984); “Culture of Animal Cells: A Manual of Basic Technique and Specialized Applications” (R. I.
- Vectors are polynucleotide vehicles used to introduce genetic material into a cell.
- Vectors useful in the methods described herein can be linear or circular.
- Vectors can integrate into a target genome of a host cell or replicate independently in a host cell. For many applications, integrating vectors that produced stable transformants are preferred.
- Vectors can include, for example, an origin of replication, a multiple cloning site (MCS), and/or a selectable marker.
- An expression vector typically includes an expression cassette containing regulatory elements that facilitate expression of a polynucleotide sequence (often a coding sequence) in a particular host cell.
- Vectors include, but are not limited to, integrating vectors, prokaryotic plasmids, episomes, viral vectors, cosmids, and artificial chromosomes.
- Illustrative regulatory elements that may be used in expression cassettes include promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g., transcription termination signals, such as polyadenylation signals and poly-U sequences).
- promoters e.g., promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g., transcription termination signals, such as polyadenylation signals and poly-U sequences).
- IRES internal ribosomal entry sites
- transcription termination signals such as polyadenylation signals and poly-U sequences
- vectors may be used to introduce systems that can carry out genome editing, such as CRISPR systems.
- CRISPR systems See U.S. Patent Pub. No. 2014/0068797, published 6 Mar. 2014; see also Jinek M., et al., “A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity,” Science 337:816-21, 2012).
- Cas9 is a site-directed endonuclease, namely an enzyme that is, or can be, directed to cleave a polynucleotide at a particular target sequence using two distinct endonuclease domains (HNH and RuvC/RNase H-like domains).
- Cas9 can be engineered to cleave DNA at any desired site because Cas9 is directed to its cleavage site by RNA. Cas9 is therefore also described as an “RNA-guided nuclease.” More specifically, Cas9 becomes associated with one or more RNA molecules, which guide Cas9 to a specific polynucleotide target based on hybridization of at least a portion of the RNA molecule(s) to a specific sequence in the target polynucleotide.
- Ran, F. A., et al. (“In vivo genome editing using Staphylococcus aureus Cas9,” Nature 520(7546):186-91, 2015, Apr.
- Example 1 describes illustrative integration approaches for introducing polynucleotides and other genetic alterations into the genomes of C. glutamicum cells.
- Vectors or other polynucleotides can be introduced into microbial cells by any of a variety of standard methods, such as transformation, conjugation, electroporation, nuclear microinjection, transduction, transfection (e.g., lipofection mediated or DEAE-Dextrin mediated transfection or transfection using a recombinant phage virus), incubation with calcium phosphate DNA precipitate, high velocity bombardment with DNA-coated microprojectiles, and protoplast fusion.
- Transformants can be selected by any method known in the art. Suitable methods for selecting transformants are described in U.S. Patent Pub. Nos. 2009/0203102, 2010/0048964, and 2010/0003716, and International Publication Nos. WO 2009/076676, WO 2010/003007, and WO 2009/132220.
- Engineered microbial cells can have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more genetic alterations, such as 30-100 alterations, as compared to a native microbial cell, such as any of the microbial host cells described herein.
- Engineered microbial cells described in the Example below have one, two, or three genetic alterations, but those of skill in the art can, following the guidance set forth herein, design microbial cells with additional alterations.
- the engineered microbial cells have not more than 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, or 4 genetic alterations, as compared to a native microbial cell.
- microbial cells engineered for L-homocysteine production can have a number of genetic alterations falling within the any of the following illustrative ranges: 1-10, 1-9, 1-8, 2-7, 2-6, 2-5, 2-4, 2-3, 3-7, 3-6, 3-5, 3-4, etc.
- an engineered microbial cell expresses at least one heterologous gene, e.g., a 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase) gene, a sulfite reductase hemoprotein beta-component gene (sulfite reductase) gene, and/or or a sulfate adenylyltransferase subunit 1 gene (ATP sulfurylase) gene.
- PAPS reductase 3-phosphoadenosine-5-phosphosulfate sulfotransferase
- sulfite reductase hemoprotein beta-component gene sulfite reductase
- ATP sulfurylase sulfate adenylyltransferase subunit 1 gene
- the microbial cell can include and express, for example: (1) a single heterologous PAPS reductase gene, (2) two or more heterologous PAPS reductase genes, which can be the same or different (in other words, multiple copies of the same heterologous PAPS reductase gene can be introduced or multiple, different heterologous PAPS reductase genes can be introduced), (3) a single heterologous PAPS reductase gene that is not native to the cell and one or more additional copies of an native PAPS reductase gene (if applicable), or (4) two or more non-native PAPS reductase genes, which can be the same or different, and one or more additional copies of a native PAPS reductase gene (if applicable).
- heterologous genes that can be introduced into the engineered microbial cell, such as those encoding sulfite reductase and/or ATP sulfurase.
- This engineered host cell can include at least one additional genetic alteration that increases flux through any pathway leading to the production of an immediate precursor of L-homocysteine. As discussed above, this can be accomplished by one or more of the following: increasing the activity of upstream enzymes, reducing consumption of L-homocysteine precursors or of L-homocysteine itself, and altering the cofactor specificity of upstream pathway enzymes.
- the engineered host cell can express an amino acid transporter to enhance transport of L-homocysteine from inside the engineered microbial cell to the culture medium.
- the engineered microbial cells can contain introduced genes that have a native nucleotide sequence or that differ from native.
- the native nucleotide sequence can be codon-optimized for expression in a particular host cell. Codon optimization for a particular host can, for example, be based on the codon usage tables found at www.kazusa.or.jp/codon/.
- the amino acid sequences encoded by any of these introduced genes can be native or can differ from native. In various embodiments, the amino acid sequences have at least 60 percent, 70 percent, 75 percent, 80 percent, 85 percent, 90 percent, 95 percent or 100 percent amino acid sequence identity with a native amino acid sequence.
- the engineered bacterial (e.g., C. glutamicum ) cell expresses one or more heterologous 3-phosphoadenosine-5-phosphosulfate sulfotransferases (PAPS reductases) having at least 70 percent, 75 percent, 80 percent, 85 percent, 90 percent, 95 percent or 100 percent amino acid sequence identity with an PAPS reductase encoded by a C.
- PAPS reductases heterologous 3-phosphoadenosine-5-phosphosulfate sulfotransferases
- glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase gene and/or one or more heterologous sulfite reductases having at least 70 percent, 75 percent, 80 percent, 85 percent, 90 percent, 95 percent or 100 percent amino acid sequence identity with a sulfite reductase encoded by a C. glutamicum sulfite reductase hemoprotein beta-component gene; and/or or one or more heterologous sulfate adenylyltransferases (ATP sulfurases) having at least 70 percent, 75 percent, 80 percent, 85 percent, 90 percent, 95 percent or 100 percent amino acid sequence identity with an ATP sulfurase encoded by a C. glutamicum sulfate adenylyltransferase subunit 1 gene or another C. glutamicum sulfate adenylyltransferase (e.g., SEQ ID NO:7).
- the PAPS reductase encoded by the C. glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase gene includes SEQ ID NO:2;
- the sulfite reductase encoded by the C. glutamicum sulfite reductase hemoprotein beta-component gene includes SEQ ID NO:3; and/or
- the ATP sulfurase encoded by the C. glutamicum sulfate adenylyltransferase subunit 1 gene includes SEQ ID NO:1.
- the PAPS reductase encoded by the C. glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase gene includes SEQ ID NO:2;
- the sulfite reductase encoded by the C. glutamicum sulfite reductase hemoprotein beta-component gene includes SEQ ID NO:3; and/or
- the C. glutamicum sulfate adenylyltransferase includes SEQ ID NO:7.
- C. glutamicum for example, an about 4.43 mg/L titer of L-homocysteine was achieved by overexpressing the enzymes having SEQ ID NOs:2, 3, and 7 (see Example 2).
- the engineered bacterial (e.g., C. glutamicum ) cell expresses, in addition to a set of the three enzymes described in the preceding paragraphs, one or more heterologous serine O-acetyltransferases having at least 70 percent, 75 percent, 80 percent, 85 percent, 90 percent, 95 percent or 100 percent amino acid sequence identity with a serine O-acetyltransferase from Lactobacillus acidophilus ; and/or one or more heterologous homoserine dehydrogenases having at least 70 percent, 75 percent, 80 percent, 85 percent, 90 percent, 95 percent or 100 percent amino acid sequence identity with a homoserine dehydrogenase from C.
- glutamicum e.g., strain ATCC 13032/DSM 20300/JCM 1318/LMG 3730/NCIMB 10025, Uniprot ID: P08499); and/or or one or more heterologous O-acetylhomoserine aminocarboxypropyltransferases having at least 70 percent, 75 percent, 80 percent, 85 percent, 90 percent, 95 percent or 100 percent amino acid sequence identity with an O-acetylhomoserine aminocarboxypropyltransferase from Lactobacillus collinoides.
- O-acetylhomoserine aminocarboxypropyltransferase from Lactobacillus collinoides.
- the serine O-acetyltransferase includes SEQ ID NO:4;
- the homoserine dehydrogenase includes SEQ ID NO:11; and/or
- the O-acetylhomoserine aminocarboxypropyltransferase includes SEQ ID NO:6.
- Any of the microbial cells described herein can be cultured, e.g., for maintenance, growth, and/or L-homocysteine production.
- the cultures are grown to an optical density at 600 nm of 10-500, such as an optical density of 50-150.
- the cultures include produced L-homocysteine at titers of at least 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 600, 700, 800, or 900 ⁇ g/L or at least 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, or 150 mg/L.
- the titer is in the range of 50 ⁇ g/L to 100 mg/L, 75 ⁇ g/L to 75 mg/L, 100 ⁇ g/L to 50 gm/L, 200 ⁇ g/L to 25 gm/L, 300 ⁇ g/L to 10 gm/L, 350 ⁇ g/L to 5 gm/L or any range bounded by any of the values listed above.
- Microbial cells can be cultured in any suitable medium including, but not limited to, a minimal medium, i.e., one containing the minimum nutrients possible for cell growth.
- Minimal medium typically contains: (1) a carbon source for microbial growth; (2) salts, which may depend on the particular microbial cell and growing conditions; and (3) water.
- Suitable media can also include any combination of the following: a nitrogen source for growth and product formation, a sulfur source for growth, a phosphate source for growth, metal salts for growth, vitamins for growth, and other cofactors for growth.
- carbon source refers to one or more carbon-containing compounds capable of being metabolized by a microbial cell.
- the carbon source is a carbohydrate (such as a monosaccharide, a disaccharide, an oligosaccharide, or a polysaccharide), or an invert sugar (e.g., enzymatically treated sucrose syrup).
- Illustrative monosaccharides include glucose (dextrose), fructose (levulose), and galactose; illustrative oligosaccharides include dextran or glucan, and illustrative polysaccharides include starch and cellulose.
- Suitable sugars include C6 sugars (e.g., fructose, mannose, galactose, or glucose) and C5 sugars (e.g., xylose or arabinose).
- C6 sugars e.g., fructose, mannose, galactose, or glucose
- C5 sugars e.g., xylose or arabinose
- Other, less expensive carbon sources include sugar cane juice, beet juice, sorghum juice, and the like, any of which may, but need not be, fully or partially deionized.
- the salts in a culture medium generally provide essential elements, such as magnesium, nitrogen, phosphorus, and sulfur to allow the cells to synthesize proteins and nucleic acids.
- Minimal medium can be supplemented with one or more selective agents, such as antibiotics.
- the culture medium can include, and/or is supplemented during culture with, glucose and/or a nitrogen source such as urea, an ammonium salt, ammonia, or any combination thereof.
- a nitrogen source such as urea, an ammonium salt, ammonia, or any combination thereof.
- the medium can include a sulfur source that is in a reduced form, relative to sulfate, and/or the reduced sulfur source can be added to the culture during fermentation.
- the sulfur source includes a sulfide or thiosulfate.
- suitable reduced sulfur sources include sulfates, sulfites, sulfides, methylsulfonates, ametryne, prometryne, or any combinations thereof.
- cells are grown and maintained at an appropriate temperature, gas mixture, and pH (such as about 20° C. to about 37° C., about 6% to about 84% CO 2 , and a pH between about 5 to about 9). In some aspects, cells are grown at 35° C. In certain embodiments, such as where thermophilic bacteria are used as the host cells, higher temperatures (e.g., 50° C.-75° C.) may be used. In some aspects, the pH ranges for fermentation are between about pH 5.0 to about pH 9.0 (such as about pH 6.0 to about pH 8.0 or about 6.5 to about 7.0). Cells can be grown under aerobic, anoxic, or anaerobic conditions based on the requirements of the particular cell.
- Standard culture conditions and modes of fermentation such as batch, fed-batch, or continuous fermentation that can be used are described in U.S. Publ. Nos. 2009/0203102, 2010/0003716, and 2010/0048964, and International Pub. Nos. WO 2009/076676, WO 2009/132220, and WO 2010/003007.
- Batch and Fed-Batch fermentations are common and well known in the art, and examples can be found in Brock, Biotechnology: A Textbook of Industrial Microbiology, Second Edition (1989) Sinauer Associates, Inc.
- the cells are cultured under limited sugar (e.g., glucose) conditions.
- the amount of sugar that is added is less than or about 105% (such as about 100%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, or 10%) of the amount of sugar that can be consumed by the cells.
- the amount of sugar that is added to the culture medium is approximately the same as the amount of sugar that is consumed by the cells during a specific period of time.
- the rate of cell growth is controlled by limiting the amount of added sugar such that the cells grow at the rate that can be supported by the amount of sugar in the cell medium.
- sugar does not accumulate during the time the cells are cultured.
- the cells are cultured under limited sugar conditions for times greater than or about 1, 2, 3, 5, 10, 15, 20, 25, 30, 35, 40, 50, 60, or 70 hours or even up to about 5-10 days. In various embodiments, the cells are cultured under limited sugar conditions for greater than or about 5, 10, 15, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 95, or 100% of the total length of time the cells are cultured. While not intending to be bound by any particular theory, it is believed that limited sugar conditions can allow more favorable regulation of the cells.
- the cells are grown in batch culture.
- the cells can also be grown in fed-batch culture or in continuous culture.
- the cells can be cultured in minimal medium, including, but not limited to, any of the minimal media described above.
- the minimal medium can be further supplemented with 1.0% (w/v) glucose (or any other six-carbon sugar) or less.
- the minimal medium can be supplemented with 1% (w/v), 0.9% (w/v), 0.8% (w/v), 0.7% (w/v), 0.6% (w/v), 0.5% (w/v), 0.4% (w/v), 0.3% (w/v), 0.2% (w/v), or 0.1% (w/v) glucose.
- sugar levels e.g., glucose
- the sugar levels falls within a range of any two of the above values, e.g.: 0.1-10% (w/v), 1.0-20% (w/v), 10-70% (w/v), 20-60% (w/v), or 30-50% (w/v).
- different sugar levels can be used for different phases of culturing. For fed-batch culture (e.g., of S. cerevisiae or C. glutamicum ), the sugar level can be about 100-200 g/L (10-20% (w/v)) in the batch phase and then up to about 500-700 g/L (50-70% in the feed).
- the minimal medium can be supplemented 0.1% (w/v) or less yeast extract. Specifically, the minimal medium can be supplemented with 0.1% (w/v), 0.09% (w/v), 0.08% (w/v), 0.07% (w/v), 0.06% (w/v), 0.05% (w/v), 0.04% (w/v), 0.03% (w/v), 0.02% (w/v), or 0.01% (w/v) yeast extract.
- the minimal medium can be supplemented with 1% (w/v), 0.9% (w/v), 0.8% (w/v), 0.7% (w/v), 0.6% (w/v), 0.5% (w/v), 0.4% (w/v), 0.3% (w/v), 0.2% (w/v), or 0.1% (w/v) glucose and with 0.1% (w/v), 0.09% (w/v), 0.08% (w/v), 0.07% (w/v), 0.06% (w/v), 0.05% (w/v), 0.04% (w/v), 0.03% (w/v), or 0.02% (w/v) yeast extract.
