US20210038684A1 - Compositions and Methods for Cancer Immunotherapy - Google Patents
Compositions and Methods for Cancer Immunotherapy Download PDFInfo
- Publication number
- US20210038684A1 US20210038684A1 US16/898,008 US202016898008A US2021038684A1 US 20210038684 A1 US20210038684 A1 US 20210038684A1 US 202016898008 A US202016898008 A US 202016898008A US 2021038684 A1 US2021038684 A1 US 2021038684A1
- Authority
- US
- United States
- Prior art keywords
- treatment
- dose
- cells
- cancer
- day
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 238000000034 method Methods 0.000 title claims abstract description 89
- 239000000203 mixture Substances 0.000 title claims abstract description 29
- 238000002619 cancer immunotherapy Methods 0.000 title 1
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 247
- 238000011282 treatment Methods 0.000 claims abstract description 194
- 108020001507 fusion proteins Proteins 0.000 claims abstract description 193
- 102000037865 fusion proteins Human genes 0.000 claims abstract description 152
- 201000011510 cancer Diseases 0.000 claims abstract description 127
- 210000004027 cell Anatomy 0.000 claims abstract description 85
- 210000000822 natural killer cell Anatomy 0.000 claims abstract description 72
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 claims abstract description 64
- 231100000673 dose–response relationship Toxicity 0.000 claims abstract description 43
- 230000001105 regulatory effect Effects 0.000 claims abstract description 36
- 241000282414 Homo sapiens Species 0.000 claims abstract description 33
- 210000003289 regulatory T cell Anatomy 0.000 claims abstract description 26
- 230000001976 improved effect Effects 0.000 claims abstract description 10
- 230000004044 response Effects 0.000 claims description 104
- 238000001802 infusion Methods 0.000 claims description 51
- 239000003814 drug Substances 0.000 claims description 43
- 229960002621 pembrolizumab Drugs 0.000 claims description 43
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 claims description 33
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 claims description 33
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 claims description 31
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 claims description 31
- 210000002966 serum Anatomy 0.000 claims description 31
- 201000005488 Capillary Leak Syndrome Diseases 0.000 claims description 28
- 208000031932 Systemic capillary leak syndrome Diseases 0.000 claims description 28
- 101001002657 Homo sapiens Interleukin-2 Proteins 0.000 claims description 27
- 229940124597 therapeutic agent Drugs 0.000 claims description 27
- 208000006265 Renal cell carcinoma Diseases 0.000 claims description 26
- 201000001441 melanoma Diseases 0.000 claims description 25
- 239000008194 pharmaceutical composition Substances 0.000 claims description 25
- 108090001005 Interleukin-6 Proteins 0.000 claims description 24
- 238000010253 intravenous injection Methods 0.000 claims description 21
- 206010009944 Colon cancer Diseases 0.000 claims description 20
- 206010025323 Lymphomas Diseases 0.000 claims description 19
- 239000002246 antineoplastic agent Substances 0.000 claims description 19
- 206010052015 cytokine release syndrome Diseases 0.000 claims description 18
- 230000036961 partial effect Effects 0.000 claims description 17
- 206010006187 Breast cancer Diseases 0.000 claims description 15
- 208000026310 Breast neoplasm Diseases 0.000 claims description 15
- 230000008859 change Effects 0.000 claims description 15
- 238000001990 intravenous administration Methods 0.000 claims description 15
- 208000017604 Hodgkin disease Diseases 0.000 claims description 14
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 claims description 14
- 208000032839 leukemia Diseases 0.000 claims description 13
- 208000002154 non-small cell lung carcinoma Diseases 0.000 claims description 13
- 229940127089 cytotoxic agent Drugs 0.000 claims description 12
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 claims description 12
- 206010039491 Sarcoma Diseases 0.000 claims description 11
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 10
- 206010005003 Bladder cancer Diseases 0.000 claims description 9
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 9
- 206010060862 Prostate cancer Diseases 0.000 claims description 9
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 claims description 9
- 208000029742 colonic neoplasm Diseases 0.000 claims description 9
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 9
- 201000002528 pancreatic cancer Diseases 0.000 claims description 9
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 9
- 201000005112 urinary bladder cancer Diseases 0.000 claims description 9
- 201000009030 Carcinoma Diseases 0.000 claims description 8
- 208000021519 Hodgkin lymphoma Diseases 0.000 claims description 8
- 208000010747 Hodgkins lymphoma Diseases 0.000 claims description 8
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 8
- 108010074708 B7-H1 Antigen Proteins 0.000 claims description 7
- 208000034578 Multiple myelomas Diseases 0.000 claims description 7
- 102100040678 Programmed cell death protein 1 Human genes 0.000 claims description 7
- 201000007270 liver cancer Diseases 0.000 claims description 7
- 239000011886 peripheral blood Substances 0.000 claims description 7
- 230000002829 reductive effect Effects 0.000 claims description 7
- 210000005259 peripheral blood Anatomy 0.000 claims description 6
- 208000000461 Esophageal Neoplasms Diseases 0.000 claims description 5
- 206010030155 Oesophageal carcinoma Diseases 0.000 claims description 5
- 201000004101 esophageal cancer Diseases 0.000 claims description 5
- 238000002347 injection Methods 0.000 claims description 5
- 239000007924 injection Substances 0.000 claims description 5
- 230000003993 interaction Effects 0.000 claims description 5
- 208000014018 liver neoplasm Diseases 0.000 claims description 5
- 230000003442 weekly effect Effects 0.000 claims description 5
- 206010008342 Cervix carcinoma Diseases 0.000 claims description 4
- 239000012661 PARP inhibitor Substances 0.000 claims description 4
- 229940121906 Poly ADP ribose polymerase inhibitor Drugs 0.000 claims description 4
- 208000024770 Thyroid neoplasm Diseases 0.000 claims description 4
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 claims description 4
- 201000010881 cervical cancer Diseases 0.000 claims description 4
- 239000002254 cytotoxic agent Substances 0.000 claims description 4
- 210000002381 plasma Anatomy 0.000 claims description 4
- 201000002510 thyroid cancer Diseases 0.000 claims description 4
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 claims description 3
- 206010027406 Mesothelioma Diseases 0.000 claims description 2
- 208000003445 Mouth Neoplasms Diseases 0.000 claims description 2
- 101710089372 Programmed cell death protein 1 Proteins 0.000 claims description 2
- 208000015634 Rectal Neoplasms Diseases 0.000 claims description 2
- 210000001072 colon Anatomy 0.000 claims description 2
- 231100000599 cytotoxic agent Toxicity 0.000 claims description 2
- 206010038038 rectal cancer Diseases 0.000 claims description 2
- 201000001275 rectum cancer Diseases 0.000 claims description 2
- 201000008261 skin carcinoma Diseases 0.000 claims description 2
- 201000005787 hematologic cancer Diseases 0.000 claims 2
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 claims 2
- 102000008096 B7-H1 Antigen Human genes 0.000 claims 1
- 108010002350 Interleukin-2 Proteins 0.000 abstract description 67
- 238000009169 immunotherapy Methods 0.000 abstract description 17
- 230000001506 immunosuppresive effect Effects 0.000 abstract description 10
- 239000000427 antigen Substances 0.000 description 124
- 108091007433 antigens Proteins 0.000 description 123
- 102000036639 antigens Human genes 0.000 description 123
- 102000000588 Interleukin-2 Human genes 0.000 description 66
- 238000002560 therapeutic procedure Methods 0.000 description 48
- 108090000765 processed proteins & peptides Proteins 0.000 description 47
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 46
- 230000001225 therapeutic effect Effects 0.000 description 45
- 230000000694 effects Effects 0.000 description 44
- 108090000623 proteins and genes Proteins 0.000 description 44
- 150000001413 amino acids Chemical class 0.000 description 43
- 102000004169 proteins and genes Human genes 0.000 description 39
- 210000001744 T-lymphocyte Anatomy 0.000 description 37
- 229940024606 amino acid Drugs 0.000 description 37
- 235000001014 amino acid Nutrition 0.000 description 37
- 235000018102 proteins Nutrition 0.000 description 37
- 201000010099 disease Diseases 0.000 description 34
- 229960005486 vaccine Drugs 0.000 description 34
- 230000000875 corresponding effect Effects 0.000 description 32
- 208000024891 symptom Diseases 0.000 description 31
- -1 CGEN-15049 Proteins 0.000 description 27
- 230000034994 death Effects 0.000 description 24
- 238000011269 treatment regimen Methods 0.000 description 24
- 231100000371 dose-limiting toxicity Toxicity 0.000 description 23
- 102000004127 Cytokines Human genes 0.000 description 22
- 108090000695 Cytokines Proteins 0.000 description 22
- 102000004889 Interleukin-6 Human genes 0.000 description 22
- 230000000259 anti-tumor effect Effects 0.000 description 22
- 229940100601 interleukin-6 Drugs 0.000 description 22
- 239000003795 chemical substances by application Substances 0.000 description 21
- 238000002648 combination therapy Methods 0.000 description 20
- 102000004196 processed proteins & peptides Human genes 0.000 description 20
- 208000037821 progressive disease Diseases 0.000 description 20
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 19
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 19
- 230000003285 pharmacodynamic effect Effects 0.000 description 19
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 18
- 210000001519 tissue Anatomy 0.000 description 17
- 102000001301 EGF receptor Human genes 0.000 description 16
- 238000004458 analytical method Methods 0.000 description 16
- 229920001184 polypeptide Polymers 0.000 description 16
- 238000009097 single-agent therapy Methods 0.000 description 16
- 108060006698 EGF receptor Proteins 0.000 description 15
- 230000004083 survival effect Effects 0.000 description 14
- 208000003174 Brain Neoplasms Diseases 0.000 description 13
- 101100519207 Mus musculus Pdcd1 gene Proteins 0.000 description 13
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 13
- 231100000682 maximum tolerated dose Toxicity 0.000 description 13
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 12
- 239000002671 adjuvant Substances 0.000 description 12
- 208000035475 disorder Diseases 0.000 description 12
- 230000028993 immune response Effects 0.000 description 12
- 150000003839 salts Chemical class 0.000 description 12
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 11
- 208000037844 advanced solid tumor Diseases 0.000 description 11
- 150000001875 compounds Chemical class 0.000 description 11
- 239000003446 ligand Substances 0.000 description 11
- 150000003384 small molecules Chemical class 0.000 description 11
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 10
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 10
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 10
- 229940079593 drug Drugs 0.000 description 10
- 230000003902 lesion Effects 0.000 description 10
- 239000002904 solvent Substances 0.000 description 10
- 210000004881 tumor cell Anatomy 0.000 description 10
- 239000013598 vector Substances 0.000 description 10
- 108010038453 Interleukin-2 Receptors Proteins 0.000 description 9
- 102000010789 Interleukin-2 Receptors Human genes 0.000 description 9
- 206010037660 Pyrexia Diseases 0.000 description 9
- 230000004913 activation Effects 0.000 description 9
- 230000002411 adverse Effects 0.000 description 9
- 238000011394 anticancer treatment Methods 0.000 description 9
- 230000003915 cell function Effects 0.000 description 9
- 239000000546 pharmaceutical excipient Substances 0.000 description 9
- 230000009885 systemic effect Effects 0.000 description 9
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 8
- 206010033128 Ovarian cancer Diseases 0.000 description 8
- 206010061535 Ovarian neoplasm Diseases 0.000 description 8
- 108091008605 VEGF receptors Proteins 0.000 description 8
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 8
- 230000001154 acute effect Effects 0.000 description 8
- 230000008901 benefit Effects 0.000 description 8
- 238000011156 evaluation Methods 0.000 description 8
- 230000014509 gene expression Effects 0.000 description 8
- 201000005202 lung cancer Diseases 0.000 description 8
- 208000020816 lung neoplasm Diseases 0.000 description 8
- 230000035935 pregnancy Effects 0.000 description 8
- 238000001959 radiotherapy Methods 0.000 description 8
- 230000009467 reduction Effects 0.000 description 8
- 238000012552 review Methods 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 108020004414 DNA Proteins 0.000 description 7
- 241000282412 Homo Species 0.000 description 7
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 7
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 7
- 108700025316 aldesleukin Proteins 0.000 description 7
- 210000004369 blood Anatomy 0.000 description 7
- 239000008280 blood Substances 0.000 description 7
- 231100000433 cytotoxic Toxicity 0.000 description 7
- 230000001472 cytotoxic effect Effects 0.000 description 7
- 230000004069 differentiation Effects 0.000 description 7
- 239000012636 effector Substances 0.000 description 7
- 239000012634 fragment Substances 0.000 description 7
- 230000002496 gastric effect Effects 0.000 description 7
- 208000015181 infectious disease Diseases 0.000 description 7
- 229960003301 nivolumab Drugs 0.000 description 7
- 229940023041 peptide vaccine Drugs 0.000 description 7
- 229940002612 prodrug Drugs 0.000 description 7
- 239000000651 prodrug Substances 0.000 description 7
- 206010061818 Disease progression Diseases 0.000 description 6
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 6
- 206010018338 Glioma Diseases 0.000 description 6
- 102100037850 Interferon gamma Human genes 0.000 description 6
- 108010074328 Interferon-gamma Proteins 0.000 description 6
- 241000699670 Mus sp. Species 0.000 description 6
- 208000000453 Skin Neoplasms Diseases 0.000 description 6
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 description 6
- 230000002159 abnormal effect Effects 0.000 description 6
- 229960005310 aldesleukin Drugs 0.000 description 6
- 229940100198 alkylating agent Drugs 0.000 description 6
- 239000002168 alkylating agent Substances 0.000 description 6
- 239000005557 antagonist Substances 0.000 description 6
- 230000001093 anti-cancer Effects 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 238000002659 cell therapy Methods 0.000 description 6
- 239000003085 diluting agent Substances 0.000 description 6
- 230000005750 disease progression Effects 0.000 description 6
- 239000003995 emulsifying agent Substances 0.000 description 6
- 201000000459 head and neck squamous cell carcinoma Diseases 0.000 description 6
- 210000002865 immune cell Anatomy 0.000 description 6
- 230000002163 immunogen Effects 0.000 description 6
- 230000002757 inflammatory effect Effects 0.000 description 6
- 230000005764 inhibitory process Effects 0.000 description 6
- 230000000977 initiatory effect Effects 0.000 description 6
- 229960005386 ipilimumab Drugs 0.000 description 6
- 230000002611 ovarian Effects 0.000 description 6
- 239000000047 product Substances 0.000 description 6
- 230000000770 proinflammatory effect Effects 0.000 description 6
- 108010014186 ras Proteins Proteins 0.000 description 6
- 201000000849 skin cancer Diseases 0.000 description 6
- 229940124676 vascular endothelial growth factor receptor Drugs 0.000 description 6
- KKVYYGGCHJGEFJ-UHFFFAOYSA-N 1-n-(4-chlorophenyl)-6-methyl-5-n-[3-(7h-purin-6-yl)pyridin-2-yl]isoquinoline-1,5-diamine Chemical compound N=1C=CC2=C(NC=3C(=CC=CN=3)C=3C=4N=CNC=4N=CN=3)C(C)=CC=C2C=1NC1=CC=C(Cl)C=C1 KKVYYGGCHJGEFJ-UHFFFAOYSA-N 0.000 description 5
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 5
- 229940045513 CTLA4 antagonist Drugs 0.000 description 5
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 5
- 108010041986 DNA Vaccines Proteins 0.000 description 5
- 229940021995 DNA vaccine Drugs 0.000 description 5
- 241000196324 Embryophyta Species 0.000 description 5
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 5
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 5
- 208000032672 Histiocytosis haematophagic Diseases 0.000 description 5
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 5
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 description 5
- 108090000174 Interleukin-10 Proteins 0.000 description 5
- 102000003814 Interleukin-10 Human genes 0.000 description 5
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 5
- 102000002698 KIR Receptors Human genes 0.000 description 5
- 108010043610 KIR Receptors Proteins 0.000 description 5
- 102000017578 LAG3 Human genes 0.000 description 5
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 5
- 208000004987 Macrophage activation syndrome Diseases 0.000 description 5
- 102100028389 Melanoma antigen recognized by T-cells 1 Human genes 0.000 description 5
- 206010027480 Metastatic malignant melanoma Diseases 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 101100381978 Mus musculus Braf gene Proteins 0.000 description 5
- 206010061309 Neoplasm progression Diseases 0.000 description 5
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 5
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 5
- 102100038358 Prostate-specific antigen Human genes 0.000 description 5
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 5
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 5
- 206010045170 Tumour lysis syndrome Diseases 0.000 description 5
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 description 5
- 239000000090 biomarker Substances 0.000 description 5
- 230000001684 chronic effect Effects 0.000 description 5
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 5
- 238000013461 design Methods 0.000 description 5
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 description 5
- 201000010536 head and neck cancer Diseases 0.000 description 5
- 208000014829 head and neck neoplasm Diseases 0.000 description 5
- 239000003112 inhibitor Substances 0.000 description 5
- 229940076144 interleukin-10 Drugs 0.000 description 5
- 208000021039 metastatic melanoma Diseases 0.000 description 5
- 230000002685 pulmonary effect Effects 0.000 description 5
- 230000001988 toxicity Effects 0.000 description 5
- 231100000419 toxicity Toxicity 0.000 description 5
- 208000010380 tumor lysis syndrome Diseases 0.000 description 5
- 230000005751 tumor progression Effects 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- PUPZLCDOIYMWBV-UHFFFAOYSA-N (+/-)-1,3-Butanediol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 4
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 4
- 101150051188 Adora2a gene Proteins 0.000 description 4
- 206010003571 Astrocytoma Diseases 0.000 description 4
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 4
- BPYKTIZUTYGOLE-IFADSCNNSA-N Bilirubin Chemical compound N1C(=O)C(C)=C(C=C)\C1=C\C1=C(C)C(CCC(O)=O)=C(CC2=C(C(C)=C(\C=C/3C(=C(C=C)C(=O)N\3)C)N2)CCC(O)=O)N1 BPYKTIZUTYGOLE-IFADSCNNSA-N 0.000 description 4
- 102100038078 CD276 antigen Human genes 0.000 description 4
- 101710185679 CD276 antigen Proteins 0.000 description 4
- 101150050673 CHK1 gene Proteins 0.000 description 4
- 206010010144 Completed suicide Diseases 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- 102100031351 Galectin-9 Human genes 0.000 description 4
- 101100229077 Gallus gallus GAL9 gene Proteins 0.000 description 4
- 208000021309 Germ cell tumor Diseases 0.000 description 4
- 208000032612 Glial tumor Diseases 0.000 description 4
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 4
- 101000834898 Homo sapiens Alpha-synuclein Proteins 0.000 description 4
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 4
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 4
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 description 4
- 101000578784 Homo sapiens Melanoma antigen recognized by T-cells 1 Proteins 0.000 description 4
- 101001117317 Homo sapiens Programmed cell death 1 ligand 1 Proteins 0.000 description 4
- 101001117312 Homo sapiens Programmed cell death 1 ligand 2 Proteins 0.000 description 4
- 101000611936 Homo sapiens Programmed cell death protein 1 Proteins 0.000 description 4
- 101000777277 Homo sapiens Serine/threonine-protein kinase Chk2 Proteins 0.000 description 4
- 101000652359 Homo sapiens Spermatogenesis-associated protein 2 Proteins 0.000 description 4
- 208000001953 Hypotension Diseases 0.000 description 4
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 4
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 4
- 206010027476 Metastases Diseases 0.000 description 4
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 4
- 206010028813 Nausea Diseases 0.000 description 4
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 description 4
- 206010030113 Oedema Diseases 0.000 description 4
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 4
- 229940127361 Receptor Tyrosine Kinase Inhibitors Drugs 0.000 description 4
- 102100031075 Serine/threonine-protein kinase Chk2 Human genes 0.000 description 4
- 206010041067 Small cell lung cancer Diseases 0.000 description 4
- 208000005718 Stomach Neoplasms Diseases 0.000 description 4
- 101800001271 Surface protein Proteins 0.000 description 4
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 4
- 108010079206 V-Set Domain-Containing T-Cell Activation Inhibitor 1 Proteins 0.000 description 4
- 102100038929 V-set domain-containing T-cell activation inhibitor 1 Human genes 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- 239000004037 angiogenesis inhibitor Substances 0.000 description 4
- 229940121369 angiogenesis inhibitor Drugs 0.000 description 4
- 239000003242 anti bacterial agent Substances 0.000 description 4
- 229940088710 antibiotic agent Drugs 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 230000032823 cell division Effects 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 238000009826 distribution Methods 0.000 description 4
- 230000002708 enhancing effect Effects 0.000 description 4
- 229940088598 enzyme Drugs 0.000 description 4
- 206010017758 gastric cancer Diseases 0.000 description 4
- 230000002068 genetic effect Effects 0.000 description 4
- 230000036543 hypotension Effects 0.000 description 4
- 230000002267 hypothalamic effect Effects 0.000 description 4
- 210000000987 immune system Anatomy 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 210000004072 lung Anatomy 0.000 description 4
- 208000003747 lymphoid leukemia Diseases 0.000 description 4
- 230000003211 malignant effect Effects 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 230000009401 metastasis Effects 0.000 description 4
- 230000008693 nausea Effects 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 125000003729 nucleotide group Chemical group 0.000 description 4
- 230000000737 periodic effect Effects 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 239000003755 preservative agent Substances 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 230000002062 proliferating effect Effects 0.000 description 4
- 102000016914 ras Proteins Human genes 0.000 description 4
- 102000027426 receptor tyrosine kinases Human genes 0.000 description 4
- 108091008598 receptor tyrosine kinases Proteins 0.000 description 4
- 102000005962 receptors Human genes 0.000 description 4
- 108020003175 receptors Proteins 0.000 description 4
- 208000000587 small cell lung carcinoma Diseases 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 210000002784 stomach Anatomy 0.000 description 4
- 201000011549 stomach cancer Diseases 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- 231100000331 toxic Toxicity 0.000 description 4
- 230000002588 toxic effect Effects 0.000 description 4
- 230000001052 transient effect Effects 0.000 description 4
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- 208000009304 Acute Kidney Injury Diseases 0.000 description 3
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 3
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 3
- 239000012275 CTLA-4 inhibitor Substances 0.000 description 3
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 3
- 206010010904 Convulsion Diseases 0.000 description 3
- 206010012735 Diarrhoea Diseases 0.000 description 3
- 208000000059 Dyspnea Diseases 0.000 description 3
- 206010013975 Dyspnoeas Diseases 0.000 description 3
- 108091008794 FGF receptors Proteins 0.000 description 3
- 102000044168 Fibroblast Growth Factor Receptor Human genes 0.000 description 3
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 3
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 3
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 3
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 3
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 3
- 206010061218 Inflammation Diseases 0.000 description 3
- 102000013462 Interleukin-12 Human genes 0.000 description 3
- 108010065805 Interleukin-12 Proteins 0.000 description 3
- 102000000704 Interleukin-7 Human genes 0.000 description 3
- 108010002586 Interleukin-7 Proteins 0.000 description 3
- 102000004890 Interleukin-8 Human genes 0.000 description 3
- 108090001007 Interleukin-8 Proteins 0.000 description 3
- 208000008839 Kidney Neoplasms Diseases 0.000 description 3
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 3
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 3
- OFOBLEOULBTSOW-UHFFFAOYSA-N Malonic acid Chemical compound OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 3
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 3
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 3
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 3
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 3
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 206010038389 Renal cancer Diseases 0.000 description 3
- 229940123237 Taxane Drugs 0.000 description 3
- 102000006601 Thymidine Kinase Human genes 0.000 description 3
- 108020004440 Thymidine kinase Proteins 0.000 description 3
- 206010046865 Vaccinia virus infection Diseases 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- 206010047700 Vomiting Diseases 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 239000002256 antimetabolite Substances 0.000 description 3
- 206010003119 arrhythmia Diseases 0.000 description 3
- 229950002916 avelumab Drugs 0.000 description 3
- 239000002585 base Substances 0.000 description 3
- 210000004204 blood vessel Anatomy 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- 229940022399 cancer vaccine Drugs 0.000 description 3
- 238000009566 cancer vaccine Methods 0.000 description 3
- 208000002458 carcinoid tumor Diseases 0.000 description 3
- 230000030833 cell death Effects 0.000 description 3
- 229940030156 cell vaccine Drugs 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 3
- 230000006378 damage Effects 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 239000002552 dosage form Substances 0.000 description 3
- 229960004679 doxorubicin Drugs 0.000 description 3
- 229950009791 durvalumab Drugs 0.000 description 3
- 210000002889 endothelial cell Anatomy 0.000 description 3
- 235000019441 ethanol Nutrition 0.000 description 3
- 230000001747 exhibiting effect Effects 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 229960002949 fluorouracil Drugs 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 3
- 229960001101 ifosfamide Drugs 0.000 description 3
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 3
- 208000026278 immune system disease Diseases 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 239000002955 immunomodulating agent Substances 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 230000006698 induction Effects 0.000 description 3
- 230000004054 inflammatory process Effects 0.000 description 3
- 229940117681 interleukin-12 Drugs 0.000 description 3
- 229940100994 interleukin-7 Drugs 0.000 description 3
- 229940096397 interleukin-8 Drugs 0.000 description 3
- XKTZWUACRZHVAN-VADRZIEHSA-N interleukin-8 Chemical compound C([C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@@H](NC(C)=O)CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N1[C@H](CCC1)C(=O)N1[C@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC(O)=CC=1)C(=O)N[C@H](CO)C(=O)N1[C@H](CCC1)C(N)=O)C1=CC=CC=C1 XKTZWUACRZHVAN-VADRZIEHSA-N 0.000 description 3
- 210000004153 islets of langerhan Anatomy 0.000 description 3
- 201000010982 kidney cancer Diseases 0.000 description 3
- 230000002045 lasting effect Effects 0.000 description 3
- 201000002364 leukopenia Diseases 0.000 description 3
- 231100001022 leukopenia Toxicity 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 229960000485 methotrexate Drugs 0.000 description 3
- 150000007522 mineralic acids Chemical class 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- 201000005962 mycosis fungoides Diseases 0.000 description 3
- 208000004235 neutropenia Diseases 0.000 description 3
- 231100000252 nontoxic Toxicity 0.000 description 3
- 230000003000 nontoxic effect Effects 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 150000007523 nucleic acids Chemical class 0.000 description 3
- 201000002575 ocular melanoma Diseases 0.000 description 3
- 239000003921 oil Substances 0.000 description 3
- 235000019198 oils Nutrition 0.000 description 3
- 150000007524 organic acids Chemical class 0.000 description 3
- 230000007170 pathology Effects 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 3
- 230000002335 preservative effect Effects 0.000 description 3
- 208000015347 renal cell adenocarcinoma Diseases 0.000 description 3
- 230000011664 signaling Effects 0.000 description 3
- 229960001052 streptozocin Drugs 0.000 description 3
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 201000008205 supratentorial primitive neuroectodermal tumor Diseases 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 3
- 238000011285 therapeutic regimen Methods 0.000 description 3
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 description 3
- 208000007089 vaccinia Diseases 0.000 description 3
- 230000002792 vascular Effects 0.000 description 3
- 210000000239 visual pathway Anatomy 0.000 description 3
- 230000004400 visual pathway Effects 0.000 description 3
- 230000008673 vomiting Effects 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- IPVFGAYTKQKGBM-BYPJNBLXSA-N 1-[(2r,3s,4r,5r)-3-fluoro-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-iodopyrimidine-2,4-dione Chemical compound F[C@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 IPVFGAYTKQKGBM-BYPJNBLXSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 2
- XMIIGOLPHOKFCH-UHFFFAOYSA-N 3-phenylpropionic acid Chemical compound OC(=O)CCC1=CC=CC=C1 XMIIGOLPHOKFCH-UHFFFAOYSA-N 0.000 description 2
- 208000030507 AIDS Diseases 0.000 description 2
- 241000239290 Araneae Species 0.000 description 2
- 208000006820 Arthralgia Diseases 0.000 description 2
- 206010060971 Astrocytoma malignant Diseases 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 208000003950 B-cell lymphoma Diseases 0.000 description 2
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 206010004593 Bile duct cancer Diseases 0.000 description 2
- 206010006143 Brain stem glioma Diseases 0.000 description 2
- 206010055113 Breast cancer metastatic Diseases 0.000 description 2
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 2
- 108010080937 Carboxypeptidases A Proteins 0.000 description 2
- 102000000496 Carboxypeptidases A Human genes 0.000 description 2
- 206010007275 Carcinoid tumour Diseases 0.000 description 2
- 206010007953 Central nervous system lymphoma Diseases 0.000 description 2
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 description 2
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 206010052358 Colorectal cancer metastatic Diseases 0.000 description 2
- 241000759568 Corixa Species 0.000 description 2
- 108090000404 Cyclin G1 Proteins 0.000 description 2
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 2
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 2
- 102000000311 Cytosine Deaminase Human genes 0.000 description 2
- 108010080611 Cytosine Deaminase Proteins 0.000 description 2
- RGHNJXZEOKUKBD-SQOUGZDYSA-N D-gluconic acid Chemical group OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)=O RGHNJXZEOKUKBD-SQOUGZDYSA-N 0.000 description 2
- 230000006820 DNA synthesis Effects 0.000 description 2
- 206010012218 Delirium Diseases 0.000 description 2
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- 206010014967 Ependymoma Diseases 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 208000012468 Ewing sarcoma/peripheral primitive neuroectodermal tumor Diseases 0.000 description 2
- 208000002633 Febrile Neutropenia Diseases 0.000 description 2
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 2
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 2
- 108010060309 Glucuronidase Proteins 0.000 description 2
- 102000053187 Glucuronidase Human genes 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Chemical group OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Chemical compound OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 2
- 208000032843 Hemorrhage Diseases 0.000 description 2
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 2
- 101000746373 Homo sapiens Granulocyte-macrophage colony-stimulating factor Proteins 0.000 description 2
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 2
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 2
- 102000006992 Interferon-alpha Human genes 0.000 description 2
- 108010047761 Interferon-alpha Proteins 0.000 description 2
- 102000000589 Interleukin-1 Human genes 0.000 description 2
- 108010002352 Interleukin-1 Proteins 0.000 description 2
- 102000003816 Interleukin-13 Human genes 0.000 description 2
- 108090000176 Interleukin-13 Proteins 0.000 description 2
- 102000003812 Interleukin-15 Human genes 0.000 description 2
- 108090000172 Interleukin-15 Proteins 0.000 description 2
- 102000049772 Interleukin-16 Human genes 0.000 description 2
- 101800003050 Interleukin-16 Proteins 0.000 description 2
- 102000003810 Interleukin-18 Human genes 0.000 description 2
- 108090000171 Interleukin-18 Proteins 0.000 description 2
- 102000013264 Interleukin-23 Human genes 0.000 description 2
- 108010065637 Interleukin-23 Proteins 0.000 description 2
- 102000004388 Interleukin-4 Human genes 0.000 description 2
- 108090000978 Interleukin-4 Proteins 0.000 description 2
- 102000000743 Interleukin-5 Human genes 0.000 description 2
- 108010002616 Interleukin-5 Proteins 0.000 description 2
- 206010061252 Intraocular melanoma Diseases 0.000 description 2
- 108010044023 Ki-1 Antigen Proteins 0.000 description 2
- 102000003855 L-lactate dehydrogenase Human genes 0.000 description 2
- 108700023483 L-lactate dehydrogenases Proteins 0.000 description 2
- 206010023825 Laryngeal cancer Diseases 0.000 description 2
- 208000028018 Lymphocytic leukaemia Diseases 0.000 description 2
- 102000043131 MHC class II family Human genes 0.000 description 2
- 108091054438 MHC class II family Proteins 0.000 description 2
- 206010025557 Malignant fibrous histiocytoma of bone Diseases 0.000 description 2
- 208000000172 Medulloblastoma Diseases 0.000 description 2
- 102000000440 Melanoma-associated antigen Human genes 0.000 description 2
- 108050008953 Melanoma-associated antigen Proteins 0.000 description 2
- 206010050513 Metastatic renal cell carcinoma Diseases 0.000 description 2
- 102100034256 Mucin-1 Human genes 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 208000000112 Myalgia Diseases 0.000 description 2
- 241001467552 Mycobacterium bovis BCG Species 0.000 description 2
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 2
- FUSGACRLAFQQRL-UHFFFAOYSA-N N-Ethyl-N-nitrosourea Chemical compound CCN(N=O)C(N)=O FUSGACRLAFQQRL-UHFFFAOYSA-N 0.000 description 2
- ZRKWMRDKSOPRRS-UHFFFAOYSA-N N-Methyl-N-nitrosourea Chemical compound O=NN(C)C(N)=O ZRKWMRDKSOPRRS-UHFFFAOYSA-N 0.000 description 2
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 2
- 208000012902 Nervous system disease Diseases 0.000 description 2
- 102000004459 Nitroreductase Human genes 0.000 description 2
- 108090000854 Oxidoreductases Proteins 0.000 description 2
- 102000004316 Oxidoreductases Human genes 0.000 description 2
- 108091008606 PDGF receptors Proteins 0.000 description 2
- 229930012538 Paclitaxel Natural products 0.000 description 2
- 206010033661 Pancytopenia Diseases 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 102000011653 Platelet-Derived Growth Factor Receptors Human genes 0.000 description 2
- 206010035664 Pneumonia Diseases 0.000 description 2
- 229920001213 Polysorbate 20 Polymers 0.000 description 2
- LCTONWCANYUPML-UHFFFAOYSA-N Pyruvic acid Chemical compound CC(=O)C(O)=O LCTONWCANYUPML-UHFFFAOYSA-N 0.000 description 2
- AHHFEZNOXOZZQA-ZEBDFXRSSA-N Ranimustine Chemical compound CO[C@H]1O[C@H](CNC(=O)N(CCCl)N=O)[C@@H](O)[C@H](O)[C@H]1O AHHFEZNOXOZZQA-ZEBDFXRSSA-N 0.000 description 2
- 208000033626 Renal failure acute Diseases 0.000 description 2
- 201000000582 Retinoblastoma Diseases 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 230000024932 T cell mediated immunity Effects 0.000 description 2
- 230000005867 T cell response Effects 0.000 description 2
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 2
- 208000001871 Tachycardia Diseases 0.000 description 2
- 201000009365 Thymic carcinoma Diseases 0.000 description 2
- 102000002689 Toll-like receptor Human genes 0.000 description 2
- 108020000411 Toll-like receptor Proteins 0.000 description 2
- 206010044221 Toxic encephalopathy Diseases 0.000 description 2
- 206010044565 Tremor Diseases 0.000 description 2
- 102100040247 Tumor necrosis factor Human genes 0.000 description 2
- 201000005969 Uveal melanoma Diseases 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 108700005077 Viral Genes Proteins 0.000 description 2
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 2
- 230000001594 aberrant effect Effects 0.000 description 2
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 2
- 201000011040 acute kidney failure Diseases 0.000 description 2
- 208000020990 adrenal cortex carcinoma Diseases 0.000 description 2
- 208000007128 adrenocortical carcinoma Diseases 0.000 description 2
- 229940009456 adriamycin Drugs 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 208000007502 anemia Diseases 0.000 description 2
- 230000033115 angiogenesis Effects 0.000 description 2
- 230000006023 anti-tumor response Effects 0.000 description 2
- 230000030741 antigen processing and presentation Effects 0.000 description 2
- 210000000612 antigen-presenting cell Anatomy 0.000 description 2
- 229940045719 antineoplastic alkylating agent nitrosoureas Drugs 0.000 description 2
- 230000005975 antitumor immune response Effects 0.000 description 2
- 201000007201 aphasia Diseases 0.000 description 2
- 230000006793 arrhythmia Effects 0.000 description 2
- 229960003852 atezolizumab Drugs 0.000 description 2
- 229960000190 bacillus calmette–guérin vaccine Drugs 0.000 description 2
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 2
- SESFRYSPDFLNCH-UHFFFAOYSA-N benzyl benzoate Chemical compound C=1C=CC=CC=1C(=O)OCC1=CC=CC=C1 SESFRYSPDFLNCH-UHFFFAOYSA-N 0.000 description 2
- 238000001574 biopsy Methods 0.000 description 2
- 210000000481 breast Anatomy 0.000 description 2
- 229960000455 brentuximab vedotin Drugs 0.000 description 2
- 235000019437 butane-1,3-diol Nutrition 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 230000000747 cardiac effect Effects 0.000 description 2
- 229960005243 carmustine Drugs 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 210000003169 central nervous system Anatomy 0.000 description 2
- 201000007335 cerebellar astrocytoma Diseases 0.000 description 2
- 208000030239 cerebral astrocytoma Diseases 0.000 description 2
- 230000002490 cerebral effect Effects 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- 229960004316 cisplatin Drugs 0.000 description 2
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 2
- 206010009887 colitis Diseases 0.000 description 2
- 238000012790 confirmation Methods 0.000 description 2
- 229960004397 cyclophosphamide Drugs 0.000 description 2
- 208000031513 cyst Diseases 0.000 description 2
- 229960000684 cytarabine Drugs 0.000 description 2
- 231100000409 cytocidal Toxicity 0.000 description 2
- 230000000445 cytocidal effect Effects 0.000 description 2
- 230000016396 cytokine production Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 229940029030 dendritic cell vaccine Drugs 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- XBDQKXXYIPTUBI-UHFFFAOYSA-N dimethylselenoniopropionate Natural products CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 2
- 208000009190 disseminated intravascular coagulation Diseases 0.000 description 2
- 230000002526 effect on cardiovascular system Effects 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 2
- 229960005420 etoposide Drugs 0.000 description 2
- 208000024519 eye neoplasm Diseases 0.000 description 2
- 206010016256 fatigue Diseases 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 230000027950 fever generation Effects 0.000 description 2
- XRECTZIEBJDKEO-UHFFFAOYSA-N flucytosine Chemical compound NC1=NC(=O)NC=C1F XRECTZIEBJDKEO-UHFFFAOYSA-N 0.000 description 2
- 229960004413 flucytosine Drugs 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 201000003444 follicular lymphoma Diseases 0.000 description 2
- 208000005017 glioblastoma Diseases 0.000 description 2
- 239000004220 glutamic acid Chemical group 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 208000029824 high grade glioma Diseases 0.000 description 2
- 102000055277 human IL2 Human genes 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 230000005934 immune activation Effects 0.000 description 2
- 230000005746 immune checkpoint blockade Effects 0.000 description 2
- 230000003308 immunostimulating effect Effects 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 239000003701 inert diluent Substances 0.000 description 2
- 229960003130 interferon gamma Drugs 0.000 description 2
- 229940124829 interleukin-23 Drugs 0.000 description 2
- 102000003898 interleukin-24 Human genes 0.000 description 2
- 108090000237 interleukin-24 Proteins 0.000 description 2
- 229940028885 interleukin-4 Drugs 0.000 description 2
- 229940100602 interleukin-5 Drugs 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 230000002601 intratumoral effect Effects 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- SUMDYPCJJOFFON-UHFFFAOYSA-N isethionic acid Chemical compound OCCS(O)(=O)=O SUMDYPCJJOFFON-UHFFFAOYSA-N 0.000 description 2
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 2
- 210000000244 kidney pelvis Anatomy 0.000 description 2
- 230000002147 killing effect Effects 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 2
- BCFGMOOMADDAQU-UHFFFAOYSA-N lapatinib Chemical compound O1C(CNCCS(=O)(=O)C)=CC=C1C1=CC=C(N=CN=C2NC=3C=C(Cl)C(OCC=4C=C(F)C=CC=4)=CC=3)C2=C1 BCFGMOOMADDAQU-UHFFFAOYSA-N 0.000 description 2
- 206010023841 laryngeal neoplasm Diseases 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 229920006008 lipopolysaccharide Polymers 0.000 description 2
- 239000008297 liquid dosage form Substances 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 208000019423 liver disease Diseases 0.000 description 2
- 229960002247 lomustine Drugs 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 2
- 208000030883 malignant astrocytoma Diseases 0.000 description 2
- 201000011614 malignant glioma Diseases 0.000 description 2
- 208000006178 malignant mesothelioma Diseases 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 229960001924 melphalan Drugs 0.000 description 2
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 210000003071 memory t lymphocyte Anatomy 0.000 description 2
- 230000002503 metabolic effect Effects 0.000 description 2
- 229960004857 mitomycin Drugs 0.000 description 2
- TXXHDPDFNKHHGW-UHFFFAOYSA-N muconic acid Chemical group OC(=O)C=CC=CC(O)=O TXXHDPDFNKHHGW-UHFFFAOYSA-N 0.000 description 2
- 208000025113 myeloid leukemia Diseases 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- FUZZWVXGSFPDMH-UHFFFAOYSA-N n-hexanoic acid Natural products CCCCCC(O)=O FUZZWVXGSFPDMH-UHFFFAOYSA-N 0.000 description 2
- 208000018795 nasal cavity and paranasal sinus carcinoma Diseases 0.000 description 2
- 210000000440 neutrophil Anatomy 0.000 description 2
- 108020001162 nitroreductase Proteins 0.000 description 2
- 239000000346 nonvolatile oil Substances 0.000 description 2
- 201000008106 ocular cancer Diseases 0.000 description 2
- 229960002450 ofatumumab Drugs 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 201000008968 osteosarcoma Diseases 0.000 description 2
- 239000001301 oxygen Substances 0.000 description 2
- 229910052760 oxygen Inorganic materials 0.000 description 2
- 238000004806 packaging method and process Methods 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- 208000010626 plasma cell neoplasm Diseases 0.000 description 2
- 238000003752 polymerase chain reaction Methods 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- 229940068977 polysorbate 20 Drugs 0.000 description 2
- 208000016800 primary central nervous system lymphoma Diseases 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 210000002307 prostate Anatomy 0.000 description 2
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 description 2
- 229960004641 rituximab Drugs 0.000 description 2
- YGSDEFSMJLZEOE-UHFFFAOYSA-N salicylic acid Chemical group OC(=O)C1=CC=CC=C1O YGSDEFSMJLZEOE-UHFFFAOYSA-N 0.000 description 2
- 210000004872 soft tissue Anatomy 0.000 description 2
- 238000007619 statistical method Methods 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 239000000375 suspending agent Substances 0.000 description 2
- 208000011580 syndromic disease Diseases 0.000 description 2
- 230000002195 synergetic effect Effects 0.000 description 2
- 230000006794 tachycardia Effects 0.000 description 2
- 229940066453 tecentriq Drugs 0.000 description 2
- 230000004797 therapeutic response Effects 0.000 description 2
- 206010043554 thrombocytopenia Diseases 0.000 description 2
- 229960005267 tositumomab Drugs 0.000 description 2
- 231100000167 toxic agent Toxicity 0.000 description 2
- 239000003440 toxic substance Substances 0.000 description 2
- 206010044412 transitional cell carcinoma Diseases 0.000 description 2
- 229950007217 tremelimumab Drugs 0.000 description 2
- 230000004614 tumor growth Effects 0.000 description 2
- 230000005909 tumor killing Effects 0.000 description 2
- 230000002476 tumorcidal effect Effects 0.000 description 2
- 208000018417 undifferentiated high grade pleomorphic sarcoma of bone Diseases 0.000 description 2
- 210000000626 ureter Anatomy 0.000 description 2
- 238000002255 vaccination Methods 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 229940126580 vector vaccine Drugs 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 229960004528 vincristine Drugs 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 2
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 2
- 229960004355 vindesine Drugs 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- 238000011179 visual inspection Methods 0.000 description 2
- 239000000080 wetting agent Substances 0.000 description 2
- QBYIENPQHBMVBV-HFEGYEGKSA-N (2R)-2-hydroxy-2-phenylacetic acid Chemical compound O[C@@H](C(O)=O)c1ccccc1.O[C@@H](C(O)=O)c1ccccc1 QBYIENPQHBMVBV-HFEGYEGKSA-N 0.000 description 1
- PGOHTUIFYSHAQG-LJSDBVFPSA-N (2S)-6-amino-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-5-amino-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-5-amino-2-[[(2S)-1-[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2R)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-4-methylsulfanylbutanoyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-5-carbamimidamidopentanoyl]amino]propanoyl]pyrrolidine-2-carbonyl]amino]-3-methylbutanoyl]amino]-4-methylpentanoyl]amino]-4-methylpentanoyl]amino]acetyl]amino]-3-hydroxypropanoyl]amino]-4-methylpentanoyl]amino]-3-sulfanylpropanoyl]amino]-4-methylsulfanylbutanoyl]amino]-5-carbamimidamidopentanoyl]amino]-3-hydroxybutanoyl]pyrrolidine-2-carbonyl]amino]-5-oxopentanoyl]amino]-3-hydroxypropanoyl]amino]-3-hydroxypropanoyl]amino]-3-(1H-imidazol-5-yl)propanoyl]amino]-4-methylpentanoyl]amino]-3-hydroxybutanoyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-5-carbamimidamidopentanoyl]amino]-5-oxopentanoyl]amino]-3-hydroxybutanoyl]amino]-3-hydroxypropanoyl]amino]-3-carboxypropanoyl]amino]-3-hydroxypropanoyl]amino]-5-oxopentanoyl]amino]-5-oxopentanoyl]amino]-3-phenylpropanoyl]amino]-5-carbamimidamidopentanoyl]amino]-3-methylbutanoyl]amino]-4-methylpentanoyl]amino]-4-oxobutanoyl]amino]-5-carbamimidamidopentanoyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-4-carboxybutanoyl]amino]-5-oxopentanoyl]amino]hexanoic acid Chemical compound CSCC[C@H](N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(O)=O PGOHTUIFYSHAQG-LJSDBVFPSA-N 0.000 description 1
- JNYAEWCLZODPBN-JGWLITMVSA-N (2r,3r,4s)-2-[(1r)-1,2-dihydroxyethyl]oxolane-3,4-diol Chemical compound OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O JNYAEWCLZODPBN-JGWLITMVSA-N 0.000 description 1
- UQQHOWKTDKKTHO-ICQCTTRCSA-N (2r,3s,4s,5r)-2-(hydroxymethyl)-5-(6-methoxypurin-9-yl)oxolane-3,4-diol Chemical compound C1=NC=2C(OC)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O UQQHOWKTDKKTHO-ICQCTTRCSA-N 0.000 description 1
- ZMKRGPFAJHZXPP-JTQLQIEISA-N (2s)-2-(3-chloropropanoylamino)-3-phenylpropanoic acid Chemical compound ClCCC(=O)N[C@H](C(=O)O)CC1=CC=CC=C1 ZMKRGPFAJHZXPP-JTQLQIEISA-N 0.000 description 1
- BRVFNEZMTRVUGW-QFIPXVFZSA-N (2s)-2-[6-[(3-methyl-1-oxo-4h-benzo[f]quinazolin-9-yl)methylamino]-3-oxo-1h-isoindol-2-yl]pentanedioic acid Chemical compound C1=C2C(=O)N([C@@H](CCC(O)=O)C(O)=O)CC2=CC(NCC2=CC=C3C=CC4=C(C3=C2)C(=O)N=C(N4)C)=C1 BRVFNEZMTRVUGW-QFIPXVFZSA-N 0.000 description 1
- BXTJCSYMGFJEID-XMTADJHZSA-N (2s)-2-[[(2r,3r)-3-[(2s)-1-[(3r,4s,5s)-4-[[(2s)-2-[[(2s)-2-[6-[3-[(2r)-2-amino-2-carboxyethyl]sulfanyl-2,5-dioxopyrrolidin-1-yl]hexanoyl-methylamino]-3-methylbutanoyl]amino]-3-methylbutanoyl]-methylamino]-3-methoxy-5-methylheptanoyl]pyrrolidin-2-yl]-3-met Chemical compound C([C@H](NC(=O)[C@H](C)[C@@H](OC)[C@@H]1CCCN1C(=O)C[C@H]([C@H]([C@@H](C)CC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)CCCCCN1C(C(SC[C@H](N)C(O)=O)CC1=O)=O)C(C)C)OC)C(O)=O)C1=CC=CC=C1 BXTJCSYMGFJEID-XMTADJHZSA-N 0.000 description 1
- WOWDZACBATWTAU-FEFUEGSOSA-N (2s)-2-[[(2s)-2-(dimethylamino)-3-methylbutanoyl]amino]-n-[(3r,4s,5s)-1-[(2s)-2-[(1r,2r)-3-[[(1s,2r)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-n,3-dimethylbutanamide Chemical compound CC(C)[C@H](N(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)C1=CC=CC=C1 WOWDZACBATWTAU-FEFUEGSOSA-N 0.000 description 1
- VEEGZPWAAPPXRB-BJMVGYQFSA-N (3e)-3-(1h-imidazol-5-ylmethylidene)-1h-indol-2-one Chemical compound O=C1NC2=CC=CC=C2\C1=C/C1=CN=CN1 VEEGZPWAAPPXRB-BJMVGYQFSA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 1
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- MIOPJNTWMNEORI-GMSGAONNSA-N (S)-camphorsulfonic acid Chemical compound C1C[C@@]2(CS(O)(=O)=O)C(=O)C[C@@H]1C2(C)C MIOPJNTWMNEORI-GMSGAONNSA-N 0.000 description 1
- BJEPYKJPYRNKOW-REOHCLBHSA-N (S)-malic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O BJEPYKJPYRNKOW-REOHCLBHSA-N 0.000 description 1
- WBYWAXJHAXSJNI-VOTSOKGWSA-M .beta-Phenylacrylic acid Natural products [O-]C(=O)\C=C\C1=CC=CC=C1 WBYWAXJHAXSJNI-VOTSOKGWSA-M 0.000 description 1
- 229940058015 1,3-butylene glycol Drugs 0.000 description 1
- WEYNBWVKOYCCQT-UHFFFAOYSA-N 1-(3-chloro-4-methylphenyl)-3-{2-[({5-[(dimethylamino)methyl]-2-furyl}methyl)thio]ethyl}urea Chemical compound O1C(CN(C)C)=CC=C1CSCCNC(=O)NC1=CC=C(C)C(Cl)=C1 WEYNBWVKOYCCQT-UHFFFAOYSA-N 0.000 description 1
- BADMGRJDJPQBLS-UNTFVMJOSA-N 1-methyl-1-nitroso-3-[(2r,3r,4s,5s)-3,4,5-trihydroxyoxan-2-yl]urea Chemical compound O=NN(C)C(=O)N[C@@H]1OC[C@H](O)[C@H](O)[C@H]1O BADMGRJDJPQBLS-UNTFVMJOSA-N 0.000 description 1
- YABJJWZLRMPFSI-UHFFFAOYSA-N 1-methyl-5-[[2-[5-(trifluoromethyl)-1H-imidazol-2-yl]-4-pyridinyl]oxy]-N-[4-(trifluoromethyl)phenyl]-2-benzimidazolamine Chemical compound N=1C2=CC(OC=3C=C(N=CC=3)C=3NC(=CN=3)C(F)(F)F)=CC=C2N(C)C=1NC1=CC=C(C(F)(F)F)C=C1 YABJJWZLRMPFSI-UHFFFAOYSA-N 0.000 description 1
- AMMPLVWPWSYRDR-UHFFFAOYSA-N 1-methylbicyclo[2.2.2]oct-2-ene-4-carboxylic acid Chemical compound C1CC2(C(O)=O)CCC1(C)C=C2 AMMPLVWPWSYRDR-UHFFFAOYSA-N 0.000 description 1
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 1
- SNKUSVNHTCUELQ-UHFFFAOYSA-N 2-[[4-amino-2-[[2-[[2-[2-[[2-[[2-[[2-[[2-amino-3-(4-hydroxyphenyl)propanoyl]amino]-4-methylpentanoyl]amino]-3-hydroxypropanoyl]amino]acetyl]amino]propanoylamino]-3-carboxypropanoyl]amino]-4-methylpentanoyl]amino]-4-oxobutanoyl]amino]-4-methylpentanoic aci Chemical compound CC(C)CC(C(O)=O)NC(=O)C(CC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(CC(O)=O)NC(=O)C(C)NC(=O)CNC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(N)CC1=CC=C(O)C=C1 SNKUSVNHTCUELQ-UHFFFAOYSA-N 0.000 description 1
- MKKDSIYTXTZFAU-UHFFFAOYSA-N 2-amino-3,7-dihydropurin-6-one;5-methyl-1h-pyrimidine-2,4-dione Chemical group CC1=CNC(=O)NC1=O.O=C1NC(N)=NC2=C1NC=N2 MKKDSIYTXTZFAU-UHFFFAOYSA-N 0.000 description 1
- NOIRDLRUNWIUMX-UHFFFAOYSA-N 2-amino-3,7-dihydropurin-6-one;6-amino-1h-pyrimidin-2-one Chemical compound NC=1C=CNC(=O)N=1.O=C1NC(N)=NC2=C1NC=N2 NOIRDLRUNWIUMX-UHFFFAOYSA-N 0.000 description 1
- UPHOPMSGKZNELG-UHFFFAOYSA-N 2-hydroxynaphthalene-1-carboxylic acid Chemical group C1=CC=C2C(C(=O)O)=C(O)C=CC2=C1 UPHOPMSGKZNELG-UHFFFAOYSA-N 0.000 description 1
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 1
- XLZYKTYMLBOINK-UHFFFAOYSA-N 3-(4-hydroxybenzoyl)benzoic acid Chemical compound OC(=O)C1=CC=CC(C(=O)C=2C=CC(O)=CC=2)=C1 XLZYKTYMLBOINK-UHFFFAOYSA-N 0.000 description 1
- LKKMLIBUAXYLOY-UHFFFAOYSA-N 3-Amino-1-methyl-5H-pyrido[4,3-b]indole Chemical compound N1C2=CC=CC=C2C2=C1C=C(N)N=C2C LKKMLIBUAXYLOY-UHFFFAOYSA-N 0.000 description 1
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 1
- ZRPLANDPDWYOMZ-UHFFFAOYSA-N 3-cyclopentylpropionic acid Chemical compound OC(=O)CCC1CCCC1 ZRPLANDPDWYOMZ-UHFFFAOYSA-N 0.000 description 1
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 1
- XXJWYDDUDKYVKI-UHFFFAOYSA-N 4-[(4-fluoro-2-methyl-1H-indol-5-yl)oxy]-6-methoxy-7-[3-(1-pyrrolidinyl)propoxy]quinazoline Chemical compound COC1=CC2=C(OC=3C(=C4C=C(C)NC4=CC=3)F)N=CN=C2C=C1OCCCN1CCCC1 XXJWYDDUDKYVKI-UHFFFAOYSA-N 0.000 description 1
- RJWBTWIBUIGANW-UHFFFAOYSA-N 4-chlorobenzenesulfonic acid Chemical compound OS(=O)(=O)C1=CC=C(Cl)C=C1 RJWBTWIBUIGANW-UHFFFAOYSA-N 0.000 description 1
- 102100030310 5,6-dihydroxyindole-2-carboxylic acid oxidase Human genes 0.000 description 1
- 101710163881 5,6-dihydroxyindole-2-carboxylic acid oxidase Proteins 0.000 description 1
- IDPUKCWIGUEADI-UHFFFAOYSA-N 5-[bis(2-chloroethyl)amino]uracil Chemical compound ClCCN(CCCl)C1=CNC(=O)NC1=O IDPUKCWIGUEADI-UHFFFAOYSA-N 0.000 description 1
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 1
- MMRCWWRFYLZGAE-ZBZRSYSASA-N 533u947v6q Chemical compound O([C@]12[C@H](OC(C)=O)[C@]3(CC)C=CCN4CC[C@@]5([C@H]34)[C@H]1N(C)C1=C5C=C(C(=C1)OC)[C@]1(C(=O)OC)C3=C(C4=CC=CC=C4N3)CCN3C[C@H](C1)C[C@@](C3)(O)CC)C(=O)N(CCCl)C2=O MMRCWWRFYLZGAE-ZBZRSYSASA-N 0.000 description 1
- WYWHKKSPHMUBEB-UHFFFAOYSA-N 6-Mercaptoguanine Natural products N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 1
- VVIAGPKUTFNRDU-UHFFFAOYSA-N 6S-folinic acid Natural products C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-UHFFFAOYSA-N 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 1
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 1
- 230000035502 ADME Effects 0.000 description 1
- 208000002008 AIDS-Related Lymphoma Diseases 0.000 description 1
- 208000004998 Abdominal Pain Diseases 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 208000010444 Acidosis Diseases 0.000 description 1
- 206010000830 Acute leukaemia Diseases 0.000 description 1
- 206010052747 Adenocarcinoma pancreas Diseases 0.000 description 1
- 229940123702 Adenosine A2a receptor antagonist Drugs 0.000 description 1
- 101710137115 Adenylyl cyclase-associated protein 1 Proteins 0.000 description 1
- 101710137132 Adenylyl cyclase-associated protein 2 Proteins 0.000 description 1
- 102100021879 Adenylyl cyclase-associated protein 2 Human genes 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 208000008190 Agammaglobulinemia Diseases 0.000 description 1
- 208000000722 Akinetic Mutism Diseases 0.000 description 1
- 108010012934 Albumin-Bound Paclitaxel Proteins 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 206010073478 Anaplastic large-cell lymphoma Diseases 0.000 description 1
- 208000007860 Anus Neoplasms Diseases 0.000 description 1
- 235000003276 Apios tuberosa Nutrition 0.000 description 1
- 206010002961 Aplasia Diseases 0.000 description 1
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 1
- 206010003062 Apraxia Diseases 0.000 description 1
- 101100067974 Arabidopsis thaliana POP2 gene Proteins 0.000 description 1
- 244000105624 Arachis hypogaea Species 0.000 description 1
- 235000010777 Arachis hypogaea Nutrition 0.000 description 1
- 235000010744 Arachis villosulicarpa Nutrition 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- 102000015790 Asparaginase Human genes 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 206010003591 Ataxia Diseases 0.000 description 1
- 241000700663 Avipoxvirus Species 0.000 description 1
- 102100035526 B melanoma antigen 1 Human genes 0.000 description 1
- 208000028564 B-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- 229940123944 B7-H3 antagonist Drugs 0.000 description 1
- 229940116375 B7-H4 antagonist Drugs 0.000 description 1
- MLDQJTXFUGDVEO-UHFFFAOYSA-N BAY-43-9006 Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 MLDQJTXFUGDVEO-UHFFFAOYSA-N 0.000 description 1
- 229940111018 BTLA antagonist Drugs 0.000 description 1
- 208000008035 Back Pain Diseases 0.000 description 1
- 208000031729 Bacteremia Diseases 0.000 description 1
- 108010077805 Bacterial Proteins Proteins 0.000 description 1
- 208000006373 Bell palsy Diseases 0.000 description 1
- 239000005711 Benzoic acid Substances 0.000 description 1
- 108060000903 Beta-catenin Proteins 0.000 description 1
- 102000015735 Beta-catenin Human genes 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 208000037403 Blood and lymphatic system disease Diseases 0.000 description 1
- 208000019838 Blood disease Diseases 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 208000014644 Brain disease Diseases 0.000 description 1
- 206010048962 Brain oedema Diseases 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 108010074051 C-Reactive Protein Proteins 0.000 description 1
- 102100032752 C-reactive protein Human genes 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- 238000011740 C57BL/6 mouse Methods 0.000 description 1
- 101800004711 CAP-3 Proteins 0.000 description 1
- 108010077333 CAP1-6D Proteins 0.000 description 1
- 108010046080 CD27 Ligand Proteins 0.000 description 1
- 108010063916 CD40 Antigens Proteins 0.000 description 1
- 102100025221 CD70 antigen Human genes 0.000 description 1
- FVLVBPDQNARYJU-XAHDHGMMSA-N C[C@H]1CCC(CC1)NC(=O)N(CCCl)N=O Chemical compound C[C@H]1CCC(CC1)NC(=O)N(CCCl)N=O FVLVBPDQNARYJU-XAHDHGMMSA-N 0.000 description 1
- 101100257359 Caenorhabditis elegans sox-2 gene Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 1
- WWZKQHOCKIZLMA-UHFFFAOYSA-N Caprylic acid Natural products CCCCCCCC(O)=O WWZKQHOCKIZLMA-UHFFFAOYSA-N 0.000 description 1
- 206010007279 Carcinoid tumour of the gastrointestinal tract Diseases 0.000 description 1
- 206010049993 Cardiac death Diseases 0.000 description 1
- 208000020446 Cardiac disease Diseases 0.000 description 1
- 208000024172 Cardiovascular disease Diseases 0.000 description 1
- 206010008025 Cerebellar ataxia Diseases 0.000 description 1
- 206010008072 Cerebellar syndrome Diseases 0.000 description 1
- MKQWTWSXVILIKJ-LXGUWJNJSA-N Chlorozotocin Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](C=O)NC(=O)N(N=O)CCCl MKQWTWSXVILIKJ-LXGUWJNJSA-N 0.000 description 1
- WBYWAXJHAXSJNI-SREVYHEPSA-N Cinnamic acid Chemical compound OC(=O)\C=C/C1=CC=CC=C1 WBYWAXJHAXSJNI-SREVYHEPSA-N 0.000 description 1
- YASYEJJMZJALEJ-UHFFFAOYSA-N Citric acid monohydrate Chemical compound O.OC(=O)CC(O)(C(O)=O)CC(O)=O YASYEJJMZJALEJ-UHFFFAOYSA-N 0.000 description 1
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 1
- 206010073140 Clear cell sarcoma of soft tissue Diseases 0.000 description 1
- 206010053567 Coagulopathies Diseases 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 206010011224 Cough Diseases 0.000 description 1
- 102000004420 Creatine Kinase Human genes 0.000 description 1
- 108010042126 Creatine kinase Proteins 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 102000004012 Cyclin G1 Human genes 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- 239000003154 D dimer Substances 0.000 description 1
- RGHNJXZEOKUKBD-UHFFFAOYSA-N D-gluconic acid Chemical group OCC(O)C(O)C(O)C(O)C(O)=O RGHNJXZEOKUKBD-UHFFFAOYSA-N 0.000 description 1
- 239000012650 DNA demethylating agent Chemical class 0.000 description 1
- 229940045805 DNA demethylating agent Drugs 0.000 description 1
- 108010092160 Dactinomycin Proteins 0.000 description 1
- 206010011906 Death Diseases 0.000 description 1
- 108090000204 Dipeptidase 1 Proteins 0.000 description 1
- 101150029707 ERBB2 gene Proteins 0.000 description 1
- 208000032274 Encephalopathy Diseases 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 1
- 208000010201 Exanthema Diseases 0.000 description 1
- 208000017259 Extragonadal germ cell tumor Diseases 0.000 description 1
- 206010015866 Extravasation Diseases 0.000 description 1
- 108010049003 Fibrinogen Proteins 0.000 description 1
- 102000008946 Fibrinogen Human genes 0.000 description 1
- 102100027581 Forkhead box protein P3 Human genes 0.000 description 1
- 101710113436 GTPase KRas Proteins 0.000 description 1
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 1
- 208000018522 Gastrointestinal disease Diseases 0.000 description 1
- 208000012671 Gastrointestinal haemorrhages Diseases 0.000 description 1
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 1
- 206010018092 Generalised oedema Diseases 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 102000009465 Growth Factor Receptors Human genes 0.000 description 1
- 108010009202 Growth Factor Receptors Proteins 0.000 description 1
- 102000025850 HLA-A2 Antigen Human genes 0.000 description 1
- 108010074032 HLA-A2 Antigen Proteins 0.000 description 1
- 208000004547 Hallucinations Diseases 0.000 description 1
- 206010019233 Headaches Diseases 0.000 description 1
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 1
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 1
- 208000010670 Hemic and Lymphatic disease Diseases 0.000 description 1
- 208000007514 Herpes zoster Diseases 0.000 description 1
- 101000971171 Homo sapiens Apoptosis regulator Bcl-2 Proteins 0.000 description 1
- 101000874316 Homo sapiens B melanoma antigen 1 Proteins 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 1
- 101100118549 Homo sapiens EGFR gene Proteins 0.000 description 1
- 101000861452 Homo sapiens Forkhead box protein P3 Proteins 0.000 description 1
- 101000744505 Homo sapiens GTPase NRas Proteins 0.000 description 1
- 101000599852 Homo sapiens Intercellular adhesion molecule 1 Proteins 0.000 description 1
- 101001063392 Homo sapiens Lymphocyte function-associated antigen 3 Proteins 0.000 description 1
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 description 1
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 1
- 101000831496 Homo sapiens Toll-like receptor 3 Proteins 0.000 description 1
- 101001087394 Homo sapiens Tyrosine-protein phosphatase non-receptor type 1 Proteins 0.000 description 1
- 241000701085 Human alphaherpesvirus 3 Species 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- 208000028958 Hyperferritinemia Diseases 0.000 description 1
- 208000003623 Hypoalbuminemia Diseases 0.000 description 1
- 206010051125 Hypofibrinogenaemia Diseases 0.000 description 1
- 206010020983 Hypogammaglobulinaemia Diseases 0.000 description 1
- 208000022569 Hypohidrotic ectodermal dysplasia-hypothyroidism-ciliary dyskinesia syndrome Diseases 0.000 description 1
- 208000019025 Hypokalemia Diseases 0.000 description 1
- 206010021036 Hyponatraemia Diseases 0.000 description 1
- 206010021042 Hypopharyngeal cancer Diseases 0.000 description 1
- 206010056305 Hypopharyngeal neoplasm Diseases 0.000 description 1
- 206010021143 Hypoxia Diseases 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 102000053646 Inducible T-Cell Co-Stimulator Human genes 0.000 description 1
- 108700013161 Inducible T-Cell Co-Stimulator Proteins 0.000 description 1
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 1
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 208000005016 Intestinal Neoplasms Diseases 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical group NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- 102100031413 L-dopachrome tautomerase Human genes 0.000 description 1
- 101710093778 L-dopachrome tautomerase Proteins 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical group OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 1
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 1
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 1
- 239000005511 L01XE05 - Sorafenib Substances 0.000 description 1
- 239000002136 L01XE07 - Lapatinib Substances 0.000 description 1
- UIARLYUEJFELEN-LROUJFHJSA-N LSM-1231 Chemical compound C12=C3N4C5=CC=CC=C5C3=C3C(=O)NCC3=C2C2=CC=CC=C2N1[C@]1(C)[C@](CO)(O)C[C@H]4O1 UIARLYUEJFELEN-LROUJFHJSA-N 0.000 description 1
- 208000032004 Large-Cell Anaplastic Lymphoma Diseases 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 206010024291 Leukaemias acute myeloid Diseases 0.000 description 1
- 206010062038 Lip neoplasm Diseases 0.000 description 1
- 108090001030 Lipoproteins Proteins 0.000 description 1
- 102000004895 Lipoproteins Human genes 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- 201000000251 Locked-in syndrome Diseases 0.000 description 1
- 208000019693 Lung disease Diseases 0.000 description 1
- 208000008771 Lymphadenopathy Diseases 0.000 description 1
- 102100030984 Lymphocyte function-associated antigen 3 Human genes 0.000 description 1
- 206010025312 Lymphoma AIDS related Diseases 0.000 description 1
- 206010025327 Lymphopenia Diseases 0.000 description 1
- 101001133631 Lysinibacillus sphaericus Penicillin acylase Proteins 0.000 description 1
- 108010010995 MART-1 Antigen Proteins 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 241000282567 Macaca fascicularis Species 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 208000004059 Male Breast Neoplasms Diseases 0.000 description 1
- 208000006644 Malignant Fibrous Histiocytoma Diseases 0.000 description 1
- 208000030070 Malignant epithelial tumor of ovary Diseases 0.000 description 1
- 206010073059 Malignant neoplasm of unknown primary site Diseases 0.000 description 1
- 208000032271 Malignant tumor of penis Diseases 0.000 description 1
- 102000005727 Mammaglobin A Human genes 0.000 description 1
- 108010031030 Mammaglobin A Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 208000029001 Mediastinal disease Diseases 0.000 description 1
- 208000002030 Merkel cell carcinoma Diseases 0.000 description 1
- 206010027417 Metabolic acidosis Diseases 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 108010008707 Mucin-1 Proteins 0.000 description 1
- TXXHDPDFNKHHGW-CCAGOZQPSA-N Muconic acid Chemical group OC(=O)\C=C/C=C\C(O)=O TXXHDPDFNKHHGW-CCAGOZQPSA-N 0.000 description 1
- 206010028116 Mucosal inflammation Diseases 0.000 description 1
- 101100257363 Mus musculus Sox2 gene Proteins 0.000 description 1
- 208000023178 Musculoskeletal disease Diseases 0.000 description 1
- 208000014767 Myeloproliferative disease Diseases 0.000 description 1
- 201000007224 Myeloproliferative neoplasm Diseases 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 1
- DYCJFJRCWPVDHY-LSCFUAHRSA-N NBMPR Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(SCC=3C=CC(=CC=3)[N+]([O-])=O)=C2N=C1 DYCJFJRCWPVDHY-LSCFUAHRSA-N 0.000 description 1
- 208000002454 Nasopharyngeal Carcinoma Diseases 0.000 description 1
- 206010029098 Neoplasm skin Diseases 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 206010029266 Neuroendocrine carcinoma of the skin Diseases 0.000 description 1
- 201000004404 Neurofibroma Diseases 0.000 description 1
- 206010060860 Neurological symptom Diseases 0.000 description 1
- 206010029350 Neurotoxicity Diseases 0.000 description 1
- 208000007125 Neurotoxicity Syndromes Diseases 0.000 description 1
- GRYLNZFGIOXLOG-UHFFFAOYSA-N Nitric acid Chemical compound O[N+]([O-])=O GRYLNZFGIOXLOG-UHFFFAOYSA-N 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 229960005557 OSI-7904 Drugs 0.000 description 1
- 206010030124 Oedema peripheral Diseases 0.000 description 1
- 240000007817 Olea europaea Species 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 1
- 206010053159 Organ failure Diseases 0.000 description 1
- 206010031096 Oropharyngeal cancer Diseases 0.000 description 1
- 206010057444 Oropharyngeal neoplasm Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 208000007571 Ovarian Epithelial Carcinoma Diseases 0.000 description 1
- 206010061328 Ovarian epithelial cancer Diseases 0.000 description 1
- 206010033268 Ovarian low malignant potential tumour Diseases 0.000 description 1
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 1
- 229940124060 PD-1 antagonist Drugs 0.000 description 1
- 229940123751 PD-L1 antagonist Drugs 0.000 description 1
- 239000012271 PD-L1 inhibitor Substances 0.000 description 1
- 229940032310 PROSTVAC vaccine Drugs 0.000 description 1
- 208000002193 Pain Diseases 0.000 description 1
- 208000000821 Parathyroid Neoplasms Diseases 0.000 description 1
- 101710123388 Penicillin G acylase Proteins 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- 206010034299 Penile cancer Diseases 0.000 description 1
- 101800004196 Peptide P4 Proteins 0.000 description 1
- 208000005228 Pericardial Effusion Diseases 0.000 description 1
- 241000233805 Phoenix Species 0.000 description 1
- 108010089430 Phosphoproteins Proteins 0.000 description 1
- 102000007982 Phosphoproteins Human genes 0.000 description 1
- 208000007913 Pituitary Neoplasms Diseases 0.000 description 1
- 102000001393 Platelet-Derived Growth Factor alpha Receptor Human genes 0.000 description 1
- 108010068588 Platelet-Derived Growth Factor alpha Receptor Proteins 0.000 description 1
- 208000002151 Pleural effusion Diseases 0.000 description 1
- 201000008199 Pleuropulmonary blastoma Diseases 0.000 description 1
- 206010035742 Pneumonitis Diseases 0.000 description 1
- 102000012338 Poly(ADP-ribose) Polymerases Human genes 0.000 description 1
- 108010061844 Poly(ADP-ribose) Polymerases Proteins 0.000 description 1
- 229920000776 Poly(Adenosine diphosphate-ribose) polymerase Polymers 0.000 description 1
- 206010062519 Poor quality sleep Diseases 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 241000700625 Poxviridae Species 0.000 description 1
- 102100027378 Prothrombin Human genes 0.000 description 1
- 108010094028 Prothrombin Proteins 0.000 description 1
- 208000003251 Pruritus Diseases 0.000 description 1
- IWYDHOAUDWTVEP-UHFFFAOYSA-N R-2-phenyl-2-hydroxyacetic acid Natural products OC(=O)C(O)C1=CC=CC=C1 IWYDHOAUDWTVEP-UHFFFAOYSA-N 0.000 description 1
- 229940022005 RNA vaccine Drugs 0.000 description 1
- 206010037855 Rash erythematous Diseases 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 102000004278 Receptor Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000873 Receptor Protein-Tyrosine Kinases Proteins 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 206010062237 Renal impairment Diseases 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- 235000004443 Ricinus communis Nutrition 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 101100123851 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) HER1 gene Proteins 0.000 description 1
- 208000004337 Salivary Gland Neoplasms Diseases 0.000 description 1
- 206010061934 Salivary gland cancer Diseases 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 102100025517 Serpin B9 Human genes 0.000 description 1
- 208000009359 Sezary Syndrome Diseases 0.000 description 1
- 208000021388 Sezary disease Diseases 0.000 description 1
- 101710173693 Short transient receptor potential channel 1 Proteins 0.000 description 1
- 101710173694 Short transient receptor potential channel 2 Proteins 0.000 description 1
- 108010029180 Sialic Acid Binding Ig-like Lectin 3 Proteins 0.000 description 1
- 102000001555 Sialic Acid Binding Ig-like Lectin 3 Human genes 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 208000019498 Skin and subcutaneous tissue disease Diseases 0.000 description 1
- 208000032140 Sleepiness Diseases 0.000 description 1
- 206010041349 Somnolence Diseases 0.000 description 1
- 208000014604 Specific Language disease Diseases 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- ZSJLQEPLLKMAKR-UHFFFAOYSA-N Streptozotocin Natural products O=NN(C)C(=O)NC1C(O)OC(CO)C(O)C1O ZSJLQEPLLKMAKR-UHFFFAOYSA-N 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Natural products OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 108010008038 Synthetic Vaccines Proteins 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 208000031673 T-Cell Cutaneous Lymphoma Diseases 0.000 description 1
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 1
- 206010042971 T-cell lymphoma Diseases 0.000 description 1
- 208000027585 T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 229940123803 TIM3 antagonist Drugs 0.000 description 1
- 102100033082 TNF receptor-associated factor 3 Human genes 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 1
- 108010000499 Thromboplastin Proteins 0.000 description 1
- 102100030859 Tissue factor Human genes 0.000 description 1
- 102100024324 Toll-like receptor 3 Human genes 0.000 description 1
- IVTVGDXNLFLDRM-HNNXBMFYSA-N Tomudex Chemical compound C=1C=C2NC(C)=NC(=O)C2=CC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)S1 IVTVGDXNLFLDRM-HNNXBMFYSA-N 0.000 description 1
- 231100000076 Toxic encephalopathy Toxicity 0.000 description 1
- 102000003929 Transaminases Human genes 0.000 description 1
- 108090000340 Transaminases Proteins 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 206010044407 Transitional cell cancer of the renal pelvis and ureter Diseases 0.000 description 1
- 102100023935 Transmembrane glycoprotein NMB Human genes 0.000 description 1
- GSEJCLTVZPLZKY-UHFFFAOYSA-N Triethanolamine Chemical compound OCCN(CCO)CCO GSEJCLTVZPLZKY-UHFFFAOYSA-N 0.000 description 1
- 208000003721 Triple Negative Breast Neoplasms Diseases 0.000 description 1
- LVTKHGUGBGNBPL-UHFFFAOYSA-N Trp-P-1 Chemical compound N1C2=CC=CC=C2C2=C1C(C)=C(N)N=C2C LVTKHGUGBGNBPL-UHFFFAOYSA-N 0.000 description 1
- 206010045169 Tumour flare Diseases 0.000 description 1
- 102000003425 Tyrosinase Human genes 0.000 description 1
- 108060008724 Tyrosinase Proteins 0.000 description 1
- 102100033001 Tyrosine-protein phosphatase non-receptor type 1 Human genes 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 208000015778 Undifferentiated pleomorphic sarcoma Diseases 0.000 description 1
- 206010046337 Urate nephropathy Diseases 0.000 description 1
- 206010046431 Urethral cancer Diseases 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 229940122803 Vinca alkaloid Drugs 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 1
- 102100038968 WAP four-disulfide core domain protein 1 Human genes 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 1
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
- 239000001089 [(2R)-oxolan-2-yl]methanol Substances 0.000 description 1
- 229940028652 abraxane Drugs 0.000 description 1
- 229960004150 aciclovir Drugs 0.000 description 1
- MKUXAQIIEYXACX-UHFFFAOYSA-N aciclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCO)C=N2 MKUXAQIIEYXACX-UHFFFAOYSA-N 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000033289 adaptive immune response Effects 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 239000002467 adenosine A2a receptor antagonist Substances 0.000 description 1
- 238000011360 adjunctive therapy Methods 0.000 description 1
- 230000001780 adrenocortical effect Effects 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 229960000548 alemtuzumab Drugs 0.000 description 1
- 229910001413 alkali metal ion Inorganic materials 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 230000029936 alkylation Effects 0.000 description 1
- 238000005804 alkylation reaction Methods 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-N alpha-hydroxysuccinic acid Natural products OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 1
- 229960000473 altretamine Drugs 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 239000003708 ampul Substances 0.000 description 1
- 208000024783 anasarca Diseases 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- RGHILYZRVFRRNK-UHFFFAOYSA-N anthracene-1,2-dione Chemical compound C1=CC=C2C=C(C(C(=O)C=C3)=O)C3=CC2=C1 RGHILYZRVFRRNK-UHFFFAOYSA-N 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 238000011319 anticancer therapy Methods 0.000 description 1
- 230000014102 antigen processing and presentation of exogenous peptide antigen via MHC class I Effects 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 229940045985 antineoplastic platinum compound Drugs 0.000 description 1
- 201000011165 anus cancer Diseases 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 229960003272 asparaginase Drugs 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-M asparaginate Chemical compound [O-]C(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-M 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 108010044540 auristatin Proteins 0.000 description 1
- RITAVMQDGBJQJZ-FMIVXFBMSA-N axitinib Chemical compound CNC(=O)C1=CC=CC=C1SC1=CC=C(C(\C=C\C=2N=CC=CC=2)=NN2)C2=C1 RITAVMQDGBJQJZ-FMIVXFBMSA-N 0.000 description 1
- 229960002756 azacitidine Drugs 0.000 description 1
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 1
- 150000001541 aziridines Chemical class 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 210000000270 basal cell Anatomy 0.000 description 1
- HDRGJRSISASRAJ-WKPMUQCKSA-N bazlitoran Chemical compound CO[C@@H]1[C@H](O)[C@@H](COP(=O)(S)O[C@@H]2[C@@H](COP(=O)(S)O[C@H]3C[C@@H](O[C@@H]3COP(=O)(S)O[C@H]4C[C@@H](O[C@@H]4COP(=O)(S)O[C@H]5C[C@@H](O[C@@H]5COP(=O)(S)O[C@H]6C[C@@H](O[C@@H]6COP(=O)(S)O[C@H]7C[C@@H](O[C@@H]7COP(=O)(S)O[C@H]8C[C@@H](O[C@@H]8COP(=O)(S)O[C@H]9C[C@@H](O[C@@H]9COP(=O)(S)O[C@H]%10C[C@@H](O[C@@H]%10COP(=O)(S)O[C@@H]%11[C@@H](COP(=O)(S)O[C@@H]%12[C@@H](COP(=O)(S)O[C@H]%13C[C@@H](O[C@@H]%13COP(=O)(S)O[C@H]%14C[C@@H](O[C@@H]%14COP(=O)(S)O[C@H]%15C[C@@H](O[C@@H]%15COP(=O)(S)O[C@H]%16C[C@@H](O[C@@H]%16COP(=O)(S)O[C@H]%17C[C@@H](O[C@@H]%17COP(=O)(S)O[C@H]%18C[C@@H](O[C@@H]%18CO)N%19C=CC(=NC%19=O)N)N%20C=C(C)C(=O)NC%20=O)n%21cnc%22c(N)ncnc%21%22)N%23C=C(C)C(=O)NC%23=O)N%24C=CC(=NC%24=O)N)N%25C=C(C)C(=O)NC%25=O)O[C@H]([C@@H]%12OC)n%26cnc%27C(=O)NC(=Nc%26%27)N)O[C@H]([C@@H]%11OC)N%28C=CC(=O)NC%28=O)N%29C=C(C)C(=NC%29=O)N)n%30ccc%31C(=O)NC(=Nc%30%31)N)N%32C=C(C)C(=O)NC%32=O)N%33C=C(C)C(=O)NC%33=O)N%34C=CC(=NC%34=O)N)N%35C=C(C)C(=O)NC%35=O)N%36C=CC(=NC%36=O)N)N%37C=C(C)C(=O)NC%37=O)O[C@H]([C@@H]2OC)n%38cnc%39C(=O)NC(=Nc%38%39)N)O[C@H]1N%40C=CC(=O)NC%40=O HDRGJRSISASRAJ-WKPMUQCKSA-N 0.000 description 1
- 108700000711 bcl-X Proteins 0.000 description 1
- 102000055104 bcl-X Human genes 0.000 description 1
- SRSXLGNVWSONIS-UHFFFAOYSA-N benzenesulfonic acid Chemical compound OS(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-N 0.000 description 1
- 229940092714 benzenesulfonic acid Drugs 0.000 description 1
- 235000010233 benzoic acid Nutrition 0.000 description 1
- 229960002903 benzyl benzoate Drugs 0.000 description 1
- GONOPSZTUGRENK-UHFFFAOYSA-N benzyl(trichloro)silane Chemical compound Cl[Si](Cl)(Cl)CC1=CC=CC=C1 GONOPSZTUGRENK-UHFFFAOYSA-N 0.000 description 1
- 108010047754 beta-Glucosidase Proteins 0.000 description 1
- 102000006995 beta-Glucosidase Human genes 0.000 description 1
- 102000006635 beta-lactamase Human genes 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 229940108502 bicnu Drugs 0.000 description 1
- 208000026900 bile duct neoplasm Diseases 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 239000000117 blood based biomarker Substances 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 208000015294 blood coagulation disease Diseases 0.000 description 1
- 230000036772 blood pressure Effects 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 208000015322 bone marrow disease Diseases 0.000 description 1
- 201000008873 bone osteosarcoma Diseases 0.000 description 1
- 208000012172 borderline epithelial tumor of ovary Diseases 0.000 description 1
- 208000006752 brain edema Diseases 0.000 description 1
- 210000000133 brain stem Anatomy 0.000 description 1
- 201000002143 bronchus adenoma Diseases 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 1
- 229940126608 cBR96-doxorubicin immunoconjugate Drugs 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 1
- 229940127093 camptothecin Drugs 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 210000000845 cartilage Anatomy 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 102000007588 cdc25 Phosphatases Human genes 0.000 description 1
- 108010046616 cdc25 Phosphatases Proteins 0.000 description 1
- 229960002412 cediranib Drugs 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 230000018486 cell cycle phase Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000017455 cell-cell adhesion Effects 0.000 description 1
- 230000035289 cell-matrix adhesion Effects 0.000 description 1
- 210000003570 cell-matrix junction Anatomy 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- 230000000973 chemotherapeutic effect Effects 0.000 description 1
- 208000011654 childhood malignant neoplasm Diseases 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 229960001480 chlorozotocin Drugs 0.000 description 1
- 208000006990 cholangiocarcinoma Diseases 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 208000037893 chronic inflammatory disorder Diseases 0.000 description 1
- 235000013985 cinnamic acid Nutrition 0.000 description 1
- 229930016911 cinnamic acid Natural products 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 229960004106 citric acid Drugs 0.000 description 1
- 235000015165 citric acid Nutrition 0.000 description 1
- 229960002303 citric acid monohydrate Drugs 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- 201000000292 clear cell sarcoma Diseases 0.000 description 1
- 230000009852 coagulant defect Effects 0.000 description 1
- 230000015271 coagulation Effects 0.000 description 1
- 238000005345 coagulation Methods 0.000 description 1
- 201000010989 colorectal carcinoma Diseases 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000002591 computed tomography Methods 0.000 description 1
- 208000004209 confusion Diseases 0.000 description 1
- 235000005822 corn Nutrition 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 238000010219 correlation analysis Methods 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 201000007241 cutaneous T cell lymphoma Diseases 0.000 description 1
- 208000017763 cutaneous neuroendocrine carcinoma Diseases 0.000 description 1
- 108010079940 cyanogenic beta-glucosidase Proteins 0.000 description 1
- 229940097362 cyclodextrins Drugs 0.000 description 1
- 208000024389 cytopenia Diseases 0.000 description 1
- 210000004292 cytoskeleton Anatomy 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 229960002806 daclizumab Drugs 0.000 description 1
- 229960000640 dactinomycin Drugs 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- 206010061428 decreased appetite Diseases 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- ZBCBWPMODOFKDW-UHFFFAOYSA-N diethanolamine Chemical compound OCCNCCO ZBCBWPMODOFKDW-UHFFFAOYSA-N 0.000 description 1
- 230000008034 disappearance Effects 0.000 description 1
- 206010013395 disorientation Diseases 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 238000002224 dissection Methods 0.000 description 1
- 208000002173 dizziness Diseases 0.000 description 1
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- MOTZDAYCYVMXPC-UHFFFAOYSA-N dodecyl hydrogen sulfate Chemical group CCCCCCCCCCCCOS(O)(=O)=O MOTZDAYCYVMXPC-UHFFFAOYSA-N 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 210000003162 effector t lymphocyte Anatomy 0.000 description 1
- 238000010894 electron beam technology Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 230000001804 emulsifying effect Effects 0.000 description 1
- 229960001904 epirubicin Drugs 0.000 description 1
- 230000007705 epithelial mesenchymal transition Effects 0.000 description 1
- 229960001433 erlotinib Drugs 0.000 description 1
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 1
- AFAXGSQYZLGZPG-UHFFFAOYSA-N ethanedisulfonic acid Chemical compound OS(=O)(=O)CCS(O)(=O)=O AFAXGSQYZLGZPG-UHFFFAOYSA-N 0.000 description 1
- CCIVGXIOQKPBKL-UHFFFAOYSA-M ethanesulfonate Chemical compound CCS([O-])(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-M 0.000 description 1
- 229940093499 ethyl acetate Drugs 0.000 description 1
- 201000005884 exanthem Diseases 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 238000002710 external beam radiation therapy Methods 0.000 description 1
- 201000008819 extrahepatic bile duct carcinoma Diseases 0.000 description 1
- 230000036251 extravasation Effects 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 108010052295 fibrin fragment D Proteins 0.000 description 1
- 229940012952 fibrinogen Drugs 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- 229960005304 fludarabine phosphate Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- VVIAGPKUTFNRDU-ABLWVSNPSA-N folinic acid Chemical compound C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-ABLWVSNPSA-N 0.000 description 1
- 235000008191 folinic acid Nutrition 0.000 description 1
- 239000011672 folinic acid Substances 0.000 description 1
- 230000003325 follicular Effects 0.000 description 1
- 229960004783 fotemustine Drugs 0.000 description 1
- YAKWPXVTIGTRJH-UHFFFAOYSA-N fotemustine Chemical compound CCOP(=O)(OCC)C(C)NC(=O)N(CCCl)N=O YAKWPXVTIGTRJH-UHFFFAOYSA-N 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 239000001530 fumaric acid Substances 0.000 description 1
- 235000011087 fumaric acid Nutrition 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 201000010175 gallbladder cancer Diseases 0.000 description 1
- 108010062699 gamma-Glutamyl Hydrolase Proteins 0.000 description 1
- 229960002963 ganciclovir Drugs 0.000 description 1
- IRSCQMHQWWYFCW-UHFFFAOYSA-N ganciclovir Chemical compound O=C1NC(N)=NC2=C1N=CN2COC(CO)CO IRSCQMHQWWYFCW-UHFFFAOYSA-N 0.000 description 1
- 208000030304 gastrointestinal bleeding Diseases 0.000 description 1
- 229960002584 gefitinib Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- 229960003297 gemtuzumab ozogamicin Drugs 0.000 description 1
- 201000007116 gestational trophoblastic neoplasm Diseases 0.000 description 1
- 239000000174 gluconic acid Chemical group 0.000 description 1
- 235000012208 gluconic acid Nutrition 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 101150106093 gpt gene Proteins 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 201000009277 hairy cell leukemia Diseases 0.000 description 1
- 210000003128 head Anatomy 0.000 description 1
- 231100000869 headache Toxicity 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- 230000004217 heart function Effects 0.000 description 1
- 208000014951 hematologic disease Diseases 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 208000018706 hematopoietic system disease Diseases 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- 210000003494 hepatocyte Anatomy 0.000 description 1
- 206010019847 hepatosplenomegaly Diseases 0.000 description 1
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 1
- 230000007236 host immunity Effects 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 201000001421 hyperglycemia Diseases 0.000 description 1
- 208000006575 hypertriglyceridemia Diseases 0.000 description 1
- 201000006866 hypopharynx cancer Diseases 0.000 description 1
- 208000003532 hypothyroidism Diseases 0.000 description 1
- 230000002989 hypothyroidism Effects 0.000 description 1
- 230000007954 hypoxia Effects 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- KTUFNOKKBVMGRW-UHFFFAOYSA-N imatinib Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 KTUFNOKKBVMGRW-UHFFFAOYSA-N 0.000 description 1
- 229960002411 imatinib Drugs 0.000 description 1
- 229960002751 imiquimod Drugs 0.000 description 1
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 1
- 230000005965 immune activity Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 230000037449 immunogenic cell death Effects 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 238000013394 immunophenotyping Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 238000011221 initial treatment Methods 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- 201000002313 intestinal cancer Diseases 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 229910052740 iodine Inorganic materials 0.000 description 1
- 239000011630 iodine Substances 0.000 description 1
- 229960002358 iodine Drugs 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 239000004310 lactic acid Substances 0.000 description 1
- 235000014655 lactic acid Nutrition 0.000 description 1
- 229960004891 lapatinib Drugs 0.000 description 1
- 229960001691 leucovorin Drugs 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 229950002950 lintuzumab Drugs 0.000 description 1
- 201000006721 lip cancer Diseases 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 230000005976 liver dysfunction Effects 0.000 description 1
- 230000003908 liver function Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 210000004324 lymphatic system Anatomy 0.000 description 1
- 208000018555 lymphatic system disease Diseases 0.000 description 1
- 230000000527 lymphocytic effect Effects 0.000 description 1
- 231100001023 lymphopenia Toxicity 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 108700021021 mRNA Vaccine Proteins 0.000 description 1
- 201000000564 macroglobulinemia Diseases 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 238000002595 magnetic resonance imaging Methods 0.000 description 1
- 206010025482 malaise Diseases 0.000 description 1
- 201000003175 male breast cancer Diseases 0.000 description 1
- 208000010907 male breast carcinoma Diseases 0.000 description 1
- 239000011976 maleic acid Substances 0.000 description 1
- 239000001630 malic acid Substances 0.000 description 1
- 235000011090 malic acid Nutrition 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 208000026045 malignant tumor of parathyroid gland Diseases 0.000 description 1
- 229960002510 mandelic acid Drugs 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 210000000716 merkel cell Anatomy 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 208000037970 metastatic squamous neck cancer Diseases 0.000 description 1
- 229940098779 methanesulfonic acid Drugs 0.000 description 1
- WBYWAXJHAXSJNI-UHFFFAOYSA-N methyl p-hydroxycinnamate Natural products OC(=O)C=CC1=CC=CC=C1 WBYWAXJHAXSJNI-UHFFFAOYSA-N 0.000 description 1
- VAOCPAMSLUNLGC-UHFFFAOYSA-N metronidazole Chemical compound CC1=NC=C([N+]([O-])=O)N1CCO VAOCPAMSLUNLGC-UHFFFAOYSA-N 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 238000012737 microarray-based gene expression Methods 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- BMGQWWVMWDBQGC-IIFHNQTCSA-N midostaurin Chemical compound CN([C@H]1[C@H]([C@]2(C)O[C@@H](N3C4=CC=CC=C4C4=C5C(=O)NCC5=C5C6=CC=CC=C6N2C5=C43)C1)OC)C(=O)C1=CC=CC=C1 BMGQWWVMWDBQGC-IIFHNQTCSA-N 0.000 description 1
- 229950010895 midostaurin Drugs 0.000 description 1
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 1
- 230000011278 mitosis Effects 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- CQDGTJPVBWZJAZ-UHFFFAOYSA-N monoethyl carbonate Chemical compound CCOC(O)=O CQDGTJPVBWZJAZ-UHFFFAOYSA-N 0.000 description 1
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 1
- RAHBGWKEPAQNFF-UHFFFAOYSA-N motesanib Chemical compound C=1C=C2C(C)(C)CNC2=CC=1NC(=O)C1=CC=CN=C1NCC1=CC=NC=C1 RAHBGWKEPAQNFF-UHFFFAOYSA-N 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 210000000214 mouth Anatomy 0.000 description 1
- 206010051747 multiple endocrine neoplasia Diseases 0.000 description 1
- 238000012243 multiplex automated genomic engineering Methods 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- OHDXDNUPVVYWOV-UHFFFAOYSA-N n-methyl-1-(2-naphthalen-1-ylsulfanylphenyl)methanamine Chemical compound CNCC1=CC=CC=C1SC1=CC=CC2=CC=CC=C12 OHDXDNUPVVYWOV-UHFFFAOYSA-N 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- KVBGVZZKJNLNJU-UHFFFAOYSA-N naphthalene-2-sulfonic acid Chemical compound C1=CC=CC2=CC(S(=O)(=O)O)=CC=C21 KVBGVZZKJNLNJU-UHFFFAOYSA-N 0.000 description 1
- 201000011216 nasopharynx carcinoma Diseases 0.000 description 1
- 210000003739 neck Anatomy 0.000 description 1
- 230000001338 necrotic effect Effects 0.000 description 1
- 230000032147 negative regulation of DNA repair Effects 0.000 description 1
- 238000010984 neurological examination Methods 0.000 description 1
- 231100000228 neurotoxicity Toxicity 0.000 description 1
- 230000007135 neurotoxicity Effects 0.000 description 1
- 229960001420 nimustine Drugs 0.000 description 1
- VFEDRRNHLBGPNN-UHFFFAOYSA-N nimustine Chemical compound CC1=NC=C(CNC(=O)N(CCCl)N=O)C(N)=N1 VFEDRRNHLBGPNN-UHFFFAOYSA-N 0.000 description 1
- 229910017604 nitric acid Inorganic materials 0.000 description 1
- IAIWVQXQOWNYOU-FPYGCLRLSA-N nitrofural Chemical compound NC(=O)N\N=C\C1=CC=C([N+]([O-])=O)O1 IAIWVQXQOWNYOU-FPYGCLRLSA-N 0.000 description 1
- 229960001907 nitrofurazone Drugs 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- OSTGTTZJOCZWJG-UHFFFAOYSA-N nitrosourea Chemical compound NC(=O)N=NO OSTGTTZJOCZWJG-UHFFFAOYSA-N 0.000 description 1
- 239000012457 nonaqueous media Substances 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 150000003833 nucleoside derivatives Chemical class 0.000 description 1
- 208000030212 nutrition disease Diseases 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical group CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Chemical group CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 150000002482 oligosaccharides Chemical class 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 231100000590 oncogenic Toxicity 0.000 description 1
- 230000002246 oncogenic effect Effects 0.000 description 1
- 244000309459 oncolytic virus Species 0.000 description 1
- 208000022982 optic pathway glioma Diseases 0.000 description 1
- 201000005443 oral cavity cancer Diseases 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 201000006958 oropharynx cancer Diseases 0.000 description 1
- 208000021284 ovarian germ cell tumor Diseases 0.000 description 1
- 229960001756 oxaliplatin Drugs 0.000 description 1
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 238000002638 palliative care Methods 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 201000002094 pancreatic adenocarcinoma Diseases 0.000 description 1
- 201000002530 pancreatic endocrine carcinoma Diseases 0.000 description 1
- 229960001972 panitumumab Drugs 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N papa-hydroxy-benzoic acid Chemical group OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- 208000035824 paresthesia Diseases 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 229940121656 pd-l1 inhibitor Drugs 0.000 description 1
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- 239000002304 perfume Substances 0.000 description 1
- 230000010412 perfusion Effects 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 229960002087 pertuzumab Drugs 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- 229960005190 phenylalanine Drugs 0.000 description 1
- 208000028591 pheochromocytoma Diseases 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 229950010773 pidilizumab Drugs 0.000 description 1
- 201000003113 pineoblastoma Diseases 0.000 description 1
- 208000010916 pituitary tumor Diseases 0.000 description 1
- IUGYQRQAERSCNH-UHFFFAOYSA-N pivalic acid Chemical compound CC(C)(C)C(O)=O IUGYQRQAERSCNH-UHFFFAOYSA-N 0.000 description 1
- 150000003058 platinum compounds Chemical class 0.000 description 1
- 229960003171 plicamycin Drugs 0.000 description 1
- 239000008389 polyethoxylated castor oil Substances 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229940068965 polysorbates Drugs 0.000 description 1
- 238000010837 poor prognosis Methods 0.000 description 1
- 230000008092 positive effect Effects 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 208000024896 potassium deficiency disease Diseases 0.000 description 1
- WSHYKIAQCMIPTB-UHFFFAOYSA-M potassium;2-oxo-3-(3-oxo-1-phenylbutyl)chromen-4-olate Chemical compound [K+].[O-]C=1C2=CC=CC=C2OC(=O)C=1C(CC(=O)C)C1=CC=CC=C1 WSHYKIAQCMIPTB-UHFFFAOYSA-M 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 208000025638 primary cutaneous T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 230000000861 pro-apoptotic effect Effects 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229940087463 proleukin Drugs 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 235000019260 propionic acid Nutrition 0.000 description 1
- 229960004063 propylene glycol Drugs 0.000 description 1
- 239000003806 protein tyrosine phosphatase inhibitor Substances 0.000 description 1
- 229940039716 prothrombin Drugs 0.000 description 1
- 230000009325 pulmonary function Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 229940107700 pyruvic acid Drugs 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- IUVKMZGDUIUOCP-BTNSXGMBSA-N quinbolone Chemical compound O([C@H]1CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)CC[C@@]21C)C1=CCCC1 IUVKMZGDUIUOCP-BTNSXGMBSA-N 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 229960004432 raltitrexed Drugs 0.000 description 1
- 229960002185 ranimustine Drugs 0.000 description 1
- 206010037844 rash Diseases 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 238000005057 refrigeration Methods 0.000 description 1
- 208000030859 renal pelvis/ureter urothelial carcinoma Diseases 0.000 description 1
- BXNMTOQRYBFHNZ-UHFFFAOYSA-N resiquimod Chemical compound C1=CC=CC2=C(N(C(COCC)=N3)CC(C)(C)O)C3=C(N)N=C21 BXNMTOQRYBFHNZ-UHFFFAOYSA-N 0.000 description 1
- 208000023504 respiratory system disease Diseases 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- KNUXHTWUIVMBBY-JRJYXWDASA-N rintatolimod Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](COP(O)(O)=O)O1.O[C@@H]1[C@H](O)[C@@H](COP(O)(O)=O)O[C@H]1N1C(=O)NC(=O)C=C1.O[C@@H]1[C@H](O)[C@@H](COP(O)(O)=O)O[C@H]1N1C(NC=NC2=O)=C2N=C1 KNUXHTWUIVMBBY-JRJYXWDASA-N 0.000 description 1
- 229950006564 rintatolimod Drugs 0.000 description 1
- 231100000279 safety data Toxicity 0.000 description 1
- 229960004889 salicylic acid Drugs 0.000 description 1
- 210000003079 salivary gland Anatomy 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- WUWDLXZGHZSWQZ-WQLSENKSSA-N semaxanib Chemical compound N1C(C)=CC(C)=C1\C=C/1C2=CC=CC=C2NC\1=O WUWDLXZGHZSWQZ-WQLSENKSSA-N 0.000 description 1
- 229960003440 semustine Drugs 0.000 description 1
- 208000013223 septicemia Diseases 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 208000017520 skin disease Diseases 0.000 description 1
- 201000002314 small intestine cancer Diseases 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000008354 sodium chloride injection Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 229960003787 sorafenib Drugs 0.000 description 1
- 229950007213 spartalizumab Drugs 0.000 description 1
- 208000027765 speech disease Diseases 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 208000037969 squamous neck cancer Diseases 0.000 description 1
- 238000012066 statistical methodology Methods 0.000 description 1
- 239000008117 stearic acid Chemical group 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 239000008227 sterile water for injection Substances 0.000 description 1
- 239000003206 sterilizing agent Substances 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 150000003871 sulfonates Chemical class 0.000 description 1
- 229960001796 sunitinib Drugs 0.000 description 1
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000003319 supportive effect Effects 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 210000004243 sweat Anatomy 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- UXXQOJXBIDBUAC-UHFFFAOYSA-N tandutinib Chemical compound COC1=CC2=C(N3CCN(CC3)C(=O)NC=3C=CC(OC(C)C)=CC=3)N=CN=C2C=C1OCCCN1CCCCC1 UXXQOJXBIDBUAC-UHFFFAOYSA-N 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- 229940095064 tartrate Drugs 0.000 description 1
- DKPFODGZWDEEBT-QFIAKTPHSA-N taxane Chemical class C([C@]1(C)CCC[C@@H](C)[C@H]1C1)C[C@H]2[C@H](C)CC[C@@H]1C2(C)C DKPFODGZWDEEBT-QFIAKTPHSA-N 0.000 description 1
- RCINICONZNJXQF-XAZOAEDWSA-N taxol® Chemical compound O([C@@H]1[C@@]2(CC(C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3(C21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-XAZOAEDWSA-N 0.000 description 1
- 229960004964 temozolomide Drugs 0.000 description 1
- 210000002435 tendon Anatomy 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 125000005207 tetraalkylammonium group Chemical group 0.000 description 1
- BSYVTEYKTMYBMK-UHFFFAOYSA-N tetrahydrofurfuryl alcohol Chemical compound OCC1CCCO1 BSYVTEYKTMYBMK-UHFFFAOYSA-N 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 229960001196 thiotepa Drugs 0.000 description 1
- 210000000115 thoracic cavity Anatomy 0.000 description 1
- 208000022944 thrombocytopenia 7 Diseases 0.000 description 1
- 208000008732 thymoma Diseases 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- MNRILEROXIRVNJ-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=NC=N[C]21 MNRILEROXIRVNJ-UHFFFAOYSA-N 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 108091007466 transmembrane glycoproteins Proteins 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 229960000575 trastuzumab Drugs 0.000 description 1
- 208000022679 triple-negative breast carcinoma Diseases 0.000 description 1
- 208000029387 trophoblastic neoplasm Diseases 0.000 description 1
- 229940030325 tumor cell vaccine Drugs 0.000 description 1
- 231100000588 tumorigenic Toxicity 0.000 description 1
- 230000000381 tumorigenic effect Effects 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 229960001055 uracil mustard Drugs 0.000 description 1
- 229950005972 urelumab Drugs 0.000 description 1
- 208000019206 urinary tract infection Diseases 0.000 description 1
- 208000037965 uterine sarcoma Diseases 0.000 description 1
- 206010046885 vaginal cancer Diseases 0.000 description 1
- 208000013139 vaginal neoplasm Diseases 0.000 description 1
- 125000002987 valine group Chemical group [H]N([H])C([H])(C(*)=O)C([H])(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 229960000241 vandetanib Drugs 0.000 description 1
- 208000019553 vascular disease Diseases 0.000 description 1
- 230000008728 vascular permeability Effects 0.000 description 1
- YCOYDOIWSSHVCK-UHFFFAOYSA-N vatalanib Chemical compound C1=CC(Cl)=CC=C1NC(C1=CC=CC=C11)=NN=C1CC1=CC=NC=C1 YCOYDOIWSSHVCK-UHFFFAOYSA-N 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- 229950005839 vinzolidine Drugs 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 229940023148 viral-based vaccine Drugs 0.000 description 1
- 210000001835 viscera Anatomy 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 230000036642 wellbeing Effects 0.000 description 1
- 229940055760 yervoy Drugs 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1793—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
- A61K38/2013—IL-2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/6425—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the peptide or protein in the drug conjugate being a receptor, e.g. CD4, a cell surface antigen, i.e. not a peptide ligand targeting the antigen, or a cell surface determinant, i.e. a part of the surface of a cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
- A61K9/19—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles lyophilised, i.e. freeze-dried, solutions or dispersions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
- C07K14/08—RNA viruses
- C07K14/15—Retroviridae, e.g. bovine leukaemia virus, feline leukaemia virus human T-cell leukaemia-lymphoma virus
- C07K14/155—Lentiviridae, e.g. human immunodeficiency virus [HIV], visna-maedi virus or equine infectious anaemia virus
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/55—IL-2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/715—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
- C07K14/7155—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0646—Natural killers cells [NK], NKT cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/20—Cytokines; Chemokines
- C12N2501/23—Interleukins [IL]
- C12N2501/2302—Interleukin-2 (IL-2)
Definitions
- Interleukin-2 is a cytokine that induces proliferation of antigen-activated T cells and stimulates natural killer (NK) cells.