- yeast extract In some cultures, significantly higher levels of yeast extract can be used, e.g., at least 1.5% (w/v), 2.0% (w/v), 2.5% (w/v), or 3% (w/v). In some cultures (e.g., of S. cerevisiae or C. glutamicum ), the yeast extract level falls within a range of any two of the above values, e.g.: 0.5-3.0% (w/v), 1.0-2.5% (w/v), or 1.5-2.0% (w/v).
- Example 1 Illustrative materials and methods suitable for the maintenance and growth of the engineered microbial cells described herein can be found below in Example 1.
- any of the methods described herein may further include a step of recovering L-homocysteine.
- the produced L-homocysteine contained in a so-called harvest stream is recovered/harvested from the production vessel.
- the harvest stream may include, for instance, cell-free or cell-containing aqueous solution coming from the production vessel, which contains L-homocysteine as a result of the conversion of production substrate by the resting cells in the production vessel.
- Cells still present in the harvest stream may be separated from the L-homocysteine by any operations known in the art, such as for instance filtration, centrifugation, decantation, membrane crossflow ultrafiltration or microfiltration, tangential flow ultrafiltration or microfiltration or dead-end filtration. After this cell separation operation, the harvest stream is essentially free of cells.
- Steps of separation and/or purification of the produced L-homocysteine from other components contained in the harvest stream may optionally be carried out.
- These steps may include any means known to a skilled person, such as, for instance, concentration, extraction, crystallization, precipitation, adsorption, ion exchange, and/or chromatography. Any of these procedures can be used alone or in combination to purify L-homocysteine.
- Further purification steps can include one or more of, e.g., concentration, crystallization, precipitation, washing and drying, treatment with activated carbon, ion exchange, nanofiltration, and/or re-crystallization.
- concentration, crystallization, precipitation, washing and drying, treatment with activated carbon, ion exchange, nanofiltration, and/or re-crystallization may depend on the cells, the culture medium, the size of the culture, the production vessel, etc. and is within the level of skill in the art.
- Plasmid designs were specific to each of the host organisms engineered in this work.
- the plasmid DNA was physically constructed by a standard DNA assembly method. This plasmid DNA was then used to integrate metabolic pathway inserts by one of two host-specific methods, each described below.
- FIG. 10 illustrates genomic integration of loop-in only and loop-in/loop-out constructs and verification of correct integration via colony PCR.
- Loop-in only constructs contained a single 2-kb homology arm (denoted as “integration locus”), a positive selection marker (denoted as “Marker”)), and gene(s) of interest (denoted as “promoter-gene-terminator”).
- a single crossover event integrated the plasmid into the C. glutamicum or B. subtilis chromosome.
- Integration events are stably maintained in the genome by growth in the presence of antibiotic (25 ⁇ g/ml kanamycin). Correct genomic integration in colonies derived from loop-in integration were confirmed by colony PCR with UF/IR and DR/IF PCR primers.
- FIG. 7 illustrates genomic integration of complementary, split-marker plasmids and verification of correct genomic integration via colony PCR in S. cerevisiae .
- Two plasmids with complementary 5′ and 3′ homology arms and overlapping halves of a URA3 selectable marker (direct repeats shown by the hashed bars) were digested with meganucleases and transformed as linear fragments.
- a triple-crossover event integrated the desired heterologous genes into the targeted locus and re-constituted the full URA3 gene.
- Colonies derived from this integration event were assayed using two 3-primer reactions to confirm both the 5′ and 3′ junctions (UF/IF/wt-R and DR/IF/wt-F).
- the strains can be plated on 5-FOA plates to select for the removal of URA3, leaving behind a small single copy of the original direct repeat.
- This genomic integration strategy can be used for gene knock-out, gene knock-in, and promoter titration in the same workflow.
- the workflow established for S. cerevisiae involved a hit-picking step that consolidated successfully built strains using an automated workflow that randomized strains across the plate. For each strain that was successfully built, up to four replicates were tested from distinct colonies to test colony-to-colony variation and other process variation. If fewer than four colonies were obtained, the existing colonies were replicated so that at least four wells were tested from each desired genotype.
- the colonies were consolidated into 96-well plates with selective medium (SD-ura for S. cerevisiae ) and cultivated for two days until saturation and then frozen with 16.6% glycerol at ⁇ 80° C. for storage.
- the frozen glycerol stocks were then used to inoculate a seed stage in minimal media with a low level of amino acids to help with growth and recovery from freezing.
- the seed plates were grown at 30° C. for 1-2 days.
- the seed plates were then used to inoculate a main cultivation plate with minimal medium and grown for 48-88 hours. Plates were removed at the desired time points and tested for cell density (OD600), viability and glucose, supernatant samples stored for LC-MS analysis for product of interest.
- Cell density was measured using a spectrophotometric assay detecting absorbance of each well at 600 nm. Robotics were used to transfer fixed amounts of culture from each cultivation plate into an assay plate, followed by mixing with 175 mM sodium phosphate (pH 7.0) to generate a 10-fold dilution. The assay plates were measured using a Tecan M1000 spectrophotometer and assay data uploaded to a LIMS database. A non-inoculated control was used to subtract background absorbance. Cell growth was monitored by inoculating multiple plates at each stage, and then sacrificing an entire plate at each time point.
- each plate was shaken for 10-15 seconds before each read. Wide variations in cell density within a plate may also lead to absorbance measurements outside of the linear range of detection, resulting in underestimate of higher OD cultures. In general, the tested strains so far have not varied significantly enough for this be a concern.
- Strategies for enhancing fermentative production of L-homocysteine in engineered microbes include one or more of the following:
- C. glutamicum strain 7000139229 (CgHMCYS_12) was engineered to overproduce L-homocysteine.
- Strain 7000139229 by integration of Zymergen plasmid 13000234177 into the genome of publicly available C. glutamicum strain NRRL B-4263.
- Zymergen plasmid 13000234177 overexpresses the following: sulfate adenylyltransferase (ATP sulfurylase) subunit 1 gene from C. glutamicum (SEQ ID NO:1), 3-phosphoadenosine-5-phosphposulfate sulfotransferase (PAPS reductase) gene from C.
- glutamicum SEQ ID NO: 2
- SEQ ID NO:3 sulfite reductase hemoprotein beta-component gene from C. glutamicum
- FIG. 2 shows different fed-batch fermentation process configurations that started with a batch phase at 10 gm/L sugar, followed by a feed phase in which sugar (200 gm/L) is fed to the culture via different strategies. This approach achieved an increase cell density to OD 600 50-60 and gave an L-homocysteine titer of ⁇ 18 mg/L.
- CgHMCYS_56 was a C. glutamicum strain designed to express three enzymes: sulfate adenylyltransferase from C. glutamicum (SEQ ID NO:7), 5′-phosphosulfate sulfotransferase (PAPS reductase) from C. glutamicum (SEQ ID NO:2), sulfite reductase from C. glutamicum (SEQ ID NO: 3).
- This strain gave an L-homocysteine titer of 4.43 mg/L of culture medium.
- CgHMCYS_127 was a C. glutamicum strain that expressed the same three enzymes as CgHMCYS_56 and additionally expressed the following enzymes: serine O-acetyltransferase from Lactobacillus acidophilus (Uniprot ID: A0A1D3PCK2) (SEQ ID NO:4), homoserine dehydrogenase from C.
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Physics & Mathematics (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The present disclosure describes the engineering of microbial cells for fermentative production of L-homocysteine and provides novel engineered microbial cells and cultures, as well as related L-homocysteine production methods.
Description
- This application claims the benefit of U.S. provisional application No. 62/824,220, filed Mar. 26, 2019, which is hereby incorporated by reference in its entirety.
- This invention was made with Government support under Agreement No. HR0011-15-9-0014, awarded by DARPA. The Government has certain rights in the invention.
- This application includes a sequence listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. This ASCII copy, created on Mar. 24, 2020, is named ZMGNP023WO_SeqList_ST25.txt. and is 32,589 bytes in size.
- The present disclosure relates generally to the area of engineering microbes for production of L-homocysteine by fermentation.
- Homocysteine is a non-proteinogenic α-amino acid. It is a homologue of the amino acid cysteine, differing by an additional methylene bridge (—CH2—). It is produced from methionine by the removal of its terminal Cε methyl group. Homocysteine can be recycled into methionine or converted into cysteine with the aid of certain B-vitamins Homocysteine also acts as an allosteric antagonist at Dopamine D2 receptors.
- The disclosure provides engineered microbial cells, cultures of the microbial cells, and methods for the production of L-homocysteine, including the following:
- Embodiment 1: An engineered microbial cell that includes increased activity of at least one upstream pathway enzyme leading to L-homocysteine, wherein the at least one upstream pathway enzyme is selected from the group consisting of: (a) 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase); (b) sulfite reductase, and (c) sulfate adenylyltransferase (ATP sulfurase), said increased activity being increased relative to a control cell, wherein the engineered microbial cell produces L-homocysteine.
- Embodiment 2: The engineered microbial cell of
embodiment 1, wherein the engineered microbial cell expresses at least two of said upstream pathway enzymes, wherein the at least two upstream pathway enzymes are selected from the group consisting of: (a) a 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase) and a sulfite reductase; (b) a sulfite reductase and a sulfate adenylyltransferase (ATP sulfurase); and (c) a 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase) and a sulfate adenylyltransferase (ATP sulfurase). - Embodiment 3: The engineered microbial cell of
embodiment 1 orembodiment 2, wherein said upstream pathway enzymes are heterologous enzymes. - Embodiment 4: The engineered microbial cell of
embodiment 3, wherein the engineered microbial cell expresses: (a) a heterologous 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase); (b) a heterologous sulfite reductase, and (c) a heterologous sulfate adenylyltransferase (ATP sulfurase). - Embodiment 5: The engineered microbial cell of any one of embodiments 1-4, wherein the engineered microbial cell includes increased activity of one or more additional upstream pathway enzyme(s) leading to L-homocysteine that is/are selected from the group consisting of phosphoadenosine phosphosulfate reductase (PAPS reductase), and homocysteine synthase, said increased activity being increased relative to a control cell.
- Embodiment 6: The engineered microbial cell of any one of embodiments 1-5, wherein the engineered microbial cell includes increased activity of a sulfate transporter, said increased activity being increased relative to a control cell.
- Embodiment 7: The engineered microbial cell of any one of embodiments 1-6, wherein the engineered microbial cell includes increased activity of one or more upstream pathway enzymes leading to O-acetyl-L-homoserine, said increased activity being increased relative to a control cell.
- Embodiment 8: The engineered microbial cell of
embodiment 7, wherein the one or more upstream pathway enzymes leading to O-acetyl-L-homoserine is/are selected from the group consisting of phosphoenolpyruvate carboxykinase (PEP carboxykinase), pyruvate kinase, pyruvate carboxylase, glutamate dehydrogenase, aspartate transaminase (aspartate aminotransferase), aspartate kinase (aspartokinase), aspartate-semialdehyde dehydrogenase, homoserine dehydrogenase, and L-homoserine-O-acetyltransferase. - Embodiment 9: The engineered microbial cell of
embodiment 8, the one or more upstream pathway enzymes leading to O-acetyl-L-homoserine includes PEP carboxykinase, and the activity of pyruvate carboxylase is reduced relative to a control cell. - Embodiment 10: The engineered microbial cell of any one of embodiments 1-9, wherein the activity of malate dehydrogenase is reduced relative to a control cell.
- Embodiment 11: The engineered microbial cell of any one of embodiments 1-10, wherein the activity of the one or more upstream pathway enzymes is increased by expressing one or more feedback-deregulated enzyme(s).
- Embodiment 12: The engineered microbial cell of
embodiment 11, where the one or more feedback-deregulated enzyme (s) is/are selected from the group consisting of a feedback-deregulated aspartate kinase, a feedback-deregulated homoserine dehydrogenase, a feedback-deregulated aspartate-semialdehyde dehydrogenase, and a feedback-deregulated pyruvate carboxylase. - Embodiment 13: The engineered microbial cell of any one of embodiments 1-10, wherein the activity of the one or more upstream pathway enzymes is increased by expressing one or more upstream pathway enzyme(s) that is/are normally subject to feedback inhibition at the transcriptional level so as to reduce said feedback inhibition at the transcriptional level.
- Embodiment 14: The engineered microbial cell of
embodiment 13, wherein reduced feedback inhibition at the transcriptional level is achieved by a method including expressing aspartate kinase from a constitutive promoter. - Embodiment 15: The engineered microbial cell of any one of embodiments 1-14, wherein the engineered microbial cell includes reduced activity of one or more enzyme(s) that consume one or more upstream pathway precursors, said reduced activity being reduced relative to a control cell.
- Embodiment 16: The engineered microbial cell of
embodiment 15, wherein the one or more enzyme(s) that consume one or more upstream pathway precursors is/are selected from the group consisting of cystathionine gamma-synthase, homoserine kinase, and L-homoserine succinyl transferase. - Embodiment 17: The engineered microbial cell of any one of embodiments 1-16, wherein the engineered microbial cell includes reduced activity of one or more enzyme(s) that consume L-homocysteine, said reduced activity being reduced relative to a control cell.
- Embodiment 18: The engineered microbial cell of
embodiment 17, wherein the one or more enzyme(s) that consume L-homocysteine is/are selected from the group consisting of cystathionine beta-synthase and methionine synthase. - Embodiment 19: The engineered microbial cell of any one of embodiments 15-18, wherein the reduced activity is achieved by one or more means selected from the group consisting of gene deletion, gene disruption, altering regulation of a gene, and replacing a native promoter with a less active promoter.
- Embodiment 20: The engineered microbial cell of any one of embodiments 1-19, wherein the engineered microbial cell includes reduced activity of one or more upstream pathway enzymes leading to cysteine, said reduced activity being reduced relative to a control cell.
- Embodiment 21: The engineered microbial cell of
embodiment 20, wherein the one or more upstream pathway enzymes leading to cysteine is/are selected from the group consisting of 3-phosphoglycerate dehydrogenase, phosphoserine transaminase, phosphoserine phosphatase, serine-O-acetyltransferase, and cysteine synthase. - Embodiment 22: The engineered microbial cell of any of embodiments 1-21, wherein the engineered microbial cell includes altered cofactor specificity of one or more upstream pathway enzyme(s) from the reduced form of nicotinamide adenine dinucleotide phosphate (NADPH) to the reduced from of nicotinamide adenine dinucleotide (NADH).
- Embodiment 23: The engineered microbial cell of embodiment 22, wherein the one or more upstream pathway enzyme(s) whose cofactor specificity is altered is/are selected from the group consisting of aspartate semi-aldehyde dehydrogenase, PAPS reductase, and sulfite reductase.
- Embodiment 24: An engineered microbial cell that includes means for increasing the activity of at least one upstream pathway enzyme leading to L-homocysteine, wherein the at least one upstream pathway enzyme is selected from the group consisting of: (a) 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase); (b) sulfite reductase, and (c) sulfate adenylyltransferase (ATP sulfurase), said increased activity being increased relative to a control cell, wherein the engineered microbial cell produces L-homocysteine.
- Embodiment 25: The engineered microbial cell of embodiment 24, wherein the engineered microbial cell includes means for expressing at least two of said upstream pathway enzymes, wherein the at least two upstream pathway enzymes are selected from the group consisting of: (a) a 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase) and a sulfite reductase; (b) a sulfite reductase and a sulfate adenylyltransferase (ATP sulfurase); and (c) a 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase) and a sulfate adenylyltransferase (ATP sulfurase).
- Embodiment 26: The engineered microbial cell of embodiment 24 or embodiment 25, wherein said upstream pathway enzymes are heterologous enzymes.