- the biological activity of IL-2 is mediated through a multi-subunit IL-2 receptor complex (IL-2R) of three polypeptide subunits that span the cell membrane: p55 (IL-2R ⁇ , the alpha subunit, also known as CD25 in humans), p75 (IL-2R13, the beta subunit, also known as CD122 in humans) and p64 (IL-2R ⁇ , the gamma subunit, also known as CD132 in humans).
- IL-2R multi-subunit IL-2 receptor complex
- T cell response to IL-2 depends on a variety of factors, including: (1) the concentration of IL-2; (2) the number of IL-2R molecules on the cell surface; and (3) the number of IL-2R occupied by IL-2 (i.e., the affinity of the binding interaction between IL-2 and IL-2R).
- the IL-2:IL-2R complex is internalized upon ligand binding and the different components undergo differential sorting. IL-2R ⁇ is recycled to the cell surface, while IL-2 associated with the IL-2:IL-2R ⁇ complex is routed to the lysosome and degraded.
- Aldesleukin recombinant human IL-2 (rhlL-2) also as known as Proleukin
- rhlL-2 also as known as Proleukin
- rhIL-2 is one of the few treatment regimens that elicit a complete and durable response in a subset of patients, up to 12% in melanoma and 7% in RCC.
- High doses of rhIL-2 are required to stimulate cells that express the intermediate-affinity IL-2 receptor, including memory CD8 + T cells and natural killer (NK) cells, which are the primary cell types mediating anticancer immune responses.
- NK natural killer
- rhIL-2 a contributing factor limiting the therapeutic efficacy of rhIL-2 is that it preferentially activates and induces the expansion of immunosuppressive CD4 + T regs , which can counteract anticancer immune responses. This preferential activation is through binding of IL-2 to the high-affinity IL-2 receptor expressed on T regs . Furthermore, it is hypothesized that direct interaction between rhlL-2 with high-affinity IL-2R expressed on vascular and pulmonary endothelial cells contributes to rhIL-2-mediated toxicity via capillary leak syndrome.
- compositions, methods and treatment regimens in accordance with the invention provide numerous advantages for the treatment of cancer using IL-2 immunotherapy as compared to, for example, high dose rhlL-2 therapy (e.g. Aldesleukin). It has been discovered that administration of the fusion protein of SEQ ID NO: 1 when administered at doses of about 6 ⁇ g/kg/day to about 70 ⁇ g/kg/day and preferably at about 6 ⁇ g/kg/day to about 15 ⁇ g/kg/day or at a corresponding fixed per day dose based, for example, on an average 60-70 kg adult human (e.g.
- 0.4 mg/day to about 1-4 mg) or based on a child, for example a child of about 12 kg to 50 kg or more, provides a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in circulating T regulatory (Treg) cells.
- the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater in a patient administered the fusion protein of SEQ ID NO:1 in accordance with the methods of the invention as compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving, for example, high dose recombinant human IL-2 (rhlL-2) treatment.
- rhlL-2 high dose recombinant human IL-2
- the invention provides methods of treating cancer in a patient comprising administering to the patient a dose of at least about 6 ⁇ g/kg/day to about 15 ⁇ g/kg per day, or a corresponding fixed dose thereof based, for example, on a 60-70 kg adult (e.g. ⁇ 0.4 mg/day to about ⁇ 1.0 mg/day), or a corresponding fixed dose based on a child, for example, a child of about 12 kg to about 50 kg.
- a dose of at least about 6 ⁇ g/kg/day to about 15 ⁇ g/kg per day or a corresponding fixed dose thereof based, for example, on a 60-70 kg adult (e.g. ⁇ 0.4 mg/day to about ⁇ 1.0 mg/day), or a corresponding fixed dose based on a child, for example, a child of about 12 kg to about 50 kg.
- the dose of the fusion protein of SEQ ID NO: 1 in terms of ⁇ g/kg/day is a dose of about: 6 ⁇ g/kg/day, 8 ⁇ g/kg/day, 10 ⁇ g/kg/day, 12 ⁇ g/kg/day, 14 ⁇ g/kg/day, or 15 ⁇ g/kg/day or a corresponding fixed dose thereof based on, for example, a 60-70 kg adult or based on a child, for example a child of about 12 kg to 50 kg or more.
- administration of the fusion protein of SEQ ID NO: 1 results in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in T regulatory (Treg) cells.
- the increase in circulating NK cells and CD8+ cells is at least 2-fold over baseline prior to administration of the fusion protein of SEQ ID NO: 1 to the patient.
- the increase in circulating NK cells and CD8+ cells is greater relative to the increase in circulating Treg cells.
- an increase in circulating NK cells and CD8+ cells is greater relative to the increase in circulating Treg cells as compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating Treg cells in a patient receiving high dose rhIL-2 treatment.
- the patient has an improved safety profile as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment.
- the patient has a lower risk of capillary leak syndrome or cytokine release syndrome.
- the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater as compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment and the patient has a lower risk of capillary leak syndrome.
- the dose of the fusion protein of SEQ ID NO: 1 is administered by intravenous injection or infusion.
- the fusion protein of SEQ ID NO: 1 is administered by intravenous injection or infusion at a dose of at least about 6 ⁇ g/kg to about 15 ⁇ g/kg per day for 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 9 consecutive days.
- the rest period is at least about 16 days.
- the fusion protein of SEQ ID NO: 1 is administered in at least two courses of treatment, the first course of treatment comprising administration by intravenous injection or infusion at a dose of at least about 6 ⁇ g/kg to about 15 ⁇ g/kg per day for a period 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 9 consecutive days resulting in a total 14 day course followed by a second course of treatment comprising administering by intravenous injection or infusion at a dose of at least about 6 ⁇ g/kg to about 15 ⁇ g/kg per day for 1 to about 5 consecutive or non-consecutive days, followed by a rest period of at least about 16 consecutive days resulting in a total 21 day course.
- the first course of treatment comprising administration by intravenous injection or infusion at a dose of at least about 6 ⁇ g/kg to about 15 ⁇ g/kg per day for a period 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 16 consecutive days
- the second course of treatment begins within about 24 hours or more after completion of the first course of treatment.
- a third 21-day course of treatment follows the second course of administration.
- the third course of treatment begins within about 24 hours or more after completion of the second course of treatment.
- a fourth 21 day course of treatment follows the third course of administration.
- the fourth course of treatment begins within about 24 hours or more after completion of the third course of treatment.
- administering the fusion protein of SEQ ID NO: 1 further comprises co-administering to the patient a therapeutically effective amount of a therapeutic agent.
- a therapeutic agent is an immune checkpoint inhibitor or a PARP inhibitor.
- the therapeutic agent is an immune checkpoint inhibitor.
- the immune checkpoint inhibitor inhibits the interaction of PD-1 and PD-L.
- the immune checkpoint inhibitor is pembrolizumab.
- the fusion protein of SEQ ID NO: 1 is administered in at least two courses of treatment, the first course of treatment comprising administration by intravenous injection or infusion at a dose of at least about 6 ⁇ g/kg to about 15 ⁇ g/kg per day for 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 16 consecutive days resulting in a total 21 day course followed by a second course of treatment comprising administering by intravenous injection or infusion at a dose of at least about 6 ⁇ g/kg to about 15 ⁇ g/kg per day for a period of at least 5 consecutive days, followed by a rest period of at least about 16 consecutive days resulting in a total 21 day course and wherein the pembrolizumab is co-administered on the first day of the first course of and on the first day of the second course; wherein the pembrolizumab is co-administered prior to, simultaneously with, or subsequent to, administration of the fusion protein of SEQ ID NO:1
- the patient has an improved safety profile as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment; and preferably the patient has a lower risk of cytokine release syndrome as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment.
- the patient has a lower risk of capillary leak syndrome as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment.
- the invention also provides methods of treating cancer in a patient comprising administering to the patient a dose of at least about 6 ⁇ g/kg to about 15 ⁇ g/kg per day of the fusion protein of SEQ ID NO: 1 wherein the dose is administered by intravenous injection or infusion for 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 9 consecutive days resulting in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in T regulatory (Treg) cells; and wherein the increase in circulating NK cells and CD8+ cells is at least 2 fold over baseline prior to administration of the fusion protein of SEQ ID NO: 1 to the patient; preferably wherein the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater as compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving high dose recombin
- the invention also provides methods of treating cancer in a patient comprising administering to the patient a dose of at least about 6 ⁇ g/kg to about 15 ⁇ g/kg per day of the fusion protein of SEQ ID NO: 1 wherein the dose is administered by intravenous injection or infusion for 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 9 consecutive days resulting in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in T regulatory (Treg) cells and wherein the patient has an improved safety profile as compared to a patient receiving high dose recombinant human IL-2 (rhIL-2) treatment; preferably wherein the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater as compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving high dose recombinant human IL-2 (
- the invention also provides methods of treating cancer in a patient comprising administering to the patient a dose of at least about 6 ⁇ g/kg to about 15 ⁇ g/kg per day of the fusion protein of SEQ ID NO: 1 wherein the dose is administered by intravenous injection or infusion for 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 9 consecutive days resulting in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in T regulatory (Treg) cells and wherein the patient has a lower risk of cytokine release syndrome as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment; preferably wherein the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater as compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving high dose re
- the invention also provides methods of treating cancer in a patient comprising administering to the patient a dose of at least about 6 ⁇ g/kg to about 15 ⁇ g/kg per day of the fusion protein of SEQ ID NO: 1 wherein the dose is administered by intravenous injection or infusion for 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 9 consecutive days resulting in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in T regulatory (Treg) cells and lower risk of cytokine release syndrome as compared to a patient receiving high dose recombinant human IL-2 (rhIL-2) treatment preferably wherein the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater as compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving high dose recombinant human IL-2 (r
- the invention also provides pharmaceutical compositions comprising about 6 ⁇ g/kg to about 70 ⁇ g/kg and preferably about 6 ⁇ g/kg to about 15 ⁇ g/kg of the fusion protein of SEQ ID NO: 1; preferably wherein the pharmaceutical compositions comprise about 8 ⁇ g/kg to about 15 ⁇ g/kg of the fusion protein of SEQ ID NO: 1, preferably wherein the pharmaceutical composition comprises about 8 ⁇ g/kg of the fusion protein of SEQ ID NO: 1; preferably wherein the pharmaceutical composition comprises about 10 ⁇ g/kg of the fusion protein of SEQ ID NO: 1; preferably wherein the pharmaceutical composition comprises about 12 ⁇ g/kg of the fusion protein of SEQ ID NO: 1; preferably wherein the fusion protein comprises about 14 ⁇ g/kg of the fusion protein of SEQ ID NO: 1; and preferably wherein the fusion protein comprises about 15 ⁇ g/kg of the fusion protein of SEQ ID NO: 1.
- the invention also provides a method of treating cancer in a patient comprising administering to the patient a dose of at least about 50 ⁇ g/kg to about 60 ⁇ g/kg per day or at a corresponding fixed per day dose based on an average 60-70 kg adult human (e.g.
- rhIL-2 high dose recombinant human IL-2
- the invention also provides a pharmaceutical composition
- a pharmaceutical composition comprising at least about 6 ⁇ g/kg to about 70 ⁇ g/kg and preferably at least about 6 ⁇ g/kg to about 15 ⁇ g/kg, or at a corresponding fixed per day dose based on an average 60-70 kg adult human (e.g. ⁇ 0.4 mg to about ⁇ 1.0 mg), or a corresponding fixed dose based on a child, for example, a child of about 12 kg to about 50 kg or more, of the fusion protein of SEQ ID NO: 1.
- the invention also provides a pharmaceutical composition
- a pharmaceutical composition comprising about 40 ⁇ g/kg to about 70 ⁇ g/kg or at a corresponding fixed dose based on, for example, an average 60-70 kg adult human (e.g. ⁇ 3.0 mg to about ⁇ 3.6 mg), or a corresponding fixed dose based on a child, for example, a child of about 12 kg to about 50 kg or more, of the fusion protein of SEQ ID NO: 1; preferably wherein the composition comprises about 40 ⁇ g/kg to about 70 ⁇ g/kg of the fusion protein of SEQ ID NO: 1.
- the invention also provides a method of treating cancer in a patient comprising administering to the patient a dose of less than 6 ⁇ g/kg/day such as about 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5 and 5.9 ⁇ g/kg/day, or a corresponding fixed dose based on, for example, a 60-70 kg adult (e.g.
- a corresponding fixed dose based on a child for example, a child of about 12 kg to about 50 kg or more, of the fusion protein of SEQ ID NO: 1 resulting in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in circulating T regulatory (Treg) cells and wherein the increase in circulating NK cells and CD8+ cells is greater relative to the increase in circulating T regulatory (Treg).
- FIG. 1 shows diagrams of structural models of the fusion protein of SEQ ID NO: 1 (panel A) and its selective binding intermediate-affinity IL-2 receptor (panel B).
- FIG. 2 are diagrams of the treatment regimens for intravenous (IV.) infusion of the fusion protein of SEQ ID NO: 1 as monotherapy and as combination therapy with pembrolizumab in the first in human (FIH) study described in Example 1.
- FIG. 3 are graphs showing systemic exposure in human patients to the fusion protein of SEQ ID NO: 1 at various doses in accordance with the invention.
- FIG. 4 are graphs showing circulating Treg cells, NK cells and CD8+ cells responses in human patients who have been treated with the fusion protein of SEQ ID NO: 1 in accordance with the invention.
- FIG. 5 is a graph showing the pharmacodynamic response of patients exposed to high dose rhIL-2 as described in Example 2.
- FIG. 6 is a graph showing the pharmacodynamic response of patients exposed to high dose rhIL-2 as described in Example 2.
- FIG. 7 is a graph showing duration of treatment and overall response by tumor type in those patients treated with SEQ ID NO: 1 as a monotherapy.
- FIG. 8 is a graph showing duration of treatment and overall response by tumor type in those patients treated with SEQ ID NO: 1 as a combination therapy with pembrolizumab.
- FIG. 9 is graph showing change in tumor size from baseline by tumor type in those patients treated with 8 SEQ ID NO: 1 as a combination therapy with pembrolizumab.
- FIG. 10 is a series of graphs showing levels of inflammatory cytokines TNF ⁇ and IL-6 in mice treated with 8, 20, or 30 ⁇ g of the mouse ortholog of SEQ ID NO: 1.
- FIG. 11 is a graph showing the mean (+standard deviation) serum concentrations ( ⁇ g/mL) of SEQ ID NO: 1 in patients with advanced solid tumors after the first IV dose (0.1, 0.3, 1, 3, 6 or 8 ⁇ g/kg) of SEQ ID NO: 1 (Cycle 1 Day 1 (C1D1)).
- FIG. 12 are graphs showing the mean (+standard deviation) maximum serum concentrations (C max ) (left) and area under the concentration versus time curve from time 0 to the last measurable concentration (AUC last ) (right) in patients with advanced solid tumors after the first IV dose (0.1, 0.3, 1, 3, 6 or 8 ⁇ g/kg) of SEQ ID NO: 1 (Cycle 1 Day 1 (C1D1)).
- FIG. 13 are graphs showing the mean (+standard error) absolute counts (cells/ ⁇ L blood) of total NK cells (top), total CD8+ T cells (middle) and T regs (bottom) in patients with advanced solid tumors in patients with advanced solid tumors after the first two treatment cycles with IV SEQ ID NO: 1 at a dose of 0.1, 0.3, 1, 3, 6 or 8 ⁇ g/kg.
- FIG. 14 are graphs showing the mean (+standard error) fold change from baseline (FCB). Absolute counts of total NK cells (left), total CD8+ T cells (middle) and T regs cells (right) on cycle 1, day 8 (C1D8) and cycle 2 day 8 (C2D8) in patients with advanced solid tumors after the first two treatment cycles with IV SEQ ID NO: 1 at a dose of 0.1, 0.3, 1, 3, 6 or 8 ⁇ g/kg.
- FIG. 15 are graphs showing the mean (+standard error) maximum serum concentrations (pg/ml) ( ⁇ standard error) IFN ⁇ (left) and of IL-6 (right) in patients with advanced solid tumors after the first two treatment cycles with IV SEQ ID NO: 1 at a dose of 0.1, 0.3, 1, 3, 6 or 8 ⁇ g/kg.
- articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context.
- the invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process.
- the invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
- the term “about” or “approximately” as applied to one or more values of interest refers to a value that is similar to a stated reference value.
- the term “approximately” or “about” refers to a range of values that fall within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
- the term “substantially” refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest.
- One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result.
- the term “substantially” is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
- any form of administration or coadministration of a “combination”, “combined therapy” and/or “combined treatment regimen” refers to at least two therapeutically active agents or compositions which may be administered or co-administered”, simultaneously, in either separate or combined formulations, or sequentially at different times separated by minutes, hours or days.
- each agent will be administered at a dose and/or on a time schedule determined for that agent.
- parenteral refers to dosage forms that are intended for administration as an injection or infusion and includes subcutaneous, intravenous, intra-arterial, intraperitoneal, intracardiac, intrathecal, and intramuscular injection, as well as infusion injections usually by the intravenous route.
- therapeutic agent encompasses any agent administered to treat a symptom or disease in an individual in need of such treatment in addition to, or in combination with, SEQ ID NO: 1.
- additional therapeutic agent may comprise any active ingredients suitable for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
- chemotherapeutic agent refers to a compound or a derivative thereof that can interact with a cancer cell, thereby reducing the proliferative status of the cell and/or killing the cell for example, by impairing cell division or DNA synthesis, or by damaging DNA, effectively targeting fast dividing cells.
- chemotherapeutic agents include, but are not limited to, alkylating agents (e.g., cyclophosphamide, ifosfamide); metabolic antagonists (e.g., methotrexate (MTX), 5-fluorouracil or derivatives thereof); a substituted nucleotide; a substituted nucleoside; DNA demethylating agents (also known as antimetabolites; e.g., azacitidine); antitumor antibiotics (e.g., mitomycin, adriamycin); plant-derived antitumor agents (e.g., vincristine, vindesine, TAXOL®, paclitaxel, abraxane); cisplatin; carboplatin; etoposide; and the like.
- alkylating agents e.g., cyclophosphamide, ifosfamide
- metabolic antagonists e.g., methotrexate (MTX), 5-fluorouracil or
- Such agents may further include, but are not limited to, the anti-cancer agents trimethotrexate (TMTX); temozolomide; raltitrexed; S-(4-Nitrobenzyl)-6-thioinosine (NBMPR); 6-benzyguanidine (6-BG); a nitrosoureas a nitrosourea (rabinopyranosyl-N-methyl-N-nitrosourea (Aranose), Carmustine (BCNU, BiCNU), Chlorozotocin, Ethylnitrosourea (ENU), Fotemustine, Lomustine (CCNU), Nimustine, N-Nitroso-N-methylurea (NMU), Ranimustine (MCNU), Semustine, Streptozocin (Streptozotocin)); cytarabine; and camptothecin; or a therapeutic derivative of any thereof.
- TTTX trimethotrexate
- temozolomide
- a single “course” of treatment such as a first course, second course, third course and so on refers to a treatment regimen wherein the Fusion Protein is administered for a desired period of time such as 1 to about 5 consecutive or non-consecutive days of treatment or a once weekly administration followed by a rest period of a certain amount of consecutive days. Therefore, one course of treatment includes a period of time of consecutive or non-consecutive administration of the Fusion Protein to the patient followed by a rest period of consecutive days wherein there is no administration of the Fusion Protein to the patient.
- fusion protein designates a protein or peptide linked together with another protein or peptide by peptide bond between their respective N- and C-terminal amino acid residues or verse visa, or by insertion of the first protein or peptide into the internal region of the second protein or peptide by two peptide bonds at the N- and C-termini of the inserted protein or peptide.
- a peptide bond is a covalent chemical bond formed between carboxyl group of one amino acid and the amine group of another amino acid.
- a fusion protein is produced by expression of the fusion protein gene in an expression host, in which the coding sequence for the first protein or peptide is linked to the coding sequence of the second protein or peptide.
- Fusion Protein refers to the fusion protein of SEQ ID NO: 1.
- the invention also contemplates the use of a variant of the fusion protein of SEQ ID NO: 1 having an amino acid sequence having sequence identity that is about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher over a contiguous stretch of about 20 amino acids up to the full length of SEQ ID NO: 1.
- a variant of the SEQ ID NO: 1 may have a defined sequence identity as compared to SEQ ID NO: 1 over a defined length of contiguous amino acids (e.g., a “comparison window”). Methods of alignment of sequences for comparison are well-known in the art.
- Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Madison, Wis.), or by manual alignment and visual inspection (see, e.g., Current Protocols in Molecular Biology (Ausubel et al., eds. 1995 supplement)).
- a variant of the fusion protein of SEQ ID NO: 1 can comprise an amino acid sequence having at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, or at least about 99%, amino acid sequence identity to a contiguous stretch of SEQ ID NO: 1 of at least 20 amino acids and preferably from about 20 amino acids to about 40 amino acids, from about 40 amino acids to about 60 amino acids, from about 60 amino acids to about 80 amino acids, from about 80 amino acids to about 100 amino acids, from about 100 amino acids to about 120 amino acids, from about 120 amino acids to about 140 amino acids, from about 140 amino acids to about 150 amino acids, from about 150 amino acids to about 155 amino acids, from about 155 amino acids up to the full-length of SEQ ID NO: 1.
- IL-2 therapy includes administration of immunotherapy based on IL-2 and its associated biological functions as an immunotherapy including but not limited to maintenance of CD4 + regulatory T cells and differentiation of CD4 + T cells into a variety of subsets; promotion of CD8 + T-cell and NK cell cytotoxicity activity, and modulation of T-cell differentiation programs in response to antigen, promoting naive CD4 + T-cell differentiation into T helper-1 (Th1) and T helper-2 (Th2) cells while inhibiting T helper-17 (Th17) differentiation. Therefore “IL-2 therapy” as used herein includes but is not limited to immunotherapy with rhlL-2 or a variant of rhlL-2 such as the Fusion Protein of SEQ ID NO: 1.
- high dose IL-2 and “HD IL-2” include a dose of interleukin-2 (IL-2) of about or at least about 600,000 International Units (IU)/kg of body weight (kg)/dose, or about or at least about 720,000 IU/kg/dose.
- IL-2 interleukin-2
- low dose IL-2 and “LD IL-2” include a dose of interleukin-2 (IL-2) of less than about 600,000 IU/kg of body weight/dose, such as about 60,000 or about 72,000 IU/kg/dose, e.g., from about 60,000 to about 72,000 IU/kg/dose.
- IL-2 interleukin-2
- the term “subject” or “patient” refers to any organism to which a composition in accordance with the present disclosure may be administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes. Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans) and/or plants.
- patient refers to a human subject who may seek or be in need of treatment, requires treatment, is receiving treatment, will receive treatment, or a subject who is under care by a trained professional for a particular disease or condition.
- the “patient” can be a child (>1-17 years).
- the patient can be an infant (1 year and younger).
- the patient can be a pediatric patient, wherein the term “pediatric” is used as understood by those skilled in the art. For example, pediatric patients include infants, children and adolescents.
- phrases “pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- the term “preventing” refers to partially or completely delaying onset of an infection, disease, disorder and/or condition; partially or completely delaying onset of one or more symptoms, features, or clinical manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying onset of one or more symptoms, features, or manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying progression from an infection, a particular disease, disorder and/or condition; and/or decreasing the risk of developing pathology associated with the infection, the disease, disorder, and/or condition.
- protein or “peptide” as used herein refers to a at least two or more amino acid residues linked together by peptide bond.
- the amino acid sequence in a protein or peptide is shown in the standard format, i.e., from amino terminus (N-terminus) to carboxyl terminus (C-terminus).
- recombinant production refers to the techniques for manipulating and combining two or more DNA sequences together that include recombination, PCR (polymerase chain reaction), in vitro mutagenesis, and direct DNA synthesis. These techniques are described in numerous published books and manuals, including the “Current protocols in molecular biology” (Ausubel eds. 2008. John Wiley & Son).
- the term “substantially” refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest.
- One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result.
- the term “substantially” is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
- therapeutically effective amount refers to the administration of an agent to a subject, either alone or as part of a pharmaceutical composition and either in a single dose or as part of a series of doses, in an amount capable of having any detectable, positive effect on any symptom, aspect, or characteristic of a disease, disorder or condition when administered to the subject.
- the therapeutically effective amount can be ascertained by measuring relevant physiological effects, and it can be adjusted in connection with the dosing regimen and diagnostic analysis of the subject's condition, and the like. By way of example, measurement of the amount of inflammatory cytokines produced following administration can be indicative of whether a therapeutically effective amount has been used.
- a therapeutically effective amount refers to that amount which has the effect of (1) reducing the size of a tumor (i.e. tumor regression), (2) inhibiting (that is, slowing to some extent, preferably stopping) aberrant cell division, for example cancer cell division, (3) preventing or reducing the metastasis of cancer cells, and/or, (4) relieving to some extent (or, preferably, eliminating) one or more symptoms associated with a pathology related to or caused in part by unregulated or aberrant cellular division, including for example, cancer.
- An “effective amount” is also that amount that results in desirable PD and PK profiles and desirable immune cell profiling upon administration of the therapeutically active compositions of the invention.
- treating or “treatment” of a disease (or a condition or a disorder) as used herein refer to preventing the disease from occurring in a human subject or an animal subject that may be predisposed to the disease but does not yet experience or exhibit symptoms of the disease (prophylactic treatment), inhibiting the disease (slowing or arresting its development), providing relief from the symptoms or side-effects of the disease (including palliative treatment), and causing regression of the disease.
- the terms “treat,” “treating,” “treatment,” “therapeutic,” and “therapy” do not necessarily mean total cure or abolition of the disease or condition. Any alleviation of any undesired signs or symptoms of a disease or condition, to any extent can be considered treatment and/or therapy.
- treatment may include acts that may worsen the patient's overall feeling of well-being or appearance.
- these terms also mean that the life expectancy of an individual affected with a cancer may be increased or that one or more of the symptoms of the disease will be reduced.
- “treating” also includes enhancing or prolonging an anti-tumor response in a subject.
- PFS progression free survival
- OS Global survival
- OS rate is defined as the proportion of participants who are alive at the time point.
- OS for a participant is defined as the time from the first dosing date to the date of death due to any cause.
- a complete response is the disappearance of all signs of cancer in response to treatment.
- a complete response may also be referred to herein as “total remission”.
- partial response means a decrease in the size of the tumor, or in the extent of cancer in the body in response to treatment.
- a partial response may also be referred to herein as “partial remission”.
- cancer as used herein, shall be given its ordinary meaning, as a general term for diseases in which abnormal cells divide without control.
- reducing a tumor refers to a reduction in the size or volume of a tumor mass, a decrease in the number of metastasized tumors in a subject, a decrease in the proliferative status (the degree to which the cancer cells are multiplying) of the cancer cells, and the like.
- enhancing refers to allowing a subject or tumor cell to improve its ability to respond to a treatment disclosed herein.
- an enhanced response may comprise an increase in responsiveness of at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 98% or more.
- “enhancing” can also refer to enhancing the number of subjects who respond to a treatment such as a combination therapy comprising chemotherapy, drug-resistant immunocompetent cells, and immune checkpoint inhibitors.
- an enhanced response may refer to a total percentage of subjects who respond to a treatment wherein the percentage is of at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 98% or more.
- Immune checkpoint proteins regulate T cell function in the immune system.
- T cells play a central role in cell-mediated immunity.
- Immune checkpoint proteins interact with specific ligands that send a signal into the T cell and essentially switch off or inhibit T cell function.
- Cancer cells take advantage of this system by driving high levels of expression of immune checkpoint proteins on their surface that results in control of the T cells expressing immune checkpoint proteins on the surface of T cells that enter the tumor microenvironment, thus suppressing the anticancer immune response.
- inhibition of immune checkpoint proteins by agents referred to herein as “immune checkpoint protein inhibitors” or “immune checkpoint inhibitors” would result in restoration of T cell function and an immune response to the cancer cells.
- immune checkpoint proteins include, but are not limited to: CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR, OX40, B-7 family ligands or a combination thereof.
- the immune checkpoint inhibitor interacts with a ligand of an immune checkpoint protein which may be CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, OX40, A2aR, B-7 family ligands or a combination thereof.
- an immune checkpoint protein which may be CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, OX40, A2aR, B-7 family ligands or a combination thereof.
- immune checkpoint inhibitors include but are not limited to: from a PD-1 antagonist, PD-L1 antagonist, CTLA-4 antagonist, adenosine A2A receptor antagonist, B7-H3 antagonist, B7-H4 antagonist, BTLA antagonist, KIR antagonist, LAG3 antagonist, TIM-3 antagonist, VISTA antagonist or TIGIT antagonist.
- angiogenesis inhibitor refers to a drug, compound, antibody or other agent that keeps new blood vessels from forming. In cancer treatment, angiogenesis inhibitors may prevent the growth of new blood vessels that tumors need to grow.
- Angiogenesis inhibitors include those agents that can target one or more signaling pathways associated with receptor tyrosine kinases (RTK).
- RTKs include, but are not limited to, vascular endothelial growth factor receptors types 1, 2, and 3 (VEGFR1-3); platelet derived growth factor receptors, types alpha and beta (PDGFR ⁇ / ⁇ ) and fibroblast growth factor receptors (FGFR), types 1, 2, and 3 (FGFR1-3).
- Preferred angiogenesis inhibitors in accordance with the invention have broad target selectivity and are capable of simultaneous targeted inhibition of multiple RTKs and are referred to herein as “multiple receptor tyrosine kinase inhibitors”.
- “Pharmaceutically acceptable salt” refers to a salt of a compound of the disclosure that is pharmaceutically acceptable and that possesses the desired pharmacological activity of the parent compound.
- such salts are non-toxic may be inorganic or organic acid addition salts and base addition salts.
- such salts include: (1) acid addition salts, formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like; or formed with organic acids such as acetic acid, propionic acid, hexanoic acid, cyclopentanepropionic acid, glycolic acid, pyruvic acid, lactic acid, malonic acid, succinic acid, malic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, 3-(4-hydroxybenzoyl)benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, 1,2-ethane-disulfonic acid, 2-hydroxyethanesulfonic acid, benzenesulfonic acid, 4-chlorobenzenesulfonic acid, 2-naphthalenesulfonic acid, 4-toluenesulfonic acid
- Salts further include, by way of example only, sodium, potassium, calcium, magnesium, ammonium, tetraalkylammonium, and the like; and when the compound contains a basic functionality, salts of non-toxic organic or inorganic acids, such as hydrochloride, hydrobromide, tartrate, mesylate, acetate, maleate, oxalate and the like.
- non-toxic organic or inorganic acids such as hydrochloride, hydrobromide, tartrate, mesylate, acetate, maleate, oxalate and the like.
- such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in water or in an organic solvent, or in a mixture of the two; generally, nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are preferred.
- nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are preferred.
- Lists of suitable salts are found in Allen, Jr., L. V., ed., Remington: The Science and Practice of Pharmacy, 22nd Edition, Pharmaceutical Press, London, UK (2012).
- a recombinant human IL-2 variant fusion protein is a circularly permuted (cp) IL-2 variant fused to the extracellular domain of the IL-2R ⁇ portion of the IL-2 receptor and is referred to herein as the “fusion protein of SEQ ID NO: 1” or the “Fusion Protein” and has the following amino acid sequence:
- fusion proteins that are closely related to SEQ ID NO: 1, such as those fusion proteins having sequence identities of about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher identity over the full length of SEQ ID NO: 1 may also be suitable for administration in accordance with the methods of the invention.
- fusion proteins that are closely related to SEQ ID NO: 1, such as those fusion proteins having sequence identities of about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher identity over a contiguous sequence of at least about 20 amino acids up to the full length of SEQ ID NO: 1 may also be suitable for administration in accordance with the methods of the invention.
- the fusion protein of SEQ ID NO: 1 may be produced using a biological recombinant expression system or any protein synthesizer.
- Strategies for recombinant protein expression are well known in the art, and typically involve transfecting cells with a DNA vector that contains a genetic template encoding the Fusion Protein of SEQ ID NO: 1 and then culturing the cells so that they transcribe and translate the Fusion Protein. Typically, the cells are then lysed to extract the expressed protein for subsequent purification. Both prokaryotic and eukaryotic in vivo protein expression systems are widely used.
- the fusion protein of SEQ ID NO: 1 is produced in CHO cells.
- the invention provides pharmaceutical compositions of a dose of at least about 6 ⁇ g/kg to about 70 ⁇ g/kg of the fusion protein of SEQ ID NO: 1 and preferably pharmaceutical compositions of at least about 6 ⁇ g/kg to at least about 15 ⁇ g/kg of the fusion protein of SEQ ID NO: 1 and a pharmaceutically acceptable excipient or a corresponding fixed dose based on an average 60-70 kg adult human (e.g. ⁇ 0.4 mg to about ⁇ 1.0 mg) or based on a child, for example, a child of about 12 kg to about 50 kg or more.
- the invention also provides pharmaceutical compositions of a dose of at least about 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11, 11.5, 12, 12.5, 13, 13.5, 14, 14.5, or 15 ⁇ g/kg or at a corresponding fixed dose based on, for example, an average 60-70 kg adult or based on, for example, a child of about 12 kg to about 50 kg or more.
- the invention also provides pharmaceutical compositions of a dose of at least about 3 ⁇ g/kg to at least about 5.5 ⁇ g/kg of the fusion protein of SEQ ID NO: 1 and a pharmaceutically acceptable excipient or a corresponding fixed dose based on an average 60-70 kg adult human (e.g. ⁇ 0.2 mg to ⁇ 0.4 mg).
- the invention also provides pharmaceutical compositions of a dose of at least about 3, 3.5, 4, 4.5, 5, 5.5 ⁇ g/kg or a corresponding fixed dose based on an average 60-70 kg adult human or based on a child, for example a child of about 12 kg to about 50 kg or more.
- the invention also provides pharmaceutical compositions of a dose of at least about 40 ⁇ g/kg to at least about 70 ⁇ g/kg of the fusion protein of SEQ ID NO: 1 and a pharmaceutically acceptable excipient or a corresponding fixed dose based on an average 60-70 kg adult human (e.g. about 3.0 mg to about 3.6 mg) or based on a child, for example a child of about 12 kg to about 50 kg or more.
- a pharmaceutically acceptable excipient which, as used herein, includes any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired.
- Remington's The Science and Practice of Pharmacy, 21′Edition, A. R. Gennaro discloses various excipients used in formulating pharmaceutical compositions and known techniques for the preparation thereof.
- oral compositions can include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and/or perfuming agents.
- adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and/or perfuming agents.
- compositions are mixed with solubilizing agents such as CREMOPHOR®, alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and/or combinations thereof.
- Injectable preparations for example, sterile injectable aqueous or oleaginous suspensions may be formulated according to the known art using suitable dispersing agents, wetting agents, and/or suspending agents.
- Sterile injectable preparations may be sterile injectable solutions, suspensions, and/or emulsions in nontoxic parenterally acceptable diluents and/or solvents, for example, as a solution in 1,3-butanediol.
- the acceptable vehicles and solvents that may be employed are water, Ringer's solution, U.S.P., and isotonic sodium chloride solution.
- Sterile, fixed oils are conventionally employed as a solvent or suspending medium.
- any bland fixed oil can be employed including synthetic mono- or diglycerides.
- Fatty acids such as oleic acid can be used in the preparation of injectables.
- Injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, and/or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
- sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
- General considerations in the formulation and/or manufacture of pharmaceutical agents may be found, for example, in Remington's The Science and Practice of Pharmacy, 21 st Edition, A. R. Gennaro (Lippincott, Williams & Wilkins, Baltimore, Md., 2006; incorporated herein by reference).
- the fusion protein of SEQ ID NO: 1 ( FIG. 1A ) is designed to selectively bind to and activate the intermediate-affinity IL-2R, but not the high-affinity IL-2R.
- the IL-2R ⁇ domain of the fusion protein of SEQ ID NO: 1 serves to sterically impede the binding of the fusion protein of SEQ ID NO: 1 to the high-affinity IL-2R yet still allow binding to the intermediate-affinity IL-2R.
- the fusion protein of SEQ ID NO: 1 is administered to a cancer patient in accordance with the methods and dosing regimens of the invention.
- Preferred routes of administration are intravenous, e.g., intravenous injection and intravenous infusion, e.g., via central venous access. Additional routes of administration include subcutaneous, intramuscular, oral, nasal, and pulmonary administration.
- the Fusion Protein may be administered as part of a pharmaceutical composition comprising at least one excipient.
- the invention provides pharmaceutical compositions for intravenous (I. V.) administration comprising a dose of the fusion protein of SEQ ID NO: 1 in terms of ⁇ g/kg as is often preferred for calculating dose in pediatric patients but is also useful for calculating dose for adults, preferably at a dose of: about 0.1 ⁇ g/kg to about 70 ⁇ g/kg; about 1 ⁇ g/kg to about 70 ⁇ g/kg; about 1 ⁇ g/kg to about 50 ⁇ g/kg; about 1 ⁇ g/kg to about 30 ⁇ g/kg; about 1 ⁇ g/kg to about 25 ⁇ g/kg; about 1 ⁇ g/kg to about 15 ⁇ g/kg; about 1 ⁇ g/kg to about 10 ⁇ g/kg; about 1 ⁇ g/kg to about 5 ⁇ g/kg; about 1 ⁇ g/kg to about 3 ⁇ g/kg; about 6 ⁇ g/kg to about 70 ⁇ g/kg; about 6 ⁇ g/kg to about 50 ⁇ g/kg; about 6 ⁇ g
- the fusion protein of SEQ ID NO: 1 is administered by I.V infusion to a patient at a dose of at least about 6 ⁇ g/kg per day to at least about 15 ⁇ g/kg/day or at a corresponding fixed per day dose based on, for example, an average 60-70 kg adult human (e.g. ⁇ 0.4 mg/day to about ⁇ 1.0 mg/day) or a corresponding fixed per day dose based on a child for example, a child of about 12 kg to about 50 kg or more.
- the dose is about 6 ⁇ g/kg per day.
- the dose is about 8 ⁇ g/kg per day.
- the dose is about 10 ⁇ g/kg per day.
- administration of the Fusion Protein need not be consecutive and may take place over the course of 1, 2, 3, 4, or 5 non-consecutive days.
- the fusion protein is administered to the patient as a once a day by I.V. infusion for 1 to about 5 consecutive days.
- the Fusion Protein is administered to the patient once a day for 1-5 non-consecutive days, e.g. infusions on day 1 with one or two days in between before the next infusion and so on for the desired total number of infusion days prior to the rest period.
- the second course of treatment comprises administering the Fusion Protein of SEQ ID NO: 1 by I.V. infusion once a day for five (5) consecutive days followed by a rest period of at least about 16 consecutive days for a treatment course that lasts about 21 days.
- Additional treatment courses such as a third, fourth and fifth treatment courses, may follow the second treatment course, preferably starting within about 24 hours after the previous course is finished.
- all treatment courses after the first treatment course are at least about 21-day treatment courses.
- Fusion Protein is administered with another therapeutic and/or anti-cancer agent as described infra.
- the therapeutic agent is the immune checkpoint inhibitor, pembrolizumab.
- pembrolizumab is administered in a separate composition from the Fusion Protein and is preferably administered by I.V. infusion prior to, subsequent to, or simultaneously infusion of the Fusion Protein.
- pembrolizumab is administered in a once a day dose of about 200 ⁇ g or as per the standard prescribing recommendations.
- pembrolizumab is administered on the first day of each course of treatment with the Fusion Protein.
- An exemplary treatment regimen is shown in FIG. 2 .
- the first course of treatment with the fusion protein and all subsequent courses of treatment are generally about 21 day courses wherein the Fusion Protein is administered by I.V. infusion once a day for five (5) consecutive days followed by a rest period of at least about 16 consecutive days prior to the next course of administration.
- the days of administration need not be consecutive and may take place over the course of 1, 2, 3, 4, or 5 non-consecutive days.
- the invention also provides a dosing regimen wherein the fusion protein of SEQ ID NO:
- the periodic dosing is once every about 3 days to once every about 21 days.
- the periodic dosing is once every 3 days, once every 4 days, once every 7 days, once every 14 days or once every 21 days. In accordance with this periodic dosing e.g.
- the fusion protein of SEQ ID NO: 1 is administered by I.V. infusion on day 1, day 7, day 14 and day 21 during each treatment cycle.
- the fusion protein of SEQ ID NO: 1 is administered by I.V. infusion on day 1, and day 14 during each treatment cycle.
- the fusion protein of SEQ ID NO: 1 is administered by I.V. infusion on day 1, and day 21 during each treatment cycle.
- the fusion protein of SEQ ID NO: 1 is administered by I.V. infusion on day 1, day 7 and day 14 during each treatment cycle.
- the fusion protein of SEQ ID NO: 1 is administered by I.V. infusion on day 1, day 7 and day 21 during each treatment cycle.
- the fusion protein of SEQ ID NO: 1 is administered periodically, for example, the fusion protein of SEQ ID NO: 1 is administered to the patient by I.V. infusion on one or more days during a treatment cycle wherein each I.V. administration during the treatment cycle is separated by about 7 days, about 14 days, or about 21 days or any combination thereof so long as the administration of SEQ ID NO: 1 does not occur on consecutive days at doses of about 6 ⁇ g/kg per day to at about 15 ⁇ g/kg/day or at doses of about 16 ⁇ g/kg per day to about 70 ⁇ g/kg/day or a corresponding fixed per day dose based, for example, on an average 60-70 kg adult (e.g. ⁇ 1 mg to ⁇ 4 mg) or a corresponding fixed per day dose based on a child, for example, a child of about 12 kg to about 50 kg or more.
- each I.V. administration during the treatment cycle is separated by about 7 days, about 14 days, or about 21 days or any combination thereof so long as the
- the fusion protein of SEQ ID NO: 1 is administered periodically, for example, the patient is administered to the patient by I.V. infusion on one or more days during a treatment cycle wherein each I.V. administration during the treatment cycle is separated by about 7 days, about 14 days, or about 21 days or any combination thereof so long as the administration of SEQ ID NO: 1 does not occur on consecutive days preferably at a dose of about 16 ⁇ g/kg per day to about 70 ⁇ g/kg/day; preferably at dose of about 16 ⁇ g/kg per day to about 50 ⁇ g/kg/day; preferably at a dose of about 16 ⁇ g/kg per day to about 30 ⁇ g/kg/day; preferably at a dose of about 16 ⁇ g/kg per day to about 20 ⁇ g/kg/day; preferably at about a dose of 30 ⁇ g/kg per day to about 50 ⁇ g/kg/day; or a corresponding fixed per day dose based, for example, on an average 60-70 kg adult (e.g.
- a once a day dosing regimen of less than about 6 ⁇ g/kg/day or a fixed dose equivalent thereof based on a 60-70 kg human may be administered in accordance with any of the dosing regimens described above for in relation to doses between 6 ⁇ g/kg/day and 15 ⁇ g/kg/day.
- All of the dosing regimens of the invention described above preferably result in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in T regulatory (Treg) cells and preferably result in an increase in circulating NK cells and CD8+ cells that is greater relative to the increase in circulating Treg cells in the patient.
- all dosing regimens of the invention preferably require less frequent dosing e.g., once daily dosing of the fusion protein of SEQ ID NO: 1 as compared to dosing 3 times per day dosing of high dose or low dose rhlL-2.
- dosing parameters of monotherapy with the fusion protein of SEQ ID NO: 1 or any of the combination therapies described herein dictate that the dosage amount be less than an amount that could be irreversibly toxic to the subject (i.e., the maximum tolerated dose, “MTD”) and not less than an amount required to produce a measurable effect on the subject.
- MTD maximum tolerated dose
- Such amounts are determined by, for example, the pharmacokinetic and pharmacodynamic parameters associated with ADME, taking into consideration the route of administration and other factors.
- An effective dose is the dose or amount of an agent that produces a therapeutic response or desired effect in some fraction of the subjects taking it.
- the “median effective dose” or ED50 of an agent is the dose or amount of an agent that produces a therapeutic response or desired effect in 50% of the population to which it is administered.
- the ED50 is commonly used as a measure of reasonable expectance of an agent's effect, it is not necessarily the dose that a clinician might deem appropriate taking into consideration all relevant factors.
- the effective amount can be more than the calculated ED50, in other situations the effective amount can be less than the calculated ED50, and in still other situations the effective amount can be the same as the calculated ED50.
- the fusion protein of SEQ ID NO: 1 is administered to a cancer patient in accordance with the methods and dosing regimens of the invention.
- Preferred routes of administration are intravenous, e.g., intravenous injection and intravenous infusion, e.g., via central venous access. Additional preferred routes of administration include subcutaneous, intramuscular, oral, nasal, and pulmonary administration.
- the treatment regimens of the invention are administered to the patient until the patient is cured or until the patient is no longer benefiting from the treatment regimen.
- rhlL-2 human recombinant interleukin-2
- VLS vascular leak syndrome
- EC damage The pathogenesis of endothelial cell (EC) damage is complex and can involve activation or damage to ECs and leukocytes, release of cytokines and of inflammatory mediators, alteration in cell-cell and cell-matrix adhesion and in cytoskeleton function.
- CLS restricts the doses of IL-2 which can be administered to humans and, in some cases, necessitates the cessation of therapy.
- an “improved safety profile”, or a “lower risk of a side effects”, or “reduced frequency or severity of a side effect” associated with, for example standard rhlL-2 therapy and particularly as compared to high dose rhlL-2 therapy can be assessed in several ways.
- a side effect or symptom of IL-2 therapy may be quantified.
- a side effect or symptom of IL-2 therapy may be quantified on a semi-quantitative scale, for example 0 to 5, where 0 represents absence, 1 to 4 represent identifiable increases in severity, and 5 represents maximum severity.
- a side effect or symptom of IL-2 therapy may be quantified on a quantitative scale, for instance: mass per volume such as mass of cytokine per volume of tissue fluid; temperature; duration; rate; enzyme activity; oxygen saturation; and so on.
- mass per volume such as mass of cytokine per volume of tissue fluid
- temperature such as mass of cytokine per volume of tissue fluid
- rate such as rate
- enzyme activity oxygen saturation
- oxygen saturation such as oxygen saturation
- a side effect or symptom of IL-2 therapy may be quantified on a quantitative scale, for instance: mass per volume such as mass of cytokine per volume of tissue fluid; temperature; duration; rate; enzyme activity; oxygen saturation; and so on.
- the person skilled in the art will readily understand how to assess ad quantify any side effect or symptom of IL-2 therapy and be able to do so without difficulty or undue burden.
- the person skilled in the art will be able to measure: a cytokine concentration in plasma or serum; temperature (fever); heart rate (tachy
- a “lowered risk” of a side effect of IL-2 therapy may be about a 1% decrease, about a 2% decrease, about a 3% decrease, about a 4% decrease, about a 5% decrease, about a 6% decrease, about a 7% decrease, about an 8% decrease, about a 9% decrease, about a 10% decrease, about a 20% decrease, about a 30% decrease, about a 40% decrease, about a 50% decrease, about a 60% decrease, about a 70% decrease, about an 80% decrease, about a 90% decrease, about a 100%, decrease in the manifestation of side effects or symptom of IL-2 therapy as compared to, for example high dose rhlL-2 therapy.
- the dosing regimen of the Fusion Protein in accordance with the invention reduces the frequency and severity of capillary leak syndrome (CLS) also referred to herein as vascular leak syndrome (VLS).
- CLS capillary leak syndrome
- VLS vascular leak syndrome
- CRS cytokine-release syndrome
- SEQ ID NO: 1 has been shown to induce lower levels of inflammatory cytokines as compared to for example, rhlL-2 in mice. See Example 4 and FIG. 10 .
- MAS overlaps clinically with CRS with subjects potentially experiencing hepatosplenomegaly, lymphadenopathy, pancytopenia, liver dysfunction, disseminated intravascular coagulation, hypofibrinogenemia, hyperferritinemia, and hypertriglyceridemia.
- subjects with MAS exhibit elevated levels of cytokines, including IFN- ⁇ and GMCSF.
- Neurotoxicity may result from immunotherapy including IL-2 therapy and symptoms may include cerebral edema, delirium, hallucinations, dysphasia, akinetic mutism, headache, confusion, alterations in wakefulness, ataxia, apraxia, facial nerve palsy, tremor, dysmetria, and seizure.
- Patients undergoing IL-2 immunotherapy may experience one or more side effects or symptoms that are not necessarily caused by CLS, CRS, MAS or TLS including anemia, aphasia, arrhythmia, arthralgia, back pain, blood and bone marrow disorders, blood and lymphatic system disorders, cardiac disorders, chills, coagulation disorders, colitis, confused state, constitutional symptoms, cough, decreased appetite, diarrhea, disorientation, dizziness, dyspnea, encephalopathy, fatigue, fever, gastrointestinal disorders, general cardiovascular disorders, hemorrhage, hepatic disorders, hyperglycemia, hypokalemia, hypothyroidism, increased ALT, increased AST, increased C-reactive protein, infection febrile neutropenia, leukopenia, malaise, abnormal metabolic laboratory-testing results, metabolism nutrition disorders, mucosal inflammation, musculoskeletal disorders, myalgia nausea, nervous system disorders, neurologic disorders, neutropenia edema, pain, palmar-plantar erythrody
- Representative cancers include, but are not limited to, Acute Lymphoblastic Leukemia, Adult; Acute Lymphoblastic Leukemia, Childhood; Acute Myeloid Leukemia, Adult; Adrenocortical Carcinoma; Adrenocortical Carcinoma, Childhood; AIDS-Related Lymphoma; AIDS-Related Malignancies; Anal Cancer; Astrocytoma, Childhood Cerebellar; Astrocytoma, Childhood Cerebral; Bile Duct Cancer, Extrahepatic; Bladder Cancer; Bladder Cancer, Childhood; Bone Cancer, Osteosarcoma/Malignant Fibrous Histiocytoma; Glioblastoma, Childhood; Glioblastoma, Childhood; Brain Stem Glioma, Childhood; Brain Tumor, Adult; Brain Tumor, Brain Stem Glioma, Childhood; Brain Tumor, Cerebellar Astrocytoma, Childhood; Brain Tumor, Cerebral Astrocytoma/M
- reducing a tumor refers to a reduction in the size or volume of a tumor mass, a decrease in the number of metastasized tumors in a subject, a decrease in the proliferative status (the degree to which the cancer cells are multiplying) of the cancer cells, and the like.
- the treatment regimens of the invention are particularly suited for treating solid tumors including but not limited to: lymphomas, melanoma, renal cell carcinoma (RCC), advanced solid tumors, tumors that have previously been treated with therapeutic therapy but remain refractory to previous therapies.
- the treatment regimens of the invention are particularly suited for treating solid tumors including but not limited to: lymphomas, melanoma, renal cell carcinoma (RCC), hepatic cell carcinoma (HCC), non-small cell lung cancer (NSCLC), small cell lung cancer (SCLC), squamous cell carcinoma of the head and neck (SCCHN) and including advanced solid tumors and tumors that have previously been treated with anti-cancer therapy but remain refractory to previous therapies.
- fusion protein of SEQ ID NO: 1 may be used as a monotherapy in the treatment regimens in accordance with the invention, the combination of the fusion protein of SEQ ID NO: 1 with other anticancer treatments in the context of the invention is also contemplated.
- Other therapeutic treatment regimens include other therapeutic immunotherapies such as adoptive cell transfer regimens, antigen-specific vaccination, inhibition of DNA repair proteins (e.g.
- CTLA-4 cytotoxic T lymphocyte-associated antigen 4
- PD-1 programmed death 1
- immune checkpoint proteins include, but are not limited to: CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR, OX40, B-7 family ligands or a combination thereof.
- the immune checkpoint inhibitor interacts with a ligand of an immune checkpoint protein which may be CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, OX40, A2aR, B-7 family ligands or a combination thereof.
- the immune checkpoint inhibitor is a biologic therapeutic or a small molecule.
- the immune checkpoint inhibitor is a monoclonal antibody, a humanized antibody, a fully human antibody, a fusion protein or a combination thereof.
- the PD1 immune checkpoint inhibitor comprises one or more anti-PD-1 antibodies, including nivolumab and pembrolizumab.
- the combination therapy methods described herein include administering at least one immune checkpoint inhibitor in combination with the fusion protein of SEQ ID NO: 1.
- the invention is not limited to any specific immune checkpoint inhibitor so long as the immune checkpoint inhibitor inhibits one or more activities of the target immune checkpoint proteins when administered in an effective amount as monotherapy or in combination with the fusion protein of SEQ ID NO: 1.
- minimal inhibition of the immune checkpoint protein by the immune checkpoint inhibitor may be sufficient in the presence of SEQ ID NO: 1.
- Many immune checkpoint inhibitors are known in the art.
- Exemplary PD-1/PD-L1 based immune checkpoint inhibitors include antibody-based therapeutics.
- Exemplary treatment methods that employ PD-1/PD-L1 based immune checkpoint inhibition are described in U.S. Pat. Nos. 8,728,474 and 9,073,994, and EP Patent No. 1537878B1, and, for example, include the use of anti-PD-1 antibodies.
- Exemplary anti-PD-1 antibodies are described, for example, in U.S. Pat. Nos. 8,952,136, 8,779,105, 8,008,449, 8,741,295, 9,205,148, 9,181,342, 9,102,728, 9,102,727, 8,952,136, 8,927,697, 8,900,587, 8,735,553, and 7,488,802.
- Exemplary anti-PD-1 antibodies include, for example, nivolumab (OPDIVO®, Bristol-Myers Squibb Co.), pembrolizumab (KEYTRUDA®, Merck Sharp & Dohme Corp), PDR001 (Novartis Pharmaceuticals), and pidilizumab (CT-011, Cure Tech).
- Exemplary anti-PD-L1 antibodies are described, for example, in U.S. Pat. Nos.
- Exemplary anti-PD-L1 antibodies include, for example, atezolizumab (TECENTRIQ®, Genentech), durvalumab (AstraZeneca), MEDI4736, avelumab, and BMS 936559 (Bristol Myers Squibb Co.).
- a method or composition described herein is administered in combination with a CTLA-4 inhibitor.
- CTLA-4 In the CTLA-4 pathway, the interaction of CTLA-4 on a T-cell with its ligands (e.g., CD80, also known as B7-1, and CD86) on the surface of an antigen presenting cells (rather than cancer cells) leads to T-cell inhibition.
- ligands e.g., CD80, also known as B7-1, and CD86
- antigen presenting cells also known as cancer cells
- Exemplary CTLA-4 based immune checkpoint inhibition methods are described in U.S. Pat. Nos. 5,811,097, 5,855,887, 6,051,227.
- anti-CTLA-4 antibodies are described in U.S. Pat. Nos.
- CTLA-4 antibodies include ipilimumab or tremelimumab.
- a method or composition of the invention is administered in combination with (i) a PD-1 or PD-LI inhibitor, e.g., a PD-1 or PD-L1 inhibitor disclosed herein, and (ii) CTLA-4 inhibitor, e.g., a CTLA-4 inhibitor disclosed herein.
- a PD-1 or PD-LI inhibitor e.g., a PD-1 or PD-L1 inhibitor disclosed herein
- CTLA-4 inhibitor e.g., a CTLA-4 inhibitor disclosed herein.
- FDA approved immune checkpoint protein inhibitors includes:
- a preferred treatment regimen of the invention combines the fusion protein of SEQ ID NO: 1 administered in accordance with the invention with the immune checkpoint inhibitor, pembrolizumab.
- pembrolizumab is administered on the first day of each treatment cycle of the treatment regimen according to the invention.
- 200 mg of pembrolizumab is administered in accordance with manufacturer's recommendations, generally once every three weeks or 21 days.
- Treatment regimens with the fusion protein of SEQ ID NO: 1 in accordance with the invention may also be combined with other therapeutic agents and/or anti-cancer agents in addition to, or instead of, immune checkpoint inhibitors.
- the therapeutic agent and/or anti-cancer agent is an antibody.
- the therapeutic agent is a therapeutic protein.
- the therapeutic agent is a small molecule.
- the anticancer agent is an antigen.
- the therapeutic agent is a population of cells.
- the therapeutic agent is a therapeutic antibody.
- the therapeutic agent is another cytotoxic and/or chemotherapeutic agent.
- cytotoxic agent refers to a substance that inhibits or prevents a cellular function and/or causes cell death or destruction.
- Chemotherapeutic agent includes chemical compounds useful in the treatment of cancer.
- SEQ ID NO: 1 may be combined with a therapeutic antibody.
- Methods of producing antibodies, and antigen-binding fragments thereof, are well known in the art and are disclosed in, e.g., U.S. Pat. No. 7,247,301, US2008/0138336, and U.S. Pat. No. 7,923,221, all of which are herein incorporated by reference in their entirety.
- Therapeutic antibodies that can be used in the methods of the present invention include, but are not limited to, any of the art-recognized therapeutic antibodies that are approved for use, in clinical trials, or in development for clinical use. In some embodiments, more than one therapeutic antibody can be included in the combination therapy of the present invention.
- Non-limiting examples of therapeutic antibodies include the following, without limitation:
- the therapeutic antibodies to be used in the methods of the present invention are not limited to those described herein.
- the following approved therapeutic antibodies can also be used in the methods of the invention: brentuximab vedotin (ADCETRISTM) for anaplastic large cell lymphoma and Hodgkin lymphoma, ipilimumab (MDX-101; YERVOYTM) for melanoma, ofatumumab (ARZERRATM) for chronic lymphocytic leukemia, panitumumab (VECTIBIXTM) for colorectal cancer, alemtuzumab (CAMPATHTM) for chronic lymphocytic leukemia, ofatumumab (ARZERRATM) for chronic lymphocytic leukemia, gemtuzumab ozogamicin (MYLOTARGTM) for acute myelogenous leukemia.
- ADCETRISTM for anaplastic large cell lymphoma and Hodgkin lympho
- Antibodies for use in accordance with the invention can also target molecules expressed by immune cells, such as, but not limited to, tremelimumab (CP-675,206) and ipilimumab (MDX-010) which targets CTLA4 and has the effect of tumor rejection, protection from re-challenge, and enhanced tumor-specific T cell responses; OX86 which targets OX40 and increases antigen-specific CD8+ T cells at tumor sites and enhances tumor rejection; CT-011 which targets PD 1 and has the effect of maintaining and expanding tumor specific memory T cells and activates NK cells; BMS-663513 which targets CD137 and causes regression of established tumors, as well as the expansion and maintenance of CD8+ T cells, and daclizumab (ZENAPAXTM) which targets CD25 and causes transient depletion of CD4+CD25+FOXP3+Tregs and enhances tumor regression and increases the number of effector T cells.
- tremelimumab CP-675,206
- MDX-010
- the antibody is a pro-inflammatory and/or pro-tumorigenic cytokine targeting antibody including, but not limited to, anti-TNF antibodies, anti-IL-1Ra receptor targeting antibodies, anti-IL-1 antibodies, anti-IL-6 receptor antibodies, and anti-IL-6 antibodies.
- antibodies include those that target pro-inflammatory T helper type 17 cells (TH17).
- the therapeutic antibody can be a fragment of an antibody; a complex comprising an antibody; or a conjugate comprising an antibody.
- the antibody can optionally be chimeric or humanized or fully human.
- the methods of the invention include administration of the fusion protein of SEQ ID NO: 1 in accordance with the treatment regimen of the invention in combination with a therapeutic protein or peptide.
- Therapeutic proteins that are effective in treating cancer are well known in the art.
- the therapeutic polypeptide or protein is a “suicide protein” that causes cell death by itself or in the presence of other compounds.
- a representative example of such a suicide protein is thymidine kinase of the herpes simplex virus. Additional examples include thymidine kinase of varicella zoster virus, the bacterial gene cytosine deaminase (which converts 5-fluorocytosine to the highly toxic compound 5-fluorouracil), p450 oxidoreductase, carboxypeptidase G2, beta-glucuronidase, penicillin-V-amidase, penicillin-G-amidase, beta-lactamase, nitroreductase, carboxypeptidase A, linamarase (also referred to as ⁇ -glucosidase), the E. coli gpt gene, and the E. coli Deo gene, although others are known in the art.
- the suicide protein converts a prodrug into a toxic compound.
- prodrug means any compound useful in the methods of the present invention that can be converted to a toxic product, i.e. toxic to tumor cells.
- the prodrug is converted to a toxic product by the suicide protein.
- Representative examples of such prodrugs include: ganciclovir, acyclovir, and FIAU (1-(2-deoxy-2-fluoro- ⁇ -D-arabinofuranosyl)-5-iod-ouracil) for thymidine kinase; ifosfamide for oxidoreductase; 6-methoxypurine arabinoside for VZV-TK; 5-fluorocytosine for cytosine deaminase; doxorubicin for beta-glucuronidase; CB 1954 and nitrofurazone for nitroreductase; and N-(Cyanoacetyl)-L-phenylalanine or N-(3-chloropropionyl)-L-phenylalan
- the therapeutic protein or polypeptide is a cancer suppressor, for example p53 or Rb, or a nude acid encoding such a protein or polypeptide.
- a cancer suppressor for example p53 or Rb
- a nude acid encoding such a protein or polypeptide Those of skill know of a wide variety of such cancer suppressors and how to obtain them and/or the nucleic acids encoding them.
- anti-cancer/therapeutic proteins or polypeptides include pro-apoptotic therapeutic proteins and polypeptides, for example, p15, p16, or p21 WAF-1 .
- Cytokines, and nucleic acid encoding them may also be used as therapeutic proteins and polypeptides.
- Examples include: GM-CSF (granulocyte macrophage colony stimulating factor); TNF-alpha (Tumor necrosis factor alpha); Interferons including, but not limited to, IFN-alpha and IFN-gamma; and Interleukins including, but not limited to, Interleukin-1 (IL-1), Interleukin-Beta (IL-beta), Interleukin-2 (IL-2), Interleukin-4 (IL-4), Interleukin-5 (IL-5), Interleukin-6 (IL-6), Interleukin-7 (IL-7), Interleukin-8 (IL-8), Interleukin-10 (IL-10), Interleukin-12 (IL-12), Interleukin-13 (IL-13), Interleukin-14 (IL-14), Interleukin-15 (IL-15), Interleukin-16 (IL-16), Interleukin-18 (IL-18), Interleukin-23 (IL-23), Inter
- cytocidal genes includes, but is not limited to, mutated cyclin G1 genes.
- the cytocidal gene may be a dominant negative mutation of the cyclin G1 protein (e.g., WO/01/64870).
- the therapeutic regimens of the invention include administration of a fusion protein of SEQ ID NO: 1 in combination with administration of a cancer vaccine for stimulating a cancer specific-immune response, e.g., innate and adaptive immune responses, for generating host immunity against a cancer (see, e.g., Overwijk, et al. Journal of Experimental Medicine 2008; 198:569-80).
- a cancer vaccine for stimulating a cancer specific-immune response, e.g., innate and adaptive immune responses, for generating host immunity against a cancer (see, e.g., Overwijk, et al. Journal of Experimental Medicine 2008; 198:569-80).
- Illustrative vaccines include, but are not limited to, for example, antigen vaccines, whole cell vaccines, dendritic cell vaccines, and DNA vaccines.
- the vaccine composition may include one or more suitable adjuvants known to enhance a subject's immune response to the vaccine.
- the vaccine may, for example, be cellular based, i.e., created using cells from the patient's own cancer cells to identify and obtain an antigen.
- exemplary vaccines include tumor cell-based and dendritic-cell based vaccines, where activated immune cells from the subject are delivered back to the same subject, along with other proteins, to further facilitate immune activation of these tumor antigen primed immune cells.
- Tumor cell-based vaccines include whole tumor cells and gene-modified tumor cells. Whole tumor cell vaccines may optionally be processed to enhance antigen presentation, e.g., by irradiation of either the tumor cells or tumor lysates).
- Vaccine administration may also be accompanied by adjuvants such as bacillus calmette-guerin (BCG) or keyhole limpet hemocyanin (KLH), depending upon the type of vaccine employed.
- BCG bacillus calmette-guerin
- KLH keyhole limpet hemocyanin
- Plasmid DNA vaccines may also be used and can be administered via direct injection or biolistically. Also contemplated for use are peptide vaccines, viral gene transfer vector vaccines, and antigen-modified dentritic cells (DCs).
- DCs antigen-modified dentritic cells
- the vaccine is a therapeutic cancer peptide-based vaccine.
- Peptide vaccines can be created using known sequences or from isolated antigens from a subject's own tumor(s) and include neoantigens and modified antigens.
- Illustrative antigen-based vaccines include those where the antigen is a tumor-specific antigen.
- the tumor-specific antigen may be selected from a cancer-testis antigen, a differentiation antigen, and a widely occurring over-expressed tumor associated antigen, among others.
- Recombinant peptide vaccines, based on peptides from tumor-associated antigens, when used in the instant method, may be administered or formulated with, an adjuvant or immune modulator.
- a peptide vaccine may comprise a cancer-testis antigen such as MAGE, BAGE, NY-ESO-1 and SSX-2, encoded by genes that are normally silenced in adult tissues but transcriptionally reactivated in tumor cells.
- the peptide vaccine may comprise a tissue differentiation associated antigen, i.e., an antigen of normal tissue origin and shared by both normal and tumorous tissue.
- the vaccine may comprise a melanoma-associated antigen such as gp100, Melan-A/Mart-1, MAGE-3, or tyrosinase; or may comprise a prostate cancer antigen such as PSA or PAP.
- the vaccine may comprise a breast cancer-associated antigen such as mammaglobin-A.
- tumor antigens that may be comprised in a vaccine for use in the instant method include, for example, CEA, MUC-1, HER1/Nue, hTERT, ras, and B-raf.
- Other suitable antigens that may be used in a vaccine include SOX-2 and OCT-4, associated with cancer stem cells or the EMT process.
- Antigen vaccines include multi-antigen and single antigen vaccines.
- Exemplary cancer antigens may include peptides having from about 5 to about 30 amino acids, or from about 6 to 25 amino acids, or from about 8 to 20 amino acids.
- an immunostimulatory adjuvant may be used in a vaccine, in particular, a tumor-associated antigen-based vaccine, to assist in generating an effective immune response.
- a vaccine may incorporate a pathogen-associated molecular pattern (PAMP) to assist in improving immunity.
- PAMP pathogen-associated molecular pattern
- Additional suitable adjuvants include monophosphoryl lipid A, or other lipopolysaccharides; toll-like receptor (TLR) agonists such as, for example, imiquimod, resiquimod (R-848), TLR3, IMO-8400, and rintatolimod.
- Additional adjuvants suitable for use include heat shock proteins.
- a genetic vaccine typically uses viral or plasmid DNA vectors carrying expression cassettes. Upon administration, they transfect somatic cells or dendritic cells as part of the inflammatory response to thereby result in cross-priming or direct antigen presentation.
- a genetic vaccine is one that provides delivery of multiple antigens in one immunization.
- Genetic vaccines include DNA vaccines, RNA vaccines and viral-based vaccines.
- DNA vaccines for use in the instant methods are bacterial plasmids that are constructed to deliver and express tumor antigen.
- DNA vaccines may be administered by any suitable mode of administration, e.g., subcantaneous or intradermal injection, but may also be injected directly into the lymph nodes. Additional modes of delivery include, for example, gene gun, electroporation, ultrasound, laser, liposomes, microparticles and nanoparticles.
- the vaccine comprises a neoantigen, or multiple neoantigens.
- the vaccine is a neoantigen-based vaccine.
- a neoantigen-based vaccine (NBV) composition may encode multiple cancer neoantigens in tandem, where each neoantigen is a polypeptide fragment derived from a protein mutated in cancer cells.
- a neoantigenic vaccine may comprise a first vector comprising a nucleic acid construct encoding multiple immunogenic polypeptide fragments, each of a protein mutated in cancer cells, where each immunogenic polypeptide fragment comprises one or more mutated amino acids flanked by a variable number of wild type amino acids from the original protein, and each polypeptide fragment is joined head-to-tail to form an immunogenic polypeptide.
- the lengths of each of the immunogenic polypeptide fragments forming the immunogenic polypeptide can vary.
- Viral gene transfer vector vaccines may also be used; in such vaccines, recombinant engineered virus, yeast, bacteria or the like is used to introduce cancer-specific proteins to the patient's immune cells.
- a vector-based approach which can be tumor lytic or non-tumor lytic, the vector can increase the efficiency of the vaccine due to, for example, its inherent immunostimulatory properties.
- Illustrative viral-based vectors include those from the poxviridae family, such as vaccinia, modified vaccinia strain Ankara and avipoxviruses.
- the cancer vaccine PROSTVAC, containing a replication-competent vaccinia priming vector and a replication-incompetent fowlbox-boosting vector.
- Each vector contains transgenes for PSA and three co-stimulatory molecules, CD80, CD54 and CD58, collectively referred to as TRICOM.
- Other suitable vector-based cancer vaccines include Trovax and TG4010 (encoding MUC1 antigen and IL-2). Additional vaccines for use include bacteria and yeast-based vaccines such as recombinant Listeria monocytogenes and Saccharomyces cerevisae.
- vaccines may be combined and/or formulated with adjuvants and other immune boosters to increase efficacy.
- administration may be either intratumoral or non-intratumoral (i.e., systemic).
- cancer antigens that can be used in vaccinations include, but are not limited to, (i) tumor-specific antigens, (ii) tumor-associated antigens, (iii) cells that express tumor-specific antigens, (iv) cells that express tumor-associated antigens, (v) embryonic antigens on tumors, (vi) autologous tumor cells, (vii) tumor-specific membrane antigens, (viii) tumor-associated membrane antigens, (ix) growth factor receptors, (x) growth factor ligands, and (xi) any other type of antigen or antigen-presenting cell or material that is associated with a cancer.
- the cancer antigen may be an epithelial cancer antigen, (e.g., breast, gastrointestinal, lung), a prostate specific cancer antigen (PSA) or prostate specific membrane antigen (PSMA), a bladder cancer antigen, a lung (e.g., small cell lung) cancer antigen, a colon cancer antigen, an ovarian cancer antigen, a brain cancer antigen, a gastric cancer antigen, a renal cell carcinoma antigen, a pancreatic cancer antigen, a liver cancer antigen, an esophageal cancer antigen, a head and neck cancer antigen, or a colorectal cancer antigen.
- epithelial cancer antigen e.g., breast, gastrointestinal, lung
- PSA prostate specific cancer antigen
- PSMA prostate specific membrane antigen
- bladder cancer antigen e.g., a lung (e.g., small cell lung) cancer antigen
- a colon cancer antigen e.g., an ovarian cancer antigen
- a brain cancer antigen
- the cancer antigen is a lymphoma antigen (e.g., non-Hodgkin's lymphoma or Hodgkin's lymphoma), a B-cell lymphoma cancer antigen, a leukemia antigen, a myeloma (i.e., multiple myeloma or plasma cell myeloma) antigen, an acute lymphoblastic leukemia antigen, a chronic myeloid leukemia antigen, or an acute myelogenous leukemia antigen.
- the described cancer antigens are only exemplary, and that any cancer antigen can be targeted in the present invention.
- the cancer antigen is a mucin-1 protein or peptide (MUC-1) that is found on all human adenocarcinomas: pancreas, colon, breast, ovarian, lung, prostate, head and neck, including multiple myelomas and some B cell lymphomas.
- MUC-1 is a type I transmembrane glycoprotein. The major extracellular portion of MUC-1 has a large number of tandem repeats consisting of 20 amino acids which comprise immunogenic epitopes. In some cancers it is exposed in an unglycosylated form that is recognized by the immune system (Gendler et al., J Biol Chem 1990; 265:15286-15293).
- the cancer antigen is a mutated B-Raf antigen, which is associated with melanoma and colon cancer.
- the vast majority of these mutations represent a single nucleotide change of T-A at nucleotide 1796 resulting in a valine to glutamic acid change at residue 599 within the activation segment of B-Raf.
- Raf proteins are also indirectly associated with cancer as effectors of activated Ras proteins, oncogenic forms of which are present in approximately one-third of all human cancers.
- Normal non-mutated B-Raf is involved in cell signaling, relaying signals from the cell membrane to the nucleus. The protein is usually only active when needed to relay signals.
- mutant B-Raf has been reported to be constantly active, disrupting the signaling relay (Mercer and Pritchard, Biochim Biophys Acta (2003) 1653(1):25-40; Sharkey et al., Cancer Res. (2004) 64(5):1595-1599).
- the cancer antigen is a human epidermal growth factor receptor-2 (HER-2/neu) antigen.
- HER-2/neu human epidermal growth factor receptor-2
- Cancers that have cells that overexpress HER-2/neu are referred to as HER-2/neu + cancers.
- Exemplary HER-2/neu + cancers include prostate cancer, lung cancer, breast cancer, ovarian cancer, pancreatic cancer, skin cancer, liver cancer (e.g., hepatocellular adenocarcinoma), intestinal cancer, and bladder cancer.
- HER-2/neu has an extracellular binding domain (ECD) of approximately 645 aa, with 40% homology to epidermal growth factor receptor (EGFR), a highly hydrophobic transmembrane anchor domain (TMD), and a carboxyterminal intracellular domain (ICD) of approximately 580 aa with 80% homology to EGFR.
- ECD extracellular binding domain
- EGFR epidermal growth factor receptor
- TMD highly hydrophobic transmembrane anchor domain
- ICD carboxyterminal intracellular domain
- AH002823 human HER-2 gene, promoter region and exon 1
- M16792 human HER-2 gene, exon 4
- M16791 human HER-2 gene, exon 3
- M16790 human HER-2 gene, exon 2
- M16789 human HER-2 gene, promoter region and exon 1).
- the amino acid sequence for the HER-2/neu protein is available at GENBANKTM Accession No. AAA58637. Based on these sequences, one skilled in the art could develop HER-2/neu antigens using known assays to find appropriate epitopes that generate an effective immune response.
- HER-2/neu antigens include p369-377 (a HER-2/neu derived HLA-A2 peptide); dHER2 (Corixa Corporation); li-Key MHC class II epitope hybrid (Generex Biotechnology Corporation); peptide P4 (amino acids 378-398); peptide P7 (amino acids 610-623); mixture of peptides P6 (amino acids 544-560) and P7; mixture of peptides P4, P6 and P7; HER2 [9754]; and the like.
- the cancer antigen is an epidermal growth factor receptor (EGFR) antigen.
- the EGFR antigen can be an EGFR variant 1 antigen, an EGFR variant 2 antigen, an EGFR variant 3 antigen and/or an EGFR variant 4 antigen.
- Cancers with cells that overexpress EGFR are referred to as EGFR cancers.
- Exemplary EGFR cancers include lung cancer, head and neck cancer, colon cancer, colorectal cancer, breast cancer, prostate cancer, gastric cancer, ovarian cancer, brain cancer and bladder cancer.
- the cancer antigen is a vascular endothelial growth factor receptor (VEGFR) antigen.
- VEGFR is considered to be a regulator of cancer-induced angiogenesis. Cancers with cells that overexpress VEGFR are called VEGFR + cancers. Exemplary VEGFR + cancers include breast cancer, lung cancer, small cell lung cancer, colon cancer, colorectal cancer, renal cancer, leukemia, and lymphocytic leukemia.
- the cancer antigen is prostate-specific antigen (PSA) and/or prostate-specific membrane antigen (PSMA) that are prevalently expressed in androgen-independent prostate cancers.
- PSA prostate-specific antigen
- PSMA prostate-specific membrane antigen
- the cancer antigen is Gp-100 Glycoprotein 100 (gp 100) is a tumor-specific antigen associated with melanoma.
- the cancer antigen is a carcinoembryonic (CEA) antigen.
- CEA + cancers include colorectal cancer, gastric cancer and pancreatic cancer.
- Exemplary CEA antigens include CAP-1 (i.e., CEA aa 571-579), CAP1-6D, CAP-2 (i.e., CEA aa 555-579), CAP-3 (i.e., CEA aa 87-89), CAP-4 (CEA aa 1-11), CAP-5 (i.e., CEA aa 345-354), CAP-6 (i.e., CEA aa 19-28) and CAP-7.
- CAP-1 i.e., CEA aa 571-579
- CAP1-6D i.e., CEA aa 555-579
- CAP-3 i.e., CEA aa 87-89
- CAP-4 CEA aa 1-11
- CAP-5 i.e., CE
- the cancer antigen is carbohydrate antigen 10.9 (CA 19.9).
- CA 19.9 is an oligosaccharide related to the Lewis A blood group substance and is associated with colorectal cancers.
- the cancer antigen is a melanoma cancer antigen.
- Melanoma cancer antigens are useful for treating melanoma.
- Exemplary melanoma cancer antigens include MART-1 (e.g., MART-1 26-35 peptide, MART-1 27-35 peptide); MART-1/Mel an A; pMel17; pMel17/gp100; gp100 (e.g., gp 100 peptide 280-288, gp 100 peptide 154-162, gp 100 peptide 457-467); TRP-1; TRP-2; NY-ESO-1; p16; beta-catenin; mum-1; and the like.
- MART-1 e.g., MART-1 26-35 peptide, MART-1 27-35 peptide
- MART-1/Mel an A pMel17; pMel17/gp100
- gp100 e.g.,
- the cancer antigen is a mutant or wild type ras peptide.
- the mutant ras peptide can be a mutant K-ras peptide, a mutant N-ras peptide and/or a mutant H-ras peptide. Mutations in the ras protein typically occur at positions 12 (e.g., arginine or valine substituted for glycine), 13 (e.g., asparagine for glycine), 61 (e.g., glutamine to leucine) and/or 59.
- Mutant ras peptides can be useful as lung cancer antigens, gastrointestinal cancer antigens, hepatoma antigens, myeloid cancer antigens (e.g., acute leukemia, myelodysplasia), skin cancer antigens (e.g., melanoma, basal cell, squamous cell), bladder cancer antigens, colon cancer antigens, colorectal cancer antigens, and renal cell cancer antigens.
- myeloid cancer antigens e.g., acute leukemia, myelodysplasia
- skin cancer antigens e.g., melanoma, basal cell, squamous cell
- bladder cancer antigens e.g., colon cancer antigens, colorectal cancer antigens, and renal cell cancer antigens.
- the cancer antigen is a mutant and/or wildtype p53 peptide.
- the p53 peptide can be used as colon cancer antigens, lung cancer antigens, breast cancer antigens, hepatocellular carcinoma cancer antigens, lymphoma cancer antigens, prostate cancer antigens, thyroid cancer antigens, bladder cancer antigens, pancreatic cancer antigens and ovarian cancer antigens.
- the cancer antigen can be a cell, a protein, a peptide, a fusion protein, DNA encoding a peptide or protein, RNA encoding a peptide or protein, a glycoprotein, a lipoprotein, a phosphoprotein, a carbohydrate, a lipopolysaccharide, a lipid, a chemically linked combination of two or more thereof, a fusion or two or more thereof, or a mixture of two or more thereof, or a virus encoding two or more thereof, or an oncolytic virus encoding two or more thereof.
- the cancer antigen is a peptide comprising about 6 to about 24 amino acids; from about 8 to about 20 amino acids; from about 8 to about 12 amino acids; from about 8 to about 10 amino acids; or from about 12 to about 20 amino acids.
- the cancer antigen is a peptide having a MHC Class I binding motif or a MHC Class II binding motif.
- the cancer antigen comprises a peptide that corresponds to one or more cytotoxic T lymphocyte (CTL) epitopes.
- CTL cytotoxic T lymphocyte
- the methods of the invention include administration of the fusion protein of SEQ ID NO: 1 in combination with administration of a therapeutic cell therapy.
- Cell therapies that are useful for treating cancer are well known and are disclosed in, e.g., U.S. Pat. No. 7,402,431.
- the cell therapy is T cell transplant.
- T cells are expanded ex vivo with IL-2 prior to transplantation into a subject.
- Methods for cell therapies are disclosed in, e.g., U.S. Pat. No. 7,402,431, US2006/0057121, U.S. Pat. Nos. 5,126,132, 6,255,073, 5,846,827, 6,251,385, 6,194,207, 5,443,983, 6,040,177, 5,766,920, and US2008/0279836.
- the therapeutic regimens of the invention include administration of a fusion protein of SEQ ID NO: 1 in further combination with radiation therapy.
- radiation therapy may be used interchangeably with the term “radiotherapy”, is a type of cancer treatment that uses beams of intense energy to kill cancer cells. Radiation therapy most often uses X-rays, but gamma rays, electron beams, or protons also can be used. The term “radiation therapy” most often refers to external beam radiation therapy. During this type of radiation, the high-energy beams come from a machine outside of the patient's body that aims the beams at a precise point on the body. Each session is quick and painless, lasting about 15 minutes.
- the term “session” or “session of treatment” refers to each radiotherapy treatment.
- a radiation therapy “regimen” or “schedule” usually consists of a specific number of treatments given over a set period of time, depending on the type and the stage of the cancer.
- the therapeutic regimens of the invention include administration of a fusion protein of SEQ ID NO: 1 in combination with administration of an anticancer small molecule.
- Small molecules that are effective in treating cancer are well known in the art and include antagonists of factors that are involved in tumor growth, such as EGFR, ErbB2 (also known as Her2) ErbB3, ErbB4, or TNF.
- Non-limiting examples include small molecule receptor tyrosine kinase inhibitors (RTKIs) that target one or more tyrosine kinase receptors, such as VEGF receptors, FGF receptors, EGF receptors and PDGF receptors.