- Embodiment 27: The engineered microbial cell of embodiment 26, wherein the engineered microbial cell includes means for expressing: (a) a heterologous 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase); (b) a heterologous sulfite reductase, and (c) a heterologous sulfate adenylyltransferase (ATP sulfurase).
- Embodiment 28: The engineered microbial cell of any one of embodiments 24-27, wherein the engineered microbial cell includes means for increasing the activity of one or more additional upstream pathway enzyme(s) leading to L-homocysteine that is/are selected from the group consisting of phosphoadenosine phosphosulfate reductase (PAPS reductase) and homocysteine synthase, said increased activity being increased relative to a control cell.
- Embodiment 29: The engineered microbial cell of any one of embodiments 24-28, wherein the engineered microbial cell includes means for increasing the activity of a sulfate transporter, said increased activity being increased relative to a control cell.
- Embodiment 30: The engineered microbial cell of any one of embodiments 24-29, wherein the engineered microbial cell includes means for increasing the activity of one or more upstream pathway enzymes leading to O-acetyl-L-homoserine, said increased activity being increased relative to a control cell.
- Embodiment 31: The engineered microbial cell of embodiment 30, wherein the one or more upstream pathway enzymes leading to O-acetyl-L-homoserine is/are selected from the group consisting of phosphoenolpyruvate carboxykinase (PEP carboxykinase), pyruvate kinase, pyruvate carboxylase, glutamate dehydrogenase, aspartate transaminase (aspartate aminotransferase), aspartate kinase (aspartokinase), aspartate-semialdehyde dehydrogenase, homoserine dehydrogenase, and L-homoserine-O-acetyltransferase.
- Embodiment 32: The engineered microbial cell of embodiment 31, the one or more upstream pathway enzymes leading to O-acetyl-L-homoserine includes PEP carboxykinase, and the engineered microbial cell includes means for reducing the activity of pyruvate carboxylase relative to a control cell.
- Embodiment 33: The engineered microbial cell of any one of embodiments 24-32, wherein the engineered microbial cell includes means for reducing the activity of malate dehydrogenase relative to a control cell.
- Embodiment 34: The engineered microbial cell of any one of embodiments 24-33, wherein the engineered microbial cell includes means for expressing one or more feedback-deregulated enzyme(s).
- Embodiment 35: The engineered microbial cell of embodiment 34, where the one or more feedback-deregulated enzyme (s) is/are selected from the group consisting of a feedback-deregulated aspartate kinase, a feedback-deregulated homoserine dehydrogenase, a feedback-deregulated aspartate-semialdehyde dehydrogenase, and a feedback-deregulated pyruvate carboxylase.
- Embodiment 36: The engineered microbial cell of any one of embodiments 24-33, wherein the activity of the one or more upstream pathway enzymes is increased by expressing one or more upstream pathway enzyme(s) that is/are normally subject to feedback inhibition at the transcriptional level so as to reduce said feedback inhibition at the transcriptional level.
- Embodiment 37: The engineered microbial cell of embodiment 36, wherein reduced feedback inhibition at the transcriptional level is achieved by a method including expressing aspartate kinase from a constitutive promoter.
- Embodiment 38: The engineered microbial cell of any one of embodiments 24-37, wherein the engineered microbial cell includes means for reducing the activity of one or more enzyme(s) that consume one or more upstream pathway precursors, said reduced activity being reduced relative to a control cell.
- Embodiment 39: The engineered microbial cell of embodiment 38, wherein the one or more enzyme(s) that consume one or more upstream pathway precursors is/are selected from the group consisting of cystathionine gamma-synthase, homoserine kinase, and L-homoserine succinyl transferase.
- Embodiment 40: The engineered microbial cell of any one of embodiments 24-39, wherein the engineered microbial cell includes means for reducing the activity of one or more enzyme(s) that consume(s) L-homocysteine, said reduced activity being reduced relative to a control cell.
- Embodiment 41: The engineered microbial cell of
embodiment 40, wherein the one or more enzyme(s) that consume L-homocysteine is/are selected from the group consisting of cystathionine beta-synthase and methionine synthase. - Embodiment 42: The engineered microbial cell of any one of embodiments 24-41, wherein the engineered microbial cell includes means for reducing the activity of one or more upstream pathway enzymes leading to cysteine, said reduced activity being reduced relative to a control cell.
- Embodiment 43: The engineered microbial cell of embodiment 42, wherein the one or more upstream pathway enzymes leading to cysteine is/are selected from the group consisting of 3-phosphoglycerate dehydrogenase, phosphoserine transaminase, phosphoserine phosphatase, serine-O-acetyltransferase, and cysteine synthase.
- Embodiment 44: The engineered microbial cell of any of embodiments 24-43, wherein the engineered microbial cell includes means for altering the cofactor specificity of one or more upstream pathway enzyme(s) from the reduced form of nicotinamide adenine dinucleotide phosphate (NADPH) to the reduced from of nicotinamide adenine dinucleotide (NADH).
- Embodiment 45: The engineered microbial cell of embodiment 44, wherein the one or more upstream pathway enzyme(s) whose cofactor specificity is altered is/are selected from the group consisting of aspartate semi-aldehyde dehydrogenase, PAPS reductase, and sulfite reductase.
- Embodiment 46: The engineered microbial cell of any one of embodiments 1-45, wherein the engineered microbial cell is a bacterial cell.
- Embodiment 47: The engineered microbial cell of embodiment 46, wherein the bacterial cell is a cell of the genus Corynebacteria.
- Embodiment 48: The engineered microbial cell of embodiment 47, wherein the bacterial cell is a cell of the species glutamicum.
- Embodiment 49: The engineered microbial cell of embodiment 48, wherein the engineered microbial cell includes a heterologous 3-phosphoadenosine-5-phosphposulfate sulfotransferase (PAPS reductase) having at least 70% amino acid sequence identity with a Corynebacteria glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase (PAPS reductase) including SEQ ID NO:2.
- Embodiment 50: The engineered microbial cell of embodiment 48 or embodiment 49, wherein the engineered microbial cell additionally includes a heterologous sulfite reductase having at least 70% amino acid sequence identity with a Corynebacteria glutamicum sulfite reductase hemoprotein beta-component including SEQ ID NO:3.
- Embodiment 51: The engineered microbial cell of any one of embodiments 48-50, wherein the engineered microbial cell additionally includes a heterologous sulfate adenylyltransferase (ATP sulfurase) having at least 70% amino acid sequence identity with a Corynebacteria glutamicum sulfate adenylyltransferase subunit 1 including SEQ ID NO:1.
- Embodiment 52: The engineered microbial cell of embodiment 51, wherein the engineered microbial cell is a Corynebacteria glutamicum cell that expresses: (a) a heterologous Corynebacteria glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase (PAPS reductase) including SEQ ID NO:2; (b) a heterologous Corynebacteria glutamicum sulfite reductase hemoprotein beta-component including SEQ ID NO:3; and (c) a heterologous Corynebacteria glutamicum sulfate adenylyltransferase subunit 1 including SEQ ID NO:1.
- Embodiment 52-1: The engineered microbial cell of embodiment 51, wherein the engineered microbial cell is a Corynebacteria glutamicum cell that expresses: (a) a heterologous Corynebacteria glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase (PAPS reductase) including SEQ ID NO:2; (b) a heterologous Corynebacteria glutamicum sulfite reductase hemoprotein beta-component including SEQ ID NO:3; and (c) a heterologous Corynebacteria glutamicum sulfate adenylyltransferase including SEQ ID NO:7.
- Embodiment 52-2: The engineered microbial cell of embodiment 52-1, wherein the engineered microbial cell additionally expresses: (a) a heterologous Lactobacillus acidophilus serine O-acetyltransferase comprising SEQ ID NO:4; (b) a heterologous Corynebacteria glutamicum homoserine dehydrogenase comprising SEQ ID NO:11; and (c) a heterologous Lactobacillus collinoides O-acetylhomoserine aminocarboxypropyltransferase comprising SEQ ID NO:6.
- Embodiment 53: The engineered microbial cell of any one of embodiments 1-52, wherein, when cultured, the engineered microbial cell produces L-homocysteine at a level of at least 5 mg/L of culture medium.
- Embodiment 54: The engineered microbial cell of embodiment 53, wherein, when cultured, the engineered microbial cell produces L-homocysteine at a level of at least 15 mg/L of culture medium.
- Embodiment 55: A culture of engineered microbial cells according to any one of embodiments 1-54.
- Embodiment 56: The culture of embodiment 55, wherein the culture includes a sulfur source that is in a reduced form, relative to sulfate.
- Embodiment 57: The culture of embodiment 56, wherein the sulfur source includes a sulfur source selected from the group consisting of a sulfide, a thiosulfate, a methylsulfonate, an ametryne, a prometryne, and any combination thereof.
- Embodiment 58: The culture of any one of embodiments 55-57, wherein the substrate includes a carbon source and a nitrogen source selected from the group consisting of urea, an ammonium salt, ammonia, and any combination thereof.
- Embodiment 59: The culture of any one of embodiments 55-58, wherein the engineered microbial cells are present in a concentration such that the culture has an optical density at 600 nm of 10-500.
- Embodiment 60: The culture of any one of embodiments 55-59, wherein the culture includes L-homocysteine.
- Embodiment 61: The culture of any one of embodiments 55-60, wherein the culture includes L-homocysteine at a level of at least 15 mg/L of culture medium.
- Embodiment 62: A method of culturing engineered microbial cells according to any one of embodiments 1-54, the method including culturing the cells under conditions suitable for producing L-homocysteine.
- Embodiment 63: The method of embodiment 62, wherein the method includes culturing the engineered microbial cells in the presence of a sulfur source that is in a reduced form, relative to sulfate.
- Embodiment 64: The culture of embodiment 63, wherein the sulfur source includes a sulfur source selected from the group consisting of a sulfide, a thiosulfate, a methylsulfonate, an ametryne, a prometryne, and any combination thereof.
- Embodiment 65: The method of any one of embodiments 62-64, wherein the method includes fed-batch culture, with an initial glucose level in the range of 1-100 g/L, followed by controlled sugar feeding.
- Embodiment 66: The method of any one of embodiments 62-65, wherein the fermentation substrate includes glucose and a nitrogen source selected from the group consisting of urea, an ammonium salt, ammonia, and any combination thereof.
- Embodiment 67: The method of any one of embodiments 62-66, wherein the culture is pH-controlled during culturing.
- Embodiment 68: The method of any one of embodiments 62-67, wherein the culture is aerated during culturing.
- Embodiment 69: The method of any one of embodiments 62-68, wherein the engineered microbial cells produce L-homocysteine at a level of at least 15 mg/L of culture medium.
- Embodiment 70: The method of any one of embodiments 62-69, wherein the method additionally includes recovering L-homocysteine from the culture.
-
FIG. 1 : Biosynthetic pathway for L-homocysteine. -
FIG. 2 : Fermentation processes for producing L-homocysteine in engineered strains of Corynebacteria glutamicum. (See also Example 1.) -
FIG. 3 : Integration of Promoter-Gene-Terminator into Saccharomyces cerevisiae and Yarrowia lipolytica. -
FIG. 4 : Promoter replacement in Saccharomyces cerevisiae and Yarrowia lipolytica. -
FIG. 5 : Targeted gene deletion in Saccharomyces cerevisiae and Yarrowia lipolytica. -
FIG. 6 : Integration of Promoter-Gene-Terminator into Corynebacteria glutamicum and Bacillus subtilis. - This disclosure describes a method for the production of the small molecule L-homocysteine via fermentation by a microbial host from simple carbon and nitrogen sources, such as glucose and urea, respectively. In the work described herein, a titer of about 18 mg/L L-homocysteine was achieved in engineered Corynebacteria glutamicum.
- Terms used in the claims and specification are defined as set forth below unless otherwise specified.
- The term “fermentation” is used herein to refer to a process whereby a microbial cell converts one or more substrate(s) into a desired product (such as L-homocysteine) by means of one or more biological conversion steps, without the need for any chemical conversion step.
- The term “engineered” is used herein, with reference to a cell, to indicate that the cell contains at least one targeted genetic alteration introduced by man that distinguishes the engineered cell from the naturally occurring cell.
- The term “native” is used herein to refer to a cellular component, such as a polynucleotide or polypeptide, that is naturally present in a particular cell. A native polynucleotide or polypeptide is endogenous to the cell.
- When used with reference to a polynucleotide or polypeptide, the term “non-native” refers to a polynucleotide or polypeptide that is not naturally present in a particular cell.
- When used with reference to the context in which a gene is expressed, the term “non-native” refers to a gene expressed in any context other than the genomic and cellular context in which it is naturally expressed. A gene expressed in a non-native manner may have the same nucleotide sequence as the corresponding gene in a host cell, but may be expressed from a vector or from an integration point in the genome that differs from the locus of the native gene.
- The term “heterologous” is used herein to describe a polynucleotide or polypeptide introduced into a host cell. This term encompasses a polynucleotide or polypeptide, respectively, derived from a different organism, species, or strain than that of the host cell. In this case, the heterologous polynucleotide or polypeptide has a sequence that is different from any sequence(s) found in the same host cell. However, the term also encompasses a polynucleotide or polypeptide that has a sequence that is the same as a sequence found in the host cell, wherein the polynucleotide or polypeptide is present in a different context than the native sequence (e.g., a heterologous polynucleotide can be linked to a different promotor and inserted into a different genomic location than that of the native sequence). “Heterologous expression” thus encompasses expression of a sequence that is non-native to the host cell, as well as expression of a sequence that is native to the host cell in a non-native context.
- As used with reference to polynucleotides or polypeptides, the term “wild-type” refers to any polynucleotide having a nucleotide sequence, or polypeptide having an amino acid, sequence present in a polynucleotide or polypeptide from a naturally occurring organism, regardless of the source of the molecule; i.e., the term “wild-type” refers to sequence characteristics, regardless of whether the molecule is purified from a natural source; expressed recombinantly, followed by purification; or synthesized. The term “wild-type” is also used to denote naturally occurring cells.
- A “control cell” is a cell that is otherwise identical to an engineered cell being tested, including being of the same genus and species as the engineered cell, but lacks the specific genetic modification(s) being tested in the engineered cell.
- Enzymes are identified herein by the reactions they catalyze and, unless otherwise indicated, refer to any polypeptide capable of catalyzing the identified reaction. Unless otherwise indicated, enzymes may be derived from any organism and may have a native or mutated amino acid sequence. As is well known, enzymes may have multiple functions and/or multiple names, sometimes depending on the source organism from which they derive. The enzyme names used herein encompass orthologs, including enzymes that may have one or more additional functions or a different name.
- The term “feedback-deregulated” is used herein with reference to an enzyme that is normally negatively regulated by a downstream product of the enzymatic pathway (i.e., feedback-inhibition) in a particular cell. In this context, a “feedback-deregulated” enzyme is a form of the enzyme that is less sensitive to feedback-inhibition than the enzyme native to the cell or a form of the enzyme that is native to the cell, but is naturally less sensitive to feedback inhibition than one or more other natural forms of the enzyme. A feedback-deregulated enzyme may be produced by introducing one or more mutations into a native enzyme. Alternatively, a feedback-deregulated enzyme may simply be a heterologous, native enzyme that, when introduced into a particular microbial cell, is not as sensitive to feedback-inhibition as the native, native enzyme. In some embodiments, the feedback-deregulated enzyme shows no feedback-inhibition in the microbial cell.
- The term “L-homocysteine” refers to a chemical compound of the formula C4H9NO2S also known as “2-amino-4-sulfanylbutanoic acid” (CAS #6027-13-0 [L-isomer]).
- The term “sequence identity,” in the context of two or more amino acid or nucleotide sequences, refers to two or more sequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection.
- For sequence comparison to determine percent nucleotide or amino acid sequence identity, typically one sequence acts as a “reference sequence,” to which a “test” sequence is compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence relative to the reference sequence, based on the designated program parameters. Alignment of sequences for comparison can be conducted using BLAST set to default parameters.
- The term “titer,” as used herein, refers to the mass of a product (e.g., L-homocysteine) produced by a culture of microbial cells divided by the culture volume.
- As used herein with respect to recovering L-homocysteine from a cell culture, “recovering” refers to separating the L-homocysteine from at least one other component of the cell culture medium.
- L-Homocysteine Biosynthesis Pathway
- L-homocysteine can be produced in one enzymatic step, requiring either the enzyme L-homocysteine synthase or the enzyme cystathionine gamma-lyase. The L-homocysteine biosynthesis pathway is shown in
FIG. 1 . Not all microbes have these enzymes. For example, homocysteine synthases have been identified in Corynebacteria glutamicum and Saccharomyces cerevisiae, whereas this enzyme is absent in Bacillus subtilis. Cystathionine gamma-lyases are naturally present in B. subtilis, S. cerevisiae, and Y. lipolytica, but absent in C. glutamicum. L-homocysteine production can be enabled in a host that does not naturally produce it, or potentially improved in one that does, by the addition of one or more L-homocysteine synthases and/or one or more cystathionine gamma-lyases. - Engineering for Microbial L-Homocysteine Production
- Any L-homocysteine synthase and/or cystathionine gamma-lyase that is active in the microbial cell being engineered may be introduced into the cell, typically by introducing and expressing the gene(s) encoding the enzyme(s)s using standard genetic engineering techniques. Suitable L-homocysteine beta-synthases and/or cystathionine gamma-lyases may be derived from any source, including plant, archaeal, fungal, gram-positive bacterial, and gram-negative bacterial sources.
- One or more copies of any of these genes can be introduced into a selected microbial host cell. If more than one copy of a gene is introduced, the copies can have the same or different nucleotide sequences. In some embodiments, one or both (or all) of the heterologous gene(s) is/are expressed from a strong, constitutive promoter. In some embodiments, the heterologous gene(s) is/are expressed from an inducible promoter. The heterologous gene(s) can optionally be codon-optimized to enhance expression in the selected microbial host cell. The codon-optimization tables used in the Examples are as follows: Bacillus subtilis Kazusa codon table: www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=1423&aa=1&style=N; Yarrowia lipolytica Kazusa codon table: www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=4952&aa=1&style=N; Corynebacteria glutamicum Kazusa codon table: www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=340322&aa=1&style=N; Saccharomyces cerevisiae Kazusa codon table: www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=4932&aa=1&style=N. Also used, was a modified, combined codon usage scheme for S. cereviae and C. glutamicum, which is reproduced below.
-
Modified Codon Usage Table for Sc and Cg Amino Acid Codon Fraction A GCG 0.22 A GCA 0.29 A GCT 0.24 A GCC 0.25 C TGT 0.36 C TGC 0.64 D GAT 0.56 D GAC 0.44 E GAG 0.44 E GAA 0.56 F TTT 0.37 F TTC 0.63 G GGG 0.08 G GGA 0.19 G GGT 0.3 G GGC 0.43 H CAT 0.32 H CAC 0.68 I ATA 0.03 I ATT 0.38 I ATC 0.59 K AAG 0.6 K AAA 0.4 L TTG 0.29 L TTA 0.05 L CTG 0.29 L CTA 0.06 L CTT 0.17 L CTC 0.14 M ATG 1 N AAT 0.33 N AAC 0.67 P CCG 0.22 P CCA 0.35 P CCT 0.23 P CCC 0.2 Q CAG 0.61 Q CAA 0.39 R AGG 0.11 R AGA 0.12 R CGG 0.09 R CGA 0.17 R CGT 0.34 R CGC 0.18 S AGT 0.08 S AGC 0.16 S TCG 0.12 S TCA 0.13 S TCT 0.17 S TCC 0.34 T ACG 0.14 T ACA 0.12 T ACT 0.2 T ACC 0.53 V GTG 0.36 V GTA 0.1 V GTT 0.26 V GTC 0.28 W TGG 1 Y TAT 0.34 Y TAC 0.66 - Increasing the Activity of Upstream Enzymes
- One approach to increasing L-homocysteine production in a microbial cell that is capable of such production is to increase the activity of one or more upstream enzymes in the L-homocysteine biosynthesis pathway. Upstream pathway enzymes include all enzymes involved in the conversions from a feedstock all the way to a metabolite that can be directly converted to L-homocysteine (e.g., O-acetyl-L-homoserine or L-cystathionine). Illustrative enzymes, for this purpose, include, but are not limited to, those shown in
FIG. 1 in the pathways leading to these metabolites. Suitable upstream pathway genes encoding these enzymes may be derived from any available source, including, for example, those disclosed herein. - In some embodiments, the activity of one or more upstream pathway enzymes is increased by modulating the expression or activity of the native enzyme(s). For example, native regulators of the expression or activity of such enzymes can be exploited to increase the activity of suitable enzymes.
- Alternatively, or in addition, one or more promoters can be substituted for native promoters using, for example, a technique such as that illustrated in
FIG. 4 . In certain embodiments, the replacement promoter is stronger than the native promoter and/or is a constitutive promoter. - In some embodiments, the activity of one or more upstream pathway enzymes is supplemented by introducing one or more of the corresponding genes into the engineered microbial host cell. An introduced upstream pathway gene may be from an organism other than that of the host cell or may simply be an additional copy of a native gene. In some embodiments, one or more such genes are introduced into a microbial host cell capable of L-homocysteine production and expressed from a strong constitutive promoter and/or can optionally be codon-optimized to enhance expression in the selected microbial host cell.
- For upstream pathway enzymes that are normally subject to feedback inhibition at the transcriptional level, enzyme activity can be upregulated by blocking or bypassing the normal feedback inhibition. In certain embodiments, a recombinant construct in which the native promoter for this gene is replaced with a strong constitutive promoter can be introduced into an engineered microbial cell to produce more of the enzyme under conditions where expression of the enzyme would normally be inhibited. LysC, for example, encodes aspartate kinase and is feedback-inhibited at the transcriptional level.
- In various embodiments, the engineering of a L-homocysteine-producing microbial cell to increase the activity of one or more upstream pathway enzymes increases the L-homocysteine titer by at least 10, 20, 30, 40, 50, 60, 70, 80, or 90 percent or by at least 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 5.5-fold, 6-fold, 6.5-fold, 7-fold, 7.5-fold, 8-fold, 8.5-fold, 9-fold, 9.5-fold, 10-fold, 11-fold, 12-fold, 13-fold, 14-fold, 15-fold, 16-fold, 17-fold, 18-fold, 19-fold, 20-fold, 21-fold, 22-fold, 23-fold, 24-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95-fold, 100-fold, 150-fold, 200-fold, 250-fold, 300-fold, 350-fold, 400-fold, 450-fold, 500-fold, 550-fold, 600-fold, 650-fold, 700-fold, 750-fold, 800-fold, 850-fold, 900-fold, 950-fold, or 1000-fold. In various embodiments, the increase in L-homocysteine titer is in the range of 10-fold to 1000-fold, 20-fold to 500-fold, 50-fold to 400-fold, 10-fold to 300-fold, or any range bounded by any of the values listed above. (Ranges herein include their endpoints.) These increases are determined relative to the L-homocysteine titer observed in a L-homocysteine-producing microbial cell that lacks any increase in activity of upstream pathway enzymes. This reference cell may have one or more other genetic alterations aimed at increasing L-homocysteine production.
- In various embodiments, the L-homocysteine titers achieved by increasing the activity of one or more upstream pathway enzymes are at least 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 600, 700, 800, or 900 μg/L or at least 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, or 150 mg/L. In various embodiments, the titer is in the range of 50 μg/L to 100 mg/L, 75 μg/L to 75 mg/L, 100 μg/L to 50 mg/L, 200 μg/L to 40 gm/L, 300 μg/L to 30 gm/L, 500 μg/L to 25 mg/L, 1 mg/L to 20 mg/L, or any range bounded by any of the values listed above.
- In Corynebacteria glutamicum, for example, an about 18 mg/L titer of L-homocysteine was achieved by overexpressing: a
sulfate adenylyltransferase subunit 1 gene (also called “ATP sulfurylase,”enzyme 17 inFIG. 1 ) from C. glutamicum, a 3-phosphoadenosine-5-phosphposulfate sulfotransferase gene (also called “PAPS reductase,”enzyme 19 inFIG. 1 ) from C. glutamicum, and a sulfite reductase hemoprotein beta-component gene (also called “sulfite reductase,”enzyme 20 inFIG. 1 ) from C. glutamicum (see Example 1). - Feedback-Deregulated Enzymes
- Another approach to increasing L-homocysteine production in a microbial cell engineered for enhanced L-homocysteine production is to introduce feedback-deregulated forms of one or more enzymes that are normally subject to feedback regulation (e.g., those discussed above in the Summary) A feedback-deregulated form can be a heterologous, native enzyme that is less sensitive to feedback inhibition than the native enzyme in the particular microbial host cell. Alternatively, a feedback-deregulated form can be a variant of a native or heterologous enzyme that has one or more mutations or truncations rendering it less sensitive to feedback inhibition than the corresponding native enzyme.
- In some embodiments, the feedback-deregulated enzyme need not be “introduced,” in the traditional sense. Rather, the microbial host cell selected for engineering can be one that has a native enzyme that is naturally insensitive to feedback inhibition.
- In various embodiments, the engineering of a L-homocysteine-producing microbial cell to include one or more feedback-regulated enzymes increases the L-homocysteine titer by at least 10, 20, 30, 40, 50, 60, 70, 80, or 90 percent or by at least 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 5.5-fold, 6-fold, 6.5-fold, 7-fold, 7.5-fold, 8-fold, 8.5-fold, 9-fold, 9.5-fold, 10-fold, 11-fold, 12-fold, 13-fold, 14-fold, 15-fold, 16-fold, 17-fold, 18-fold, 19-fold, 20-fold, 21-fold, 22-fold, 23-fold, 24-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95-fold, 100-fold, 150-fold, 200-fold, 250-fold, 300-fold, 350-fold, 400-fold, 450-fold, 500-fold, 550-fold, 600-fold, 650-fold, 700-fold, 750-fold, 800-fold, 850-fold, 900-fold, 950-fold, or 1000-fold. In various embodiments, the increase in L-homocysteine titer is in the range of 10-fold to 1000-fold, 20-fold to 500-fold, 50-fold to 400-fold, 10-fold to 300-fold, or any range bounded by any of the values listed above. These increases are determined relative to the L-homocysteine titer observed in a L-homocysteine-producing microbial cell that does not include genetic alterations to reduce feedback regulation. This reference cell may (but need not) have other genetic alterations aimed at increasing L-homocysteine production, i.e., the cell may have increased activity of an upstream pathway enzyme.
- In various embodiments, the L-homocysteine titers achieved by reducing feedback deregulation are at least 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 600, 700, 800, or 900 μg/L or at least 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, or 150 mg/L. In various embodiments, the titer is in the range of 50 μg/L to 100 mg/L, 75 μg/L to 75 mg/L, 100 μg/L to 50 mg/L, 200 μg/L to 40 gm/L, 300 μg/L to 30 gm/L, 500 μg/L to 25 mg/L, 1 mg/L to 20 mg/L, or any range bounded by any of the values listed above.
- Reduction of Consumption of L-Homocysteine and/or its Precursors
- Another approach to increasing L-homocysteine production in a microbial cell that is capable of such production is to decrease the activity of one or more enzymes that consume one or more L-homocysteine pathway precursors or that consume L-homocysteine itself (see those discussed above in the Summary) In some embodiments, the activity of one or more such enzymes is reduced by modulating the expression or activity of the native enzyme(s). The activity of such enzymes can be decreased, for example, by substituting the native promoter of the corresponding gene(s) with a less active or inactive promoter or by deleting the corresponding gene(s). See
FIGS. 4 and 5 for examples of schemes for promoter replacement and targeted gene deletion, respectively, in S. cervisiae and Y. lipolytica. - In various embodiments, the engineering of a L-homocysteine-producing microbial cell to reduce precursor consumption by one or more side pathways increases the L-homocysteine titer by at least 10, 20, 30, 40, 50, 60, 70, 80, or 90 percent or by at least 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 5.5-fold, 6-fold, 6.5-fold, 7-fold, 7.5-fold, 8-fold, 8.5-fold, 9-fold, 9.5-fold, 10-fold, 11-fold, 12-fold, 13-fold, 14-fold, 15-fold, 16-fold, 17-fold, 18-fold, 19-fold, 20-fold, 21-fold, 22-fold, 23-fold, 24-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95-fold, 100-fold, 150-fold, 200-fold, 250-fold, 300-fold, 350-fold, 400-fold, 450-fold, 500-fold, 550-fold, 600-fold, 650-fold, 700-fold, 750-fold, 800-fold, 850-fold, 900-fold, 950-fold, or 1000-fold. In various embodiments, the increase in L-homocysteine titer is in the range of 10-fold to 1000-fold, 20-fold to 500-fold, 50-fold to 400-fold, 10-fold to 300-fold, or any range bounded by any of the values listed above. These increases are determined relative to the L-homocysteine titer observed in a L-homocysteine-producing microbial cell that does not include genetic alterations to reduce precursor consumption. This reference cell may (but need not) have other genetic alterations aimed at increasing L-homocysteine production, i.e., the cell may have increased activity of an upstream pathway enzyme.
- In various embodiments, the L-homocysteine titers achieved by reducing precursor consumption are at least 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 600, 700, 800, or 900 μg/L or at least 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, or 150 mg/L. In various embodiments, the titer is in the range of 50 μg/L to 100 mg/L, 75 μg/L to 75 mg/L, 100 μg/L to 50 mg/L, 200 μg/L to 40 gm/L, 300 μg/L to 30 gm/L, 500 μg/L to 25 mg/L, 1 mg/L to 20 mg/L, or any range bounded by any of the values listed above.
- Any of the approaches for increasing L-homocysteine production described above can be combined, in any combination, to achieve even higher L-homocysteine production levels.
- Altering the Cofactor Specificity of Upstream Pathway Enzymes
- Another approach to increasing L-homocysteine production in a microbial cell that is capable of such production is to alter the cofactor specificity of an upstream pathway enzyme that typically prefers the reduced form of nicotinamide adenine dinucleotide phosphate (NADPH) to the reduced from of nicotinamide adenine dinucleotide (NADH) (see those discussed above in the Summary). which provides the reducing equivalents for biosynthetic reactions. This can be achieved, for example, by expressing one or more variants of such enzymes that have the desired altered cofactor specificity. Examples of upstream pathway enzymes that rely on NADPH, and for which suitable variants are known, include aspartate semi-aldehyde dehydrogenase, homoserine dehydrogenase, and glyceraldehyde 3-phosphate dehydrogenase (GAPDH).
- In various embodiments, the engineering of a L-homocysteine-producing microbial cell to alter the cofactor specificity of one or more of such enzymes increases the L-homocysteine titer by at least 10, 20, 30, 40, 50, 60, 70, 80, or 90 percent or by at least 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 5.5-fold, 6-fold, 6.5-fold, 7-fold, 7.5-fold, 8-fold, 8.5-fold, 9-fold, 9.5-fold, 10-fold, 11-fold, 12-fold, 13-fold, 14-fold, 15-fold, 16-fold, 17-fold, 18-fold, 19-fold, 20-fold, 21-fold, 22-fold, 23-fold, 24-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95-fold, 100-fold, 150-fold, 200-fold, 250-fold, 300-fold, 350-fold, 400-fold, 450-fold, 500-fold, 550-fold, 600-fold, 650-fold, 700-fold, 750-fold, 800-fold, 850-fold, 900-fold, 950-fold, or 1000-fold. In various embodiments, the increase in L-homocysteine titer is in the range of 10-fold to 1000-fold, 20-fold to 500-fold, 50-fold to 400-fold, 10-fold to 300-fold, or any range bounded by any of the values listed above. (Ranges herein include their endpoints.) These increases are determined relative to the L-homocysteine titer observed in a L-homocysteine-producing microbial cell that lacks any increase in activity of such enzymes. This reference cell may have one or more other genetic alterations aimed at increasing L-homocysteine production.