- RTKIs small molecule receptor tyrosine kinase inhibitors
- RTKIs are known in the art, including, but are not limited to, vatalanib (PTK787), erlotinib (TARCEVATM), OSI-7904, ZD6474 (ZACTIMATM), ZD6126 (ANG453), ZD1839, sunitinib (SUTENTTM), semaxanib (SU5416), AMG706, AG013736, Imatinib (GLEEVECTM), MLN-518, CEP-701, PKC-412, Lapatinib (GSK572016), VELCADETM, AZD2171, sorafenib (NEXAVARTM), XL880, and CHIR-265.
- PTK787 vatalanib
- TARCEVATM erlotinib
- OSI-7904 ZD6474
- ZACTIMATM ZD6126
- ANG453 ZD1839
- sunitinib SUTENTTM
- semaxanib SU5416
- Small molecule protein tyrosine phosphatase inhibitors such as those disclosed in Jiang et al., Cancer Metastasis Rev. 2008; 27:263-72 are also useful for practicing the methods of the invention.
- Such inhibitors can target, e.g., HSP2, PRL, PTP1B, or Cdc25 phosphatases.
- Small molecules that target Bcl-2/Bcl-XL are also useful for practicing the methods of the present invention.
- Further exemplary small molecules for use in the present invention are disclosed in Zhang et al. Nature Reviews: Cancer 2009; 9:28-39.
- chemotherapeutic agents that lead to immunogenic cell death such as anthracyclins (Kepp et al., Cancer and Metastasis Reviews 2011; 30:61-9) will be well suited for synergistic effects with extended-PK IL-2.
- the methods of the invention include administration of the fusion protein of SEQ ID NO: 1 in combination with administration with chemotherapeutic agents including but not limited to, alkylating agents, antitumor antibiotics, antimetabolic agents, other anti-tumor antibiotics, and plant derived agents.
- chemotherapeutic agents including but not limited to, alkylating agents, antitumor antibiotics, antimetabolic agents, other anti-tumor antibiotics, and plant derived agents.
- Alkylating agents are drugs which impair cell function by forming covalent bonds with amino, carboxyl, sulfhydryl and phosphate groups in biologically important molecules. The most important sites of alkylation are DNA, RNA and proteins. Alkylating agents depend on cell proliferation for activity but are not cell-cycle-phase-specific. Alkylating agents suitable for use in the present invention include, but are not limited to, bischloroethylamines (nitrogen mustards, e.g. chlorambucil, cyclophosphamide, ifosfamide, mechlorethamine, melphalan, uracil mustard), aziridines (e.g.
- alkyl alkone sulfonates e.g. busulfan
- nitroso-ureas e.g. BCNU, carmustine, lomustine, streptozocin
- nonclassic alkylating agents e.g., altretamine, dacarbazine, and procarbazine
- platinum compounds e.g., carboplastin, oxaliplatin and cisplatin.
- Antitumor antibiotics like adriamycin intercalate DNA at guanine-cytosine and guanine-thymine sequences, resulting in spontaneous oxidation and formation of free oxygen radicals that cause strand breakage.
- Other antibiotic agents suitable for use in the present invention include, but are not limited to, anthracyclines (e. g. doxorubicin, daunorubicin, epirubicin, idarubicin and anthracenedione), mitomycin C, bleomycin, dactinomycin, and plicatomycin.
- Antimetabolic agents suitable for use in the present invention include but are not limited to, floxuridine, fluorouracil, methotrexate, leucovorin, hydroxyurea, thioguanine, mercaptopurine, cytarabine, pentostatin, fludarabine phosphate, cladribine, asparaginase, and gemcitabine.
- Plant derived agents include taxanes, which are semisynthetic derivatives of extracted precursors from the needles of yew plants. These drugs have a novel 14-member ring, the taxane. Unlike the vinca alkaloids, which cause microtubular disassembly, the taxanes (e.g., taxol) promote microtubular assembly and stability, therefore blocking the cell cycle in mitosis.
- Other plant derived agents include, but are not limited to, vincristine, vinblastine, vindesine, vinzolidine, vinorelbine, etoposide, teniposide, and docetaxel.
- compositions for Combination Therapy are Compositions for Combination Therapy
- the fusion protein of SEQ ID NO: 1 is administered together (simultaneously or sequentially) with one or more additional therapeutic agents or other therapeutic agents, such as a therapeutic antibody.
- the fusion protein of SEQ ID NO: 1 is administered prior to the administration of one or more therapeutic agents, such as a therapeutic antibody.
- the fusion protein of SEQ ID NO: 1 is administered concurrent with the administration of one or more therapeutic agents, such as a therapeutic antibody.
- the fusion protein of SEQ ID NO: 1 is administered subsequent to the administration of one or more therapeutic agents, such as a therapeutic antibody.
- the SEQ ID NO: 1 and one or more therapeutic agents, such as a therapeutic antibody are administered simultaneously.
- the and one or more therapeutic agents are administered sequentially.
- the fusion protein of SEQ ID NO: 1 and one or more therapeutic agents, such as a therapeutic antibody are administered within one, two, or three days of each other.
- the one or more therapeutic agents may be those that serve as adjunctive therapy for cancer, such as cytokines, chemotherapeutic agents, small molecules, antigens, or therapeutic antibodies, and are well known in the art and discussed supra. Additional non-limiting examples of additional agents include GM-CSF (expands monocyte and neutrophil population), IL-7 (important for generation and survival of memory T-cells), interferon alpha, tumor necrosis factor alpha, IL-12, and therapeutic antibodies, such as anti-PD-1, anti-PD-L, anti-CTLA4, anti-CD40, anti-OX40, and anti-CD137, PARP inhibitors, antibodies.
- the subject receives the fusion protein of SEQ ID NO: 1 and one or more therapeutic agents during a same period of prevention, occurrence of a disorder, and/or period of treatment.
- the invention provides for separate pharmaceutical compositions comprising the fusion protein of SEQ ID NO: 1 with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant and another pharmaceutical composition comprising one or more therapeutic agents, such as a therapeutic antibody, with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
- the invention provides for pharmaceutical compositions comprising the fusion protein of SEQ ID NO: 1 and one or more therapeutic or anti-cancer agents in the same composition, together with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
- kits comprising a fusion protein of SEQ ID NO: 1 formulated for SC administration, and optionally any other chemotherapeutic or anti-cancer agent.
- the kits are generally in the form of a physical structure housing various components, as described below, and can be utilized, for example, in practicing the methods described above.
- a kit can include the fusion protein of SEQ ID NO: 1 (provided in, e.g., a sterile container), which can be in the form of a pharmaceutical composition suitable for administration to a subject.
- the pharmaceutical composition can be provided in a form that is ready for use or in a form requiring, for example, reconstitution or dilution prior to administration.
- the kit can also include buffers, pharmaceutically acceptable excipients, and the like, packaged with or separately from the fusion protein of SEQ ID NO: 1.
- combination therapy e.g., the fusion protein of SEQ ID NO: 1 and an immune checkpoint inhibitor(s)
- the kit can contain the several agents separately or they can already be combined in the kit.
- additional complementary therapy e.g., a fusion protein of SEQ ID NO: 1, an immune checkpoint inhibitor(s), and an additional complementary therapy or agent
- the kit can contain the several agents separately or two or more of them can already be combined in the kit.
- a kit of the invention can be designed for conditions necessary to properly maintain the components housed therein (e.g., refrigeration or freezing).
- a kit can contain a label or packaging insert including identifying information for the components therein and instructions for their use (e.g., dosing parameters, clinical pharmacology of the active ingredient(s), including mechanism(s) of action, pharmacokinetics and pharmacodynamics, adverse effects, contraindications, etc.).
- Each component of the kit can be enclosed within an individual container, and all of the various containers can be within a single package.
- Labels or inserts can include manufacturer information such as lot numbers and expiration dates.
- the label or packaging insert can be, e.g., integrated into the physical structure housing the components, contained separately within the physical structure, or affixed to a component of the kit (e.g., an ampule, syringe or vial).
- Labels or inserts can additionally include, or be incorporated into, a computer readable medium, such as a disk (e.g., hard disk, card, memory disk), optical disk such as CD- or DVD-ROM/RAM, DVD, MP3, magnetic tape, or an electrical storage media such as RAM and ROM or hybrids of these such as magnetic/optical storage media, FLASH media or memory-type cards.
- a computer readable medium such as a disk (e.g., hard disk, card, memory disk), optical disk such as CD- or DVD-ROM/RAM, DVD, MP3, magnetic tape, or an electrical storage media such as RAM and ROM or hybrids of these such as magnetic/optical storage media, FLASH media or memory-type cards.
- the actual instructions are not present in the kit, but means for obtaining the instructions from a remote source, e.g., via an internet site, are provided.
- compositions of the invention any particular embodiment of the compositions of the invention; any method of production; any method of use can be excluded from any one or more claims, for any reason, whether or not related to the existence of prior art.
- Example 1 A Phase 1 Study of the Fusion Protein of SEQ ID NO: 1 Administered Intravenously as Monotherapy and in Combination with Pembrolizumab in Subjects with Advanced Solid Tumors
- the Fusion Protein of SEQ ID NO: 1 is a fusion of circularly permuted IL-2 and IL-2 Receptor a (IL-2R ⁇ ) designed to selectively activate the intermediate-affinity IL-2R, comprised of IL-2R ⁇ and ⁇ , for activation of cytotoxic CD8 + T cells and NK cells.
- the intermediate-affinity IL-2R is expressed predominantly on effector lymphocytes, which play an important role in driving antitumor immune responses.
- Wild-type IL-2 activates the high-affinity IL-2R, comprised of IL-2R ⁇ , ⁇ , and ⁇ c , driving the expansion of immunosuppressive CD4 + regulatory T (T reg ) cells at concentrations below those at which intermediate-affinity IL-2R-bearing effector cells are activated.
- T reg regulatory T
- the fusion protein of SEQ ID NO: 1 is being studied in a Phase 1 study in human subjects with advanced refractory solid tumors.
- the Fusion Protein was supplied as a sterile, white to off-white, lyophilized powder for IV or SC administration.
- the excipients included in the Fusion Protein formulation are citric acid monohydrate, sodium citrate tribasic dihydrate, sucrose, and polysorbate 20.
- sterile water for injection United States Pharmacopeia (USP)
- Citrate buffer containing 1% polysorbate 20 PS20 Diluent
- Saline solution (0.9% Sodium Chloride Injection, USP) is sourced separately as needed for additional dilution.
- the first part of the study is a dose escalation with the primary objective of investigating the safety and tolerability of the Fusion Protein and to determine the maximum tolerated dose (MTD) and the recommended phase 2 dose (RP2D).
- the RP2D will be equal to or less than the MTD and its associated dosing schedule and will be selected based on the safety, PK, pharmacodynamics, and preliminary antitumor activity data observed during dose escalation.
- FIG. 2 shows the treatment regimens followed for this study.
- FIG. 2 shows the treatment regimens followed for this study.
- IL-6 levels peaked at 4 hours post-dose and recovered to baseline at 8-10 hours post-dose. Fever coincided with the time of maximum IL-6 and recovered to baseline 8-12 hours post-dose.
- One patient with ovarian cancer had a confirmed partial response.
- One patient with triple negative breast cancer showed greater than 50% reduction in target lesion size ( FIG. 9 ).
- rhlL-2 Recombinant human interleukin-2 (rhlL-2, aldesleukin) is approved and used for the treatment of metastatic melanoma and renal cell carcinoma. 1-8 However, the use of rhlL-2 is limited to patients with normal cardiac and pulmonary function due to associated capillary leak syndrome and resulting hypotension. 9-12
- rhlL-2 preferentially activates and induces the expansion of immunosuppressive CD4+ Tregs,13 and high-dose IL-2 is required to induce signaling on receptor complexes expressed on potential tumor killing CD8+ T cells and natural killer (NK) cells.
- ADVERSE EVENT N 10 Hypotension requiring vasopressors 8 (80%)* Elevated bilirubin 7 (70%) Erythematous rash 7 (70%) Thrombocytopenia 7 (70%) Diarrhea 7 (70%) Nausea 6 (60%) Acute kidney injury 6 (60%) Vomiting 5 (50%) Metabolic acidosis 4 (40%) Rigors 3 (30%) Toxic encephalopathy 3 (30%) Dyspnea 2 (20%) Neutropenia 1 (10%) Fatigue 1 (10%) Leukopenia 1 (10%) Hyponatremia 1 (10%) Arthralgias 1 (10%) Gastrointestinal bleeding (prior nivolumab) 1 (10%) *Including capillary leak syndrome in 5 patients
- the data also shows that the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment
- rhlL-2 human IL-2
- rhlL-2 treatment induced greater levels of systemic pro-inflammatory cytokines in mice than SEQ ID NO: 1.
- the data FIG. 10 shows the cytokine production for IFN ⁇ and IL-6. Elevated levels of TNF ⁇ and IL-6 are found in individuals with inflammation that is associated with an infection as in septicemia or are afflicted with a chronic inflammatory disease like rheumatoid arthritis.
- Antibodies that block TNF ⁇ and IL-6 pathways are prescribed for treating rheumatoid arthritis and anti-IL-6 drugs are used to mitigate the effects of inflammation that arise during certain types of anti-cancer treatments like chimeric antigen receptor (CAR) T cell therapy. Therefore, reduced induction of proinflammatory cytokines as observed in FIG. 10 would suggest that treatment with SEQ ID NO: 1 would be better tolerated and potentially safer than treatment with rhlL-2.
- CAR chimeric antigen receptor
- the study has three parts: Part A, a dose-escalation monotherapy part; Part B, a dose-expansion monotherapy part; and Part C, a combination therapy part with pembrolizumab (see also Example 1).
- Part A a dose-escalation monotherapy part
- Part B a dose-expansion monotherapy part
- Part C a combination therapy part with pembrolizumab (see also Example 1).
- An overview of the Study is shown in Table 3.
- cohorts in the study used a standard 3+3 study design with 3 to 6 subjects per cohort to receive SEQ ID NO: 1 at dose levels as shown in Table 3.
- the starting dose of 0.1 ⁇ g/kg/day was selected based on minimal anticipated biological effect level.
- Doses in subsequent cohorts are being increased according Table 3 until stopped for DLTs or an MTD is reached. Additional dose levels will be considered if the RP2D or MTD has not been reached within the proposed dose range.
- each cohort is evaluated for safety and tolerability using a 3+3 study design with allowance for over-enrollment with 4 to 7 subjects and a minimum of 3 evaluable subjects per cohort to receive IV SEQ ID NO: 1 at the specified dose and schedule. If none of the 3 subjects experiences a DLT, then the next dose level will open for enrollment. If 1 of the 3 subjects experiences a DLT, then 3 additional subjects will be enrolled at the same dose level. If no additional DLTs are observed, then the next dose level will open for enrollment.
- One or more lower dose level(s) may be tested in search of the MTD, defined as the dose level immediately below that in which ⁇ 2 of 6 evaluable subjects experience DLTs.
- SRC Safety Review Committee
- a teleconference of the Safety Review Committee (SRC) to include at a minimum the study investigators who have enrolled subjects and the Sponsor's Medical Monitor, will be convened to review the safety data from the current cohort and to decide if dose escalation is warranted.
- Dose-limiting toxicity will be defined by any of the following events described in Example 1, Table 1.
- Part B the second part of the study (i.e., Part B) commenced.
- this part of the study up to 41 subjects with melanoma and up to 41 subjects with RCC are being enrolled to receive SEQ ID NO: 1 at the RP2D. Enrollment to these cohorts will follow a partial response (unconfirmed) Simon's two-stage design enrollment. Response assessments will be based on the RECIST guidelines.
- Part C In the third part of the study (Part C), subjects received SEQ ID NO: 1 in combination with pembrolizumab (see Example 1). Part C is running independently of and concurrently with monotherapy of Part A and Part B.
- a 3- to 6-subject run-in phase is being utilized to assess the safety of SEQ ID NO: 1 in combination with pembrolizumab.
- subjects were enrolled with any tumor type.
- Rollover subjects (Cohort 4) were not eligible to participate in the safety run-in phase of Part C.
- the first 3 subjects received SEQ ID NO: 1 at the dose level of 1 ⁇ g/kg/day (Example 1). As all 3 subjects tolerated therapy their first 21-day cycle as assessed by the SRC, then the study progressed to the 3 ⁇ g/kg/day dose level. As the first 6 subjects tolerate therapy adequately for their first 21-day cycle as assessed by the SRC, expansion Cohorts C1, C2, C3, and C4 were opened.
- Antitumor activity was determined by the measurement of extent of known disease at baseline and approximately every 5 to 6 weeks, following each even-numbered treatment cycle.
- CR, PR, or SD have been shown to occur after an increase in tumor burden characterized as PD by RECIST criteria.
- the conventional response criteria such as RECIST may not adequately assess the activity of immunotherapeutic agents.
- PD evaluated radiologically may not mean therapeutic failure, as responses to immune therapies may occur after conventional PD.
- the appearance of measureable antitumor activity may take longer for immune therapies than for cytotoxic therapies.
- immunotherapeutic agents there should be allowance for clinically insignificant PD, defined as small new lesions in the presence of other responsive lesions, which may occur even though the subject is responding to the immunotherapy.
- Stable disease may also represent antitumor activity with iRECIST. Therefore, RECIST and iRECIST were used to ensure a more comprehensive evaluation of tumor response for SEQ ID NO: 1.
- the ORR/iORR is the number of subjects exhibiting a CR/iCR or PR or iPR divided by the number of subjects evaluable for antitumor activity. Duration of response was also be determined.
- the ORR/iORR was calculated separately for subjects in the dose-escalation portion of the study (Part A), in the dose-expansion part of the study (Part B), and in the combination therapy part of the study (Part C). Tumor images were collected and stored centrally. Centralized readings may be used to assess scans beginning in the second stage (N2) of Part B cohorts and Part C C5, C6, and C7 cohorts. Antitumor activity will be expressed as the following:
- Serum samples for evaluation of SEQ ID NO: 1 PK was obtained from each subject at predetermined time points.
- a validated electrochemiluminescence method using the Meso Scale Discovery platform will be used for the quantitation of SEQ ID NO: 1 in human serum.
- Noncompartmental PK analysis was performed to estimate the PK parameters for SEQ ID NO: 1.
- Serum samples for evaluation of anti-SEQ ID NO: 1 antibody induction were obtained from each subject at predetermined time points.
- a validated electrochemiluminescence method using the Meso Scale Discovery platform was used for the detection of antidrug antibodies to SEQ ID NO: 1 in human serum.
- the assessment of immune-response induction for each study subject was based on the comparison of the pre-dose and post-dose sample results.
- biomarkers The pharmacodynamic response of various biomarkers were assessed in blood and serum samples collected from all subjects in the study. Additional biomarker analyses were performed on tumor tissue samples, which are optional for study subjects.
- SEQ ID NO: 1 The pharmacodynamic effect of SEQ ID NO: 1 was assessed by measuring circulating CD8 + T cells, T regs , and NK cells in peripheral blood by flow cytometry from each subject at predetermined time points. In addition, serum samples were obtained from each subject at predetermined time points. Concentration of multiple proinflammatory cytokines including interferon- ⁇ , tumor necrosis factor- ⁇ , IL-10, IL-6, and IL-10 were determined. Circulating tumor DNA (ctDNA) was also be measured at predetermined time points.
- ctDNA Circulating tumor DNA
- ORR The evaluation of ORR was based on Investigator review of the radiographic or photographic images, as defined according to RECIST 1.1. Overall response rate is defined as the proportion of subjects with objective evidence of CR or PR among the number of subjects evaluable for antitumor activity.
- the best ORR was assigned for each subject as the best response recorded after initiation of study treatment, taking into account any requirement for confirmation. If applicable, responses recorded after disease progression or initiation of new anticancer treatment were excluded.
- the ORR was calculated separately for those subjects in the dose-escalation portion of the study (Part A), in the dose-expansion portion of the study (Part B), and in the combination therapy part of the study (Part C). Summarization of ORR was presented by frequency, percentage, and 95% confidence interval (CI). The CI were obtained using an exact approach given the small sample size. Sum of the Diameters of all lesions reported at each visit were graphed by spider plot (% change over time) and waterfall plot (best % change). The swimmer plot was used to display the characteristics of the responses in subjects.
- iRECIST Responses assigned using iRECIST have a prefix of “i” (ie, immune) to differentiate them from responses assigned using RECIST 1.1.
- the principles used to establish objective tumor response are largely unchanged from RECIST 1.1, but the major change for iRECIST is the concept of resetting the bar if RECIST 1.1 progression is followed at the next assessment by tumor shrinkage.
- iRECIST defines iUPD (immune unconfirmed progressive disease) on the basis of RECIST 1.1 principles. If the criteria for iUPD have never been met, principles follow RECIST 1.1.
- the next timepoint response could be iUPD, iSD, iPR, or iCR, or iCPD (immune confirmed progressive disease).
- iBOR the best overall response
- Immune overall response rate was based on iBOR. The iBOR was calculated separately for those subjects in the dose-escalation portion of the study (Part A), in the dose-expansion portion of the study (Part B), and in the combination therapy part of the study (Part C).
- a spider plot, waterfall plot, and swimmer plot were used to display the characteristics of the responses in subjects.
- Disease control rate is defined as the proportion of subjects with objective evidence of CR, PR, or SD at Cycle 4 or later.
- the DCR was calculated separately for those subjects in the dose-escalation portion of the study (Part A), in the dose-expansion portion of the study (Part B), and in the combination therapy part of the study (Part C). Summarization of DCR was presented by frequency, percentage, and 95% CI. The CI was obtained using an exact approach given the small sample size.
- Immune disease control rate is defined as the proportion of subjects with objective evidence of iCR, iPR, or iSD at Cycle 4 or later.
- the iDCR was calculated separately for those subjects in the dose-escalation portion of the study (Part A), in the dose-expansion portion of the study (Part B), and in the combination therapy part of the study (Part C). Summarization of iDCR was presented by frequency, percentage, and 95% CI. The CI was obtained using an exact approach given the small sample size.
- Duration of response defined as the time from the first documentation of response (CR or PR) to the first documentation of objective tumor progression or death due to any cause.
- Subjects who are alive and progression free as of the analysis cut-off date will be censored at their last evaluable tumor response assessment before initiation of any new anticancer treatment. Subjects with two or more consecutive missing response assessments prior to death or a visit with documented progression will be censored at the last date of tumor assessment when the subject was documented to be progression free. Subjects who never achieve CR or PR prior to starting any new anticancer treatment at a lesion site will be excluded from the analysis. The rate of response was calculated for RECIST responders.
- the DOR was calculated as follows (in weeks): (date of PD/death in Part B ⁇ date of first response (CR or PR) in Part B+1)/7
- the DOR was calculated as follows (in weeks): (date of PD/death in Part C ⁇ date of first response (CR or PR) in Part C+1)/7.
- the distribution of DOR was estimated for Part B and Part C using Kaplan-Meier methodology.
- the median point estimate DOR was provided along with the two-sided 95% CIs based on the antitumor evaluable population with subjects who experienced CR or PR. Kaplan-Meier curves were provided.
- Immune duration of response defined as the time from the first documentation of response (iCR or iPR) to the first documentation of objective tumor progression or death due to any cause.
- Subjects who are alive and progression free as of the analysis cut-off date were censored at their last evaluable tumor response assessment before initiation of any new anticancer treatment.
- Subjects with two or more consecutive missing response assessments prior to death or a visit with documented progression were censored at the last date of tumor assessment when the subject was documented to be progression free.
- Subjects who never achieve iCR or iPR prior to starting any new anticancer treatment at a lesion site were excluded from the analysis. The rate of response were calculated for iRECIST responders.
- the iDOR were calculated as follows (in weeks): (date of iPD/death in Part B ⁇ date of first response (iCR or iPR) in Part B+1)/7
- the iDOR were calculated as follows (in weeks): (date of iPD/death in Part C ⁇ date of first response (iCR or iPR) in Part C+1)/7.
- the distribution of iDOR was estimated for Part B and Part C using Kaplan-Meier methodology.
- the median point estimate iDOR was provided along with the two-sided 95% CIs based on the antitumor evaluable population with subjects who experienced iCR or iPR. Kaplan-Meier curves were provided.
- Durable response rate is defined as the percentage of subjects with an objective response (complete or partial response per RECIST1.1) lasting continuously for 6 months and starting any time within 12 months of initiating the study drug.
- the DRR was summarized by each tumor type. Summary of DRR was presented by frequency, percentage, and 95% CI. The CI was obtained using an exact approach given the small sample size.
- Immune durable response rate is defined as the percentage of subjects with an objective response (complete or partial response per iRECIST) lasting continuously for 6 months and starting any time within 12 months of initiating the study drug.
- the iDRR was summarized by each tumor type. Summary of iDRR was presented by frequency, percentage, and 95% CI. The CI was obtained using an exact approach given the small sample size.
- the PFS was calculated as follows (in weeks): (date of PD/death in Part B ⁇ first dose date in Part B+1)/7
- the PFS were calculated as follows (in weeks): (date of PD/death in Part C ⁇ first dose date in Part C+1)/7.
- the survival distribution of PFS was estimated using Kaplan-Meier methodology.
- the median PFS was provided along with the two-sided 95% CIs based on the antitumor evaluable population.
- Kaplan-Meier curves were provided.
- the 6-month and one-year PFS rate was estimated using the Kaplan-Meier estimate.
- Immune progression-free survival defined as the time from the first dose to the first documentation of objective tumor progression or death due to any cause. Subjects who do not have disease progression or have not died were censored at the last known time that the subject was progression free. If a subject begins a new anticancer treatment (either systemic or local) prior to documented progression or death, or a subject is removed from the study due to undocumented clinical disease progression, then the subject was censored at the last assessment where the subject was documented as progression free prior to the intervention. Subjects with two or more consecutive missing response assessments prior to a visit with documented progression (or death) were censored at the last date of tumor assessment when the subject was documented to be progression free.
- the iPFS was calculated as follows (in weeks): (date of iPD/death in Part B ⁇ first dose date in Part B+1)/7
- the PFS was calculated as follows (in weeks): (date of iPD/death in Part C ⁇ first dose date in Part C+1)/7.
- the survival distribution of iPFS will be estimated using Kaplan-Meier methodology.
- the median iPFS was provided along with the two-sided 95% CIs based on the antitumor evaluable population.
- Kaplan-Meier curves were provided.
- the 6-month and one-year iPFS rate was estimated using the Kaplan-Meier estimate.
- Cycle 2-stable disease SD
- Cycle 4-SD 17% reduction in target lesions form baselines
- Cycle 6 partial response (PR) 32% reduction in lesions from baseline
- Cycle 8-confirmed PR as per RECIST 35% reduction in target lesions from baseline.
- RP2D was determined to be a daily dose of 6 ⁇ g/kg.
- a new Cohort 6 began enrollment in the study to be tested at a daily dose of 8 ⁇ g/kg.
- Two patients were enrolled with up to 4 more patients expected to be enrolled. What follows is the data received from the first two patients to be enrolled.
- SEQ ID NO: 1 serum concentration vs time profiles after the first IV dose (Cycle 1 Day 1) of SEQ ID NO: 1 are depicted in FIG. 11 .
- Mean peak (C max ) and total serum exposure (AUC) of SEQ ID NO: 1 across the dose range evaluated in Part A described in Example 1 are shown in FIG. 12 .
- the 6 ⁇ g/kg dose was selected as the recommended Phase 2 dose (Example 1) for IV dosing of SEQ ID NO: 1. Enrollment at the 8 ⁇ g/kg is ongoing with two patients treated at this dose level.
- FIG. 13 The time course of cell populations of total NK cells, total CD8 + T cells and regulatory T cells (T reg ) in peripheral blood after the first two cycles of treatment with IV SEQ ID NO: 1 are depicted in FIG. 13 .
- SEQ ID NO: 1 induced dose dependent increase in circulating NK and CD8 + T cells with minimal, non-dose dependent effect on T reg cells, and the 6 and 8 ug/kg dose levels have the most robust elevation of NK cells and CD8 + T cells without a significant change in the T reg profile.
- transient elevation of serum concentrations of interferon gamma (IFN ⁇ ) and IL-6 were observed in patients receiving higher doses (>1 ⁇ g/kg) of SEQ ID NO: 1 ( FIG. 15 ).
- the peak IL-6 response was interestingly observed at the 3 ⁇ g/kg dose level, with reduced serum IL-6 levels at doses higher than 3 ⁇ g/kg, including 6 and 8 ⁇ g/kg.
- IL-6 is a pro-inflammatory cytokine that is not thought to contribute to the antitumor response but is likely associated with general inflammation and side effects of treatment including fever. Increased levels of IL-6 in the serum and tumor site has been demonstrated in several cancers. Usually this increase is accompanied with a poor prognosis and lower survival rate. Downregulation of IL-6 has been correlated with a better response to cancer treatment.
- IFN ⁇ is a very important marker of cytotoxic effector cell function, and CD8 + T cells and NK cells produce IFN ⁇ upon activation. IFN ⁇ is associated with the antitumor immune response, and significant elevation was observed at the 3, 6, and 8 ⁇ g/kg dose levels of SEQ ID 1. Notably, elevation of IFN ⁇ was observed at the 6 and 8 ug/kg dose levels where the IL-6 levels were much lower than the peak level observed at 3 ⁇ g/kg. The IFN ⁇ levels observed after treatment with 8 ug/kg SEQ ID NO: 1 were approximately 4 to 5-fold higher even than observed at 3 and 6 ⁇ g/kg. This suggests that the 6 and 8 ⁇ g/kg dose levels and potentially higher dose levels of 10, 12, 15 ⁇ g/kg or greater may have a particular advantage in terms of antitumor immune activity relative to inflammatory activity in comparison to lower dose levels of SEQ ID NO: 1.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Genetics & Genomics (AREA)
- Biomedical Technology (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Hematology (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- General Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Toxicology (AREA)
- Dermatology (AREA)
- Mycology (AREA)
- Endocrinology (AREA)
- Virology (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention provides compositions and improved methods for the treatment of cancer using IL-2 immunotherapy. The methods of the invention comprise administering to a patient, the fusion protein of SEQ ID NO: 1 at a dose of about 6 μg/kg/day to about 70 μg/kg/day and preferably at a dose of at least about 6 μg/kg/day to about 15 μg/kg/day or at a corresponding fixed per day dose based, for example, on an average about 60 to about 70 kg adult human or based, for example, on a child of about 12 kg to about 50 kg or more, wherein administration results in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in circulating immunosuppressive T regulatory (Treg) cells and preferably wherein the increase in circulating NK cells and CD8+ cells is greater relative to the increase in circulating T Treg cells.
Description
- This application claims the benefit of U.S. Provisional Application No. 62/860,182, filed on Jun. 11, 2019; 62/932,160, filed on Nov. 7, 2019 and 62/924,356, filed on Oct. 22, 2019. The entire teachings of the above applications are incorporated herein by reference.
- Interleukin-2 (IL-2) is a cytokine that induces proliferation of antigen-activated T cells and stimulates natural killer (NK) cells. The biological activity of IL-2 is mediated through a multi-subunit IL-2 receptor complex (IL-2R) of three polypeptide subunits that span the cell membrane: p55 (IL-2Rα, the alpha subunit, also known as CD25 in humans), p75 (IL-2R13, the beta subunit, also known as CD122 in humans) and p64 (IL-2Rγ, the gamma subunit, also known as CD132 in humans). T cell response to IL-2 depends on a variety of factors, including: (1) the concentration of IL-2; (2) the number of IL-2R molecules on the cell surface; and (3) the number of IL-2R occupied by IL-2 (i.e., the affinity of the binding interaction between IL-2 and IL-2R). The IL-2:IL-2R complex is internalized upon ligand binding and the different components undergo differential sorting. IL-2Rα is recycled to the cell surface, while IL-2 associated with the IL-2:IL-2Rβγ complex is routed to the lysosome and degraded.
- Outcomes of systemic IL-2 administration in cancer patients are poor. While 15 to 20 percent of patients respond objectively to high-dose IL-2, the great majority do not, and many suffer severe, life-threatening side effects. Aldesleukin (recombinant human IL-2 (rhlL-2) also as known as Proleukin), is approved and used for the treatment of metastatic melanoma and RCC.
- Among currently used therapies, rhIL-2 is one of the few treatment regimens that elicit a complete and durable response in a subset of patients, up to 12% in melanoma and 7% in RCC. High doses of rhIL-2 are required to stimulate cells that express the intermediate-affinity IL-2 receptor, including memory CD8+ T cells and natural killer (NK) cells, which are the primary cell types mediating anticancer immune responses.
- It has been hypothesized that a contributing factor limiting the therapeutic efficacy of rhIL-2 is that it preferentially activates and induces the expansion of immunosuppressive CD4+ Tregs, which can counteract anticancer immune responses. This preferential activation is through binding of IL-2 to the high-affinity IL-2 receptor expressed on Tregs. Furthermore, it is hypothesized that direct interaction between rhlL-2 with high-affinity IL-2R expressed on vascular and pulmonary endothelial cells contributes to rhIL-2-mediated toxicity via capillary leak syndrome. Despite the poor tolerability of immunotherapy with rhlL-2, it remains one of the few treatment regimens for metastatic melanoma and RCC that elicits a complete and durable response in a subset of patients. Accordingly, novel IL-2 therapies are needed to more effectively combat various cancers.
- The compositions, methods and treatment regimens in accordance with the invention provide numerous advantages for the treatment of cancer using IL-2 immunotherapy as compared to, for example, high dose rhlL-2 therapy (e.g. Aldesleukin). It has been discovered that administration of the fusion protein of SEQ ID NO: 1 when administered at doses of about 6 μg/kg/day to about 70 μg/kg/day and preferably at about 6 μg/kg/day to about 15 μg/kg/day or at a corresponding fixed per day dose based, for example, on an average 60-70 kg adult human (e.g. 0.4 mg/day to about 1-4 mg) or based on a child, for example a child of about 12 kg to 50 kg or more, provides a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in circulating T regulatory (Treg) cells. Preferably, the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater in a patient administered the fusion protein of SEQ ID NO:1 in accordance with the methods of the invention as compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving, for example, high dose recombinant human IL-2 (rhlL-2) treatment. It has also been discovered that administration of the fusion protein of SEQ ID NO: 1 at doses equivalent to, or higher than, those of high dose IL-2 is not accompanied by the toxicity and side effects, such as capillary leak syndrome (CLS), that often accompany administration of high dose rhlL-2.
- Preferably, the invention provides methods of treating cancer in a patient comprising administering to the patient a dose of at least about 6 μg/kg/day to about 15 μg/kg per day, or a corresponding fixed dose thereof based, for example, on a 60-70 kg adult (e.g. ˜0.4 mg/day to about ˜1.0 mg/day), or a corresponding fixed dose based on a child, for example, a child of about 12 kg to about 50 kg. Preferably the dose of the fusion protein of SEQ ID NO: 1 in terms of μg/kg/day is a dose of about: 6 μg/kg/day, 8 μg/kg/day, 10 μg/kg/day, 12 μg/kg/day, 14 μg/kg/day, or 15 μg/kg/day or a corresponding fixed dose thereof based on, for example, a 60-70 kg adult or based on a child, for example a child of about 12 kg to 50 kg or more. Preferably administration of the fusion protein of SEQ ID NO: 1 results in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in T regulatory (Treg) cells. Preferably the increase in circulating NK cells and CD8+ cells is at least 2-fold over baseline prior to administration of the fusion protein of SEQ ID NO: 1 to the patient. Preferably the increase in circulating NK cells and CD8+ cells is greater relative to the increase in circulating Treg cells. Preferably an increase in circulating NK cells and CD8+ cells is greater relative to the increase in circulating Treg cells as compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating Treg cells in a patient receiving high dose rhIL-2 treatment.
- Preferably the patient has an improved safety profile as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment. Preferably the patient has a lower risk of capillary leak syndrome or cytokine release syndrome. Preferably the resulting dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in circulating T regulatory (Treg) cells. Preferably the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater as compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment and the patient has a lower risk of capillary leak syndrome. Preferably the dose of the fusion protein of SEQ ID NO: 1 is administered by intravenous injection or infusion.
- Preferably, the fusion protein of SEQ ID NO: 1 is administered by intravenous injection or infusion at a dose of at least about 6 μg/kg to about 15 μg/kg per day for 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 9 consecutive days. Preferably, the rest period is at least about 16 days. Preferably the fusion protein of SEQ ID NO: 1 is administered in at least two courses of treatment, the first course of treatment comprising administration by intravenous injection or infusion at a dose of at least about 6 μg/kg to about 15 μg/kg per day for a
period 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 9 consecutive days resulting in a total 14 day course followed by a second course of treatment comprising administering by intravenous injection or infusion at a dose of at least about 6 μg/kg to about 15 μg/kg per day for 1 to about 5 consecutive or non-consecutive days, followed by a rest period of at least about 16 consecutive days resulting in a total 21 day course. Preferably the second course of treatment begins within about 24 hours or more after completion of the first course of treatment. Preferably a third 21-day course of treatment follows the second course of administration. Preferably, the third course of treatment begins within about 24 hours or more after completion of the second course of treatment. Preferably a fourth 21 day course of treatment follows the third course of administration. Preferably, the fourth course of treatment begins within about 24 hours or more after completion of the third course of treatment. - Preferably administering the fusion protein of SEQ ID NO: 1 further comprises co-administering to the patient a therapeutically effective amount of a therapeutic agent. Preferably the therapeutic agent is an immune checkpoint inhibitor or a PARP inhibitor. Preferably the therapeutic agent is an immune checkpoint inhibitor. Preferably the immune checkpoint inhibitor inhibits the interaction of PD-1 and PD-L. Preferably the immune checkpoint inhibitor is pembrolizumab.
- Preferably the fusion protein of SEQ ID NO: 1 is administered in at least two courses of treatment, the first course of treatment comprising administration by intravenous injection or infusion at a dose of at least about 6 μg/kg to about 15 μg/kg per day for 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 16 consecutive days resulting in a total 21 day course followed by a second course of treatment comprising administering by intravenous injection or infusion at a dose of at least about 6 μg/kg to about 15 μg/kg per day for a period of at least 5 consecutive days, followed by a rest period of at least about 16 consecutive days resulting in a total 21 day course and wherein the pembrolizumab is co-administered on the first day of the first course of and on the first day of the second course; wherein the pembrolizumab is co-administered prior to, simultaneously with, or subsequent to, administration of the fusion protein of SEQ ID NO:1 preferably wherein the pembrolizumab is co-administered in a separate composition from the fusion protein of SEQ ID NO: 1. Preferably pembrolizumab is co-administered in an amount of 200 mg by I.V. injection or infusion.
- Preferably all methods of the invention result in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in T regulatory (Treg) cells. Preferably the patient has an improved safety profile as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment; and preferably the patient has a lower risk of cytokine release syndrome as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment. Preferably the patient has a lower risk of capillary leak syndrome as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment.
- The invention also provides methods of treating cancer in a patient comprising administering to the patient a dose of at least about 6 μg/kg to about 15 μg/kg per day of the fusion protein of SEQ ID NO: 1 wherein the dose is administered by intravenous injection or infusion for 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 9 consecutive days resulting in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in T regulatory (Treg) cells; and wherein the increase in circulating NK cells and CD8+ cells is at least 2 fold over baseline prior to administration of the fusion protein of SEQ ID NO: 1 to the patient; preferably wherein the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater as compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment.
- The invention also provides methods of treating cancer in a patient comprising administering to the patient a dose of at least about 6 μg/kg to about 15 μg/kg per day of the fusion protein of SEQ ID NO: 1 wherein the dose is administered by intravenous injection or infusion for 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 9 consecutive days resulting in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in T regulatory (Treg) cells and wherein the patient has an improved safety profile as compared to a patient receiving high dose recombinant human IL-2 (rhIL-2) treatment; preferably wherein the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater as compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving high dose recombinant human IL-2 (rhIL-2) treatment.
- The invention also provides methods of treating cancer in a patient comprising administering to the patient a dose of at least about 6 μg/kg to about 15 μg/kg per day of the fusion protein of SEQ ID NO: 1 wherein the dose is administered by intravenous injection or infusion for 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 9 consecutive days resulting in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in T regulatory (Treg) cells and wherein the patient has a lower risk of cytokine release syndrome as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment; preferably wherein the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater as compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving high dose recombinant human IL-2 (rhIL-2) treatment.
- The invention also provides methods of treating cancer in a patient comprising administering to the patient a dose of at least about 6 μg/kg to about 15 μg/kg per day of the fusion protein of SEQ ID NO: 1 wherein the dose is administered by intravenous injection or infusion for 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 9 consecutive days resulting in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in T regulatory (Treg) cells and lower risk of cytokine release syndrome as compared to a patient receiving high dose recombinant human IL-2 (rhIL-2) treatment preferably wherein the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater as compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving high dose recombinant human IL-2 (rhIL-2) treatment.
- The invention also provides pharmaceutical compositions comprising about 6 μg/kg to about 70 μg/kg and preferably about 6 μg/kg to about 15 μg/kg of the fusion protein of SEQ ID NO: 1; preferably wherein the pharmaceutical compositions comprise about 8 μg/kg to about 15 μg/kg of the fusion protein of SEQ ID NO: 1, preferably wherein the pharmaceutical composition comprises about 8 μg/kg of the fusion protein of SEQ ID NO: 1; preferably wherein the pharmaceutical composition comprises about 10 μg/kg of the fusion protein of SEQ ID NO: 1; preferably wherein the pharmaceutical composition comprises about 12 μg/kg of the fusion protein of SEQ ID NO: 1; preferably wherein the fusion protein comprises about 14 μg/kg of the fusion protein of SEQ ID NO: 1; and preferably wherein the fusion protein comprises about 15 μg/kg of the fusion protein of SEQ ID NO: 1.
- The invention also provides a method of treating cancer in a patient comprising administering to the patient a dose of at least about 50 μg/kg to about 60 μg/kg per day or at a corresponding fixed per day dose based on an average 60-70 kg adult human (e.g. ˜3.0 mg/day to about ˜3.6 mg/day) of the fusion protein of SEQ ID NO: 1 wherein the dose is administered by intravenous injection or infusion one day per week resulting in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in circulating T regulatory (Treg) cells and wherein the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving high dose recombinant human IL-2 (rhIL-2) treatment and wherein the patient has a lower risk of capillary leak syndrome as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment.
- The invention also provides a pharmaceutical composition comprising at least about 6 μg/kg to about 70 μg/kg and preferably at least about 6 μg/kg to about 15 μg/kg, or at a corresponding fixed per day dose based on an average 60-70 kg adult human (e.g. ˜0.4 mg to about ˜1.0 mg), or a corresponding fixed dose based on a child, for example, a child of about 12 kg to about 50 kg or more, of the fusion protein of SEQ ID NO: 1.
- The invention also provides a pharmaceutical composition comprising about 40 μg/kg to about 70 μg/kg or at a corresponding fixed dose based on, for example, an average 60-70 kg adult human (e.g. ˜3.0 mg to about ˜3.6 mg), or a corresponding fixed dose based on a child, for example, a child of about 12 kg to about 50 kg or more, of the fusion protein of SEQ ID NO: 1; preferably wherein the composition comprises about 40 μg/kg to about 70 μg/kg of the fusion protein of SEQ ID NO: 1.
- The invention also provides a method of treating cancer in a patient comprising administering to the patient a dose of less than 6 μg/kg/day such as about 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5 and 5.9 μg/kg/day, or a corresponding fixed dose based on, for example, a 60-70 kg adult (e.g. ˜0.2 mg/day to ˜0.4 mg/day) or a corresponding fixed dose based on a child, for example, a child of about 12 kg to about 50 kg or more, of the fusion protein of SEQ ID NO: 1 resulting in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in circulating T regulatory (Treg) cells and wherein the increase in circulating NK cells and CD8+ cells is greater relative to the increase in circulating T regulatory (Treg).
- The foregoing and other objects, features and advantages of the invention will be apparent from the following more particular description of preferred embodiments of the invention, as illustrated in the accompanying drawings in which like reference characters refer to the same parts throughout the different views. The drawings are not necessarily to scale, emphasis instead being placed upon illustrating the principles of the invention.
-
FIG. 1 shows diagrams of structural models of the fusion protein of SEQ ID NO: 1 (panel A) and its selective binding intermediate-affinity IL-2 receptor (panel B). - The structural models in panels 1A and 1B were generated using the experimentally determined crystal structure of the quaternary complex of human IL-2 bound to the trimeric high-affinity receptor (Wang et al., Science. 2005; 310(5751):1159-1163. doi: 10.1126/science.1117893).
-
FIG. 2 are diagrams of the treatment regimens for intravenous (IV.) infusion of the fusion protein of SEQ ID NO: 1 as monotherapy and as combination therapy with pembrolizumab in the first in human (FIH) study described in Example 1. -
FIG. 3 are graphs showing systemic exposure in human patients to the fusion protein of SEQ ID NO: 1 at various doses in accordance with the invention. -
FIG. 4 are graphs showing circulating Treg cells, NK cells and CD8+ cells responses in human patients who have been treated with the fusion protein of SEQ ID NO: 1 in accordance with the invention. -
FIG. 5 is a graph showing the pharmacodynamic response of patients exposed to high dose rhIL-2 as described in Example 2. -
FIG. 6 is a graph showing the pharmacodynamic response of patients exposed to high dose rhIL-2 as described in Example 2. -
FIG. 7 is a graph showing duration of treatment and overall response by tumor type in those patients treated with SEQ ID NO: 1 as a monotherapy. -
FIG. 8 is a graph showing duration of treatment and overall response by tumor type in those patients treated with SEQ ID NO: 1 as a combination therapy with pembrolizumab. -
FIG. 9 is graph showing change in tumor size from baseline by tumor type in those patients treated with 8 SEQ ID NO: 1 as a combination therapy with pembrolizumab. -
FIG. 10 is a series of graphs showing levels of inflammatory cytokines TNFα and IL-6 in mice treated with 8, 20, or 30 μg of the mouse ortholog of SEQ ID NO: 1. -
FIG. 11 is a graph showing the mean (+standard deviation) serum concentrations (μg/mL) of SEQ ID NO: 1 in patients with advanced solid tumors after the first IV dose (0.1, 0.3, 1, 3, 6 or 8 μg/kg) of SEQ ID NO: 1 (Cycle 1 Day 1 (C1D1)). -
FIG. 12 are graphs showing the mean (+standard deviation) maximum serum concentrations (Cmax) (left) and area under the concentration versus time curve fromtime 0 to the last measurable concentration (AUClast) (right) in patients with advanced solid tumors after the first IV dose (0.1, 0.3, 1, 3, 6 or 8 μg/kg) of SEQ ID NO: 1 (Cycle 1 Day 1 (C1D1)). -
FIG. 13 are graphs showing the mean (+standard error) absolute counts (cells/μL blood) of total NK cells (top), total CD8+ T cells (middle) and Tregs (bottom) in patients with advanced solid tumors in patients with advanced solid tumors after the first two treatment cycles with IV SEQ ID NO: 1 at a dose of 0.1, 0.3, 1, 3, 6 or 8 μg/kg. -
FIG. 14 are graphs showing the mean (+standard error) fold change from baseline (FCB). Absolute counts of total NK cells (left), total CD8+ T cells (middle) and Tregs cells (right) oncycle 1, day 8 (C1D8) andcycle 2 day 8 (C2D8) in patients with advanced solid tumors after the first two treatment cycles with IV SEQ ID NO: 1 at a dose of 0.1, 0.3, 1, 3, 6 or 8 μg/kg. -
FIG. 15 are graphs showing the mean (+standard error) maximum serum concentrations (pg/ml) (±standard error) IFNγ (left) and of IL-6 (right) in patients with advanced solid tumors after the first two treatment cycles with IV SEQ ID NO: 1 at a dose of 0.1, 0.3, 1, 3, 6 or 8 μg/kg. - Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments in accordance with the invention described herein. The scope of the present invention is not intended to be limited to the following description, but rather is as set forth in the appended claims.
- In the claims, articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
- It is also noted that the term “comprising” is intended to be open and permits but does not require the inclusion of additional elements or steps. When the term “comprising” is used herein, the term “consisting of” is thus also encompassed and disclosed.
- Where ranges are given, endpoints are included. Furthermore, it is to be understood that unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or subrange within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.
- As used herein, the term “about” or “approximately” as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term “approximately” or “about” refers to a range of values that fall within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
- As used herein, the term “substantially” refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest. One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result. The term “substantially” is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
- As used herein any form of administration or coadministration of a “combination”, “combined therapy” and/or “combined treatment regimen” refers to at least two therapeutically active agents or compositions which may be administered or co-administered”, simultaneously, in either separate or combined formulations, or sequentially at different times separated by minutes, hours or days. In general, each agent will be administered at a dose and/or on a time schedule determined for that agent.
- As used herein, the term “parenteral” refers to dosage forms that are intended for administration as an injection or infusion and includes subcutaneous, intravenous, intra-arterial, intraperitoneal, intracardiac, intrathecal, and intramuscular injection, as well as infusion injections usually by the intravenous route.
- The term “therapeutic agent” encompasses any agent administered to treat a symptom or disease in an individual in need of such treatment in addition to, or in combination with, SEQ ID NO: 1. Such additional therapeutic agent may comprise any active ingredients suitable for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
- The term “chemotherapeutic agent” refers to a compound or a derivative thereof that can interact with a cancer cell, thereby reducing the proliferative status of the cell and/or killing the cell for example, by impairing cell division or DNA synthesis, or by damaging DNA, effectively targeting fast dividing cells. Examples of chemotherapeutic agents include, but are not limited to, alkylating agents (e.g., cyclophosphamide, ifosfamide); metabolic antagonists (e.g., methotrexate (MTX), 5-fluorouracil or derivatives thereof); a substituted nucleotide; a substituted nucleoside; DNA demethylating agents (also known as antimetabolites; e.g., azacitidine); antitumor antibiotics (e.g., mitomycin, adriamycin); plant-derived antitumor agents (e.g., vincristine, vindesine, TAXOL®, paclitaxel, abraxane); cisplatin; carboplatin; etoposide; and the like. Such agents may further include, but are not limited to, the anti-cancer agents trimethotrexate (TMTX); temozolomide; raltitrexed; S-(4-Nitrobenzyl)-6-thioinosine (NBMPR); 6-benzyguanidine (6-BG); a nitrosoureas a nitrosourea (rabinopyranosyl-N-methyl-N-nitrosourea (Aranose), Carmustine (BCNU, BiCNU), Chlorozotocin, Ethylnitrosourea (ENU), Fotemustine, Lomustine (CCNU), Nimustine, N-Nitroso-N-methylurea (NMU), Ranimustine (MCNU), Semustine, Streptozocin (Streptozotocin)); cytarabine; and camptothecin; or a therapeutic derivative of any thereof.
- As used herein a single “course” of treatment such as a first course, second course, third course and so on refers to a treatment regimen wherein the Fusion Protein is administered for a desired period of time such as 1 to about 5 consecutive or non-consecutive days of treatment or a once weekly administration followed by a rest period of a certain amount of consecutive days. Therefore, one course of treatment includes a period of time of consecutive or non-consecutive administration of the Fusion Protein to the patient followed by a rest period of consecutive days wherein there is no administration of the Fusion Protein to the patient.
- The term “fusion protein” designates a protein or peptide linked together with another protein or peptide by peptide bond between their respective N- and C-terminal amino acid residues or verse visa, or by insertion of the first protein or peptide into the internal region of the second protein or peptide by two peptide bonds at the N- and C-termini of the inserted protein or peptide. A peptide bond is a covalent chemical bond formed between carboxyl group of one amino acid and the amine group of another amino acid. A fusion protein is produced by expression of the fusion protein gene in an expression host, in which the coding sequence for the first protein or peptide is linked to the coding sequence of the second protein or peptide.
- The term “Fusion Protein” refers to the fusion protein of SEQ ID NO: 1. The invention also contemplates the use of a variant of the fusion protein of SEQ ID NO: 1 having an amino acid sequence having sequence identity that is about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher over a contiguous stretch of about 20 amino acids up to the full length of SEQ ID NO: 1. A variant of the SEQ ID NO: 1 may have a defined sequence identity as compared to SEQ ID NO: 1 over a defined length of contiguous amino acids (e.g., a “comparison window”). Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Madison, Wis.), or by manual alignment and visual inspection (see, e.g., Current Protocols in Molecular Biology (Ausubel et al., eds. 1995 supplement)).
- As an example, a variant of the fusion protein of SEQ ID NO: 1 can comprise an amino acid sequence having at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, or at least about 99%, amino acid sequence identity to a contiguous stretch of SEQ ID NO: 1 of at least 20 amino acids and preferably from about 20 amino acids to about 40 amino acids, from about 40 amino acids to about 60 amino acids, from about 60 amino acids to about 80 amino acids, from about 80 amino acids to about 100 amino acids, from about 100 amino acids to about 120 amino acids, from about 120 amino acids to about 140 amino acids, from about 140 amino acids to about 150 amino acids, from about 150 amino acids to about 155 amino acids, from about 155 amino acids up to the full-length of SEQ ID NO: 1.
- The term “IL-2 therapy” includes administration of immunotherapy based on IL-2 and its associated biological functions as an immunotherapy including but not limited to maintenance of CD4+ regulatory T cells and differentiation of CD4+ T cells into a variety of subsets; promotion of CD8+ T-cell and NK cell cytotoxicity activity, and modulation of T-cell differentiation programs in response to antigen, promoting naive CD4+ T-cell differentiation into T helper-1 (Th1) and T helper-2 (Th2) cells while inhibiting T helper-17 (Th17) differentiation. Therefore “IL-2 therapy” as used herein includes but is not limited to immunotherapy with rhlL-2 or a variant of rhlL-2 such as the Fusion Protein of SEQ ID NO: 1.
- The terms “high dose IL-2” and “HD IL-2” include a dose of interleukin-2 (IL-2) of about or at least about 600,000 International Units (IU)/kg of body weight (kg)/dose, or about or at least about 720,000 IU/kg/dose.
- The terms “low dose IL-2” and “LD IL-2” include a dose of interleukin-2 (IL-2) of less than about 600,000 IU/kg of body weight/dose, such as about 60,000 or about 72,000 IU/kg/dose, e.g., from about 60,000 to about 72,000 IU/kg/dose.
- As used herein, the term “subject” or “patient” refers to any organism to which a composition in accordance with the present disclosure may be administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes. Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans) and/or plants. Preferably “patient” refers to a human subject who may seek or be in need of treatment, requires treatment, is receiving treatment, will receive treatment, or a subject who is under care by a trained professional for a particular disease or condition. The “patient” can be a child (>1-17 years). In still other embodiments, the patient can be an infant (1 year and younger). In yet still other embodiments, the patient can be a pediatric patient, wherein the term “pediatric” is used as understood by those skilled in the art. For example, pediatric patients include infants, children and adolescents.
- The phrase “pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- As used herein, the term “preventing” refers to partially or completely delaying onset of an infection, disease, disorder and/or condition; partially or completely delaying onset of one or more symptoms, features, or clinical manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying onset of one or more symptoms, features, or manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying progression from an infection, a particular disease, disorder and/or condition; and/or decreasing the risk of developing pathology associated with the infection, the disease, disorder, and/or condition.
- The term “protein” or “peptide” as used herein refers to a at least two or more amino acid residues linked together by peptide bond. The amino acid sequence in a protein or peptide is shown in the standard format, i.e., from amino terminus (N-terminus) to carboxyl terminus (C-terminus).
- The term “recombinant production” refers to the techniques for manipulating and combining two or more DNA sequences together that include recombination, PCR (polymerase chain reaction), in vitro mutagenesis, and direct DNA synthesis. These techniques are described in numerous published books and manuals, including the “Current protocols in molecular biology” (Ausubel eds. 2008. John Wiley & Son).
- As used herein, the term “substantially” refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest. One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result. The term “substantially” is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
- The phrase “therapeutically effective amount” or an “effective amount refers to the administration of an agent to a subject, either alone or as part of a pharmaceutical composition and either in a single dose or as part of a series of doses, in an amount capable of having any detectable, positive effect on any symptom, aspect, or characteristic of a disease, disorder or condition when administered to the subject. The therapeutically effective amount can be ascertained by measuring relevant physiological effects, and it can be adjusted in connection with the dosing regimen and diagnostic analysis of the subject's condition, and the like. By way of example, measurement of the amount of inflammatory cytokines produced following administration can be indicative of whether a therapeutically effective amount has been used. In reference to cancer or pathologies related to unregulated cell division, a therapeutically effective amount refers to that amount which has the effect of (1) reducing the size of a tumor (i.e. tumor regression), (2) inhibiting (that is, slowing to some extent, preferably stopping) aberrant cell division, for example cancer cell division, (3) preventing or reducing the metastasis of cancer cells, and/or, (4) relieving to some extent (or, preferably, eliminating) one or more symptoms associated with a pathology related to or caused in part by unregulated or aberrant cellular division, including for example, cancer. An “effective amount” is also that amount that results in desirable PD and PK profiles and desirable immune cell profiling upon administration of the therapeutically active compositions of the invention.
- The terms “treating” or “treatment” of a disease (or a condition or a disorder) as used herein refer to preventing the disease from occurring in a human subject or an animal subject that may be predisposed to the disease but does not yet experience or exhibit symptoms of the disease (prophylactic treatment), inhibiting the disease (slowing or arresting its development), providing relief from the symptoms or side-effects of the disease (including palliative treatment), and causing regression of the disease. The terms “treat,” “treating,” “treatment,” “therapeutic,” and “therapy” do not necessarily mean total cure or abolition of the disease or condition. Any alleviation of any undesired signs or symptoms of a disease or condition, to any extent can be considered treatment and/or therapy. Furthermore, treatment may include acts that may worsen the patient's overall feeling of well-being or appearance. With regard to cancer, these terms also mean that the life expectancy of an individual affected with a cancer may be increased or that one or more of the symptoms of the disease will be reduced. With regard to cancer, “treating” also includes enhancing or prolonging an anti-tumor response in a subject.
- “Progression free survival (PFS),” as used in the context of the cancers described herein, refers to the length of time during and after treatment of the cancer until objective tumor progression or death of the patient. The treatment may be assessed by objective or subjective parameters; including the results of a physical examination, neurological examination, or psychiatric evaluation. In preferred aspects, PFS may be assessed by blinded imaging central review and may further optionally be confirmed by ORR or by blinded independent central review (BICR).
- “Overall survival (OS)” may be assessed by OS rate at certain time points (e.g., 1 year and 2 years) by the Kaplan-Meier method and corresponding 95% CI will be derived based on Greenwood formula by study treatment for each tumor type. OS rate is defined as the proportion of participants who are alive at the time point. OS for a participant is defined as the time from the first dosing date to the date of death due to any cause.
- As used herein a “complete response” is the disappearance of all signs of cancer in response to treatment. A complete response may also be referred to herein as “total remission”.
- As used herein the term “partial response” means a decrease in the size of the tumor, or in the extent of cancer in the body in response to treatment. A partial response may also be referred to herein as “partial remission”.
- The term “cancer”, as used herein, shall be given its ordinary meaning, as a general term for diseases in which abnormal cells divide without control.
- The term “reducing a tumor” or “tumor regression” as used herein refers to a reduction in the size or volume of a tumor mass, a decrease in the number of metastasized tumors in a subject, a decrease in the proliferative status (the degree to which the cancer cells are multiplying) of the cancer cells, and the like.
- The term “enhancing”, as used herein, refers to allowing a subject or tumor cell to improve its ability to respond to a treatment disclosed herein. For example, an enhanced response may comprise an increase in responsiveness of at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 98% or more. As used herein, “enhancing” can also refer to enhancing the number of subjects who respond to a treatment such as a combination therapy comprising chemotherapy, drug-resistant immunocompetent cells, and immune checkpoint inhibitors. For example, an enhanced response may refer to a total percentage of subjects who respond to a treatment wherein the percentage is of at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 98% or more.
- “Immune checkpoint proteins” regulate T cell function in the immune system. T cells play a central role in cell-mediated immunity. Immune checkpoint proteins interact with specific ligands that send a signal into the T cell and essentially switch off or inhibit T cell function. Cancer cells take advantage of this system by driving high levels of expression of immune checkpoint proteins on their surface that results in control of the T cells expressing immune checkpoint proteins on the surface of T cells that enter the tumor microenvironment, thus suppressing the anticancer immune response. As such, inhibition of immune checkpoint proteins by agents referred to herein as “immune checkpoint protein inhibitors” or “immune checkpoint inhibitors” would result in restoration of T cell function and an immune response to the cancer cells. Examples of immune checkpoint proteins include, but are not limited to: CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049,
CHK 1, CHK2, A2aR, OX40, B-7 family ligands or a combination thereof. Preferably, the immune checkpoint inhibitor interacts with a ligand of an immune checkpoint protein which may be CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049,CHK 1, CHK2, OX40, A2aR, B-7 family ligands or a combination thereof. Examples of immune checkpoint inhibitors include but are not limited to: from a PD-1 antagonist, PD-L1 antagonist, CTLA-4 antagonist, adenosine A2A receptor antagonist, B7-H3 antagonist, B7-H4 antagonist, BTLA antagonist, KIR antagonist, LAG3 antagonist, TIM-3 antagonist, VISTA antagonist or TIGIT antagonist. - As used herein the term “angiogenesis inhibitor” refers to a drug, compound, antibody or other agent that keeps new blood vessels from forming. In cancer treatment, angiogenesis inhibitors may prevent the growth of new blood vessels that tumors need to grow. Angiogenesis inhibitors include those agents that can target one or more signaling pathways associated with receptor tyrosine kinases (RTK). RTKs include, but are not limited to, vascular endothelial growth
factor receptors types types - “Pharmaceutically acceptable salt” refers to a salt of a compound of the disclosure that is pharmaceutically acceptable and that possesses the desired pharmacological activity of the parent compound. In particular, such salts are non-toxic may be inorganic or organic acid addition salts and base addition salts. Specifically, such salts include: (1) acid addition salts, formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like; or formed with organic acids such as acetic acid, propionic acid, hexanoic acid, cyclopentanepropionic acid, glycolic acid, pyruvic acid, lactic acid, malonic acid, succinic acid, malic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, 3-(4-hydroxybenzoyl)benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, 1,2-ethane-disulfonic acid, 2-hydroxyethanesulfonic acid, benzenesulfonic acid, 4-chlorobenzenesulfonic acid, 2-naphthalenesulfonic acid, 4-toluenesulfonic acid, camphorsulfonic acid, 4-methylbicyclo[2.2.2]-oct-2-ene-1-carboxylic acid, glucoheptonic acid, 3-phenylpropionic acid, trimethylacetic acid, tertiary butylacetic acid, lauryl sulfuric acid, gluconic acid, glutamic acid, hydroxynaphthoic acid, salicylic acid, stearic acid, muconic acid, and the like; or (2) salts formed when an acidic proton present in the parent compound either is replaced by a metal ion, e.g., an alkali metal ion, an alkaline earth ion, or an aluminum ion; or coordinates with an organic base such as ethanolamine, diethanolamine, triethanolamine, N-methylglucamine and the like. Salts further include, by way of example only, sodium, potassium, calcium, magnesium, ammonium, tetraalkylammonium, and the like; and when the compound contains a basic functionality, salts of non-toxic organic or inorganic acids, such as hydrochloride, hydrobromide, tartrate, mesylate, acetate, maleate, oxalate and the like.
- Generally, such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in water or in an organic solvent, or in a mixture of the two; generally, nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are preferred. Lists of suitable salts are found in Allen, Jr., L. V., ed., Remington: The Science and Practice of Pharmacy, 22nd Edition, Pharmaceutical Press, London, UK (2012).
- A recombinant human IL-2 variant fusion protein, described in WO 2013/184942, is a circularly permuted (cp) IL-2 variant fused to the extracellular domain of the IL-2Rα portion of the IL-2 receptor and is referred to herein as the “fusion protein of SEQ ID NO: 1” or the “Fusion Protein” and has the following amino acid sequence:
-
(SEQ ID NO: 1) SKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITF SQSIISTLTGGSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTF KFYMPKKATELKHLQCLEEELKPLEEVLNLAQGSGGGSELCDDDPPEIPH ATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCT SSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPGHCREPPPWEN EATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLI CTG. - It is contemplated that fusion proteins that are closely related to SEQ ID NO: 1, such as those fusion proteins having sequence identities of about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher identity over the full length of SEQ ID NO: 1 may also be suitable for administration in accordance with the methods of the invention. It is contemplated that fusion proteins that are closely related to SEQ ID NO: 1, such as those fusion proteins having sequence identities of about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher identity over a contiguous sequence of at least about 20 amino acids up to the full length of SEQ ID NO: 1 may also be suitable for administration in accordance with the methods of the invention.
- The fusion protein of SEQ ID NO: 1 may be produced using a biological recombinant expression system or any protein synthesizer. Strategies for recombinant protein expression are well known in the art, and typically involve transfecting cells with a DNA vector that contains a genetic template encoding the Fusion Protein of SEQ ID NO: 1 and then culturing the cells so that they transcribe and translate the Fusion Protein. Typically, the cells are then lysed to extract the expressed protein for subsequent purification. Both prokaryotic and eukaryotic in vivo protein expression systems are widely used. Preferably, the fusion protein of SEQ ID NO: 1 is produced in CHO cells.
- The invention provides pharmaceutical compositions of a dose of at least about 6 μg/kg to about 70 μg/kg of the fusion protein of SEQ ID NO: 1 and preferably pharmaceutical compositions of at least about 6 μg/kg to at least about 15 μg/kg of the fusion protein of SEQ ID NO: 1 and a pharmaceutically acceptable excipient or a corresponding fixed dose based on an average 60-70 kg adult human (e.g. ˜0.4 mg to about ˜1.0 mg) or based on a child, for example, a child of about 12 kg to about 50 kg or more. The invention also provides pharmaceutical compositions of a dose of at least about 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11, 11.5, 12, 12.5, 13, 13.5, 14, 14.5, or 15 μg/kg or at a corresponding fixed dose based on, for example, an average 60-70 kg adult or based on, for example, a child of about 12 kg to about 50 kg or more.
- The invention also provides pharmaceutical compositions of a dose of at least about 3 μg/kg to at least about 5.5 μg/kg of the fusion protein of SEQ ID NO: 1 and a pharmaceutically acceptable excipient or a corresponding fixed dose based on an average 60-70 kg adult human (e.g. ˜0.2 mg to ˜0.4 mg). The invention also provides pharmaceutical compositions of a dose of at least about 3, 3.5, 4, 4.5, 5, 5.5 μg/kg or a corresponding fixed dose based on an average 60-70 kg adult human or based on a child, for example a child of about 12 kg to about 50 kg or more.
- The invention also provides pharmaceutical compositions of a dose of at least about 40 μg/kg to at least about 70 μg/kg of the fusion protein of SEQ ID NO: 1 and a pharmaceutically acceptable excipient or a corresponding fixed dose based on an average 60-70 kg adult human (e.g. about 3.0 mg to about 3.6 mg) or based on a child, for example a child of about 12 kg to about 50 kg or more.
- A pharmaceutically acceptable excipient, which, as used herein, includes any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired. Remington's The Science and Practice of Pharmacy, 21′Edition, A. R. Gennaro (Lippincott, Williams & Wilkins, Baltimore, Md., 2006; incorporated herein by reference) discloses various excipients used in formulating pharmaceutical compositions and known techniques for the preparation thereof.
- Except insofar as any conventional excipient medium is incompatible with a substance or its derivatives, such as by producing any undesirable biological effect or otherwise interacting in a deleterious manner with any other component(s) of the pharmaceutical composition, its use is contemplated to be within the scope of this present disclosure.
- Liquid dosage forms for oral and parenteral administration include, but are not limited to, pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and/or elixirs. In addition to active ingredients, liquid dosage forms may comprise inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
- Besides inert diluents, oral compositions can include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and/or perfuming agents. In certain embodiments for parenteral administration, compositions are mixed with solubilizing agents such as CREMOPHOR®, alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and/or combinations thereof.
- Injectable preparations, for example, sterile injectable aqueous or oleaginous suspensions may be formulated according to the known art using suitable dispersing agents, wetting agents, and/or suspending agents. Sterile injectable preparations may be sterile injectable solutions, suspensions, and/or emulsions in nontoxic parenterally acceptable diluents and/or solvents, for example, as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution, U.S.P., and isotonic sodium chloride solution. Sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose, any bland fixed oil can be employed including synthetic mono- or diglycerides. Fatty acids such as oleic acid can be used in the preparation of injectables.
- Injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, and/or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use. General considerations in the formulation and/or manufacture of pharmaceutical agents may be found, for example, in Remington's The Science and Practice of Pharmacy, 21st Edition, A. R. Gennaro (Lippincott, Williams & Wilkins, Baltimore, Md., 2006; incorporated herein by reference).
- The fusion protein of SEQ ID NO: 1 (
FIG. 1A ) is designed to selectively bind to and activate the intermediate-affinity IL-2R, but not the high-affinity IL-2R. The IL-2Rα domain of the fusion protein of SEQ ID NO: 1 serves to sterically impede the binding of the fusion protein of SEQ ID NO: 1 to the high-affinity IL-2R yet still allow binding to the intermediate-affinity IL-2R. - In vitro and in vivo nonclinical pharmacodynamic (PD) data support selective signaling through the intermediate-affinity IL-2 receptor by the fusion protein of SEQ ID NO: 1, leading to the activation and expansion of effector cells such as NK cells and CD8+ cells, while minimizing the activation and expansion of immunosuppressive Tregs. Additionally, in vivo in mice, the fusion protein of SEQ ID NO: 1 displays improved tolerability relative to rhlL-2 at doses that elicit equivalent or greater expansion of effector cells relative to Tregs.
- Additional nonclinical data demonstrate that IV or SC administration of the fusion protein of SEQ ID NO: 1 results in equivalent tumor growth inhibition in a mouse syngeneic tumor model, as well as similar peripheral expansion of NK and CD8+ T cells after either route of administration to cynomolgus monkeys.
- First in human clinical data described in Example 1, indicates that the fusion protein of SEQ ID NO: 1 activates expansion of CD8+ cells and NK cells in a dose dependent manner in the absence of dose dependent activation of Tregs. Therefore, the fusion protein of SEQ ID NO: 1 can be dosed in human patients at a concentration that is comparative to high dose rhlL-2 to elicit equivalent or greater expansion of NK cells and CD8+ cells as compared to high dose rhIL-2 but with far less (at least two fold less) relative expansion of immunosuppressive Tregs as compared to high dose rhlL-2 (Table 2). This result was unexpected.
- Preferably, the fusion protein of SEQ ID NO: 1 is administered to a cancer patient in accordance with the methods and dosing regimens of the invention. Preferred routes of administration are intravenous, e.g., intravenous injection and intravenous infusion, e.g., via central venous access. Additional routes of administration include subcutaneous, intramuscular, oral, nasal, and pulmonary administration. Preferably the Fusion Protein may be administered as part of a pharmaceutical composition comprising at least one excipient.
- Preferably, the invention provides pharmaceutical compositions for intravenous (I. V.) administration comprising a dose of the fusion protein of SEQ ID NO: 1 in terms of μg/kg as is often preferred for calculating dose in pediatric patients but is also useful for calculating dose for adults, preferably at a dose of: about 0.1 μg/kg to about 70 μg/kg; about 1 μg/kg to about 70 μg/kg; about 1 μg/kg to about 50 μg/kg; about 1 μg/kg to about 30 μg/kg; about 1 μg/kg to about 25 μg/kg; about 1 μg/kg to about 15 μg/kg; about 1 μg/kg to about 10 μg/kg; about 1 μg/kg to about 5 μg/kg; about 1 μg/kg to about 3 μg/kg; about 6 μg/kg to about 70 μg/kg; about 6 μg/kg to about 50 μg/kg; about 6 μg/kg to about 30 μg/kg; about 6 μg/kg to about 25 μg/kg; about 6 μg/kg to about 15 μg/kg; about 6 μg/kg to about 10 μg/kg; about 6 μg/kg to about 8 μg/kg; about 8 μg/kg to about 70 μg/kg; about 8 μg/kg to about 50 μg/kg; about 8 μg/kg to about 30 μg/kg; about 8 μg/kg to about 25 μg/kg; about 8 μg/kg to about 15 μg/kg; about 8 μg/kg to about 10 μg/kg; about 10 μg/kg to about 70 μg/kg; about 10 μg/kg to about 50 μg/kg; about 10 μg/kg to about 30 μg/kg; about 10 μg/kg to about 25 μg/kg; about 10 μg/kg to about 15 μg/kg; about 12 μg/kg to about 12 μg/kg; about 12 μg/kg to about 50 μg/kg; about 12 μg/kg to about 30 μg/kg; about 12 μg/kg to about 25 μg/kg; about 12 μg/kg to about 15 μg/kg; about 14 μg/kg to about 70 μg/kg; about 14 μg/kg to about 50 μg/kg; about 14 μg/kg to about 30 μg/kg; about 14 μg/kg to about 25 μg/kg; about 30 μg/kg to about 70 μg/kg; about 30 μg/kg to about 50 μg/kg; about 40 μg/kg to about 70 μg/kg; about 40 μg/kg to about 50 μg/kg; about 50 μg/kg to about 70 μg/kg; about 50 μg/kg to about 60 μg/kg; or a corresponding fixed dose thereof based on, for example, a 60-70 kg adult (e.g. about 1 mg to about 4 mg) or a corresponding fixed dose based a child, for example, a child of about 12 kg to about 50 kg or more.
- Preferably, the fusion protein of SEQ ID NO: 1 is administered by I.V infusion to a patient at a dose of at least about 6 μg/kg per day to at least about 15 μg/kg/day or at a corresponding fixed per day dose based on, for example, an average 60-70 kg adult human (e.g. ˜0.4 mg/day to about ˜1.0 mg/day) or a corresponding fixed per day dose based on a child for example, a child of about 12 kg to about 50 kg or more. Preferably the dose is about 6 μg/kg per day. Preferably the dose is about 8 μg/kg per day. Preferably the dose is about 10 μg/kg per day. Preferably the dose is about 12 μg/kg per day. Preferably the dose is about 14 μg/kg per day. Preferably the dose is about 15 μg/kg per day. Preferably the dose is about 6 μg/kg/day, 6.5 μg/kg/day, 7 μg/kg/day, 7.5 μg/kg/day, 8 μg/kg/day, 8.5 μg/kg/day, 9 μg/kg/day, 9.5 μg/kg/day, 10 μg/kg/day, 10.5 μg/kg/day, 11 μg/kg/day, 11.5 μg/kg/day, 12 μg/kg/day, 12.5 μg/kg/day, 13 μg/kg/day, 13.5 μg/kg/day, 14 μg/kg/day, 14.5 μg/kg/day, 15 μg/kg/day or a corresponding fixed per day dose based on an average 60-70 kg adult or a corresponding fixed per day dose based on a child, for example, a child of about 12 kg to about 50 kg or more.
- Even higher doses may be contemplated for administration to a patient, such as doses of 16 μg/kg/day, 18 μg/kg/day, 20 μg/kg/day, 22 μg/kg/day, 24 μg/kg/day, 26 μg/kg/day, 28 μg/kg/day, 30 μg/kg/day, 40 μg/kg/day, 50 μg/kg/day, 60 μg/kg/day, 70 μg/kg/day or a corresponding fixed per day dose based, for example, on an average 60-70 kg adult (e.g. ˜1 mg to ˜4 mg) or a corresponding fixed dose based, for example on a child of about 12 kg to about 50 kg or more.
- Preferably the fusion protein of SEQ ID NO: 1 is administered as a single I.V. infusion per day. A single I.V. infusion may take from 5 minutes to 2 hours.
- Preferably the dosing regimen for administration of the fusion protein provides for one or more treatment courses. A single treatment course may take place over a period of days ranging from 1-90 days. Preferably a single treatment course extends for a period of 14 days or 21 days. A treatment course may involve multiple consecutive days wherein the Fusion Protein as administered to the patient once per day via I.V. infusion, followed by multiple consecutive days wherein the Fusion Protein is not administered to the patient also referred to herein as a “rest period”. It is contemplated that the days of administration may be non-consecutive if, for example, a patient experiences discomfort with consecutive daily administrations. Preferably, the Fusion protein is administered to the patient for at least about 1, 2, 3, 4, or 5 consecutive days. Preferably, administration of the Fusion Protein need not be consecutive and may take place over the course of 1, 2, 3, 4, or 5 non-consecutive days. Preferably the fusion protein is administered to the patient as a once a day by I.V. infusion for 1 to about 5 consecutive days. Preferably the Fusion Protein is administered to the patient once a day for 1-5 non-consecutive days, e.g. infusions on
day 1 with one or two days in between before the next infusion and so on for the desired total number of infusion days prior to the rest period. - Preferably the first course of treatment comprises administering the Fusion Protein by I.V. infusion once a day for five (5) consecutive days followed by a rest period of 9 days for a first treatment course that lasts about 14 days. Preferably a second course of treatment follows the first course of treatment. The second course of treatment may begin at any time after the first course of treatment but preferably begins within about 24 hours or more after the first course of treatment has ended.
- Preferably, the second course of treatment comprises administering the Fusion Protein of SEQ ID NO: 1 by I.V. infusion once a day for five (5) consecutive days followed by a rest period of at least about 16 consecutive days for a treatment course that lasts about 21 days. Additional treatment courses such as a third, fourth and fifth treatment courses, may follow the second treatment course, preferably starting within about 24 hours after the previous course is finished. Preferably, all treatment courses after the first treatment course are at least about 21-day treatment courses.
- Preferably, Fusion Protein is administered with another therapeutic and/or anti-cancer agent as described infra. Preferably the therapeutic agent is the immune checkpoint inhibitor, pembrolizumab. Preferably pembrolizumab is administered in a separate composition from the Fusion Protein and is preferably administered by I.V. infusion prior to, subsequent to, or simultaneously infusion of the Fusion Protein. Preferably, pembrolizumab is administered in a once a day dose of about 200 μg or as per the standard prescribing recommendations.
- Preferably, pembrolizumab is administered on the first day of each course of treatment with the Fusion Protein. An exemplary treatment regimen is shown in
FIG. 2 . Preferably, when co-administering the Fusion Protein with pembrolizumab, the first course of treatment with the fusion protein and all subsequent courses of treatment (e.g. Treatment courses - 1 is administered periodically such as only once every about 3 days to once every about 60 days. Preferably the periodic dosing is once every about 3 days to once every about 21 days. Preferably, the periodic dosing is once every 3 days, once every 4 days, once every 7 days, once every 14 days or once every 21 days. In accordance with this periodic dosing e.g. once weekly dosing regimen, the dose of Fusion Protein is administered on a once weekly basis, for example, wherein the dose is about 40 μg/kg to about 70 μg/kg; preferably wherein the dose is about 50 μg/kg to about 60 μg/kg; or a corresponding fixed dose, thereof based on, for example a 60 kg to 70 kg adult or based on a child, for example, a child of about 12 kg to about 50 kg or more.
- Preferably the fusion protein of SEQ ID NO: 1 is administered by I.V. infusion on
day 1,day 7,day 14 andday 21 during each treatment cycle. Preferably the fusion protein of SEQ ID NO: 1 is administered by I.V. infusion onday 1, andday 14 during each treatment cycle. Preferably the fusion protein of SEQ ID NO: 1 is administered by I.V. infusion onday 1, andday 21 during each treatment cycle. Preferably the fusion protein of SEQ ID NO: 1 is administered by I.V. infusion onday 1,day 7 andday 14 during each treatment cycle. Preferably the fusion protein of SEQ ID NO: 1 is administered by I.V. infusion onday 1,day 7 andday 21 during each treatment cycle. - Preferably the fusion protein of SEQ ID NO: 1 is administered periodically, for example, the fusion protein of SEQ ID NO: 1 is administered to the patient by I.V. infusion on one or more days during a treatment cycle wherein each I.V. administration during the treatment cycle is separated by about 7 days, about 14 days, or about 21 days or any combination thereof so long as the administration of SEQ ID NO: 1 does not occur on consecutive days at doses of about 6 μg/kg per day to at about 15 μg/kg/day or at doses of about 16 μg/kg per day to about 70 μg/kg/day or a corresponding fixed per day dose based, for example, on an average 60-70 kg adult (e.g. ˜1 mg to ˜4 mg) or a corresponding fixed per day dose based on a child, for example, a child of about 12 kg to about 50 kg or more.
- Preferably the fusion protein of SEQ ID NO: 1 is administered periodically, for example, the patient is administered to the patient by I.V. infusion on one or more days during a treatment cycle wherein each I.V. administration during the treatment cycle is separated by about 7 days, about 14 days, or about 21 days or any combination thereof so long as the administration of SEQ ID NO: 1 does not occur on consecutive days preferably at a dose of about 16 μg/kg per day to about 70 μg/kg/day; preferably at dose of about 16 μg/kg per day to about 50 μg/kg/day; preferably at a dose of about 16 μg/kg per day to about 30 μg/kg/day; preferably at a dose of about 16 μg/kg per day to about 20 μg/kg/day; preferably at about a dose of 30 μg/kg per day to about 50 μg/kg/day; or a corresponding fixed per day dose based, for example, on an average 60-70 kg adult (e.g. ˜1 mg to ˜4 mg) or a corresponding fixed dose based, for example, on a child of about 12 kg to about 50 kg or more.
- Preferably the periodic dosing is administered by I.V. infusion. Preferably a second therapeutic/anti-cancer agent such as pembrolizumab is co-administered with the fusion protein of SEQ ID NO: 1, preferably by I.V. infusion prior to, subsequent to, or simultaneously with, or on the same day as, administration of the fusion protein of SEQ ID NO: 1.
- The methods of the invention also contemplate a dosing regimen wherein the fusion protein of SEQ ID NO: 1 is administered once a day at a dose of less than about 6 μg/kg/day or a fixed dose equivalent thereof based on a 60-70 kg human or based on a child of about 12 kg to about 50 kg or more. For example, a patient may be administered a dose of about 3, 3.5, 4, 4.5, 5, 5.5 μg/kg/per day or a corresponding fixed per day dose based on, for example, an average 60-70 kg adult human or a corresponding fixed dose based on a child, for example, a child of about 12 kg to about 50 kg or more. A once a day dosing regimen of less than about 6 μg/kg/day or a fixed dose equivalent thereof based on a 60-70 kg human may be administered in accordance with any of the dosing regimens described above for in relation to doses between 6 μg/kg/day and 15 μg/kg/day.
- All of the dosing regimens of the invention described above preferably result in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in T regulatory (Treg) cells and preferably result in an increase in circulating NK cells and CD8+ cells that is greater relative to the increase in circulating Treg cells in the patient. As compared to high dose or low dose rhIL-2 therapy, all dosing regimens of the invention preferably require less frequent dosing e.g., once daily dosing of the fusion protein of SEQ ID NO: 1 as compared to
dosing 3 times per day dosing of high dose or low dose rhlL-2. - Preferably the increase in circulating CD8+ T-cells resulting from administration of the fusion protein of SEQ ID NO: 1 is at least about a 2-fold, at least about a 3-fold, at least about a 4-fold, at least about a 5-fold, at least about a 6-fold, at least about a 7-fold, at least about an 8-fold, about a 9-fold, about a 10-fold, or more as compared to baseline. Preferably the ratio of increase in circulating CD8+ T cells resulting from administration of the fusion protein of SEQ ID NO: 1 is greater relative to the ratio of increase in circulating T regulatory cells.
- Preferably the fusion protein of SEQ ID NO: 1 and pharmaceutical compositions thereof, in combination with one or more immune checkpoint inhibitors to treat and/or prevent various diseases, disorders and conditions (e.g., cancers) is affected by utilizing particular dosing parameters that serve to minimize any adverse effects associated with administration of the individual therapies by themselves. By way of example, the addition of the administration of the fusion protein of SEQ ID NO: 1 in a treatment regimen comprising an immune checkpoint inhibitor (e.g. pembrolizumab) might allow a reduction of the amount of an immune checkpoint inhibitor needed to achieve the therapeutic goal, thus reducing (or even eliminating) severe and fatal immune-mediated adverse reactions that prompted the FDA to require a “black box” warning on certain immune checkpoint inhibitors (e.g. pembrolizumab).
- In general, dosing parameters of monotherapy with the fusion protein of SEQ ID NO: 1 or any of the combination therapies described herein dictate that the dosage amount be less than an amount that could be irreversibly toxic to the subject (i.e., the maximum tolerated dose, “MTD”) and not less than an amount required to produce a measurable effect on the subject. Such amounts are determined by, for example, the pharmacokinetic and pharmacodynamic parameters associated with ADME, taking into consideration the route of administration and other factors.
- An effective dose (ED) is the dose or amount of an agent that produces a therapeutic response or desired effect in some fraction of the subjects taking it. The “median effective dose” or ED50 of an agent is the dose or amount of an agent that produces a therapeutic response or desired effect in 50% of the population to which it is administered. Although the ED50 is commonly used as a measure of reasonable expectance of an agent's effect, it is not necessarily the dose that a clinician might deem appropriate taking into consideration all relevant factors. Thus, in some situations the effective amount can be more than the calculated ED50, in other situations the effective amount can be less than the calculated ED50, and in still other situations the effective amount can be the same as the calculated ED50.
- In addition, an effective dose of the fusion protein of SEQ ID NO: 1 can be an amount that, when administered in one or more doses to a subject, produces a desired result relative to a healthy subject. For example, for a subject experiencing a particular disorder, an effective dose can be one that improves a diagnostic parameter, measure, marker and the like of that disorder by at least about 5%, at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or more than 90%, where 100% is defined as the diagnostic parameter, measure, marker and the like exhibited by a normal subject.
- Preferably, the patient is administered the fusion protein of SEQ ID NO: 1 again if after initial treatment the cancer reoccurs. For example, if the patient is initially treated for a solid tumor, and the tumor returns or more tumors develop, the patient is administered SEQ ID NO: 1, as, for example, another course or series of courses of SEQ ID NO: 1.
- Preferably, the fusion protein of SEQ ID NO: 1 is administered to a cancer patient in accordance with the methods and dosing regimens of the invention. Preferred routes of administration are intravenous, e.g., intravenous injection and intravenous infusion, e.g., via central venous access. Additional preferred routes of administration include subcutaneous, intramuscular, oral, nasal, and pulmonary administration.
- The treatment regimens of the invention are administered to the patient until the patient is cured or until the patient is no longer benefiting from the treatment regimen.
- The toxicity of rhlL-2 in humans and animals is well documented. At the high doses of rhlL-2 used in most cancer trials, considerable toxicity has been documented with only occasional tumor responses. One major dose-limiting toxicity of human recombinant interleukin-2 (rhlL-2) is capillary leak syndrome (CLS) also referred to herein as vascular leak syndrome (VLS). CLS is characterized by an increase in vascular permeability accompanied by extravasation of fluids and proteins resulting in interstitial edema and organ failure. Manifestations of CLS include fluid retention, increase in body weight, peripheral edema, pleural and pericardial effusions, ascites, anasarca and, in severe form, signs of pulmonary and cardiovascular failure. Symptoms are highly variable among patients and the causes are poorly understood.
- The pathogenesis of endothelial cell (EC) damage is complex and can involve activation or damage to ECs and leukocytes, release of cytokines and of inflammatory mediators, alteration in cell-cell and cell-matrix adhesion and in cytoskeleton function. CLS restricts the doses of IL-2 which can be administered to humans and, in some cases, necessitates the cessation of therapy.
- The methods of the invention reduce the risk of side effects often associated with high dose therapy while maintaining the desired therapeutic activity of IL-2 therapy including, but not limited to, CLS as well as cytokine release syndrome (CRS), another syndrome associated with immune therapy with cytokines that often accompanies and/or overlaps with CLS.
- Dose escalation studies in human clinical trials as described in the Examples have surprisingly revealed that the administration of the Fusion Polypeptide of SEQ ID NO: 1 to a patient at concentrations that were equivalent to those of high dose rh-IL-2 did not result in frequency and severity of certain side effects, for example, capillary leak syndrome, often associated with high dose rhIL-2 therapy. As described in the Examples outlining human clinical studies, dose limiting toxicities (DLTs) have not yet been reached doses of 6 ug/kg/day and higher even though the EC50 values for natural killer cell and CD8+ T cell activation have been exceeded. Therefore, the methods of the invention may result in an improved safety profile for patients having cancer and in need of IL-2 therapy as compared to, for example, standard rhlL-2 therapy and particularly as compared to high dose rhlL-2 therapy.
- As used herein, an “improved safety profile”, or a “lower risk of a side effects”, or “reduced frequency or severity of a side effect” associated with, for example standard rhlL-2 therapy and particularly as compared to high dose rhlL-2 therapy can be assessed in several ways. A side effect or symptom of IL-2 therapy may be quantified. A side effect or symptom of IL-2 therapy may be quantified on a semi-quantitative scale, for example 0 to 5, where 0 represents absence, 1 to 4 represent identifiable increases in severity, and 5 represents maximum severity. Clinical trials often use a 1 to 5 scale where: 1 represents a mild adverse event (side effect); 2 represents a moderate adverse event (side effect); 3 represents a severe adverse event (side effect); 4 represents a life-threatening or disabling adverse event (side effect); and 5 represents death related to adverse event (side effect). Alternatively, a side effect or symptom of IL-2 therapy may be quantified as a binary event, i.e. presence or absence, 0 or 1. Other semi-quantitative scales will be readily apparent to the person skilled in the art. In another embodiment, a side effect or symptom of IL-2 therapy may be quantified on a quantitative scale, for instance: mass per volume such as mass of cytokine per volume of tissue fluid; temperature; duration; rate; enzyme activity; oxygen saturation; and so on. The person skilled in the art will readily understand how to assess ad quantify any side effect or symptom of IL-2 therapy and be able to do so without difficulty or undue burden. For example, the person skilled in the art will be able to measure: a cytokine concentration in plasma or serum; temperature (fever); heart rate (tachycardia); blood pressure (hypotension); cardiac dysfunction; renal impairment; serum or plasma enzyme concentrations (hepatic function); and so on. Any quantification of a side effect or symptom of IL-2 therapy may be compared to a control, for example a healthy control subject not receiving IL-2 therapy, or comparing to other control subjects receiving, for example, standard high dose rhlL-2 therapy.
- A “lowered risk” of a side effect of IL-2 therapy may be about a 1% decrease, about a 2% decrease, about a 3% decrease, about a 4% decrease, about a 5% decrease, about a 6% decrease, about a 7% decrease, about an 8% decrease, about a 9% decrease, about a 10% decrease, about a 20% decrease, about a 30% decrease, about a 40% decrease, about a 50% decrease, about a 60% decrease, about a 70% decrease, about an 80% decrease, about a 90% decrease, about a 100%, decrease in the manifestation of side effects or symptom of IL-2 therapy as compared to, for example high dose rhlL-2 therapy. Alternatively, treating a side effect or symptom of IL-2 therapy may be about a 2-fold, about a 3-fold, about a 4-fold, about a 5-fold, about a 6-fold, about a 7-fold, about an 8-fold, about, a 9-fold, about a 10-fold, or more decrease in the side effect or symptom of IL-2 therapy. It follows that “less severe side effects” refers to such a decrease in the side effect or symptom of IL-2 therapy.
- Preferably the dosing regimen of the Fusion Protein in accordance with the invention reduces the frequency and severity of capillary leak syndrome (CLS) also referred to herein as vascular leak syndrome (VLS).
- The risks of other side effects often associated with rhlL-2 immunotherapy that may be also be lowered by the treatment regimens of the invention include but are not limited to cytokine-release syndrome (CRS). CRS is a serious side effect of immunotherapy having symptoms that may overlap clinically with those of CLS and yet may cause symptoms that are entirely different from CRS. CRS is thought to result from proliferating T cells that release large quantities of cytokines, including IL-6, IFN-γ, TNF, IL-2, IL-2-receptor a, IL-8, IL-10, and GMCSF. Patients with CRS may experience any one or more of fever, cardiovascular symptoms including tachycardia, hypotension, arrhythmias, decreased cardiac ejection fraction, pulmonary symptoms including edema, hypoxia, dyspnea, and pneumonitis, acute renal injury usually caused by reduced renal perfusion, hepatic and gastrointestinal symptoms including elevated serum transaminases and bilirubin, diarrhea, colitis, nausea, and abdominal pain, hematologic symptoms including cytopenia such as grade 3-4 anemia, thrombocytopenia, leukopenia, neutropenia, and lymphopenia, derangements of coagulation including prolongation of the prothrombin time and activated partial thromboplastin time (PTT), D-dimer elevation, low fibrinogen, disseminated intravascular coagulation, macrophage activation syndrome (MAS), hemorrhage, B-cell aplasia, and hypogammaglobulinemia, infectious diseases including bacteremia, Salmonella, urinary tract infections, viral infections such as influenza, respiratory syncytial virus, and herpes zoster virus, musculoskeletal symptoms including elevated creatine kinase, myalgias and weakness, neurological symptoms including delirium, confusion, and seizure.