- In various embodiments, the L-homocysteine titers achieved by altering the cofactor specificity of one or more enzymes that typically rely on NADPH as a cofactor are at least 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 600, 700, 800, or 900 μg/L or at least 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, or 150 mg/L. In various embodiments, the titer is in the range of 50 μg/L to 100 mg/L, 75 μg/L to 75 mg/L, 100 μg/L to 50 mg/L, 200 μg/L to 40 gm/L, 300 μg/L to 30 gm/L, 500 μg/L to 25 mg/L, 1 mg/L to 20 mg/L, or any range bounded by any of the values listed above.
- Illustrative Amino Acid and Nucleotide Sequences
- The following table identifies amino acid and nucleotide sequences used in Examples 1 and 2. The corresponding sequences are shown in the Sequence Listing.
-
SEQ ID NO Cross-Reference Table AA or DNA Enzyme Description SEQ ID NO: Sulfate adenylyltransferase (ATP sulfurylase) from 1 Corynebacterium glutamicum (AA sequence) 5′-phosphosulfate sulfotransferase (PAPS reductase) 2 from Corynebacterium glutamicum (AA sequence) Sulfite reductase from Corynebacterium glutamicum 3 (AA sequence) Serine O-acetyltransferase from Lactobacillus acidophilus 4 (AA sequence) Feedback-Deregulated (G378E) Homoserine dehydrogenase 5 from Corynebacterium glutamicum (AA sequence) O-acetylhomoserine aminocarboxypropyltransferase from 6 Lactobacillus collinoides (AA sequence) Sulfate adenylyltransferase from Corynebacterium 7 glutamicum (AA sequence) Sulfate adenylyltransferase from Corynebacterium 8 glutamicum (DNA sequence encoding SEQ ID NO: 7) 5′-phosphosulfate sulfotransferase (PAPS reductase) from 9 Corynebacterium glutamicum (DNA sequence encoding SEQ ID NO: 2) Sulfite reductase from Corynebacterium glutamicum 10 (DNA sequence encoding SEQ ID NO: 3) Homoserine dehydrogenase from Corynebacterium 11 glutamicum (strain ATCC 13032/DSM 20300/JCM 1318/LMG 3730/NCIMB 10025); Uniprot ID: P08499 (AA sequence) - Microbial Host Cells
- Any microbe that can be used to express introduced genes can be engineered for fermentative production of L-homocysteine as described above. In certain embodiments, the microbe is one that is naturally incapable of fermentative production of L-homocysteine. In some embodiments, the microbe is one that is readily cultured, such as, for example, a microbe known to be useful as a host cell in fermentative production of compounds of interest. Bacteria cells, including gram-positive or gram-negative bacteria can be engineered as described above. Examples include, in addition to C. glutamicum cells, Bacillus subtilus, B. licheniformis, B. lentus, B. brevis, B. stearothermophilus, B. alkalophilus, B. amyloliquefaciens, B. clausii, B. halodurans, B. megaterium, B. coagulans, B. circulans, B. lautus, B. thuringiensis, S. albus, S. lividans, S. coelicolor, S. griseus, Pseudomonas sp., P. alcaligenes, P. citrea, Lactobacilis spp. (such as L. lactis, L. plantarum), L. grayi, E. coli, E. faecium, E. gallinarum, E. casseliflavus, and/or E. faecalis cells.
- There are numerous types of anaerobic cells that can be used as microbial host cells in the methods described herein. In some embodiments, the microbial cells are obligate anaerobic cells. Obligate anaerobes typically do not grow well, if at all, in conditions where oxygen is present. It is to be understood that a small amount of oxygen may be present, that is, there is some level of tolerance level that obligate anaerobes have for a low level of oxygen. Obligate anaerobes engineered as described above can be grown under substantially oxygen-free conditions, wherein the amount of oxygen present is not harmful to the growth, maintenance, and/or fermentation of the anaerobes.
- Alternatively, the microbial host cells used in the methods described herein can be facultative anaerobic cells. Facultative anaerobes can generate cellular ATP by aerobic respiration (e.g., utilization of the TCA cycle) if oxygen is present. However, facultative anaerobes can also grow in the absence of oxygen. Facultative anaerobes engineered as described above can be grown under substantially oxygen-free conditions, wherein the amount of oxygen present is not harmful to the growth, maintenance, and/or fermentation of the anaerobes, or can be alternatively grown in the presence of greater amounts of oxygen.
- In some embodiments, the microbial host cells used in the methods described herein are filamentous fungal cells. (See, e.g., Berka & Barnett, Biotechnology Advances, (1989), 7(2):127-154). Examples include Trichoderma longibrachiatum, T. viride, T. koningii, T. harzianum, Penicillium sp., Humicola insolens, H. lanuginose, H. grisea, Chrysosporium sp., C. lucknowense, Gliocladium sp., Aspergillus sp. (such as A. oryzae, A. niger, A. sojae, A. japonicus, A. nidulans, or A. awamori), Fusarium sp. (such as F. roseum, F. graminum F. cerealis, F. oxysporuim, or F. venenatum), Neurospora sp. (such as N. crassa or Hypocrea sp.), Mucor sp. (such as M. miehei), Rhizopus sp., and Emericella sp. cells. In particular embodiments, the fungal cell engineered as described above is A. nidulans, A. awamori, A. oryzae, A. aculeatus, A. niger, A. japonicus, T reesei, T. viride, F. oxysporum, or F. solani. Illustrative plasmids or plasmid components for use with such hosts include those described in U.S. Patent Pub. No. 2011/0045563.
- Yeasts can also be used as the microbial host cell in the methods described herein. Examples include: Saccharomyces sp., Schizosaccharomyces sp., Pichia sp., Hansenula polymorpha, Pichia stipites, Kluyveromyces marxianus, Kluyveromyces spp., Yarrowia lipolytica and Candida sp. In some embodiments, the Saccharomyces sp. is S. cerevisiae (See, e.g., Romanos et al., Yeast, (1992), 8(6):423-488). Illustrative plasmids or plasmid components for use with such hosts include those described in U.S. Pat. No. 7,659,097 and U.S. Patent Pub. No. 2011/0045563.
- In some embodiments, the host cell can be an algal cell derived, e.g., from a green alga, red alga, a glaucophyte, a chlorarachniophyte, a euglenid, a chromista, or a dinoflagellate. (See, e.g., Saunders & Warmbrodt, “Gene Expression in Algae and Fungi, Including Yeast,” (1993), National Agricultural Library, Beltsville, Md.). Illustrative plasmids or plasmid components for use in algal cells include those described in U.S. Patent Pub. No. 2011/0045563.
- In other embodiments, the host cell is a cyanobacterium, such as cyanobacterium classified into any of the following groups based on morphology: Chlorococcales, Pleurocapsales, Oscillatoriales, Nostocales, Synechosystic or Stigonematales (See, e.g., Lindberg et al., Metab. Eng., (2010) 12(1):70-79). Illustrative plasmids or plasmid components for use in cyanobacterial cells include those described in U.S. Patent Pub. Nos. 2010/0297749 and 2009/0282545 and in Intl. Pat. Pub. No. WO 2011/034863.
- Genetic Engineering Methods
- Microbial cells can be engineered for fermentative L-homocysteine production using conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, and biochemistry, which are within the skill of the art. Such techniques are explained fully in the literature, see e.g., “Molecular Cloning: A Laboratory Manual,” fourth edition (Sambrook et al., 2012); “Oligonucleotide Synthesis” (M. J. Gait, ed., 1984); “Culture of Animal Cells: A Manual of Basic Technique and Specialized Applications” (R. I. Freshney, ed., 6th Edition, 2010); “Methods in Enzymology” (Academic Press, Inc.); “Current Protocols in Molecular Biology” (F. M. Ausubel et al., eds., 1987, and periodic updates); “PCR: The Polymerase Chain Reaction,” (Mullis et al., eds., 1994); Singleton et al., Dictionary of Microbiology and Molecular Biology 2nd ed., J. Wiley & Sons (New York, N.Y. 1994).
- Vectors are polynucleotide vehicles used to introduce genetic material into a cell. Vectors useful in the methods described herein can be linear or circular. Vectors can integrate into a target genome of a host cell or replicate independently in a host cell. For many applications, integrating vectors that produced stable transformants are preferred. Vectors can include, for example, an origin of replication, a multiple cloning site (MCS), and/or a selectable marker. An expression vector typically includes an expression cassette containing regulatory elements that facilitate expression of a polynucleotide sequence (often a coding sequence) in a particular host cell. Vectors include, but are not limited to, integrating vectors, prokaryotic plasmids, episomes, viral vectors, cosmids, and artificial chromosomes.
- Illustrative regulatory elements that may be used in expression cassettes include promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g., transcription termination signals, such as polyadenylation signals and poly-U sequences). Such regulatory elements are described, for example, in Goeddel, Gene Expression Technology: Methods In Enzymology 185, Academic Press, San Diego, Calif. (1990).
- In some embodiments, vectors may be used to introduce systems that can carry out genome editing, such as CRISPR systems. See U.S. Patent Pub. No. 2014/0068797, published 6 Mar. 2014; see also Jinek M., et al., “A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity,” Science 337:816-21, 2012). In Type II CRISPR-Cas9 systems, Cas9 is a site-directed endonuclease, namely an enzyme that is, or can be, directed to cleave a polynucleotide at a particular target sequence using two distinct endonuclease domains (HNH and RuvC/RNase H-like domains). Cas9 can be engineered to cleave DNA at any desired site because Cas9 is directed to its cleavage site by RNA. Cas9 is therefore also described as an “RNA-guided nuclease.” More specifically, Cas9 becomes associated with one or more RNA molecules, which guide Cas9 to a specific polynucleotide target based on hybridization of at least a portion of the RNA molecule(s) to a specific sequence in the target polynucleotide. Ran, F. A., et al., (“In vivo genome editing using Staphylococcus aureus Cas9,” Nature 520(7546):186-91, 2015, Apr. 9], including all extended data) present the crRNA/tracrRNA sequences and secondary structures of eight Type II CRISPR-Cas9 systems. Cas9-like synthetic proteins are also known in the art (see U.S. Published Patent Application No. 2014-0315985, published 23 Oct. 2014).
- Example 1 describes illustrative integration approaches for introducing polynucleotides and other genetic alterations into the genomes of C. glutamicum cells.
- Vectors or other polynucleotides can be introduced into microbial cells by any of a variety of standard methods, such as transformation, conjugation, electroporation, nuclear microinjection, transduction, transfection (e.g., lipofection mediated or DEAE-Dextrin mediated transfection or transfection using a recombinant phage virus), incubation with calcium phosphate DNA precipitate, high velocity bombardment with DNA-coated microprojectiles, and protoplast fusion. Transformants can be selected by any method known in the art. Suitable methods for selecting transformants are described in U.S. Patent Pub. Nos. 2009/0203102, 2010/0048964, and 2010/0003716, and International Publication Nos. WO 2009/076676, WO 2010/003007, and WO 2009/132220.
- The above-described methods can be used to produce engineered microbial cells that produce, and in certain embodiments, overproduce, L-homocysteine. Engineered microbial cells can have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more genetic alterations, such as 30-100 alterations, as compared to a native microbial cell, such as any of the microbial host cells described herein. Engineered microbial cells described in the Example below have one, two, or three genetic alterations, but those of skill in the art can, following the guidance set forth herein, design microbial cells with additional alterations. In some embodiments, the engineered microbial cells have not more than 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, or 4 genetic alterations, as compared to a native microbial cell. In various embodiments, microbial cells engineered for L-homocysteine production can have a number of genetic alterations falling within the any of the following illustrative ranges: 1-10, 1-9, 1-8, 2-7, 2-6, 2-5, 2-4, 2-3, 3-7, 3-6, 3-5, 3-4, etc.
- In some embodiments, an engineered microbial cell expresses at least one heterologous gene, e.g., a 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase) gene, a sulfite reductase hemoprotein beta-component gene (sulfite reductase) gene, and/or or a
sulfate adenylyltransferase subunit 1 gene (ATP sulfurylase) gene. In various embodiments, the microbial cell can include and express, for example: (1) a single heterologous PAPS reductase gene, (2) two or more heterologous PAPS reductase genes, which can be the same or different (in other words, multiple copies of the same heterologous PAPS reductase gene can be introduced or multiple, different heterologous PAPS reductase genes can be introduced), (3) a single heterologous PAPS reductase gene that is not native to the cell and one or more additional copies of an native PAPS reductase gene (if applicable), or (4) two or more non-native PAPS reductase genes, which can be the same or different, and one or more additional copies of a native PAPS reductase gene (if applicable). The same is true for other heterologous genes that can be introduced into the engineered microbial cell, such as those encoding sulfite reductase and/or ATP sulfurase. - This engineered host cell can include at least one additional genetic alteration that increases flux through any pathway leading to the production of an immediate precursor of L-homocysteine. As discussed above, this can be accomplished by one or more of the following: increasing the activity of upstream enzymes, reducing consumption of L-homocysteine precursors or of L-homocysteine itself, and altering the cofactor specificity of upstream pathway enzymes.
- In addition, the engineered host cell can express an amino acid transporter to enhance transport of L-homocysteine from inside the engineered microbial cell to the culture medium.
- The engineered microbial cells can contain introduced genes that have a native nucleotide sequence or that differ from native. For example, the native nucleotide sequence can be codon-optimized for expression in a particular host cell. Codon optimization for a particular host can, for example, be based on the codon usage tables found at www.kazusa.or.jp/codon/. The amino acid sequences encoded by any of these introduced genes can be native or can differ from native. In various embodiments, the amino acid sequences have at least 60 percent, 70 percent, 75 percent, 80 percent, 85 percent, 90 percent, 95 percent or 100 percent amino acid sequence identity with a native amino acid sequence.
- The approach described herein has been carried out in bacterial cells, namely C. glutamicum. (See Example 1.)
- Illustrative Engineered Bacterial Cells
- In certain embodiments, the engineered bacterial (e.g., C. glutamicum) cell expresses one or more heterologous 3-phosphoadenosine-5-phosphosulfate sulfotransferases (PAPS reductases) having at least 70 percent, 75 percent, 80 percent, 85 percent, 90 percent, 95 percent or 100 percent amino acid sequence identity with an PAPS reductase encoded by a C. glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase gene; and/or one or more heterologous sulfite reductases having at least 70 percent, 75 percent, 80 percent, 85 percent, 90 percent, 95 percent or 100 percent amino acid sequence identity with a sulfite reductase encoded by a C. glutamicum sulfite reductase hemoprotein beta-component gene; and/or or one or more heterologous sulfate adenylyltransferases (ATP sulfurases) having at least 70 percent, 75 percent, 80 percent, 85 percent, 90 percent, 95 percent or 100 percent amino acid sequence identity with an ATP sulfurase encoded by a C. glutamicum
sulfate adenylyltransferase subunit 1 gene or another C. glutamicum sulfate adenylyltransferase (e.g., SEQ ID NO:7). - In particular embodiments:
- the PAPS reductase encoded by the C. glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase gene includes SEQ ID NO:2;
- the sulfite reductase encoded by the C. glutamicum sulfite reductase hemoprotein beta-component gene includes SEQ ID NO:3; and/or
- the ATP sulfurase encoded by the C. glutamicum
sulfate adenylyltransferase subunit 1 gene includes SEQ ID NO:1. - In Corynebacteria glutamicum, for example, an about 18 mg/L titer of L-homocysteine was achieved by overexpressing the enzymes having SEQ ID NOs:1-3 (see Example 1).
- In other particular embodiments:
- the PAPS reductase encoded by the C. glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase gene includes SEQ ID NO:2;
- the sulfite reductase encoded by the C. glutamicum sulfite reductase hemoprotein beta-component gene includes SEQ ID NO:3; and/or
- the C. glutamicum sulfate adenylyltransferase includes SEQ ID NO:7.
- In C. glutamicum, for example, an about 4.43 mg/L titer of L-homocysteine was achieved by overexpressing the enzymes having SEQ ID NOs:2, 3, and 7 (see Example 2).
- Production in such strains can be increased by expressing additional genes encoding enzymes. In certain embodiments, the engineered bacterial (e.g., C. glutamicum) cell expresses, in addition to a set of the three enzymes described in the preceding paragraphs, one or more heterologous serine O-acetyltransferases having at least 70 percent, 75 percent, 80 percent, 85 percent, 90 percent, 95 percent or 100 percent amino acid sequence identity with a serine O-acetyltransferase from Lactobacillus acidophilus; and/or one or more heterologous homoserine dehydrogenases having at least 70 percent, 75 percent, 80 percent, 85 percent, 90 percent, 95 percent or 100 percent amino acid sequence identity with a homoserine dehydrogenase from C. glutamicum (e.g., strain ATCC 13032/DSM 20300/JCM 1318/LMG 3730/NCIMB 10025, Uniprot ID: P08499); and/or or one or more heterologous O-acetylhomoserine aminocarboxypropyltransferases having at least 70 percent, 75 percent, 80 percent, 85 percent, 90 percent, 95 percent or 100 percent amino acid sequence identity with an O-acetylhomoserine aminocarboxypropyltransferase from Lactobacillus collinoides.
- In particular embodiments:
- the serine O-acetyltransferase includes SEQ ID NO:4;
- the homoserine dehydrogenase includes SEQ ID NO:11; and/or
- the O-acetylhomoserine aminocarboxypropyltransferase includes SEQ ID NO:6.
- In Corynebacteria glutamicum, for example, an about 73.7 mg/L titer of L-homocysteine was achieved by additionally expressing the enzymes having SEQ ID NOs:4, 11, and 6 (see Example 2).
- Any of the microbial cells described herein can be cultured, e.g., for maintenance, growth, and/or L-homocysteine production.
- In some embodiments, the cultures are grown to an optical density at 600 nm of 10-500, such as an optical density of 50-150.
- In various embodiments, the cultures include produced L-homocysteine at titers of at least 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 600, 700, 800, or 900 μg/L or at least 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, or 150 mg/L. In various embodiments, the titer is in the range of 50 μg/L to 100 mg/L, 75 μg/L to 75 mg/L, 100 μg/L to 50 gm/L, 200 μg/L to 25 gm/L, 300 μg/L to 10 gm/L, 350 μg/L to 5 gm/L or any range bounded by any of the values listed above.
- Culture Media
- Microbial cells can be cultured in any suitable medium including, but not limited to, a minimal medium, i.e., one containing the minimum nutrients possible for cell growth. Minimal medium typically contains: (1) a carbon source for microbial growth; (2) salts, which may depend on the particular microbial cell and growing conditions; and (3) water. Suitable media can also include any combination of the following: a nitrogen source for growth and product formation, a sulfur source for growth, a phosphate source for growth, metal salts for growth, vitamins for growth, and other cofactors for growth.
- Any suitable carbon source can be used to cultivate the host cells. The term “carbon source” refers to one or more carbon-containing compounds capable of being metabolized by a microbial cell. In various embodiments, the carbon source is a carbohydrate (such as a monosaccharide, a disaccharide, an oligosaccharide, or a polysaccharide), or an invert sugar (e.g., enzymatically treated sucrose syrup). Illustrative monosaccharides include glucose (dextrose), fructose (levulose), and galactose; illustrative oligosaccharides include dextran or glucan, and illustrative polysaccharides include starch and cellulose. Suitable sugars include C6 sugars (e.g., fructose, mannose, galactose, or glucose) and C5 sugars (e.g., xylose or arabinose). Other, less expensive carbon sources include sugar cane juice, beet juice, sorghum juice, and the like, any of which may, but need not be, fully or partially deionized.
- The salts in a culture medium generally provide essential elements, such as magnesium, nitrogen, phosphorus, and sulfur to allow the cells to synthesize proteins and nucleic acids.
- Minimal medium can be supplemented with one or more selective agents, such as antibiotics.
- To produce L-homocysteine, the culture medium can include, and/or is supplemented during culture with, glucose and/or a nitrogen source such as urea, an ammonium salt, ammonia, or any combination thereof.
- Supplementation with a Reduced Sulfur Source
- In particular embodiments, the medium can include a sulfur source that is in a reduced form, relative to sulfate, and/or the reduced sulfur source can be added to the culture during fermentation. In illustrative embodiments, the sulfur source includes a sulfide or thiosulfate. Examples of suitable reduced sulfur sources include sulfates, sulfites, sulfides, methylsulfonates, ametryne, prometryne, or any combinations thereof.
- Culture Conditions
- Materials and methods suitable for the maintenance and growth of microbial cells are well known in the art. See, for example, U.S. Pub. Nos. 2009/0203102, 2010/0003716, and 2010/0048964, and International Pub. Nos. WO 2004/033646, WO 2009/076676, WO 2009/132220, and WO 2010/003007, Manual of Methods for General Bacteriology Gerhardt et al., eds), American Society for Microbiology, Washington, D.C. (1994) or Brock in Biotechnology: A Textbook of Industrial Microbiology, Second Edition (1989) Sinauer Associates, Inc., Sunderland, Mass.
- In general, cells are grown and maintained at an appropriate temperature, gas mixture, and pH (such as about 20° C. to about 37° C., about 6% to about 84% CO2, and a pH between about 5 to about 9). In some aspects, cells are grown at 35° C. In certain embodiments, such as where thermophilic bacteria are used as the host cells, higher temperatures (e.g., 50° C.-75° C.) may be used. In some aspects, the pH ranges for fermentation are between about pH 5.0 to about pH 9.0 (such as about pH 6.0 to about pH 8.0 or about 6.5 to about 7.0). Cells can be grown under aerobic, anoxic, or anaerobic conditions based on the requirements of the particular cell.
- Standard culture conditions and modes of fermentation, such as batch, fed-batch, or continuous fermentation that can be used are described in U.S. Publ. Nos. 2009/0203102, 2010/0003716, and 2010/0048964, and International Pub. Nos. WO 2009/076676, WO 2009/132220, and WO 2010/003007. Batch and Fed-Batch fermentations are common and well known in the art, and examples can be found in Brock, Biotechnology: A Textbook of Industrial Microbiology, Second Edition (1989) Sinauer Associates, Inc.
- In some embodiments, the cells are cultured under limited sugar (e.g., glucose) conditions. In various embodiments, the amount of sugar that is added is less than or about 105% (such as about 100%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, or 10%) of the amount of sugar that can be consumed by the cells. In particular embodiments, the amount of sugar that is added to the culture medium is approximately the same as the amount of sugar that is consumed by the cells during a specific period of time. In some embodiments, the rate of cell growth is controlled by limiting the amount of added sugar such that the cells grow at the rate that can be supported by the amount of sugar in the cell medium. In some embodiments, sugar does not accumulate during the time the cells are cultured. In various embodiments, the cells are cultured under limited sugar conditions for times greater than or about 1, 2, 3, 5, 10, 15, 20, 25, 30, 35, 40, 50, 60, or 70 hours or even up to about 5-10 days. In various embodiments, the cells are cultured under limited sugar conditions for greater than or about 5, 10, 15, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 95, or 100% of the total length of time the cells are cultured. While not intending to be bound by any particular theory, it is believed that limited sugar conditions can allow more favorable regulation of the cells.
- In some aspects, the cells are grown in batch culture. The cells can also be grown in fed-batch culture or in continuous culture. Additionally, the cells can be cultured in minimal medium, including, but not limited to, any of the minimal media described above. The minimal medium can be further supplemented with 1.0% (w/v) glucose (or any other six-carbon sugar) or less. Specifically, the minimal medium can be supplemented with 1% (w/v), 0.9% (w/v), 0.8% (w/v), 0.7% (w/v), 0.6% (w/v), 0.5% (w/v), 0.4% (w/v), 0.3% (w/v), 0.2% (w/v), or 0.1% (w/v) glucose. In some cultures, significantly higher levels of sugar (e.g., glucose) are used, e.g., at least 10% (w/v), 20% (w/v), 30% (w/v), 40% (w/v), 50% (w/v), 60% (w/v), 70% (w/v), or up to the solubility limit for the sugar in the medium. In some embodiments, the sugar levels falls within a range of any two of the above values, e.g.: 0.1-10% (w/v), 1.0-20% (w/v), 10-70% (w/v), 20-60% (w/v), or 30-50% (w/v). Furthermore, different sugar levels can be used for different phases of culturing. For fed-batch culture (e.g., of S. cerevisiae or C. glutamicum), the sugar level can be about 100-200 g/L (10-20% (w/v)) in the batch phase and then up to about 500-700 g/L (50-70% in the feed).
- Additionally, the minimal medium can be supplemented 0.1% (w/v) or less yeast extract. Specifically, the minimal medium can be supplemented with 0.1% (w/v), 0.09% (w/v), 0.08% (w/v), 0.07% (w/v), 0.06% (w/v), 0.05% (w/v), 0.04% (w/v), 0.03% (w/v), 0.02% (w/v), or 0.01% (w/v) yeast extract. Alternatively, the minimal medium can be supplemented with 1% (w/v), 0.9% (w/v), 0.8% (w/v), 0.7% (w/v), 0.6% (w/v), 0.5% (w/v), 0.4% (w/v), 0.3% (w/v), 0.2% (w/v), or 0.1% (w/v) glucose and with 0.1% (w/v), 0.09% (w/v), 0.08% (w/v), 0.07% (w/v), 0.06% (w/v), 0.05% (w/v), 0.04% (w/v), 0.03% (w/v), or 0.02% (w/v) yeast extract. In some cultures, significantly higher levels of yeast extract can be used, e.g., at least 1.5% (w/v), 2.0% (w/v), 2.5% (w/v), or 3% (w/v). In some cultures (e.g., of S. cerevisiae or C. glutamicum), the yeast extract level falls within a range of any two of the above values, e.g.: 0.5-3.0% (w/v), 1.0-2.5% (w/v), or 1.5-2.0% (w/v).
- Illustrative materials and methods suitable for the maintenance and growth of the engineered microbial cells described herein can be found below in Example 1.
- Any of the methods described herein may further include a step of recovering L-homocysteine. In some embodiments, the produced L-homocysteine contained in a so-called harvest stream is recovered/harvested from the production vessel. The harvest stream may include, for instance, cell-free or cell-containing aqueous solution coming from the production vessel, which contains L-homocysteine as a result of the conversion of production substrate by the resting cells in the production vessel. Cells still present in the harvest stream may be separated from the L-homocysteine by any operations known in the art, such as for instance filtration, centrifugation, decantation, membrane crossflow ultrafiltration or microfiltration, tangential flow ultrafiltration or microfiltration or dead-end filtration. After this cell separation operation, the harvest stream is essentially free of cells.
- Further steps of separation and/or purification of the produced L-homocysteine from other components contained in the harvest stream, i.e., so-called downstream processing steps may optionally be carried out. These steps may include any means known to a skilled person, such as, for instance, concentration, extraction, crystallization, precipitation, adsorption, ion exchange, and/or chromatography. Any of these procedures can be used alone or in combination to purify L-homocysteine. Further purification steps can include one or more of, e.g., concentration, crystallization, precipitation, washing and drying, treatment with activated carbon, ion exchange, nanofiltration, and/or re-crystallization. The design of a suitable purification protocol may depend on the cells, the culture medium, the size of the culture, the production vessel, etc. and is within the level of skill in the art.
- The following examples are given for the purpose of illustrating various embodiments of the disclosure and are not meant to limit the present disclosure in any fashion. Changes therein and other uses which are encompassed within the spirit of the disclosure, as defined by the scope of the claims, will be identifiable to those skilled in the art.
- Plasmid/DNA Design
- All strains tested for this work were transformed with plasmid DNA designed using proprietary software. Plasmid designs were specific to each of the host organisms engineered in this work. The plasmid DNA was physically constructed by a standard DNA assembly method. This plasmid DNA was then used to integrate metabolic pathway inserts by one of two host-specific methods, each described below.
- C. glutamicum and B. subtilis Pathway Integration
- A “loop-in, single-crossover” genomic integration strategy has been developed to engineer C. glutamicum and B. subtilis strains.
FIG. 10 illustrates genomic integration of loop-in only and loop-in/loop-out constructs and verification of correct integration via colony PCR. Loop-in only constructs (shown under the heading “Loop-in”) contained a single 2-kb homology arm (denoted as “integration locus”), a positive selection marker (denoted as “Marker”)), and gene(s) of interest (denoted as “promoter-gene-terminator”). A single crossover event integrated the plasmid into the C. glutamicum or B. subtilis chromosome. Integration events are stably maintained in the genome by growth in the presence of antibiotic (25 μg/ml kanamycin). Correct genomic integration in colonies derived from loop-in integration were confirmed by colony PCR with UF/IR and DR/IF PCR primers. - Loop-in, loop-out constructs (shown under the heading “Loop-in, loop-out) contained two 2-kb homology arms (5′ and 3′ arms), gene(s) of interest (arrows), a positive selection marker (denoted “Marker”), and a counter-selection marker. Similar to “loop-in” only constructs, a single crossover event integrated the plasmid into the chromosome. Note: only one of two possible integrations is shown here. Correct genomic integration was confirmed by colony PCR and counter-selection was applied so that the plasmid backbone and counter-selection marker could be excised. This results in one of two possibilities: reversion to wild-type (lower left box) or the desired pathway integration (lower right box). Again, correct genomic loop-out is confirmed by colony PCR. (Abbreviations: Primers: UF=upstream forward, DR=downstream reverse, IR=internal reverse, IF=internal forward.)
- S. cerevisiae Pathway Integration
- A “split-marker, double-crossover” genomic integration strategy has been developed to engineer S. cerevisiae strains.
FIG. 7 illustrates genomic integration of complementary, split-marker plasmids and verification of correct genomic integration via colony PCR in S. cerevisiae. Two plasmids with complementary 5′ and 3′ homology arms and overlapping halves of a URA3 selectable marker (direct repeats shown by the hashed bars) were digested with meganucleases and transformed as linear fragments. A triple-crossover event integrated the desired heterologous genes into the targeted locus and re-constituted the full URA3 gene. Colonies derived from this integration event were assayed using two 3-primer reactions to confirm both the 5′ and 3′ junctions (UF/IF/wt-R and DR/IF/wt-F). For strains in which further engineering is desired, the strains can be plated on 5-FOA plates to select for the removal of URA3, leaving behind a small single copy of the original direct repeat. This genomic integration strategy can be used for gene knock-out, gene knock-in, and promoter titration in the same workflow. - Cell Culture
- The workflow established for S. cerevisiae involved a hit-picking step that consolidated successfully built strains using an automated workflow that randomized strains across the plate. For each strain that was successfully built, up to four replicates were tested from distinct colonies to test colony-to-colony variation and other process variation. If fewer than four colonies were obtained, the existing colonies were replicated so that at least four wells were tested from each desired genotype.
- The colonies were consolidated into 96-well plates with selective medium (SD-ura for S. cerevisiae) and cultivated for two days until saturation and then frozen with 16.6% glycerol at −80° C. for storage. The frozen glycerol stocks were then used to inoculate a seed stage in minimal media with a low level of amino acids to help with growth and recovery from freezing. The seed plates were grown at 30° C. for 1-2 days. The seed plates were then used to inoculate a main cultivation plate with minimal medium and grown for 48-88 hours. Plates were removed at the desired time points and tested for cell density (OD600), viability and glucose, supernatant samples stored for LC-MS analysis for product of interest.