- Administration of SEQ ID NO: 1 has been shown to induce lower levels of inflammatory cytokines as compared to for example, rhlL-2 in mice. See Example 4 and
FIG. 10 . - Administration of SEQ ID NO: 1 has also been shown to induce higher levels of desirable cytokines such as IFN while inducing lower levels of inflammatory cytokines such as IL-6 in humans. See Example 5 and
FIG. 15 . - MAS overlaps clinically with CRS with subjects potentially experiencing hepatosplenomegaly, lymphadenopathy, pancytopenia, liver dysfunction, disseminated intravascular coagulation, hypofibrinogenemia, hyperferritinemia, and hypertriglyceridemia. Like CRS, subjects with MAS exhibit elevated levels of cytokines, including IFN-γ and GMCSF.
- Another side effect of immunotherapy including IL-2 therapy is tumor lysis syndrome (TLS), which occurs when the contents of cells are released as a result of therapy causing cell death, most often with lymphoma and leukemia. TLS is characterized by blood ion and metabolite imbalance, and symptoms include nausea, vomiting, acute uric acid nephropathy, acute kidney failure, seizures, cardiac arrhythmias, and death.
- Neurotoxicity may result from immunotherapy including IL-2 therapy and symptoms may include cerebral edema, delirium, hallucinations, dysphasia, akinetic mutism, headache, confusion, alterations in wakefulness, ataxia, apraxia, facial nerve palsy, tremor, dysmetria, and seizure.
- Patients undergoing IL-2 immunotherapy may experience one or more side effects or symptoms that are not necessarily caused by CLS, CRS, MAS or TLS including anemia, aphasia, arrhythmia, arthralgia, back pain, blood and bone marrow disorders, blood and lymphatic system disorders, cardiac disorders, chills, coagulation disorders, colitis, confused state, constitutional symptoms, cough, decreased appetite, diarrhea, disorientation, dizziness, dyspnea, encephalopathy, fatigue, fever, gastrointestinal disorders, general cardiovascular disorders, hemorrhage, hepatic disorders, hyperglycemia, hypokalemia, hypothyroidism, increased ALT, increased AST, increased C-reactive protein, infection febrile neutropenia, leukopenia, malaise, abnormal metabolic laboratory-testing results, metabolism nutrition disorders, mucosal inflammation, musculoskeletal disorders, myalgia nausea, nervous system disorders, neurologic disorders, neutropenia edema, pain, palmar-plantar erythrodysesthesia, paresthesia, pneumonia, pruritus, pulmonary disorders, pyrexia, rash, renal genitourinary disorders, respiratory disorders, skin and subcutaneous tissue disorders, somnolence, speech disorders, sweats thoracic mediastinal disorders, thrombocytopenia, tremor, tumor flare, tumor lysis syndrome, vascular disorders, and vomiting.
- The treatment regimens of the invention using the fusion protein of SEQ ID NO: 1 are useful in the treatment of many types of cancer. The term “cancer”, as used herein, shall be given its ordinary meaning, as a general term for diseases in which abnormal cells divide without control. In particular, and in the context of the embodiments of the present invention, cancer refers to angiogenesis-related cancer. Cancer cells can invade nearby tissues and can spread through the bloodstream and lymphatic system to other parts of the body. There are several main types of cancer, for example, carcinoma is cancer that begins in the skin or in tissues that line or cover internal organs. Sarcoma is cancer that begins in bone, cartilage, fat, muscle, blood vessels, or other connective or supportive tissue. Leukemia is cancer that starts in blood-forming tissue such as the bone marrow and causes large numbers of abnormal blood cells to be produced and enter the bloodstream. Lymphoma is cancer that begins in the cells of the immune system.
- When normal cells lose their ability to behave as a specified, controlled and coordinated unit, a tumor is formed. Generally, a solid tumor is an abnormal mass of tissue that usually does not contain cysts or liquid areas (some brain tumors do have cysts and central necrotic areas filled with liquid). A single tumor may even have different populations of cells within it, with differing processes that have gone awry. Solid tumors may be benign (not cancerous), or malignant (cancerous). Different types of solid tumors are named for the type of cells that form them. Examples of solid tumors are sarcomas, carcinomas, and lymphomas. Leukemias (cancers of the blood) generally do not form solid tumors.
- Representative cancers include, but are not limited to, Acute Lymphoblastic Leukemia, Adult; Acute Lymphoblastic Leukemia, Childhood; Acute Myeloid Leukemia, Adult; Adrenocortical Carcinoma; Adrenocortical Carcinoma, Childhood; AIDS-Related Lymphoma; AIDS-Related Malignancies; Anal Cancer; Astrocytoma, Childhood Cerebellar; Astrocytoma, Childhood Cerebral; Bile Duct Cancer, Extrahepatic; Bladder Cancer; Bladder Cancer, Childhood; Bone Cancer, Osteosarcoma/Malignant Fibrous Histiocytoma; Glioblastoma, Childhood; Glioblastoma, Adult; Brain Stem Glioma, Childhood; Brain Tumor, Adult; Brain Tumor, Brain Stem Glioma, Childhood; Brain Tumor, Cerebellar Astrocytoma, Childhood; Brain Tumor, Cerebral Astrocytoma/Malignant Glioma, Childhood; Brain Tumor, Ependymoma, Childhood; Brain Tumor, Medulloblastoma, Childhood; Brain Tumor, Supratentorial Primitive Neuroectodermal Tumors, Childhood; Brain Tumor, Visual Pathway and Hypothalamic Glioma, Childhood; Brain Tumor, Childhood (Other); Breast Cancer; Breast Cancer and Pregnancy; Breast Cancer, Childhood; Breast Cancer, Male; Bronchial Adenomas/Carcinoids, Childhood: Carcinoid Tumor, Childhood; Carcinoid Tumor, Gastrointestinal; Carcinoma, Adrenocortical; Carcinoma, Islet Cell; Carcinoma of Unknown Primary; Central Nervous System Lymphoma, Primary; Cerebellar Astrocytoma, Childhood; Cerebral Astrocytoma/Malignant Glioma, Childhood; Cervical Cancer; Childhood Cancers; Chronic Lymphocytic Leukemia; Chronic Myelogenous Leukemia; Chronic Myeloproliferative Disorders; Clear Cell Sarcoma of Tendon Sheaths; Colon Cancer; Colorectal Cancer, Childhood; Cutaneous T-Cell Lymphoma; Endometrial Cancer; Ependymoma, Childhood; Epithelial Cancer, Ovarian; Esophageal Cancer; Esophageal Cancer, Childhood; Ewing's Family of Tumors; Extracranial Germ Cell Tumor, Childhood; Extragonadal Germ Cell Tumor; Extrahepatic Bile Duct Cancer; Eye Cancer, Intraocular Melanoma; Eye Cancer, Retinoblastoma; Gallbladder Cancer; Gastric (Stomach) Cancer; Gastric (Stomach) Cancer, Childhood; Gastrointestinal Carcinoid Tumor; Germ Cell Tumor, Extracranial, Childhood; Germ Cell Tumor, Extragonadal; Germ Cell Tumor, Ovarian; Gestational Trophoblastic Tumor; Glioma. Childhood Brain Stem; Glioma. Childhood Visual Pathway and Hypothalamic; Hairy Cell Leukemia; Head and Neck Cancer; Hepatocellular (Liver) Cancer, Adult (Primary); Hepatocellular (Liver) Cancer, Childhood (Primary); Hodgkin's Lymphoma, Adult; Hodgkin's Lymphoma, Childhood; Hodgkin's Lymphoma During Pregnancy; Hypopharyngeal Cancer; Hypothalamic and Visual Pathway Glioma, Childhood; Intraocular Melanoma; Islet Cell Carcinoma (Endocrine Pancreas); Kaposi's Sarcoma; Kidney Cancer; Laryngeal Cancer; Laryngeal Cancer, Childhood; Leukemia, Acute Lymphoblastic, Adult; Leukemia, Acute Lymphoblastic, Childhood; Leukemia, Acute Myeloid, Adult; Leukemia, Acute Myeloid, Childhood; Leukemia, Chronic Lymphocytic; Leukemia, Chronic Myelogenous; Leukemia, Hairy Cell; Lip and Oral Cavity Cancer; Liver Cancer, Adult (Primary); Liver Cancer, Childhood (Primary); Lung Cancer, Non-Small Cell; Lung Cancer, Small Cell; Lymphoblastic Leukemia, Adult Acute; Lymphoblastic Leukemia, Childhood Acute; Lymphocytic Leukemia, Chronic; Lymphoma, AIDS-Related; Lymphoma, Central Nervous System (Primary); Lymphoma, Cutaneous T-Cell; Lymphoma, Hodgkin's, Adult; Lymphoma, Hodgkin's; Childhood; Lymphoma, Hodgkin's During Pregnancy; Lymphoma, Non-Hodgkin's, Adult; Lymphoma, Non-Hodgkin's, Childhood; Lymphoma, Non-Hodgkin's During Pregnancy; Lymphoma, Primary Central Nervous System; Macroglobulinemia, Waldenstrom's; Male Breast Cancer; Malignant Mesothelioma, Adult; Malignant Mesothelioma, Childhood; Malignant Thymoma; Medulloblastoma, Childhood; Melanoma; Melanoma, Intraocular; Merkel Cell Carcinoma; Mesothelioma, Malignant; Metastatic Squamous Neck Cancer with Occult Primary; Multiple Endocrine Neoplasia Syndrome, Childhood; Multiple Myeloma/Plasma Cell Neoplasm; Mycosis Fungoides; Myelodysplastic Syndromes; Myelogenous Leukemia, Chronic; Myeloid Leukemia, Childhood Acute; Myeloma, Multiple; Myeloproliferative Disorders, Chronic; Nasal Cavity and Paranasal Sinus Cancer; Nasopharyngeal Cancer; Nasopharyngeal Cancer, Childhood; Neuroblastoma; Neurofibroma; Non-Hodgkin's Lymphoma, Adult; Non-Hodgkin's Lymphoma, Childhood; Non-Hodgkin's Lymphoma During Pregnancy; Non-Small Cell Lung Cancer; Oral Cancer, Childhood; Oral Cavity and Lip Cancer; Oropharyngeal Cancer; Osteosarcoma/Malignant Fibrous Histiocytoma of Bone; Ovarian Cancer, Childhood; Ovarian Epithelial Cancer; Ovarian Germ Cell Tumor; Ovarian Low Malignant Potential Tumor; Pancreatic Cancer; Pancreatic Cancer, Childhood', Pancreatic Cancer, Islet Cell; Paranasal Sinus and Nasal Cavity Cancer; Parathyroid Cancer; Penile Cancer; Pheochromocytoma; Pineal and Supratentorial Primitive Neuroectodermal Tumors, Childhood; Pituitary Tumor; Plasma Cell Neoplasm/Multiple Myeloma; Pleuropulmonary Blastoma; Pregnancy and Breast Cancer; Pregnancy and Hodgkin's Lymphoma; Pregnancy and Non-Hodgkin's Lymphoma; Primary Central Nervous System Lymphoma; Primary Liver Cancer, Adult; Primary Liver Cancer, Childhood; Prostate Cancer; Rectal Cancer; Renal Cell (Kidney) Cancer; Renal Cell Cancer, Childhood; Renal Pelvis and Ureter, Transitional Cell Cancer; Retinoblastoma; Rhabdomyosarcoma, Childhood; Salivary Gland Cancer; Salivary Gland' Cancer, Childhood; Sarcoma, Ewing's Family of Tumors; Sarcoma, Kaposi's; Sarcoma (Osteosarcoma)/Malignant Fibrous Histiocytoma of Bone; Sarcoma, Rhabdomyosarcoma, Childhood; Sarcoma, Soft Tissue, Adult; Sarcoma, Soft Tissue, Childhood; Sezary Syndrome; Skin Cancer; Skin Cancer, Childhood; Skin Cancer (Melanoma); Skin Carcinoma, Merkel Cell; Small Cell Lung Cancer; Small Intestine Cancer; Soft Tissue Sarcoma, Adult; Soft Tissue Sarcoma, Childhood; Squamous Neck Cancer with Occult Primary, Metastatic; Stomach (Gastric) Cancer; Stomach (Gastric) Cancer, Childhood; Supratentorial Primitive Neuroectodermal Tumors, Childhood; T-Cell Lymphoma, Cutaneous; Testicular Cancer; Thymoma, Childhood; Thymoma, Malignant; Thyroid Cancer; Thyroid Cancer, Childhood; Transitional Cell Cancer of the Renal Pelvis and Ureter; Trophoblastic Tumor, Gestational; Unknown Primary Site, Cancer of, Childhood; Unusual Cancers of Childhood; Ureter and Renal Pelvis, Transitional Cell Cancer; Urethral Cancer; Uterine Sarcoma; Vaginal Cancer; Visual Pathway and Hypothalamic Glioma, Childhood; Vulvar Cancer; Waldenstrom's Macro globulinemia; and Wilms' Tumor, among others.
- A tumor can be classified as malignant or benign. In both cases, there is an abnormal aggregation and proliferation of cells. In the case of a malignant tumor, these cells behave more aggressively, acquiring properties of increased invasiveness. Ultimately, the tumor cells may even gain the ability to break away from the microscopic environment in which they originated, spread to another area of the body (with a very different environment, not normally conducive to their growth), and continue their rapid growth and division in this new location. This is called metastasis. Once malignant cells have metastasized, achieving a cure is more difficult. Benign tumors have less of a tendency to invade and are less likely to metastasize.
- The term “reducing a tumor” as used herein refers to a reduction in the size or volume of a tumor mass, a decrease in the number of metastasized tumors in a subject, a decrease in the proliferative status (the degree to which the cancer cells are multiplying) of the cancer cells, and the like.
- The treatment regimens of the invention are particularly suited for treating solid tumors including but not limited to: lymphomas, melanoma, renal cell carcinoma (RCC), advanced solid tumors, tumors that have previously been treated with therapeutic therapy but remain refractory to previous therapies. Preferably, the treatment regimens of the invention are particularly suited for treating solid tumors including but not limited to: lymphomas, melanoma, renal cell carcinoma (RCC), hepatic cell carcinoma (HCC), non-small cell lung cancer (NSCLC), small cell lung cancer (SCLC), squamous cell carcinoma of the head and neck (SCCHN) and including advanced solid tumors and tumors that have previously been treated with anti-cancer therapy but remain refractory to previous therapies.
- Complementary Immunotherapies and other Combination Therapies
- While the fusion protein of SEQ ID NO: 1 may be used as a monotherapy in the treatment regimens in accordance with the invention, the combination of the fusion protein of SEQ ID NO: 1 with other anticancer treatments in the context of the invention is also contemplated. Other therapeutic treatment regimens include other therapeutic immunotherapies such as adoptive cell transfer regimens, antigen-specific vaccination, inhibition of DNA repair proteins (e.g. inhibitors of the nucleic enzyme poly(
adenosine 5′-diphospho-ribose) polymerase [“poly(ADP-ribose) polymerase” PARP inhibitors”) and blockade of immune checkpoint inhibitory molecules, for example cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) and programmed death 1 (PD-1) antibodies. - Immune checkpoint proteins regulate T cell function in the immune system. T cells play a central role in cell-mediated immunity. Immune checkpoint proteins interact with specific ligands that send a signal into the T cell and essentially switch off or inhibit T cell function. Cancer cells take advantage of this system by driving high levels of expression of immune checkpoint proteins on their surface that results in control of the T cells expressing immune checkpoint proteins on the surface of T cells that enter the tumor microenvironment, thus suppressing the anticancer immune response. As such, inhibition of immune checkpoint proteins by agents referred to herein as “immune checkpoint protein (ICP) inhibitors” would result in restoration of T cell function and an immune response to the cancer cells. Examples of immune checkpoint proteins include, but are not limited to: CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049,
CHK 1, CHK2, A2aR, OX40, B-7 family ligands or a combination thereof. Preferably, the immune checkpoint inhibitor interacts with a ligand of an immune checkpoint protein which may be CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049,CHK 1, CHK2, OX40, A2aR, B-7 family ligands or a combination thereof. Preferably, the immune checkpoint inhibitor is a biologic therapeutic or a small molecule. Preferably, the immune checkpoint inhibitor is a monoclonal antibody, a humanized antibody, a fully human antibody, a fusion protein or a combination thereof. Preferably, the PD1 immune checkpoint inhibitor comprises one or more anti-PD-1 antibodies, including nivolumab and pembrolizumab. - The combination therapy methods described herein include administering at least one immune checkpoint inhibitor in combination with the fusion protein of SEQ ID NO: 1. The invention is not limited to any specific immune checkpoint inhibitor so long as the immune checkpoint inhibitor inhibits one or more activities of the target immune checkpoint proteins when administered in an effective amount as monotherapy or in combination with the fusion protein of SEQ ID NO: 1. In some instances, due to, for example, synergistic effects, minimal inhibition of the immune checkpoint protein by the immune checkpoint inhibitor may be sufficient in the presence of SEQ ID NO: 1. Many immune checkpoint inhibitors are known in the art.
- Exemplary PD-1/PD-L1 based immune checkpoint inhibitors include antibody-based therapeutics. Exemplary treatment methods that employ PD-1/PD-L1 based immune checkpoint inhibition are described in U.S. Pat. Nos. 8,728,474 and 9,073,994, and EP Patent No. 1537878B1, and, for example, include the use of anti-PD-1 antibodies. Exemplary anti-PD-1 antibodies are described, for example, in U.S. Pat. Nos. 8,952,136, 8,779,105, 8,008,449, 8,741,295, 9,205,148, 9,181,342, 9,102,728, 9,102,727, 8,952,136, 8,927,697, 8,900,587, 8,735,553, and 7,488,802. Exemplary anti-PD-1 antibodies include, for example, nivolumab (OPDIVO®, Bristol-Myers Squibb Co.), pembrolizumab (KEYTRUDA®, Merck Sharp & Dohme Corp), PDR001 (Novartis Pharmaceuticals), and pidilizumab (CT-011, Cure Tech). Exemplary anti-PD-L1 antibodies are described, for example, in U.S. Pat. Nos. 9,273,135, 7,943,743, 9,175,082, 8,741,295, 8,552,154, and 8,217,149, Exemplary anti-PD-L1 antibodies include, for example, atezolizumab (TECENTRIQ®, Genentech), durvalumab (AstraZeneca), MEDI4736, avelumab, and BMS 936559 (Bristol Myers Squibb Co.).
- In certain embodiments, a method or composition described herein is administered in combination with a CTLA-4 inhibitor. In the CTLA-4 pathway, the interaction of CTLA-4 on a T-cell with its ligands (e.g., CD80, also known as B7-1, and CD86) on the surface of an antigen presenting cells (rather than cancer cells) leads to T-cell inhibition. Exemplary CTLA-4 based immune checkpoint inhibition methods are described in U.S. Pat. Nos. 5,811,097, 5,855,887, 6,051,227. Exemplary anti-CTLA-4 antibodies are described in U.S. Pat. Nos. 6,984,720, 6,682,736, 7,311,910, 7,307,064, 7,109,003, 7,132,281, 6,207,156, 7,807,797, 7,824,679, 8,143,379, 8,263,073, 8,318,916, 8,017,114, 8,784,815, and 8,883,984, International (PCT) Publication Nos. WO98/42752, WO00/37504, and WO01/14424, and European Patent No. EP 1212422 B1. Exemplary CTLA-4 antibodies include ipilimumab or tremelimumab.
- Preferably, a method or composition of the invention is administered in combination with (i) a PD-1 or PD-LI inhibitor, e.g., a PD-1 or PD-L1 inhibitor disclosed herein, and (ii) CTLA-4 inhibitor, e.g., a CTLA-4 inhibitor disclosed herein.
- Examples of FDA approved immune checkpoint protein inhibitors includes:
-
- ipilimumab (YERVOY®)
- pembrolizumab (KEYTRUDA®)
- atezolizumab (TECENTRIQ®)
- durvalumab (IMFINZ®)
- avelumab (BAVENCIO®)
- nivolumab (OPDIVO®).
- A preferred treatment regimen of the invention combines the fusion protein of SEQ ID NO: 1 administered in accordance with the invention with the immune checkpoint inhibitor, pembrolizumab. Preferably, pembrolizumab is administered on the first day of each treatment cycle of the treatment regimen according to the invention. Preferably 200 mg of pembrolizumab is administered in accordance with manufacturer's recommendations, generally once every three weeks or 21 days.
- Treatment regimens with the fusion protein of SEQ ID NO: 1 in accordance with the invention may also be combined with other therapeutic agents and/or anti-cancer agents in addition to, or instead of, immune checkpoint inhibitors. Preferably, the therapeutic agent and/or anti-cancer agent is an antibody. Preferably, the therapeutic agent is a therapeutic protein. Preferably, the therapeutic agent is a small molecule. Preferably the anticancer agent is an antigen. Preferably, the therapeutic agent is a population of cells. Preferably, the therapeutic agent is a therapeutic antibody. Preferably the therapeutic agent is another cytotoxic and/or chemotherapeutic agent. The term “cytotoxic agent” as used herein refers to a substance that inhibits or prevents a cellular function and/or causes cell death or destruction. Chemotherapeutic agent” includes chemical compounds useful in the treatment of cancer.
- Preferably the administration of SEQ ID NO: 1 may be combined with a therapeutic antibody. Methods of producing antibodies, and antigen-binding fragments thereof, are well known in the art and are disclosed in, e.g., U.S. Pat. No. 7,247,301, US2008/0138336, and U.S. Pat. No. 7,923,221, all of which are herein incorporated by reference in their entirety. Therapeutic antibodies that can be used in the methods of the present invention include, but are not limited to, any of the art-recognized therapeutic antibodies that are approved for use, in clinical trials, or in development for clinical use. In some embodiments, more than one therapeutic antibody can be included in the combination therapy of the present invention. Non-limiting examples of therapeutic antibodies include the following, without limitation:
-
- trastuzumab (HERCEPTIN™. by Genentech, South San Francisco, Calif.), which is used to treat HER-2/neu positive breast cancer or metastatic breast cancer;
- bevacizumab (AVASTIN™ by Genentech), which is used to treat colorectal cancer, metastatic colorectal cancer, breast cancer, metastatic breast cancer, non-small cell lung cancer, or renal cell carcinoma;
- rituximab (RITUXAN™ by Genentech), which is used to treat non-Hodgkin's lymphoma or chronic lymphocytic leukemia;
- pertuzumab (OMNITARG™ by Genentech), which is used to treat breast cancer, prostate cancer, non-small cell lung cancer, or ovarian cancer;
- cetuximab (ERBITUX™ by ImClone Systems Incorporated, New York, N.Y.), which can be used to treat colorectal cancer, metastatic colorectal cancer, lung cancer, head and neck cancer, colon cancer, breast cancer, prostate cancer, gastric cancer, ovarian cancer, brain cancer, pancreatic cancer, esophageal cancer, renal cell cancer, prostate cancer, cervical cancer, or bladder cancer;
- IMC-1C11 (ImClone Systems Incorporated), which is used to treat colorectal cancer, head and neck cancer, as well as other potential cancer targets;
- tositumomab and tositumomab and iodine I131 (BEXXAR™ by Corixa Corporation, Seattle, Wash.), which is used to treat non-Hodgkin's lymphoma, which can be CD20 positive, follicular, non-Hodgkin's lymphoma, with and without transformation, whose disease is refractory to Rituximab and has relapsed following chemotherapy;
- In111 ibirtumomab tiuxetan; Y90 ibirtumomab tiuxetan; I111 ibirtumomab tiuxetan and Y90 ibirtumomab tiuxetan (ZEVALIN™ by Biogen Idec, Cambridge, Mass.), which is used to treat lymphoma or non-Hodgkin's lymphoma, which can include relapsed follicular lymphoma; relapsed or refractory, low grade or follicular non-Hodgkin's lymphoma; or transformed B-cell non-Hodgkin's lymphoma;
- EMD 7200 (EMD Pharmaceuticals, Durham, N.C.), which is used for treating for treating non-small cell lung cancer or cervical cancer;
- SGN-30 (a genetically engineered monoclonal antibody targeted to CD30 antigen by Seattle Genetics, Bothell, Wash.), which is used for treating Hodgkin's lymphoma or non-Hodgkin's lymphoma;
- SGN-15 (a genetically engineered monoclonal antibody targeted to a Lewisy-related antigen that is conjugated to doxorubicin by Seattle Genetics), which is used for treating non-small cell lung cancer;
- SGN-33 (a humanized antibody targeted to CD33 antigen by Seattle Genetics), which is used for treating acute myeloid leukemia (AML) and myelodysplastic syndromes (MDS);
- SGN-40 (a humanized monoclonal antibody targeted to CD40 antigen by Seattle Genetics), which is used for treating multiple myeloma or non-Hodgkin's lymphoma;
- SGN-35 (a genetically engineered monoclonal antibody targeted to a CD30 antigen that is conjugated to auristatin E by Seattle Genetics), which is used for treating non-Hodgkin's lymphoma;
- SGN-70 (a humanized antibody targeted to CD70 antigen by Seattle Genetics), that is used for treating renal cancer and nasopharyngeal carcinoma;
- SGN-75 (a conjugate comprised of the SGN70 antibody and an Auristatin derivative by Seattle Genetics); and
- SGN-17/19 (a fusion protein containing antibody and enzyme conjugated to melphalan prodrug by Seattle Genetics), which is used for treating melanoma or metastatic melanoma.
- The therapeutic antibodies to be used in the methods of the present invention are not limited to those described herein. For example, the following approved therapeutic antibodies can also be used in the methods of the invention: brentuximab vedotin (ADCETRIS™) for anaplastic large cell lymphoma and Hodgkin lymphoma, ipilimumab (MDX-101; YERVOY™) for melanoma, ofatumumab (ARZERRA™) for chronic lymphocytic leukemia, panitumumab (VECTIBIX™) for colorectal cancer, alemtuzumab (CAMPATH™) for chronic lymphocytic leukemia, ofatumumab (ARZERRA™) for chronic lymphocytic leukemia, gemtuzumab ozogamicin (MYLOTARG™) for acute myelogenous leukemia.
- Antibodies for use in accordance with the invention can also target molecules expressed by immune cells, such as, but not limited to, tremelimumab (CP-675,206) and ipilimumab (MDX-010) which targets CTLA4 and has the effect of tumor rejection, protection from re-challenge, and enhanced tumor-specific T cell responses; OX86 which targets OX40 and increases antigen-specific CD8+ T cells at tumor sites and enhances tumor rejection; CT-011 which targets
PD 1 and has the effect of maintaining and expanding tumor specific memory T cells and activates NK cells; BMS-663513 which targets CD137 and causes regression of established tumors, as well as the expansion and maintenance of CD8+ T cells, and daclizumab (ZENAPAX™) which targets CD25 and causes transient depletion of CD4+CD25+FOXP3+Tregs and enhances tumor regression and increases the number of effector T cells. A more detailed discussion of these antibodies can be found in, e.g., Weiner et al., Nature Rev. Immunol 2010; 10:317-27. - Preferably, the antibody is a pro-inflammatory and/or pro-tumorigenic cytokine targeting antibody including, but not limited to, anti-TNF antibodies, anti-IL-1Ra receptor targeting antibodies, anti-IL-1 antibodies, anti-IL-6 receptor antibodies, and anti-IL-6 antibodies. Preferably antibodies include those that target pro-inflammatory T helper type 17 cells (TH17).
- The therapeutic antibody can be a fragment of an antibody; a complex comprising an antibody; or a conjugate comprising an antibody. The antibody can optionally be chimeric or humanized or fully human.
- Preferably the methods of the invention include administration of the fusion protein of SEQ ID NO: 1 in accordance with the treatment regimen of the invention in combination with a therapeutic protein or peptide. Therapeutic proteins that are effective in treating cancer are well known in the art. Preferably, the therapeutic polypeptide or protein is a “suicide protein” that causes cell death by itself or in the presence of other compounds.
- A representative example of such a suicide protein is thymidine kinase of the herpes simplex virus. Additional examples include thymidine kinase of varicella zoster virus, the bacterial gene cytosine deaminase (which converts 5-fluorocytosine to the highly toxic compound 5-fluorouracil), p450 oxidoreductase, carboxypeptidase G2, beta-glucuronidase, penicillin-V-amidase, penicillin-G-amidase, beta-lactamase, nitroreductase, carboxypeptidase A, linamarase (also referred to as β-glucosidase), the E. coli gpt gene, and the E. coli Deo gene, although others are known in the art. In some embodiments, the suicide protein converts a prodrug into a toxic compound.
- As used herein, “prodrug” means any compound useful in the methods of the present invention that can be converted to a toxic product, i.e. toxic to tumor cells. The prodrug is converted to a toxic product by the suicide protein. Representative examples of such prodrugs include: ganciclovir, acyclovir, and FIAU (1-(2-deoxy-2-fluoro-β-D-arabinofuranosyl)-5-iod-ouracil) for thymidine kinase; ifosfamide for oxidoreductase; 6-methoxypurine arabinoside for VZV-TK; 5-fluorocytosine for cytosine deaminase; doxorubicin for beta-glucuronidase; CB 1954 and nitrofurazone for nitroreductase; and N-(Cyanoacetyl)-L-phenylalanine or N-(3-chloropropionyl)-L-phenylalanine for carboxypeptidase A. The prodrug may be administered readily by a person having ordinary skill in this art. A person with ordinary skill would readily be able to determine the most appropriate dose and route for the administration of the prodrug.
- Preferably the therapeutic protein or polypeptide, is a cancer suppressor, for example p53 or Rb, or a nude acid encoding such a protein or polypeptide. Those of skill know of a wide variety of such cancer suppressors and how to obtain them and/or the nucleic acids encoding them.
- Other examples of anti-cancer/therapeutic proteins or polypeptides include pro-apoptotic therapeutic proteins and polypeptides, for example, p15, p16, or p21WAF-1.
- Cytokines, and nucleic acid encoding them may also be used as therapeutic proteins and polypeptides. Examples include: GM-CSF (granulocyte macrophage colony stimulating factor); TNF-alpha (Tumor necrosis factor alpha); Interferons including, but not limited to, IFN-alpha and IFN-gamma; and Interleukins including, but not limited to, Interleukin-1 (IL-1), Interleukin-Beta (IL-beta), Interleukin-2 (IL-2), Interleukin-4 (IL-4), Interleukin-5 (IL-5), Interleukin-6 (IL-6), Interleukin-7 (IL-7), Interleukin-8 (IL-8), Interleukin-10 (IL-10), Interleukin-12 (IL-12), Interleukin-13 (IL-13), Interleukin-14 (IL-14), Interleukin-15 (IL-15), Interleukin-16 (IL-16), Interleukin-18 (IL-18), Interleukin-23 (IL-23), Interleukin-24 (IL-24), although other embodiments are known in the art.
- Additional examples of cytocidal genes includes, but is not limited to, mutated cyclin G1 genes. By way of example, the cytocidal gene may be a dominant negative mutation of the cyclin G1 protein (e.g., WO/01/64870).
- Preferably, the therapeutic regimens of the invention include administration of a fusion protein of SEQ ID NO: 1 in combination with administration of a cancer vaccine for stimulating a cancer specific-immune response, e.g., innate and adaptive immune responses, for generating host immunity against a cancer (see, e.g., Overwijk, et al. Journal of Experimental Medicine 2008; 198:569-80). Illustrative vaccines include, but are not limited to, for example, antigen vaccines, whole cell vaccines, dendritic cell vaccines, and DNA vaccines. Depending upon the particular type of vaccine, the vaccine composition may include one or more suitable adjuvants known to enhance a subject's immune response to the vaccine.
- The vaccine may, for example, be cellular based, i.e., created using cells from the patient's own cancer cells to identify and obtain an antigen. Exemplary vaccines include tumor cell-based and dendritic-cell based vaccines, where activated immune cells from the subject are delivered back to the same subject, along with other proteins, to further facilitate immune activation of these tumor antigen primed immune cells. Tumor cell-based vaccines include whole tumor cells and gene-modified tumor cells. Whole tumor cell vaccines may optionally be processed to enhance antigen presentation, e.g., by irradiation of either the tumor cells or tumor lysates). Vaccine administration may also be accompanied by adjuvants such as bacillus calmette-guerin (BCG) or keyhole limpet hemocyanin (KLH), depending upon the type of vaccine employed. Plasmid DNA vaccines may also be used and can be administered via direct injection or biolistically. Also contemplated for use are peptide vaccines, viral gene transfer vector vaccines, and antigen-modified dentritic cells (DCs).
- Preferably the vaccine is a therapeutic cancer peptide-based vaccine. Peptide vaccines can be created using known sequences or from isolated antigens from a subject's own tumor(s) and include neoantigens and modified antigens. Illustrative antigen-based vaccines include those where the antigen is a tumor-specific antigen. For example, the tumor-specific antigen may be selected from a cancer-testis antigen, a differentiation antigen, and a widely occurring over-expressed tumor associated antigen, among others. Recombinant peptide vaccines, based on peptides from tumor-associated antigens, when used in the instant method, may be administered or formulated with, an adjuvant or immune modulator. Illustrative antigens for use in a peptide-based vaccine include, but are not limited to, the following, since this list is meant to be purely illustrative. For example, a peptide vaccine may comprise a cancer-testis antigen such as MAGE, BAGE, NY-ESO-1 and SSX-2, encoded by genes that are normally silenced in adult tissues but transcriptionally reactivated in tumor cells. Alternatively, the peptide vaccine may comprise a tissue differentiation associated antigen, i.e., an antigen of normal tissue origin and shared by both normal and tumorous tissue. For example, the vaccine may comprise a melanoma-associated antigen such as gp100, Melan-A/Mart-1, MAGE-3, or tyrosinase; or may comprise a prostate cancer antigen such as PSA or PAP. The vaccine may comprise a breast cancer-associated antigen such as mammaglobin-A. Other tumor antigens that may be comprised in a vaccine for use in the instant method include, for example, CEA, MUC-1, HER1/Nue, hTERT, ras, and B-raf. Other suitable antigens that may be used in a vaccine include SOX-2 and OCT-4, associated with cancer stem cells or the EMT process.
- Antigen vaccines include multi-antigen and single antigen vaccines. Exemplary cancer antigens may include peptides having from about 5 to about 30 amino acids, or from about 6 to 25 amino acids, or from about 8 to 20 amino acids.
- As described above, an immunostimulatory adjuvant (different from RSLAIL-2) may be used in a vaccine, in particular, a tumor-associated antigen-based vaccine, to assist in generating an effective immune response. For example, a vaccine may incorporate a pathogen-associated molecular pattern (PAMP) to assist in improving immunity. Additional suitable adjuvants include monophosphoryl lipid A, or other lipopolysaccharides; toll-like receptor (TLR) agonists such as, for example, imiquimod, resiquimod (R-848), TLR3, IMO-8400, and rintatolimod. Additional adjuvants suitable for use include heat shock proteins.
- A genetic vaccine typically uses viral or plasmid DNA vectors carrying expression cassettes. Upon administration, they transfect somatic cells or dendritic cells as part of the inflammatory response to thereby result in cross-priming or direct antigen presentation. Preferably, a genetic vaccine is one that provides delivery of multiple antigens in one immunization. Genetic vaccines include DNA vaccines, RNA vaccines and viral-based vaccines.
- DNA vaccines for use in the instant methods are bacterial plasmids that are constructed to deliver and express tumor antigen. DNA vaccines may be administered by any suitable mode of administration, e.g., subcantaneous or intradermal injection, but may also be injected directly into the lymph nodes. Additional modes of delivery include, for example, gene gun, electroporation, ultrasound, laser, liposomes, microparticles and nanoparticles.
- Preferably, the vaccine comprises a neoantigen, or multiple neoantigens. Preferably, the vaccine is a neoantigen-based vaccine. Preferably a neoantigen-based vaccine (NBV) composition may encode multiple cancer neoantigens in tandem, where each neoantigen is a polypeptide fragment derived from a protein mutated in cancer cells. For instance, a neoantigenic vaccine may comprise a first vector comprising a nucleic acid construct encoding multiple immunogenic polypeptide fragments, each of a protein mutated in cancer cells, where each immunogenic polypeptide fragment comprises one or more mutated amino acids flanked by a variable number of wild type amino acids from the original protein, and each polypeptide fragment is joined head-to-tail to form an immunogenic polypeptide. The lengths of each of the immunogenic polypeptide fragments forming the immunogenic polypeptide can vary.
- Viral gene transfer vector vaccines may also be used; in such vaccines, recombinant engineered virus, yeast, bacteria or the like is used to introduce cancer-specific proteins to the patient's immune cells. In a vector-based approach, which can be tumor lytic or non-tumor lytic, the vector can increase the efficiency of the vaccine due to, for example, its inherent immunostimulatory properties. Illustrative viral-based vectors include those from the poxviridae family, such as vaccinia, modified vaccinia strain Ankara and avipoxviruses. Also suitable for use is the cancer vaccine, PROSTVAC, containing a replication-competent vaccinia priming vector and a replication-incompetent fowlbox-boosting vector. Each vector contains transgenes for PSA and three co-stimulatory molecules, CD80, CD54 and CD58, collectively referred to as TRICOM. Other suitable vector-based cancer vaccines include Trovax and TG4010 (encoding MUC1 antigen and IL-2). Additional vaccines for use include bacteria and yeast-based vaccines such as recombinant Listeria monocytogenes and Saccharomyces cerevisae.
- The foregoing vaccines may be combined and/or formulated with adjuvants and other immune boosters to increase efficacy. Depending upon the particular vaccine, administration may be either intratumoral or non-intratumoral (i.e., systemic).
- Other cancer antigens that can be used in vaccinations include, but are not limited to, (i) tumor-specific antigens, (ii) tumor-associated antigens, (iii) cells that express tumor-specific antigens, (iv) cells that express tumor-associated antigens, (v) embryonic antigens on tumors, (vi) autologous tumor cells, (vii) tumor-specific membrane antigens, (viii) tumor-associated membrane antigens, (ix) growth factor receptors, (x) growth factor ligands, and (xi) any other type of antigen or antigen-presenting cell or material that is associated with a cancer.
- The cancer antigen may be an epithelial cancer antigen, (e.g., breast, gastrointestinal, lung), a prostate specific cancer antigen (PSA) or prostate specific membrane antigen (PSMA), a bladder cancer antigen, a lung (e.g., small cell lung) cancer antigen, a colon cancer antigen, an ovarian cancer antigen, a brain cancer antigen, a gastric cancer antigen, a renal cell carcinoma antigen, a pancreatic cancer antigen, a liver cancer antigen, an esophageal cancer antigen, a head and neck cancer antigen, or a colorectal cancer antigen.
- In another embodiment, the cancer antigen is a lymphoma antigen (e.g., non-Hodgkin's lymphoma or Hodgkin's lymphoma), a B-cell lymphoma cancer antigen, a leukemia antigen, a myeloma (i.e., multiple myeloma or plasma cell myeloma) antigen, an acute lymphoblastic leukemia antigen, a chronic myeloid leukemia antigen, or an acute myelogenous leukemia antigen. The described cancer antigens are only exemplary, and that any cancer antigen can be targeted in the present invention.
- Preferably, the cancer antigen is a mucin-1 protein or peptide (MUC-1) that is found on all human adenocarcinomas: pancreas, colon, breast, ovarian, lung, prostate, head and neck, including multiple myelomas and some B cell lymphomas. Patients with inflammatory bowel disease, either Crohn's disease or ulcerative colitis, are at an increased risk for developing colorectal carcinoma. MUC-1 is a type I transmembrane glycoprotein. The major extracellular portion of MUC-1 has a large number of tandem repeats consisting of 20 amino acids which comprise immunogenic epitopes. In some cancers it is exposed in an unglycosylated form that is recognized by the immune system (Gendler et al., J Biol Chem 1990; 265:15286-15293).
- In another embodiment, the cancer antigen is a mutated B-Raf antigen, which is associated with melanoma and colon cancer. The vast majority of these mutations represent a single nucleotide change of T-A at nucleotide 1796 resulting in a valine to glutamic acid change at residue 599 within the activation segment of B-Raf. Raf proteins are also indirectly associated with cancer as effectors of activated Ras proteins, oncogenic forms of which are present in approximately one-third of all human cancers. Normal non-mutated B-Raf is involved in cell signaling, relaying signals from the cell membrane to the nucleus. The protein is usually only active when needed to relay signals. In contrast, mutant B-Raf has been reported to be constantly active, disrupting the signaling relay (Mercer and Pritchard, Biochim Biophys Acta (2003) 1653(1):25-40; Sharkey et al., Cancer Res. (2004) 64(5):1595-1599).
- Preferably, the cancer antigen is a human epidermal growth factor receptor-2 (HER-2/neu) antigen. Cancers that have cells that overexpress HER-2/neu are referred to as HER-2/neu+ cancers. Exemplary HER-2/neu+ cancers include prostate cancer, lung cancer, breast cancer, ovarian cancer, pancreatic cancer, skin cancer, liver cancer (e.g., hepatocellular adenocarcinoma), intestinal cancer, and bladder cancer.
- HER-2/neu has an extracellular binding domain (ECD) of approximately 645 aa, with 40% homology to epidermal growth factor receptor (EGFR), a highly hydrophobic transmembrane anchor domain (TMD), and a carboxyterminal intracellular domain (ICD) of approximately 580 aa with 80% homology to EGFR. The nucleotide sequence of HER-2/neu is available at GENBANK™. Accession Nos. AH002823 (human HER-2 gene, promoter region and exon 1); M16792 (human HER-2 gene, exon 4): M16791 (human HER-2 gene, exon 3); M16790 (human HER-2 gene, exon 2); and M16789 (human HER-2 gene, promoter region and exon 1). The amino acid sequence for the HER-2/neu protein is available at GENBANK™ Accession No. AAA58637. Based on these sequences, one skilled in the art could develop HER-2/neu antigens using known assays to find appropriate epitopes that generate an effective immune response.
- Exemplary HER-2/neu antigens include p369-377 (a HER-2/neu derived HLA-A2 peptide); dHER2 (Corixa Corporation); li-Key MHC class II epitope hybrid (Generex Biotechnology Corporation); peptide P4 (amino acids 378-398); peptide P7 (amino acids 610-623); mixture of peptides P6 (amino acids 544-560) and P7; mixture of peptides P4, P6 and P7; HER2 [9754]; and the like.
- Preferably, the cancer antigen is an epidermal growth factor receptor (EGFR) antigen. The EGFR antigen can be an
EGFR variant 1 antigen, anEGFR variant 2 antigen, anEGFR variant 3 antigen and/or anEGFR variant 4 antigen. Cancers with cells that overexpress EGFR are referred to as EGFR cancers. Exemplary EGFR cancers include lung cancer, head and neck cancer, colon cancer, colorectal cancer, breast cancer, prostate cancer, gastric cancer, ovarian cancer, brain cancer and bladder cancer. - Preferably, the cancer antigen is a vascular endothelial growth factor receptor (VEGFR) antigen. VEGFR is considered to be a regulator of cancer-induced angiogenesis. Cancers with cells that overexpress VEGFR are called VEGFR+ cancers. Exemplary VEGFR+ cancers include breast cancer, lung cancer, small cell lung cancer, colon cancer, colorectal cancer, renal cancer, leukemia, and lymphocytic leukemia.
- Preferably, the cancer antigen is prostate-specific antigen (PSA) and/or prostate-specific membrane antigen (PSMA) that are prevalently expressed in androgen-independent prostate cancers.
- Preferably, the cancer antigen is Gp-100 Glycoprotein 100 (gp 100) is a tumor-specific antigen associated with melanoma.
- Preferably, the cancer antigen is a carcinoembryonic (CEA) antigen. Cancers with cells that overexpress CEA are referred to as CEA+ cancers. Exemplary CEA+ cancers include colorectal cancer, gastric cancer and pancreatic cancer. Exemplary CEA antigens include CAP-1 (i.e., CEA aa 571-579), CAP1-6D, CAP-2 (i.e., CEA aa 555-579), CAP-3 (i.e., CEA aa 87-89), CAP-4 (CEA aa 1-11), CAP-5 (i.e., CEA aa 345-354), CAP-6 (i.e., CEA aa 19-28) and CAP-7.
- Preferably, the cancer antigen is carbohydrate antigen 10.9 (CA 19.9). CA 19.9 is an oligosaccharide related to the Lewis A blood group substance and is associated with colorectal cancers.
- Preferably, the cancer antigen is a melanoma cancer antigen. Melanoma cancer antigens are useful for treating melanoma. Exemplary melanoma cancer antigens include MART-1 (e.g., MART-1 26-35 peptide, MART-1 27-35 peptide); MART-1/Mel an A; pMel17; pMel17/gp100; gp100 (e.g.,
gp 100 peptide 280-288,gp 100 peptide 154-162,gp 100 peptide 457-467); TRP-1; TRP-2; NY-ESO-1; p16; beta-catenin; mum-1; and the like. - Preferably, the cancer antigen is a mutant or wild type ras peptide. The mutant ras peptide can be a mutant K-ras peptide, a mutant N-ras peptide and/or a mutant H-ras peptide. Mutations in the ras protein typically occur at positions 12 (e.g., arginine or valine substituted for glycine), 13 (e.g., asparagine for glycine), 61 (e.g., glutamine to leucine) and/or 59. Mutant ras peptides can be useful as lung cancer antigens, gastrointestinal cancer antigens, hepatoma antigens, myeloid cancer antigens (e.g., acute leukemia, myelodysplasia), skin cancer antigens (e.g., melanoma, basal cell, squamous cell), bladder cancer antigens, colon cancer antigens, colorectal cancer antigens, and renal cell cancer antigens.
- In another embodiment of the invention, the cancer antigen is a mutant and/or wildtype p53 peptide. The p53 peptide can be used as colon cancer antigens, lung cancer antigens, breast cancer antigens, hepatocellular carcinoma cancer antigens, lymphoma cancer antigens, prostate cancer antigens, thyroid cancer antigens, bladder cancer antigens, pancreatic cancer antigens and ovarian cancer antigens.
- The cancer antigen can be a cell, a protein, a peptide, a fusion protein, DNA encoding a peptide or protein, RNA encoding a peptide or protein, a glycoprotein, a lipoprotein, a phosphoprotein, a carbohydrate, a lipopolysaccharide, a lipid, a chemically linked combination of two or more thereof, a fusion or two or more thereof, or a mixture of two or more thereof, or a virus encoding two or more thereof, or an oncolytic virus encoding two or more thereof. In another embodiment, the cancer antigen is a peptide comprising about 6 to about 24 amino acids; from about 8 to about 20 amino acids; from about 8 to about 12 amino acids; from about 8 to about 10 amino acids; or from about 12 to about 20 amino acids. In one embodiment, the cancer antigen is a peptide having a MHC Class I binding motif or a MHC Class II binding motif. In another embodiment, the cancer antigen comprises a peptide that corresponds to one or more cytotoxic T lymphocyte (CTL) epitopes.
- Preferably, the methods of the invention include administration of the fusion protein of SEQ ID NO: 1 in combination with administration of a therapeutic cell therapy. Cell therapies that are useful for treating cancer are well known and are disclosed in, e.g., U.S. Pat. No. 7,402,431. In a preferred embodiment, the cell therapy is T cell transplant. In a preferred method, T cells are expanded ex vivo with IL-2 prior to transplantation into a subject. Methods for cell therapies are disclosed in, e.g., U.S. Pat. No. 7,402,431, US2006/0057121, U.S. Pat. Nos. 5,126,132, 6,255,073, 5,846,827, 6,251,385, 6,194,207, 5,443,983, 6,040,177, 5,766,920, and US2008/0279836.
- Preferably, the therapeutic regimens of the invention include administration of a fusion protein of SEQ ID NO: 1 in further combination with radiation therapy. The term “radiation therapy” may be used interchangeably with the term “radiotherapy”, is a type of cancer treatment that uses beams of intense energy to kill cancer cells. Radiation therapy most often uses X-rays, but gamma rays, electron beams, or protons also can be used. The term “radiation therapy” most often refers to external beam radiation therapy. During this type of radiation, the high-energy beams come from a machine outside of the patient's body that aims the beams at a precise point on the body. Each session is quick and painless, lasting about 15 minutes. As used herein, the term “session” or “session of treatment” refers to each radiotherapy treatment. A radiation therapy “regimen” or “schedule” usually consists of a specific number of treatments given over a set period of time, depending on the type and the stage of the cancer.
- Preferably, the therapeutic regimens of the invention include administration of a fusion protein of SEQ ID NO: 1 in combination with administration of an anticancer small molecule.
- Small molecules that are effective in treating cancer are well known in the art and include antagonists of factors that are involved in tumor growth, such as EGFR, ErbB2 (also known as Her2) ErbB3, ErbB4, or TNF. Non-limiting examples include small molecule receptor tyrosine kinase inhibitors (RTKIs) that target one or more tyrosine kinase receptors, such as VEGF receptors, FGF receptors, EGF receptors and PDGF receptors.
- Many therapeutic small molecule RTKIs are known in the art, including, but are not limited to, vatalanib (PTK787), erlotinib (TARCEVA™), OSI-7904, ZD6474 (ZACTIMA™), ZD6126 (ANG453), ZD1839, sunitinib (SUTENT™), semaxanib (SU5416), AMG706, AG013736, Imatinib (GLEEVEC™), MLN-518, CEP-701, PKC-412, Lapatinib (GSK572016), VELCADE™, AZD2171, sorafenib (NEXAVAR™), XL880, and CHIR-265. Small molecule protein tyrosine phosphatase inhibitors, such as those disclosed in Jiang et al., Cancer Metastasis Rev. 2008; 27:263-72 are also useful for practicing the methods of the invention. Such inhibitors can target, e.g., HSP2, PRL, PTP1B, or Cdc25 phosphatases.
- Small molecules that target Bcl-2/Bcl-XL, such as those disclosed in US2008/0058322, are also useful for practicing the methods of the present invention. Further exemplary small molecules for use in the present invention are disclosed in Zhang et al. Nature Reviews: Cancer 2009; 9:28-39. In particular, chemotherapeutic agents that lead to immunogenic cell death such as anthracyclins (Kepp et al., Cancer and Metastasis Reviews 2011; 30:61-9) will be well suited for synergistic effects with extended-PK IL-2.
- Preferably, the methods of the invention include administration of the fusion protein of SEQ ID NO: 1 in combination with administration with chemotherapeutic agents including but not limited to, alkylating agents, antitumor antibiotics, antimetabolic agents, other anti-tumor antibiotics, and plant derived agents.
- Alkylating agents are drugs which impair cell function by forming covalent bonds with amino, carboxyl, sulfhydryl and phosphate groups in biologically important molecules. The most important sites of alkylation are DNA, RNA and proteins. Alkylating agents depend on cell proliferation for activity but are not cell-cycle-phase-specific. Alkylating agents suitable for use in the present invention include, but are not limited to, bischloroethylamines (nitrogen mustards, e.g. chlorambucil, cyclophosphamide, ifosfamide, mechlorethamine, melphalan, uracil mustard), aziridines (e.g. thiotepa), alkyl alkone sulfonates (e.g. busulfan), nitroso-ureas (e. g. BCNU, carmustine, lomustine, streptozocin), nonclassic alkylating agents (e.g., altretamine, dacarbazine, and procarbazine), and platinum compounds (e.g., carboplastin, oxaliplatin and cisplatin).
- Antitumor antibiotics like adriamycin intercalate DNA at guanine-cytosine and guanine-thymine sequences, resulting in spontaneous oxidation and formation of free oxygen radicals that cause strand breakage. Other antibiotic agents suitable for use in the present invention include, but are not limited to, anthracyclines (e. g. doxorubicin, daunorubicin, epirubicin, idarubicin and anthracenedione), mitomycin C, bleomycin, dactinomycin, and plicatomycin.
- Antimetabolic agents suitable for use in the present invention include but are not limited to, floxuridine, fluorouracil, methotrexate, leucovorin, hydroxyurea, thioguanine, mercaptopurine, cytarabine, pentostatin, fludarabine phosphate, cladribine, asparaginase, and gemcitabine.
- Plant derived agents include taxanes, which are semisynthetic derivatives of extracted precursors from the needles of yew plants. These drugs have a novel 14-member ring, the taxane. Unlike the vinca alkaloids, which cause microtubular disassembly, the taxanes (e.g., taxol) promote microtubular assembly and stability, therefore blocking the cell cycle in mitosis. Other plant derived agents include, but are not limited to, vincristine, vinblastine, vindesine, vinzolidine, vinorelbine, etoposide, teniposide, and docetaxel.
- Preferably, the fusion protein of SEQ ID NO: 1 is administered together (simultaneously or sequentially) with one or more additional therapeutic agents or other therapeutic agents, such as a therapeutic antibody. Preferably, the fusion protein of SEQ ID NO: 1 is administered prior to the administration of one or more therapeutic agents, such as a therapeutic antibody. Preferably, the fusion protein of SEQ ID NO: 1 is administered concurrent with the administration of one or more therapeutic agents, such as a therapeutic antibody. Preferably, the fusion protein of SEQ ID NO: 1 is administered subsequent to the administration of one or more therapeutic agents, such as a therapeutic antibody. Preferably, the SEQ ID NO: 1 and one or more therapeutic agents, such as a therapeutic antibody, are administered simultaneously. In other embodiments, the and one or more therapeutic agents, such as a therapeutic antibody, are administered sequentially. Preferably, the fusion protein of SEQ ID NO: 1 and one or more therapeutic agents, such as a therapeutic antibody, are administered within one, two, or three days of each other.
- The one or more therapeutic agents may be those that serve as adjunctive therapy for cancer, such as cytokines, chemotherapeutic agents, small molecules, antigens, or therapeutic antibodies, and are well known in the art and discussed supra. Additional non-limiting examples of additional agents include GM-CSF (expands monocyte and neutrophil population), IL-7 (important for generation and survival of memory T-cells), interferon alpha, tumor necrosis factor alpha, IL-12, and therapeutic antibodies, such as anti-PD-1, anti-PD-L, anti-CTLA4, anti-CD40, anti-OX40, and anti-CD137, PARP inhibitors, antibodies. In some embodiments, the subject receives the fusion protein of SEQ ID NO: 1 and one or more therapeutic agents during a same period of prevention, occurrence of a disorder, and/or period of treatment.
- Preferably, the invention provides for separate pharmaceutical compositions comprising the fusion protein of SEQ ID NO: 1 with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant and another pharmaceutical composition comprising one or more therapeutic agents, such as a therapeutic antibody, with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
- Preferably, the invention provides for pharmaceutical compositions comprising the fusion protein of SEQ ID NO: 1 and one or more therapeutic or anti-cancer agents in the same composition, together with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
- Also provided are kits comprising a fusion protein of SEQ ID NO: 1 formulated for SC administration, and optionally any other chemotherapeutic or anti-cancer agent. The kits are generally in the form of a physical structure housing various components, as described below, and can be utilized, for example, in practicing the methods described above. A kit can include the fusion protein of SEQ ID NO: 1 (provided in, e.g., a sterile container), which can be in the form of a pharmaceutical composition suitable for administration to a subject. The pharmaceutical composition can be provided in a form that is ready for use or in a form requiring, for example, reconstitution or dilution prior to administration. When the compositions are in a form that needs to be reconstituted by a user, the kit can also include buffers, pharmaceutically acceptable excipients, and the like, packaged with or separately from the fusion protein of SEQ ID NO: 1. When combination therapy (e.g., the fusion protein of SEQ ID NO: 1 and an immune checkpoint inhibitor(s) is contemplated, the kit can contain the several agents separately or they can already be combined in the kit. Similarly, when additional complementary therapy is required (e.g., a fusion protein of SEQ ID NO: 1, an immune checkpoint inhibitor(s), and an additional complementary therapy or agent) the kit can contain the several agents separately or two or more of them can already be combined in the kit.
- A kit of the invention can be designed for conditions necessary to properly maintain the components housed therein (e.g., refrigeration or freezing). A kit can contain a label or packaging insert including identifying information for the components therein and instructions for their use (e.g., dosing parameters, clinical pharmacology of the active ingredient(s), including mechanism(s) of action, pharmacokinetics and pharmacodynamics, adverse effects, contraindications, etc.).
- Each component of the kit can be enclosed within an individual container, and all of the various containers can be within a single package. Labels or inserts can include manufacturer information such as lot numbers and expiration dates. The label or packaging insert can be, e.g., integrated into the physical structure housing the components, contained separately within the physical structure, or affixed to a component of the kit (e.g., an ampule, syringe or vial).
- Labels or inserts can additionally include, or be incorporated into, a computer readable medium, such as a disk (e.g., hard disk, card, memory disk), optical disk such as CD- or DVD-ROM/RAM, DVD, MP3, magnetic tape, or an electrical storage media such as RAM and ROM or hybrids of these such as magnetic/optical storage media, FLASH media or memory-type cards. In some embodiments, the actual instructions are not present in the kit, but means for obtaining the instructions from a remote source, e.g., via an internet site, are provided.
- Where ranges are given, endpoints are included. Furthermore, it is to be understood that unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or subrange within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.
- In addition, it is to be understood that any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the claims. Since such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein.
- Any particular embodiment of the compositions of the invention; any method of production; any method of use can be excluded from any one or more claims, for any reason, whether or not related to the existence of prior art.
- The Fusion Protein of SEQ ID NO: 1 is a fusion of circularly permuted IL-2 and IL-2 Receptor a (IL-2Rα) designed to selectively activate the intermediate-affinity IL-2R, comprised of IL-2Rβ and γ, for activation of cytotoxic CD8+ T cells and NK cells. The intermediate-affinity IL-2R is expressed predominantly on effector lymphocytes, which play an important role in driving antitumor immune responses. Wild-type IL-2 activates the high-affinity IL-2R, comprised of IL-2Rα, β, and γc, driving the expansion of immunosuppressive CD4+ regulatory T (Treg) cells at concentrations below those at which intermediate-affinity IL-2R-bearing effector cells are activated. Selective activation of the intermediate affinity IL-2R has the potential to enhance tumor killing and was shown to possess enhanced antitumor activity relative to IL-2 in murine models.
- The fusion protein of SEQ ID NO: 1 is being studied in a
Phase 1 study in human subjects with advanced refractory solid tumors. The Fusion Protein was supplied as a sterile, white to off-white, lyophilized powder for IV or SC administration. The excipients included in the Fusion Protein formulation are citric acid monohydrate, sodium citrate tribasic dihydrate, sucrose, andpolysorbate 20. For IV administration, sterile water for injection, United States Pharmacopeia (USP), is supplied separately for reconstitution. Citrate buffer containing 1% polysorbate 20 (PS20 Diluent) is supplied separately for dilution. Saline solution (0.9% Sodium Chloride Injection, USP) is sourced separately as needed for additional dilution. - Four different doses (0.1, 0.3, 1, 3 μg/kg/day) of the Fusion Protein was administered to patients as a 30-minute intravenous infusion once daily for 5 consecutive days repeating in treatment cycles of 14 days (first cycle) or 21 days (subsequent cycles). The first part of the study is a dose escalation with the primary objective of investigating the safety and tolerability of the Fusion Protein and to determine the maximum tolerated dose (MTD) and the
recommended phase 2 dose (RP2D). The RP2D will be equal to or less than the MTD and its associated dosing schedule and will be selected based on the safety, PK, pharmacodynamics, and preliminary antitumor activity data observed during dose escalation.FIG. 2 shows the treatment regimens followed for this study. - Four different doses (0.1, 0.3, 1, 3 μg/kg/day) of the Fusion Protein was administered as a 30-minute intravenous infusion once daily for 5 consecutive days repeating in treatment cycles of 14 days (first cycle) or 21 days (subsequent cycles). On
day 1 of the first cycle, the immune checkpoint inhibitor, pembrolizumab was also administered at a dose of 200 mg.FIG. 2 shows the treatment regimens followed for this study. - See below for discussion of higher doses (6 μg/kg/day and 8 μg/kg/day) that were administered as a part of this clinical study protocol (see also
FIGS. 11-15 ). - Consistent with other cytokine therapies, pyrexia and chills were the most common treatment( )emergent the Fusion Protein-related adverse events. Overt capillary leak syndrome has not been observed to date. No
Grade Grade 3 febrile neutropenia andGrade 3 hypoalbuminemia met the protocol definitions for dose-limiting toxicities (DLT). After discussion with the investigators it was determined that these should not be considered DLTs, and DLT definitions were amended, allowing continued dose escalation. - Dose-dependent elevations of serum IL-6 and IFN-γ levels were observed in response to treatment with the Fusion Protein. IL-6 levels peaked at 4 hours post-dose and recovered to baseline at 8-10 hours post-dose. Fever coincided with the time of maximum IL-6 and recovered to baseline 8-12 hours post-dose.
- Conclusions from dosing with 0.1, 0.3, 1, 3 μg/kg/day.
-
- Dose proportional increase in the Fusion Protein systemic exposure in patients treated with the Fusion Protein (
FIG. 3 ). - Dose-dependent increase in circulating NK cells and CD8+ T cells (
FIG. 4 ) as measured in the peripheral blood of the patient. - Variable and non-dose dependent increase in Treg (
FIG. 4 ). - Dose related transient elevation of serum IL-6 levels coincided with onset of AE of chills and fever.
- No evidence of capillary leak syndrome.
Cohort 5 Administration of 6 μg/kg/day
- Dose proportional increase in the Fusion Protein systemic exposure in patients treated with the Fusion Protein (
- Eleven (11) patients of
Cohort 5 of the Dose escalation study with advanced solid tumors received 6 μg/kg per day of the Fusion Protein by IV administration daily for 5 days, followed by a period off treatment in repeating cycles. DuringCycle 1, the period off treatment was 9 days, resulting in a cycle length of 14 days (2 weeks).Cycle 2 and subsequent cycles had a period off treatment of 16 days, resulting in a cycle length of 21 days (3 weeks). For the first 2 treatment cycles, subjects received the Fusion Protein as inpatients at a medical facility with access to medical support measures and to the intensive care unit, if needed. In the absence of dose limiting toxicities (DLTs), subjects received subsequent doses of the Fusion Protein on an outpatient basis. - Conclusions from
Cohort 5 Administration of 6 μg/Kg/Day -
- Dose proportional increase in the Fusion Protein systemic exposure in patients treated with the Fusion Protein (
FIG. 3 ). - Dose-dependent increase in circulating NK cells and CD8+ T cells (
FIG. 4 ) as measured in the peripheral blood of the patient. - Variable and non-dose dependent increase in Treg (
FIG. 4 ). - Dose related transient elevation of serum IL-6 levels coincided with onset of AE of chills and fever.
- No evidence of cytokine release syndrome.
- No evidence of capillary leak syndrome.
- No patients had dose limiting toxicities at the 6 μg/kg/day dosing regimen which is equivalent to high dose rhlL-2 administration (Aldesleukin).
- Given the results from this 6 μg/kg/day dosing regimen, particularly the lack of dose limiting toxicities, it is believed that the maximum tolerated dose (MTD) is higher than a dose of 8 μg/kg/day dosing regimen, 10 μg/kg/day dosing regimen and even 15 μg/kg/day dosing regimen.
- Dose proportional increase in the Fusion Protein systemic exposure in patients treated with the Fusion Protein (
- A total of 36 patients received SEQ ID NO: 1 at doses up to 6 μg/kg/day and the findings were the same as those reported above. The maximum tolerated dose of SEQ ID NO: 1 was not yet reached. Among the 27 patients with evaluable scans, 14 (52%) had stable disease (
FIG. 7 ). One patient with heavily pretreated pancreatic adenocarcinoma had prolonged stable disease and continued receiving SEQ ID NO: 1 monotherapy at 6 μg/kg/day for over 6 months. - Antitumor Activity During Combination Therapy with Pembrolizumab
- Twenty-six (26) patients received SEQ ID NO: 1 in combination with pembrolizumab. Among the 26 patients, 18 had evaluable scans. 12 of the 18 patients (67%) has stable disease or better over the course of treatment (
FIG. 8 ). - One patient with ovarian cancer had a confirmed partial response. One patient with triple negative breast cancer showed greater than 50% reduction in target lesion size (
FIG. 9 ). - Recombinant human interleukin-2 (rhlL-2, aldesleukin) is approved and used for the treatment of metastatic melanoma and renal cell carcinoma.1-8 However, the use of rhlL-2 is limited to patients with normal cardiac and pulmonary function due to associated capillary leak syndrome and resulting hypotension.9-12
- Despite the poor tolerability associated with rhlL-2 treatment, it remains one of the few treatment regimens for metastatic melanoma and renal cell carcinoma that elicits a complete and durable response in a subset of patients, up to 12% in melanoma and 7% in renal cell carcinoma.7,8 It has been hypothesized that rhlL-2 preferentially activates and induces the expansion of immunosuppressive CD4+ Tregs,13 and high-dose IL-2 is required to induce signaling on receptor complexes expressed on potential tumor killing CD8+ T cells and natural killer (NK) cells.
- Published data show that the immunosuppressive inducible T cell co-stimulator-positive (ICOS+) Treg cells were significantly expanded in a subset of melanoma patients receiving high dose IL-2 therapy.14 However, no data are readily available that specifically quantify and compare the levels of expansion of cytotoxic effectors such as CD8+ T cells and NK cells relative to Treg cells. This study was conducted with the primary goal to assess the pharmacodynamic effects of high-dose IL-2 on numbers of circulating CD8+ T cells, NK cells, and Treg cells.
-
-
- This was a single-center, open-label study.
- Study center: Beth Israel Deaconess Medical Center, Boston, Mass.
- Study participants: a cohort of patients with renal cell carcinoma receiving treatment with high-dose aldesleukin (IL-2).
- The study was approved by the Beth Israel Deaconess Medical Center IRB, protocol #06-105.
- Aldesleukin at a dose of 600,000 International Units/kg was administered every 8 hours by a 15-min intravenous infusion for a maximum of 14 doses (cycle 1). Following 9 days of rest, the schedule was repeated (cycle 2) for a maximum of 28 doses, as tolerated.
- Whole blood samples for immunophenotyping by flow cytometry were collected at four time points per patient:
-
Cycle 1 prior to the first dose -
Cycle 1 within 24 hours after the last dose -
Cycle 2 prior to the first dose -
Cycle 2 within 24 hours after the last dose
-
- CD8+ T cells, NK cells, and Treg cells were quantified by flow cytometry.
- Safety and antitumor activity were monitored throughout the study period.
- Response was assessed clinically based on radiology reports, and best response was recorded.
-
-
- Ten patients with renal cell carcinoma were enrolled
- Median age 55 (range 39-62)
- Male/
female 6/4 - ECOG PS of 0=9/1=1
- Median number of prior therapies 2 (range 1-3).
-
-
- Cycle 1: median 11 (range 8-13)
- Cycle 2: median 6 (range 0-11)
- Total (
cycle 1+cycle 2): median 17 (range 11-23).
-
-
- Partial response (PR): 5
- Mixed response: 1
- Progressive disease (PD): 4.
-
-
- Administration of high-dose IL-2 resulted in robust expansion of circulating Tregs with a mean maximum expansion of ˜4-fold as compared to ˜2-fold expansion of circulating total CD8+ T cells and NK cells.
- Minimal or no change to the ratio of NK cells/Tregs and CD8+ T cells/Tregs was observed in response to high-dose IL-2.
- High inter-subject variability in pharmacodynamic response was observed with no apparent correlation to clinical response and number of doses received.
- All treatment emergent adverse events (Table 1) seen were consistent with the known adverse event profile of high-dose IL-2.15
-
TABLE 1 Treatment-Emergent Adverse Events # PATIENTS (%) ADVERSE EVENT N = 10 Hypotension requiring vasopressors 8 (80%)* Elevated bilirubin 7 (70%) Erythematous rash 7 (70%) Thrombocytopenia 7 (70%) Diarrhea 7 (70%) Nausea 6 (60%) Acute kidney injury 6 (60%) Vomiting 5 (50%) Metabolic acidosis 4 (40%) Rigors 3 (30%) Toxic encephalopathy 3 (30%) Dyspnea 2 (20%) Neutropenia 1 (10%) Fatigue 1 (10%) Leukopenia 1 (10%) Hyponatremia 1 (10%) Arthralgias 1 (10%) Gastrointestinal bleeding (prior nivolumab) 1 (10%) *Including capillary leak syndrome in 5 patients -
-
- The safety profile and clinical response observed in this cohort of patients were similar to previously published data.15
- A more robust expansion of Tregs over CD8+ T cells and NK cells was observed in patients treated with high-dose IL-2, consistent with the known biological activities of IL-2.
- These results may be useful in the future for evaluating possible differences in immune response observed with novel cytokine therapeutic agents.
-
- 1. Rotte A, et al. Cancer Metastasis Rev 2015; 34:115-128.
- 2. Fyfe G, et al. J. Clin. Oncol 1995; 13:688-696.
- 3. Brayer J & Fishman M. J Immunother 2014; 37:187-191.
- 4. Clement J M & McDermott D F. Clin. Genitourin. Cancer 2009; 7:E7-E9.
- 5. Shanafelt A B, et al. Nat.
Biotechnol 2000; 18:1197-1202. - 6. Phan G Q, et al. J Clin. Oncol. 2001; 19:3477-3482.
- 7. Payne R, et al. J. Immunother. Cancer 2014; 2:13.
- 8. McDermott D F, et al. J Clin. Oncol 2005; 23:133-141.
- 9. McDermott D F & Atkins M B. Expert Opin. Biol. Ther. 2004; 4:455-468.
- 10. Boyman O, Surh C D & Sprent J. Expert Opin. Biol. Ther. 2006; 6:1323-1331.
- 11. Epstein A L, et al. J Natl. Cancer Inst. 2003; 95:741-749.
- 12. Nakagawa K, et al. Cancer Res. 1996; 56:507-510.
- 13. Malek T R & Bayer A L. Nat. Rev. Immunol 2004; 4:665-674.
- 14. Sim G C, et al. J Clin. Invest. 2014; 124(1):99-110.
- 15. Marabondo S and Kaufman H L. Expert Opin Drug Saf 2017; 16(12):1347-1357.
- The data from Examples 1 and 2 was combined for the purpose of comparing maximum responses to treatment with SEQ ID NO: 1 and High Dose rhlL-2. The Comparisons are shown in Table 2.
-
TABLE 2 Fold Change Induced Example Drug Patient # NK Cell CD8+ Cell Treg 1 SEQ ID N = 10 at Mean 8.5Fold Mean 2.1 fold Mean 1.8fold NO: 1 6 μg/kg/day Increase increase increase on C2D8 on C2D8 on C2D8 N = 2 at Mean 4.5 Fold Mean 2.0 fold Mean 1.7 8 μg/kg/day Increase increase on fold increase C2D8 C2D8 on C2D8 2 High Dose N = 10 Mean 2.2 fold 2.2 fold 4.1 fold rhIL-2 increase (C2) increase (C2) increase (C2) - The data also shows that the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment As per Table 2 there was a near 2 fold increase in circulating immunosuppressive Tregs when patients are administered the fusion protein of SEQ ID NO: 1 in accordance with the treatment regimens of the invention as compared to an approximately 4 fold increase in circulating immunosuppressive Tregs in patients being treated with high dose rhlL-2 therapy.
- rhlL-2 treatment induced greater levels of systemic pro-inflammatory cytokines in mice than SEQ ID NO: 1. Serum cytokine production was assayed in female C57BL/6 mice treated SC daily for 4 days with either rhlL-2 (20 μg, 50 μg, and 75 μg) or SEQ ID NO: 1 (8 μg, 20 μg, and 30 μg) at 2, 4, 6 and 24 hours post-dose on
Day 1 and Day 4 (n=4 animals per time point). The dataFIG. 10 shows the cytokine production for IFNγ and IL-6. Elevated levels of TNFα and IL-6 are found in individuals with inflammation that is associated with an infection as in septicemia or are afflicted with a chronic inflammatory disease like rheumatoid arthritis. - Antibodies that block TNFα and IL-6 pathways are prescribed for treating rheumatoid arthritis and anti-IL-6 drugs are used to mitigate the effects of inflammation that arise during certain types of anti-cancer treatments like chimeric antigen receptor (CAR) T cell therapy. Therefore, reduced induction of proinflammatory cytokines as observed in
FIG. 10 would suggest that treatment with SEQ ID NO: 1 would be better tolerated and potentially safer than treatment with rhlL-2. -
-
List of Abbreviations: Abbreviation or Term Explanation or Definition AE adverse event ANC absolute neutrophil count C2D15 Cycle 2, Day 15 CD cluster of differentiation CI confidence interval Cmax maximum drug concentration in serum CR complete response CSA Clinical Study Agreement CTCAE Common Terminology Criteria for Adverse Events DCR disease control rate DLT dose-limiting toxicity DOR duration of response ECG standard 12-lead electrocardiogram ECOG Eastern Cooperative Oncology Group eCRF electronic case report form EOT end of treatment FIH first-in-human GCP Good Clinical Practice GLP Good Laboratory Practice i- immune- iAE immune adverse event ICF informed consent form ICH International Council for Harmonisation iCR immune complete response iDCR immune disease control rate iDOR immune duration of response IFN interferon IL-2 interleukin-2 IL-2R interleukin-2 receptor iORR immune overall response rate iPD immune progressive disease iPFS immune progression-free survival iPR immune partial response IRB Institutional Review Board iRECIST Immune Response Evaluation Criteria in Solid Tumors iSD immune stable disease IV intravenous(ly) MP memory-phenotype MTD maximum tolerated dose NCI National Cancer Institute NK natural killer [cells] NSCLC non-small-cell lung cancer ORR overall response rate PD progressive disease PD-1 programmed death receptor-1 PD-L1 programmed death ligand-1 PFS progression-free survival PK pharmacokinetic(s) PR partial response QD once daily RCC renal cell carcinoma RECIST Response Evaluation Criteria in Solid Tumors rhIL-2 recombinant human interleukin-2 RP2D recommended Phase 2 dose SAE serious adverse event SAP Statistical Analysis Plan SD stable disease SPD sum of the products of the two longest perpendicular diameters TID 3 times daily Tregs regulatory T cells ULN upper limit of normal USP-NF United States Pharmacopeia-National Formulary WOCBP women of childbearing potential - This is a global, multicenter, open-label,
sequential groups Phase 1/2 study which is the same study from which the data and information of Examples 1 and 2 is derived. - The study has three parts: Part A, a dose-escalation monotherapy part; Part B, a dose-expansion monotherapy part; and Part C, a combination therapy part with pembrolizumab (see also Example 1). An overview of the Study is shown in Table 3.
-
TABLE 3 SEQ ID NO: Portion of 1 Dose the Study Cohort (μg/kg/day) Dose 1 0.1 Escalation 2 0.3 (Part A)a 3 1 4 3 5 6 6 8 7 10 8 12 9 14 Dose Melanomaa RP2D Expansion RCC RP2D (Part B) Combination SEQ ID NO: 1 1 μg/kg/day safety run-in 1 Therapy SEQ ID NO: 1 3 μg/kg/day safety run-in 3 (Part C) C1: PD-1/L1 unapproved tumor types 3b C2: PD-1/L1 approved tumor types (PD- 3b 1/L1 pretreated) C3: PD-1/L1 approved tumor types (PD- 3b 1/L1 treatment naive) C4: Rollover 3b C5: Melanoma 6b C6: NSCLC 6b C7: SCCHN 6b Abbreviations: DLT = dose-limiting toxicity; NSCLC = non-small-cell lung cancer; PD-1 = programmed death receptor-1; PD-L1 = programmed death ligand-1; RCC = renal cell carcinoma; RP2D = recommended Phase 2 dose; SCCHN = squamous cell carcinoma of the head and neck; TBD = to be determined.aNo more than 5 ocular melanoma subjects may be enrolled into this cohort. bA subject's SEQ ID NO: 1 dose may be reduced by one dose level as needed at the discretion of the Investigator. - In Part A of the study, subjects with advanced solid tumors received SEQ ID NO: 1 by IV administration daily for 5 days, followed by a period off treatment in repeating cycles. During
Cycle 1, the period off treatment was 9 days, resulting in a cycle length of 14 days (2 weeks).Cycle 2 and subsequent cycles will have a period off treatment of 16 days, resulting in a cycle length of 21 days (3 weeks). For the first 2 treatment cycles, subjects received SEQ ID NO: 1 as inpatients at a medical facility with access to medical support measures and to the intensive care unit, if needed. In the absence of DLTs, subjects who remain in the study received subsequent doses of SEQ ID NO: 1 on an outpatient basis. - In dose escalation, cohorts in the study used a standard 3+3 study design with 3 to 6 subjects per cohort to receive SEQ ID NO: 1 at dose levels as shown in Table 3. The starting dose of 0.1 μg/kg/day was selected based on minimal anticipated biological effect level. Doses in subsequent cohorts are being increased according Table 3 until stopped for DLTs or an MTD is reached. Additional dose levels will be considered if the RP2D or MTD has not been reached within the proposed dose range.
- During dose escalation, each cohort is evaluated for safety and tolerability using a 3+3 study design with allowance for over-enrollment with 4 to 7 subjects and a minimum of 3 evaluable subjects per cohort to receive IV SEQ ID NO: 1 at the specified dose and schedule. If none of the 3 subjects experiences a DLT, then the next dose level will open for enrollment. If 1 of the 3 subjects experiences a DLT, then 3 additional subjects will be enrolled at the same dose level. If no additional DLTs are observed, then the next dose level will open for enrollment.
- If two or more subjects experience DLTs at a dose level, no further dose escalations will occur. One or more lower dose level(s) may be tested in search of the MTD, defined as the dose level immediately below that in which ≥2 of 6 evaluable subjects experience DLTs. Prior to any dose escalation, a teleconference of the Safety Review Committee (SRC), to include at a minimum the study investigators who have enrolled subjects and the Sponsor's Medical Monitor, will be convened to review the safety data from the current cohort and to decide if dose escalation is warranted.
- Dose-limiting toxicity will be defined by any of the following events described in Example 1, Table 1.
- After the RP2D was determined as described in Example 1, the second part of the study (i.e., Part B) commenced. In this part of the study, up to 41 subjects with melanoma and up to 41 subjects with RCC are being enrolled to receive SEQ ID NO: 1 at the RP2D. Enrollment to these cohorts will follow a partial response (unconfirmed) Simon's two-stage design enrollment. Response assessments will be based on the RECIST guidelines.
- In the third part of the study (Part C), subjects received SEQ ID NO: 1 in combination with pembrolizumab (see Example 1). Part C is running independently of and concurrently with monotherapy of Part A and Part B.
- A 3- to 6-subject run-in phase is being utilized to assess the safety of SEQ ID NO: 1 in combination with pembrolizumab. During the safety run-in phase, subjects were enrolled with any tumor type. Rollover subjects (Cohort 4) were not eligible to participate in the safety run-in phase of Part C.
- During the safety run-in phase, the first 3 subjects received SEQ ID NO: 1 at the dose level of 1 μg/kg/day (Example 1). As all 3 subjects tolerated therapy their first 21-day cycle as assessed by the SRC, then the study progressed to the 3 μg/kg/day dose level. As the first 6 subjects tolerate therapy adequately for their first 21-day cycle as assessed by the SRC, expansion Cohorts C1, C2, C3, and C4 were opened.
- Up to 20 subjects are being enrolled into each of Cohorts C1, C2, C3 based on their tumor type and prior treatment with PD-1/PD-L1 pathway inhibitors as described in the inclusion criteria (Example 1). Subjects with RCC or melanoma were not eligible for enrollment in Cohorts C1, C2, or C3. Subjects on SEQ ID NO: 1 monotherapy in Part A or Part B who have experienced disease progression after a minimum of 2 cycles or SD after a minimum of 4 cycles and who are expected to tolerate treatment with combination therapy were eligible for treatment in Part C, Cohort C4. Subjects who have PR or CR on monotherapy were ineligible to rollover unless subsequently demonstrating progressive disease.
- Subjects received 200 mg of pembrolizumab every 3 weeks in combination with SEQ ID NO: 1 by IV administration daily for 5 days, followed by a period off treatment of 16 days, resulting in a cycle length of 21 days (3 weeks) for each cycle (Example 1).
- After the RP2D was determined for monotherapy as is described in Example, enrollment into Cohorts C5, C6, and C7 was opened. Because monotherapy doses above 6 μg/kg/day SEQ ID NO: 1 be shown to be tolerated, then the dose of SEQ ID NO: 1 in the combination arms was also increased. In Cohorts C5, C6, and C7, up to 53 subjects with melanoma, up to 42 subjects with NSCLC, and up to 36 subjects with squamous cell carcinoma of the head and neck may be enrolled to receive SEQ ID NO: 1 in combination with pembrolizumab at the RP2D. Enrollment to these cohorts will follow a PR (unconfirmed) Simon's two-stage enrollment as outlined below. Response assessments will be based on RECIST and iRECIST guidelines. Given the RP2D was determined to be 6 μg/kg/day as per Example 1, dose escalation was considered for subjects in Cohorts C1, C2, C3, and C4 who had been assigned to the 1 μg/kg/day or 3 μg/kg/day dose levels and had adequately tolerated the combination therapy.
- Antitumor activity was determined by the measurement of extent of known disease at baseline and approximately every 5 to 6 weeks, following each even-numbered treatment cycle.
- Appropriate radiological procedures (computed tomography scanning, magnetic resonance imaging, radionuclide imaging) was conducted to evaluate areas of disease. Superficial skin tumors were measured with calipers and photographed for evaluation. The determination of response was conducted according to the standard RECIST and iRECIST criteria for Parts A, B, and C. According to the guidelines for RECIST, tumors are assessed as CR, PR, SD, or PD. According to the guidelines for iRECIST, tumors are assessed as immune CR (iCR), immune PR (iPR), immune SD (iSD), or immune PD (iPD). For purposes of this study, subjects must meet the definition for SD/i SD for a minimum of 12 weeks before this assessment can be determined.
- In studies with immunotherapeutic agents, CR, PR, or SD have been shown to occur after an increase in tumor burden characterized as PD by RECIST criteria. The conventional response criteria such as RECIST may not adequately assess the activity of immunotherapeutic agents. PD evaluated radiologically may not mean therapeutic failure, as responses to immune therapies may occur after conventional PD. The appearance of measureable antitumor activity may take longer for immune therapies than for cytotoxic therapies. With immunotherapeutic agents, there should be allowance for clinically insignificant PD, defined as small new lesions in the presence of other responsive lesions, which may occur even though the subject is responding to the immunotherapy. Stable disease may also represent antitumor activity with iRECIST. Therefore, RECIST and iRECIST were used to ensure a more comprehensive evaluation of tumor response for SEQ ID NO: 1.
- The ORR/iORR is the number of subjects exhibiting a CR/iCR or PR or iPR divided by the number of subjects evaluable for antitumor activity. Duration of response was also be determined. The ORR/iORR was calculated separately for subjects in the dose-escalation portion of the study (Part A), in the dose-expansion part of the study (Part B), and in the combination therapy part of the study (Part C). Tumor images were collected and stored centrally. Centralized readings may be used to assess scans beginning in the second stage (N2) of Part B cohorts and Part C C5, C6, and C7 cohorts. Antitumor activity will be expressed as the following:
-
- ORR based on RECIST
- iORR based on iRECIST
- DCR per RECIST
- iDCR per iRECIST
- DOR per RECIST
- iDOR per iRECIST
- PFS per RECIST
- Immune PFS (iPFS) per iRECIST
- DRR per RECIST (Part B and Part C5, C6, C7)
- iDRR per iRECIST (Part B and Part C5, C6, C7).
- Serum samples for evaluation of SEQ ID NO: 1 PK was obtained from each subject at predetermined time points. A validated electrochemiluminescence method using the Meso Scale Discovery platform will be used for the quantitation of SEQ ID NO: 1 in human serum. Noncompartmental PK analysis was performed to estimate the PK parameters for SEQ ID NO: 1.
- Serum samples for evaluation of anti-SEQ ID NO: 1 antibody induction were obtained from each subject at predetermined time points. A validated electrochemiluminescence method using the Meso Scale Discovery platform was used for the detection of antidrug antibodies to SEQ ID NO: 1 in human serum. The assessment of immune-response induction for each study subject was based on the comparison of the pre-dose and post-dose sample results.
- The pharmacodynamic response of various biomarkers were assessed in blood and serum samples collected from all subjects in the study. Additional biomarker analyses were performed on tumor tissue samples, which are optional for study subjects.
- The pharmacodynamic effect of SEQ ID NO: 1 was assessed by measuring circulating CD8+ T cells, Tregs, and NK cells in peripheral blood by flow cytometry from each subject at predetermined time points. In addition, serum samples were obtained from each subject at predetermined time points. Concentration of multiple proinflammatory cytokines including interferon-γ, tumor necrosis factor-α, IL-10, IL-6, and IL-10 were determined. Circulating tumor DNA (ctDNA) was also be measured at predetermined time points.
- Collection of fresh tumor samples via biopsy were collected at baseline from consenting subjects during the study. These samples were analyzed by immunohistochemistry and/or immunofluorescence for markers of immune activation. They were also be used for gene expression analysis using method such as NanoString. Comparison of on-treatment versus baseline results was used to demonstrate the pharmacologic impact to tumor microenvironment. The analysis of the baseline tumor tissues was used for correlative analysis.
- The statistical analysis methods are described below. In general, summary statistics (n, mean, standard deviation, median, minimum, and maximum values for continuous variables and number and percentage of subjects in each category for categorical variables) were provided for evaluated variables. Data was summarized for Part A, Part B, and Part C separately. Baseline is defined as the last value prior to the first dose of study treatment administration for each part separately.
- The evaluation of ORR was based on Investigator review of the radiographic or photographic images, as defined according to RECIST 1.1. Overall response rate is defined as the proportion of subjects with objective evidence of CR or PR among the number of subjects evaluable for antitumor activity.
- At the analysis stage, the best ORR was assigned for each subject as the best response recorded after initiation of study treatment, taking into account any requirement for confirmation. If applicable, responses recorded after disease progression or initiation of new anticancer treatment were excluded.
- The ORR was calculated separately for those subjects in the dose-escalation portion of the study (Part A), in the dose-expansion portion of the study (Part B), and in the combination therapy part of the study (Part C). Summarization of ORR was presented by frequency, percentage, and 95% confidence interval (CI). The CI were obtained using an exact approach given the small sample size. Sum of the Diameters of all lesions reported at each visit were graphed by spider plot (% change over time) and waterfall plot (best % change). The swimmer plot was used to display the characteristics of the responses in subjects.
- Responses assigned using iRECIST have a prefix of “i” (ie, immune) to differentiate them from responses assigned using RECIST 1.1. The principles used to establish objective tumor response are largely unchanged from RECIST 1.1, but the major change for iRECIST is the concept of resetting the bar if RECIST 1.1 progression is followed at the next assessment by tumor shrinkage. iRECIST defines iUPD (immune unconfirmed progressive disease) on the basis of RECIST 1.1 principles. If the criteria for iUPD have never been met, principles follow RECIST 1.1. However, if the criteria for iUPD have been met, the next timepoint response could be iUPD, iSD, iPR, or iCR, or iCPD (immune confirmed progressive disease). For iRECIST, the best overall response (iBOR) is the best timepoint response recorded from the start of the study treatment until the end of the study treatment, taking into account any requirement for confirmation. Immune overall response rate was based on iBOR. The iBOR was calculated separately for those subjects in the dose-escalation portion of the study (Part A), in the dose-expansion portion of the study (Part B), and in the combination therapy part of the study (Part C). A spider plot, waterfall plot, and swimmer plot were used to display the characteristics of the responses in subjects.
- Disease Control Rate
- Disease control rate is defined as the proportion of subjects with objective evidence of CR, PR, or SD at
Cycle 4 or later. The DCR was calculated separately for those subjects in the dose-escalation portion of the study (Part A), in the dose-expansion portion of the study (Part B), and in the combination therapy part of the study (Part C). Summarization of DCR was presented by frequency, percentage, and 95% CI. The CI was obtained using an exact approach given the small sample size. - Immune Disease Control Rate
- Immune disease control rate is defined as the proportion of subjects with objective evidence of iCR, iPR, or iSD at
Cycle 4 or later. The iDCR was calculated separately for those subjects in the dose-escalation portion of the study (Part A), in the dose-expansion portion of the study (Part B), and in the combination therapy part of the study (Part C). Summarization of iDCR was presented by frequency, percentage, and 95% CI. The CI was obtained using an exact approach given the small sample size. - Duration of Response (Part B and Part C)
- Duration of response, defined as the time from the first documentation of response (CR or PR) to the first documentation of objective tumor progression or death due to any cause.
- Subjects who are alive and progression free as of the analysis cut-off date will be censored at their last evaluable tumor response assessment before initiation of any new anticancer treatment. Subjects with two or more consecutive missing response assessments prior to death or a visit with documented progression will be censored at the last date of tumor assessment when the subject was documented to be progression free. Subjects who never achieve CR or PR prior to starting any new anticancer treatment at a lesion site will be excluded from the analysis. The rate of response was calculated for RECIST responders. For Part B, the DOR was calculated as follows (in weeks): (date of PD/death in Part B−date of first response (CR or PR) in Part B+1)/7 For Part C, the DOR was calculated as follows (in weeks): (date of PD/death in Part C−date of first response (CR or PR) in Part C+1)/7. The distribution of DOR was estimated for Part B and Part C using Kaplan-Meier methodology. The median point estimate DOR was provided along with the two-sided 95% CIs based on the antitumor evaluable population with subjects who experienced CR or PR. Kaplan-Meier curves were provided.
- Immune duration of response, defined as the time from the first documentation of response (iCR or iPR) to the first documentation of objective tumor progression or death due to any cause. Subjects who are alive and progression free as of the analysis cut-off date were censored at their last evaluable tumor response assessment before initiation of any new anticancer treatment. Subjects with two or more consecutive missing response assessments prior to death or a visit with documented progression were censored at the last date of tumor assessment when the subject was documented to be progression free. Subjects who never achieve iCR or iPR prior to starting any new anticancer treatment at a lesion site were excluded from the analysis. The rate of response were calculated for iRECIST responders. For Part B, the iDOR were calculated as follows (in weeks): (date of iPD/death in Part B−date of first response (iCR or iPR) in Part B+1)/7 For Part C, the iDOR were calculated as follows (in weeks): (date of iPD/death in Part C−date of first response (iCR or iPR) in Part C+1)/7. The distribution of iDOR was estimated for Part B and Part C using Kaplan-Meier methodology. The median point estimate iDOR was provided along with the two-sided 95% CIs based on the antitumor evaluable population with subjects who experienced iCR or iPR. Kaplan-Meier curves were provided.
- Durable response rate is defined as the percentage of subjects with an objective response (complete or partial response per RECIST1.1) lasting continuously for 6 months and starting any time within 12 months of initiating the study drug. The DRR was summarized by each tumor type. Summary of DRR was presented by frequency, percentage, and 95% CI. The CI was obtained using an exact approach given the small sample size.
- Immune durable response rate (iDRR) is defined as the percentage of subjects with an objective response (complete or partial response per iRECIST) lasting continuously for 6 months and starting any time within 12 months of initiating the study drug. The iDRR was summarized by each tumor type. Summary of iDRR was presented by frequency, percentage, and 95% CI. The CI was obtained using an exact approach given the small sample size.
- Progression-free survival, defined as the time from the first dose of SEQ ID NO: 1 to the first documentation of objective tumor progression or death due to any cause. Subjects who do not have disease progression or have not died were censored at the last known time that the subject was progression free. If a subject begins a new anticancer treatment (either systemic or local) prior to documented progression or death, or a subject is removed from the study due to undocumented clinical disease progression, then the subject was censored at the last assessment where the subject was documented as progression free prior to the intervention. Subjects with two or more consecutive missing response assessments prior to a visit with documented progression (or death) were censored at the last date of tumor assessment when the subject was documented to be progression free. For Part B, the PFS was calculated as follows (in weeks): (date of PD/death in Part B−first dose date in Part B+1)/7 For Part C, the PFS were calculated as follows (in weeks): (date of PD/death in Part C−first dose date in Part C+1)/7. The survival distribution of PFS was estimated using Kaplan-Meier methodology. The median PFS was provided along with the two-sided 95% CIs based on the antitumor evaluable population. In addition, Kaplan-Meier curves were provided. The 6-month and one-year PFS rate was estimated using the Kaplan-Meier estimate.
- Immune progression-free survival, defined as the time from the first dose to the first documentation of objective tumor progression or death due to any cause. Subjects who do not have disease progression or have not died were censored at the last known time that the subject was progression free. If a subject begins a new anticancer treatment (either systemic or local) prior to documented progression or death, or a subject is removed from the study due to undocumented clinical disease progression, then the subject was censored at the last assessment where the subject was documented as progression free prior to the intervention. Subjects with two or more consecutive missing response assessments prior to a visit with documented progression (or death) were censored at the last date of tumor assessment when the subject was documented to be progression free. For Part B, the iPFS was calculated as follows (in weeks): (date of iPD/death in Part B−first dose date in Part B+1)/7 For Part C, the PFS was calculated as follows (in weeks): (date of iPD/death in Part C−first dose date in Part C+1)/7. The survival distribution of iPFS will be estimated using Kaplan-Meier methodology. The median iPFS was provided along with the two-sided 95% CIs based on the antitumor evaluable population. In addition, Kaplan-Meier curves were provided. The 6-month and one-year iPFS rate was estimated using the Kaplan-Meier estimate.
- Individual serum concentrations and concentration-time data were presented and summarized both graphically and in tabular form using descriptive statistics. Pharmacokinetic parameters were summarized using descriptive statistics. A subject listing of individual PK concentration was provided. Concentration data was summarized according to nominal (protocol-specified) sampling times. Pharmacokinetic parameters were calculated by noncompartmental analysis method using Phoenix WinNonlin Professional (version 