- Cell Density
- Cell density was measured using a spectrophotometric assay detecting absorbance of each well at 600 nm. Robotics were used to transfer fixed amounts of culture from each cultivation plate into an assay plate, followed by mixing with 175 mM sodium phosphate (pH 7.0) to generate a 10-fold dilution. The assay plates were measured using a Tecan M1000 spectrophotometer and assay data uploaded to a LIMS database. A non-inoculated control was used to subtract background absorbance. Cell growth was monitored by inoculating multiple plates at each stage, and then sacrificing an entire plate at each time point.
- To minimize settling of cells while handling large number of plates (which could result in a non-representative sample during measurement) each plate was shaken for 10-15 seconds before each read. Wide variations in cell density within a plate may also lead to absorbance measurements outside of the linear range of detection, resulting in underestimate of higher OD cultures. In general, the tested strains so far have not varied significantly enough for this be a concern.
- Liquid-Solid Separation
- To harvest extracellular samples for analysis by LC-MS, liquid and solid phases were separated via centrifugation. Cultivation plates were centrifuged at 2000 rpm for 4 minutes, and the supernatant was transferred to destination plates using robotics. 75 μL of supernatant was transferred to each plate, with one stored at 4° C., and the second stored at 80° C. for long-term storage.
- Strategies for Enhancing Production of L-Homocysteine
- Strategies for enhancing fermentative production of L-homocysteine in engineered microbes include one or more of the following:
-
- Express feedback deregulated aspartate kinase (lysC).
- Increase activity of aspartate transaminase.
- Increase activity of glutamate dehydrogenase to provide glutamate for aspartate transaminase.
- Increase activity of PEP carboxykinase; decrease activity of pyruvate carboxylase. This conserves ATP at the C3/C4 node which improves ATP availability for converting sulfate to sulfide.
- Increase expression of sulfate transporter.
- Increase activity of ATP sulfurylase.
- Increase activity of homocysteine synthase.
- Increase activity of homoserine dehydrogenase.
- Increase activity of aspartate-semialdehyde dehydrogenase.
- Increase activity of PAPS reductase.
- Increase activity of sulfite reductase.
- Decrease activity of cystathionine gamma-synthase. Conversion of O-acetyl-L-homoserine to L-homocysteine via L-cystathionine has lower yield compared to converting O-acetyl-L-homoserine to L-homocysteine via homocysteine synthase due to production of byproducts acetate, pyruvate and NH3.
- Decrease activity of cystathionine beta-synthase to decrease loss of L-homocysteine product.
- Decrease activity of L-homoserine succinyl transferase.
- Decrease activity of methionine synthase to decrease loss of L-homocysteine product.
- Decrease activity of homoserine kinase.
- Decrease activity of malate dehydrogenase.
- Express a homoserine dehydrogenase having cofactor specificity switched from NADPH to NADH. This will decrease CO2 loss due to generating NADPH thru the pentose phosphate pathway and improve yield.
- Express an aspartate-semialdehyde dehydrogenase having cofactor specificity switched from NADPH to NADH. This will decrease CO2 loss due to generating NADPH thru the pentose phosphate pathway and improve yield.
- Express a PAPS reductase having cofactor specificity switched from NADPH to NADH. This will decrease CO2 loss due to generating NADPH thru the pentose phosphate pathway and improve yield.
- Express a sulfite reductase having cofactor specificity switched from NADPH to NADH. This will decrease CO2 loss due to generating NADPH thru the pentose phosphate pathway and improve yield.
- Utilize an alternative sulfur source (relative to sulfate) that is in a more reduced state, (e.g. sulfide, thiosulfate).
- Results
- C. glutamicum strain 7000139229 (CgHMCYS_12) was engineered to overproduce L-homocysteine. Strain 7000139229 by integration of Zymergen plasmid 13000234177 into the genome of publicly available C. glutamicum strain NRRL B-4263. Zymergen plasmid 13000234177 overexpresses the following: sulfate adenylyltransferase (ATP sulfurylase)
subunit 1 gene from C. glutamicum (SEQ ID NO:1), 3-phosphoadenosine-5-phosphposulfate sulfotransferase (PAPS reductase) gene from C. glutamicum (SEQ ID NO: 2), and sulfite reductase hemoprotein beta-component gene from C. glutamicum (SEQ ID NO:3). Zymergen strain 7000139229 was cultivated in 96-well plates and showed production of 5-10 mg/L L-homocysteine. - Subsequent cultivation in bioreactors, including process development, increased titers to ˜20 mg/L. Process development focused on fed-batch fermentation and a (minimal) medium composition that can support high cell densities and sugar inputs.
FIG. 2 shows different fed-batch fermentation process configurations that started with a batch phase at 10 gm/L sugar, followed by a feed phase in which sugar (200 gm/L) is fed to the culture via different strategies. This approach achieved an increase cell density to OD600 50-60 and gave an L-homocysteine titer of ˜18 mg/L. - Two additional Corynebacteria glutamicum were designed, tested, and found to produce L-homocysteine.
- CgHMCYS_56
- CgHMCYS_56 was a C. glutamicum strain designed to express three enzymes: sulfate adenylyltransferase from C. glutamicum (SEQ ID NO:7), 5′-phosphosulfate sulfotransferase (PAPS reductase) from C. glutamicum (SEQ ID NO:2), sulfite reductase from C. glutamicum (SEQ ID NO: 3). This strain gave an L-homocysteine titer of 4.43 mg/L of culture medium.
- CgHMCYS_127
- CgHMCYS_127 was a C. glutamicum strain that expressed the same three enzymes as CgHMCYS_56 and additionally expressed the following enzymes: serine O-acetyltransferase from Lactobacillus acidophilus (Uniprot ID: A0A1D3PCK2) (SEQ ID NO:4), homoserine dehydrogenase from C. glutamicum (strain ATCC 13032/DSM 20300/JCM 1318/LMG 3730/NCIMB 10025) (Uniprot ID: P08499) (SEQ ID NO:11), and 0-acetylhomoserine aminocarboxypropyltransferase Lactobacillus collinoides, Uniprot ID: A0A166HL31 (SEQ ID NO:6). This strain produced L-homocysteine at a titer of 73.7 mg/L culture medium.
-
INFORMAL SEQUENCE LISTING 1> Sulfate adenylyltransferase (ATP) from Corynebacterium glutamicum MTVPTLNKASEKIASRETLRLCTAGSVDDGKSTFVGRLLHDTKSVLADQLASVERTSADRGFEGLDLSLLVDGLRAEREQGI TIDVAYRYFATDKRTFILADTPGHVQYTRNTVTGVSTSQVVVLLVDARHGVVEQTRRHLSVSALLGVRTVILAVNKIDLVDYS EEVFRNIEKEFVSLASALDVTDTHVVPISALKGDNVAEPSTHMDWYAGPTVLEILENVEVSRGRAHDLGFRFPIQYVIREHAT DYRGYAGTINAGSISVGDTVHLPEGRTTQVTHIDSADGSLQTASVGEAVVLRLAQEIDLIRGELIAGSDRPESVRSFNATVV GLADRTIKPGAAVKVRYGTELVRGRVAAIERVLDIDGVNDNEAPETYGLNDIAHVRIDVAGELEVEDYAARGAIGSFLLIDQS SGDTLAAGLVGHRLRNNWSI 2> 5′-phosphosulfate sulfotransferase (PAPS reductase) from Corynebacterium glutamicum MSFQLVNALKNTGSVKDPEISPEGPRTTTPLSPEVAKHNEELVEKHAAALYDASAQEILEWTAEHTPGAIAVTLSMENTVLA ELAARHLPEADFLFLDTGYHFKETLEVARQVDERYSQKLVTALPILKRTEQDSIYGLNLYRSNPAACCRMRKVEPLAASLSP YAGWITGLRRADGPTRAQAPALSLDATGRLKISPIITWSLEETNEFIADNNLIDHPLTHQGYPSIGCETCTLPVAEGQDPRAG RWAGNAKTECGLHS 3> Sulfite reductase from Corynebacterium glutamicum MTTTTGSARPARAARKPKPEGQWKIDGTEPLNHAEEIKQEEPAFAVKQRVIDIYSKQGFSSIAPDDIAPRFKWLGIYTQRKQ DLGGELTGQLPDDELQDEYFMMRVRFDGGLASPERLRAVGEISRDYARSTADFTDRQNIQLHWIRIEDVPAIWEKLETVGL STMLGCGDVPRVILGSPVSGVAAEELIDATPAIDAIRERYLDKEEFHNLPRKFKTAITGNQRQDVTHElQDVSFVPSIHPEFG PGFECFVGGGLSTNPMLAQPLGSWIPLDEVPEVWAGVAGIFRDYGFRRLRNRARLKFLVAQWGIEKFREVLETEYLERKLI DGPVVTTNPGYRDHIGIHPQKDGKFYLGVKPTVGHTTGEQLIAIADVAEKHGITRIRTTAEKELLFLDIERENLTTVARDLDEI GLYSSPSEFRRGIISCTGLEFCKLAHATTKSRAIELVDELEERLGDLDVPIKIALNGCPNSCARTQVSDIGFKGQTVTDADGN RVEGFQVHLGGSMNLDPNFGRKLKGHKVIADEVGEYVTRVVTHFKEQRHEDEHFRDWVQRAAEEDLV 4> Serine O-acetyltransferase from Lactobacillus acidophilus MANKVKIGILNLMHDKLDTQSHFIKVLPNADLTFFYPRMHYQNRPIPPEVNMTSEPLDINRVSEFDGFIITGAPIDQIDFSKITYI EEIRYLLQALDNHKIQQLYFCWGAMAALNYFYGIKKKILAEKIFGVFPHLITEPHPLLSGLSQGFMAPHARYAEMDKKQIMQD ERLAINAVDDNSHLFMVSAKDNPERNFIFSHIEYGKDSLRDEYNREINAHPERHYKKPINYSMSNPSFQWQDTQKIFFNNW LKKVKDNKLVLN 5> Feedback Deregulated (G378E) Homoserine dehydrogenase from Corynebacterium glutamicum MTSASAPSFNPGKGPGSAVGIALLGFGTVGTEVMRLMTEYGDELAHRIGGPLEVRGIAVSDISKPREGVAPELLTEDAFALI EREDVDIVVEVIGGIEYPREVVLAALKAGKSVVTANKALVAAHSAELADAAEAANVDLYFEAAVAGAIPVVGPLRRSLAGDQI QSVMGIVNGTTNFILDAMDSTGADYADSLAEATRLGYAEADPTADVEGHDAASKAAILASIAFHTRVTADDVYCEGISNISAA DIEAAQQAGHTIKLLAICEKFTNKEGKSAISARVHPTLLPVSHPLASVNKSFNAIFVEAEAAGRLMFYGNGAGGAPTASAVLG DVVGAARNKVHGGRAPGESTYANLPIADFGETTTRYHLDMDVEDRVEVLAELASLFSEQGISLRTIRQEERDDDARLIVVTH SALESDLSRTVELLKAKPVVKAINSVIRLERD 6> O-acetylhomoserine aminocarboxypropyltransferase from Lactobacillus collinoides MTDTSKLHFETKQVHAGQVVDETGARAVPIYQTTSYVFKDAAQAAGRFGLTDPGNIYTRLTNPTTDVLEKRVAQLENGTAG VALATGAAAVTAAIENVANAGDNIVSASTLYGGTYDLFSVTLPKLGITTTFVDPDDPQNFAKAIDDKTKALYIETIGNPGINIIDI EAVAKIAHDNGIVLIADNTFGTPYLIQPLDHGVDVVIHSATKFIGGHGTTMGGVIVENGKFDYAKSGKYPDFTTPDDTYNGIV WNDINPATFTTKVRAQTLRDTGATISPFNSFLLLQGLESLSLRVERHVSNAQKIAKFLNDHPKVAWVNYPGLPG NKYNDLAK KYFPKGTGSIFTIGLKGGEKAGKDLIEKLNLFSLLANVGDAKSLIIHPASTTHAQLNEEQLKETGITPDLIRLSIGIENVDDLIADL SQALDQID 7> Sulfate adenylyltransferase from Corynebacterium glutamicum MTTTVASELSPHLKDLENESIHILREVAGQFDKVGLLFSGGKDSVWYELARRAFAPANVPFELLHVDTGHNFPEVLEFRDN LVERTGARLRVAKVQDWIDRGDLQERPDGTRNPLQTVPLVETIAEQGYDAVLGGARRDEERARAKERVFSVRDSFGGWD PRRQRPELWTLYNGGHLPGENIRVFPISNWTEADIWEYIGARGIELPPIYFSHDREVFERDGMWLTAGEWGGPKKGEEIVT KTVRYRTVGDMSCTGAVLSEARTIDDVIEEIATSTLTERGATRADDRLSESAMEDRKKEGYF 8> Sulfate adenylyltransferase from Corynebacterium glutamicum atgaccacaaccgttgcatcagaactttccccacaccttaaagatcttgaaaatgaatccatccacatcctccgcgaggtagctggccagtttgata aggtcggcctgctgttttccggcggtaaggattccgtcgtggtgtacgagcttgcgcgccgcgctttcgctccagctaacgtgccttttgaattgct gcacgtggacaccggccacaacttcccagaggttttggaattccgcgacaacctggtggagcgcaccggcgcccgcctgcgcgtagctaaagtccag gactggatcgatcgcggtgacctgcaggaacgcccagacggcacccgcaacccactgcagactgtccctttggtggagaccatcgctgagcagggct acgacgccgtgcttggtggcgctcgccgcgatgaggagcgtgcccgcgccaaggagcgtgtgttctctgtgcgtgactccttcggtggttgggatcc acgccgtcagcgcccagagctgtggaccctctacaacggtggccacctgccaggcgaaaacatccgtgttttcccaatctccaactggactgaagct gacatctgggagtacatcggcgcccgtggcatcgaacttccaccgatctacttctcccacgaccgcgaagttttcgagcgcgacggcatgtggctga ccgcaggcgagtggggtggaccaaagaagggcgaggagatcgtcaccaagactgttcgctaccgcaccgtcggcgatatgtcctgcaccggtgctgt gctctcagaagcccgcaccattgacgatgtgatcgaagagatcgccacctccacccttaccgaacgtggcgcaacccgcgccgatgaccgcctcagc gaatccgcaatggaagaccgcaagaaggaaggctacttc 9> 5'-phosphosulfate sulfotransferase (PAPS reductase) from Corynebacterium glutamicum atgagctttcaactagttaacgccctgaaaaatactggttcggtaaaagatcccgagatctcacccgaaggacctcgcacgaccacaccgttgtcac cagaggtagcaaaacacaacgaggaactcgtcgaaaagcatgctgctgcgttgtatgacgccagcgcgcaagagatcctggaatggacagccgagca cacgccgggcgctattgcagtgaccttgagcatggaaaacaccgtactggcggagctggctgcgcggcacctgccggaagctgatttcctctifttg gacaccggttaccacttcaaggaaactcttgaagttgcccgccaggtagatgagcgttattcccagaagcttgtcaccgcgctgccaatcctcaagc gcacggagcaggattccatttatggtctcaacctgtaccgcagcaacccagcggcgtgctgccgaatgcgcaaagttgaaccgctggcggcgtcgtt aagcccatacgctggctggatcaccggcctgcgccgcgctgatggcccaacccgtgctcaagcccctgcgctgagcttggatgccaccggcaggctc aagatttctccaattatcacctggtcattggaggaaaccaacgagttcattgcggacaacaacctcatcgatcacccacttacccatcagggttatc catcaattggatgcgaaacctgcacccttcctgttgctgaaggacaagaccctagggccggccgttgggctggaaacgccaagacagaatgcggact tcactca 10> Sulfite reductase from Corynebacterium glutamicum atgacaacaaccaccggaagtgcccggccagcacgtgccgccaggaagcctaagcccgaaggccaatggaaaatcgacggcaccgagccgcttaacc atgccgaggaaattaagcaagaagaacccgcttttgctgtcaagcagcgggtcattgatatttactccaagcagggtttttcttccattgcaccgga tgacattgccccacgctttaagtggttgggcatttacacccagcgtaagcaggatctgggcggtgaactgaccggtcagcttcctgatgatgagctg caggatgagtacttcatgatgcgtgtgcgttttgatggcggactggcttcccctgagcgcctgcgtgccgtgggtgaaatttctagggattatgctc gttccaccgcggacttcaccgaccgccagaacattcagctgcactggattcgtattgaagatgtgcctgcgatctgggagaagctagaaaccgtcgg actgtccaccatgcttggttgcggtgacgttccacgtgttatcttgggctccccagtttctggcgtagctgctgaagagctgatcgatgccaccccg gctatcgatgcgattcgtgagcgctacctagacaaggaagagttccacaaccttcctcgtaagtttaagactgctatcactggcaaccagcgccagg atgttacccacgaaatccaggacgtttccttcgttccttcgattcacccagaattcggcccaggatttgagtgctttgtgggcggcggcctgtccac caacccaatgcttgctcagccacttggttcttggattccacttgatgaggttccagaagtgtgggctggcgtcgccggaattttccgcgactacggc ttccgacgcctgcgtaaccgtgctcgcctcaagttcttggtggcacagtggggtattgagaagttccgtgaagttcttgagaccgaatacctcgagc gcaagctgattgatggcccagttgttaccaccaaccctggctaccgtgaccacattggcattcacccacaaaaggacggcaagttctacctcggtgt gaagccaaccgttggacacaccaccggtgagcagctcattgccattgctgatgttgcagaaaagcacggcatcaccaggattcgtaccacggcggaa aaggaactgctcttcctcgatattgagcgagagaaccttactaccgttgcacgtgacctggatgaaatcggactgtactcttcaccttccgagttcc gccgcggcatcatttcctgcaccggcttggagttctgcaagcttgcgcacgcaaccaccaagtcacgagcaattgagcttgtggacgaactggaaga gcgactcggcgatttggatgttcccatcaagattgccctgaacggttgccctaactcttgtgcacgcacccaggtttccgacatcggattcaaggga cagaccgtcactgatgctgacggcaaccgcgttgaaggtttccaggttcacctgggcggttccatgaacttggatccaaacttcggacgcaagctca agggccacaaggttattgccgatgaagtgggagagtacgtcactcgcgttgttacccacttcaaggaacagcgccacgaggacgagcacttccgcga ttgggtccagcgggccgctgaggaagatttggtg 11> Homoserine dehydrogenase from Corynebacterium glutamicum MTSASAPSFNPGKGPGSAVGIALLGFGTVGTEVMRLMTEYGDELANRIGGPLEVRGIAVSDISKPREGVAPELLTEDAFALI EREDVDIVVEVIGGIEYPREVVLAALKAGKSVVTANKALVAAHSAELADAAEAANVDLYFEAAVAGAIPVVGPLRRSLAGDQI QSVMGIVNGTTNFILDAMDSTGADYADSLAEATRLGYAEADPTADVEGHDAASKAAILASIAFHTRVTADDVYCEGISNISAA DIEAAQQAGHTIKLLAICEKFTNKEGKSAISARVHPTLLPVSHPLASVNKSFNAIFVEAEAAGRLMFYGNGAGGAPTASAVLG DVVGAARNKVHGGRAPGESTYANLPIADFGETTTRYHLDMDVEDRVEVLAELASLFSEQGISLRTIRQEERDDDARLIVVTH SALESDLSRTVELLKAKPVVKAINSVIRLERD
Claims (28)
1. An engineered microbial cell that comprises increased activity of at least one upstream pathway enzyme leading to L-homocysteine, wherein the at least one upstream pathway enzyme is selected from the group consisting of:
(a) 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase),
(b) sulfite reductase, and
(c) sulfate adenylyltransferase (ATP sulfurase),
said increased activity being increased relative to a control cell, wherein the engineered microbial cell produces L-homocysteine.
2. The engineered microbial cell of claim 1 , wherein the engineered microbial cell expresses at least two of said upstream pathway enzymes, wherein the at least two upstream pathway enzymes are selected from the group consisting of:
(a) a 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase) and a sulfite reductase;
(b) a sulfite reductase and a sulfate adenylyltransferase (ATP sulfurase); and
(c) a 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase) and a sulfate adenylyltransferase (ATP sulfurase).
3. The engineered microbial cell of claim 1 or claim 2 , wherein said upstream pathway enzymes are heterologous enzymes.
4. The engineered microbial cell of claim 3 , wherein the engineered microbial cell expresses:
(a) a heterologous 3-phosphoadenosine-5-phosphosulfate sulfotransferase (PAPS reductase);
(b) a heterologous sulfite reductase, and
(c) a heterologous sulfate adenylyltransferase (ATP sulfurase).
5. The engineered microbial cell of any one of claims 1 -4 , wherein the engineered microbial cell comprises increased activity of one or more additional upstream pathway enzyme(s) leading to L-homocysteine that is/are selected from the group consisting of phosphoadenosine phosphosulfate reductase (PAPS reductase), and homocysteine synthase, said increased activity being increased relative to a control cell.
6. The engineered microbial cell of any one of claims 1 -5 , wherein the engineered microbial cell comprises increased activity of a sulfate transporter, said increased activity being increased relative to a control cell.
7. The engineered microbial cell of any one of claims 1 -6 , wherein the engineered microbial cell comprises increased activity of one or more upstream pathway enzymes leading to O-acetyl-L-homoserine, said increased activity being increased relative to a control cell.
8. The engineered microbial cell of claim 7 , wherein the one or more upstream pathway enzymes leading to O-acetyl-L-homoserine is/are selected from the group consisting of phosphoenolpyruvate carboxykinase (PEP carboxykinase), pyruvate kinase, pyruvate carboxylase, glutamate dehydrogenase, aspartate transaminase (aspartate aminotransferase), aspartate kinase (aspartokinase), aspartate-semialdehyde dehydrogenase, homoserine dehydrogenase, and L-homoserine-O-acetyltransferase.
9. The engineered microbial cell of claim 8 , the one or more upstream pathway enzymes leading to O-acetyl-L-homoserine comprises PEP carboxykinase, and the activity of pyruvate carboxylase is reduced relative to a control cell.
10. The engineered microbial cell of any one of claims 1 -9 , wherein the activity of malate dehydrogenase is reduced relative to a control cell.
11. The engineered microbial cell of any one of claims 1 -10 , wherein the activity of the one or more upstream pathway enzymes is increased by expressing one or more feedback-deregulated enzyme(s).
12. The engineered microbial cell of claim 11 , where the one or more feedback-deregulated enzyme (s) is/are selected from the group consisting of a feedback-deregulated aspartate kinase, a feedback-deregulated homoserine dehydrogenase, a feedback-deregulated aspartate-semialdehyde dehydrogenase, and a feedback-deregulated pyruvate carboxylase.
13. The engineered microbial cell of any one of claims 1 -10 , wherein the activity of the one or more upstream pathway enzymes is increased by expressing one or more upstream pathway enzyme(s) that is/are normally subject to feedback inhibition at the transcriptional level so as to reduce said feedback inhibition at the transcriptional level.
14. The engineered microbial cell of claim 13 , wherein reduced feedback inhibition at the transcriptional level is achieved by a method comprising expressing aspartate kinase from a constitutive promoter.
15. The engineered microbial cell of any one of claims 1 -14 , wherein the engineered microbial cell comprises reduced activity of one or more enzyme(s) that consume one or more upstream pathway precursors, said reduced activity being reduced relative to a control cell.
16. The engineered microbial cell of claim 15 , wherein the one or more enzyme(s) that consume one or more upstream pathway precursors is/are selected from the group consisting of cystathionine gamma-synthase, homoserine kinase, and L-homoserine succinyl transferase.
17. The engineered microbial cell of any one of claims 1 -16 , wherein the engineered microbial cell comprises reduced activity of one or more enzyme(s) that consume L-homocysteine, said reduced activity being reduced relative to a control cell.
18. The engineered microbial cell of claim 17 , wherein the one or more enzyme(s) that consume L-homocysteine is/are selected from the group consisting of cystathionine beta-synthase and methionine synthase.
19. The engineered microbial cell of any one of claims 1 -18 , wherein the engineered microbial cell comprises reduced activity of one or more upstream pathway enzymes leading to cysteine, said reduced activity being reduced relative to a control cell.
20. The engineered microbial cell of claim 19 , wherein the one or more upstream pathway enzymes leading to cysteine is/are selected from the group consisting of 3-phosphoglycerate dehydrogenase, phosphoserine transaminase, phosphoserine phosphatase, serine-O-acetyltransferase, and cysteine synthase.
21. The engineered microbial cell of any of claims 1 -20 , wherein the engineered microbial cell comprises altered cofactor specificity of one or more upstream pathway enzyme(s) from the reduced form of nicotinamide adenine dinucleotide phosphate (NADPH) to the reduced from of nicotinamide adenine dinucleotide (NADH).
22. The engineered microbial cell of claim 21 , wherein the one or more upstream pathway enzyme(s) whose cofactor specificity is altered is/are selected from the group consisting of aspartate semi-aldehyde dehydrogenase, PAPS reductase, and sulfite reductase.
23. The engineered microbial cell of any one of claims 1 -22 , wherein the engineered microbial cell is a Corynebacteria glutamicum cell.
24. The engineered microbial cell of claim 23 , wherein the engineered microbial cell is a Corynebacteria glutamicum cell that expresses:
(a) a heterologous Corynebacteria glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase (PAPS reductase) comprising SEQ ID NO:2;
(b) a heterologous Corynebacteria glutamicum sulfite reductase hemoprotein beta-component comprising SEQ ID NO:3; and
(c) a heterologous Corynebacteria glutamicum sulfate adenylyltransferase subunit 1 comprising SEQ ID NO:1.
25. The engineered microbial cell of claim 23 , wherein the engineered microbial cell is a Corynebacteria glutamicum cell that expresses:
(a) a heterologous Corynebacteria glutamicum 3-phosphoadenosine-5-phosphposulfate sulfotransferase (PAPS reductase) comprising SEQ ID NO:2;
(b) a heterologous Corynebacteria glutamicum sulfite reductase hemoprotein beta-component comprising SEQ ID NO:3; and
(c) a heterologous Corynebacteria glutamicum sulfate adenylyltransferase comprising SEQ ID NO:7.
26. The engineered microbial cell of claim 25 , wherein engineered microbial cell additionally expresses:
(a) a heterologous Lactobacillus acidophilus serine O-acetyltransferase comprising SEQ ID NO:4;
(b) a heterologous Corynebacteria glutamicum homoserine dehydrogenase comprising SEQ ID NO:11; and
(c) a heterologous Lactobacillus collinoides O-acetylhomoserine aminocarboxypropyltransferase comprising SEQ ID NO:6.
27. A culture of engineered microbial cells according to any one of claims 1 -26 , optionally wherein the culture comprises L-homocysteine at a level of at least 15 mg/L of culture medium.
28. A method of culturing engineered microbial cells according to any one of claims 1 -26 , the method comprising culturing the cells under conditions suitable for producing L-homocysteine, optionally wherein the method additionally comprises recovering L-homocysteine from the culture.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/442,090 US20220162655A1 (en) | 2019-03-26 | 2020-03-24 | Engineered biosynthetic pathways for production of l-homocysteine by fermentation |
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201962824220P | 2019-03-26 | 2019-03-26 | |
PCT/US2020/024512 WO2020198258A1 (en) | 2019-03-26 | 2020-03-24 | Engineered biosynthetic pathways for production of l-homocysteine by fermentation |
US17/442,090 US20220162655A1 (en) | 2019-03-26 | 2020-03-24 | Engineered biosynthetic pathways for production of l-homocysteine by fermentation |
Publications (1)
Publication Number | Publication Date |
---|---|
US20220162655A1 true US20220162655A1 (en) | 2022-05-26 |
Family
ID=72611129
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/442,090 Pending US20220162655A1 (en) | 2019-03-26 | 2020-03-24 | Engineered biosynthetic pathways for production of l-homocysteine by fermentation |
Country Status (2)
Country | Link |
---|---|
US (1) | US20220162655A1 (en) |
WO (1) | WO2020198258A1 (en) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20080038787A1 (en) * | 2003-12-18 | 2008-02-14 | Basf Aktiengesellschaft | Methods for the Preparation of a Fine Chemical by Fermentation |
US20090053778A1 (en) * | 2004-07-20 | 2009-02-26 | France Telecom | Microorganisms for producing sulfur-containing compounds |
US20110183383A1 (en) * | 2007-04-11 | 2011-07-28 | CJ Cheijedang Corporation | Compositions and Methods of Producing Methionine |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20080028940A (en) * | 2005-06-17 | 2008-04-02 | 마이크로비아 인코포레이티드 | Improved amino acid and metabolite biosynthesis |
EP1969130B1 (en) * | 2006-01-04 | 2014-03-12 | Metabolic Explorer | Process for the preparation of methionine and its precursors homoserine or succinylhomoserine employing a microorganism |
BR112013023465B1 (en) * | 2011-04-01 | 2020-10-27 | Ajinomoto Co., Inc | method to produce l-cysteine |
-
2020
- 2020-03-24 WO PCT/US2020/024512 patent/WO2020198258A1/en active Application Filing
- 2020-03-24 US US17/442,090 patent/US20220162655A1/en active Pending
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20080038787A1 (en) * | 2003-12-18 | 2008-02-14 | Basf Aktiengesellschaft | Methods for the Preparation of a Fine Chemical by Fermentation |
US20090053778A1 (en) * | 2004-07-20 | 2009-02-26 | France Telecom | Microorganisms for producing sulfur-containing compounds |
US20110183383A1 (en) * | 2007-04-11 | 2011-07-28 | CJ Cheijedang Corporation | Compositions and Methods of Producing Methionine |
Non-Patent Citations (4)
Title |
---|
Accession A0A0F6Z579. 22-JUL-2015 (Year: 2015) * |
Accession Q5FJQ4. 01-MAR-2005 (Year: 2005) * |
Chica et al. Curr Opin Biotechnol. 2005 Aug;16(4):378-84. (Year: 2005) * |
Singh et al. Curr Protein Pept Sci. 2017, 18, 1-11 (Year: 2017) * |
Also Published As
Publication number | Publication date |
---|---|
WO2020198258A1 (en) | 2020-10-01 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11028416B2 (en) | Engineered biosynthetic pathways for production of tyramine by fermentation | |
US20240124907A1 (en) | Engineered Biosynthetic Pathways for Production of Histamine by Fermentation | |
EP3887517A1 (en) | Engineered biosynthetic pathways for production of 1,5-diaminopentane by fermentation | |
US20230392173A1 (en) | Engineered biosynthetic pathway for production of 4-aminophenylethylamine by fermentation | |
US20220162655A1 (en) | Engineered biosynthetic pathways for production of l-homocysteine by fermentation | |
US20220282265A1 (en) | Engineered biosynthetic pathways for production of 3-amino-4-hydroxybenzoic acid by fermentation | |
US20220315965A1 (en) | Engineered biosynthetic pathways for production of cystathionine by fermentation | |
US20230175023A1 (en) | Engineered biosynthetic pathways for production of 3,4-dihydroxybenzoic acid by fermentation | |
US20230399647A1 (en) | Engineered biosynthetic pathways for production of ectoine by fermentation | |
WO2022245340A1 (en) | Engineered biosynthetic pathways for production of deoxyhydrochorismic acid by fermentation | |
US20220033862A1 (en) | Engineered biosynthetic pathways for production of 2-oxoadipate by fermentation | |
Siddiqui | STATEMENT AS TO RIGHTS TO INVENTIONS MADE UNDER FEDERALLY SPONSORED RESEARCH AND DEVELOPMENT | |
WO2023075814A1 (en) | Engineered biosynthetic pathways for production of p-coumaric acid by fermentation | |
WO2020232027A1 (en) | Stabilization of amines with sulfur compounds | |
Noguez et al. | The effect of the nitrogen source and ntrC on the adenylylation of glutamine synthetase I in Rhizobium etli |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |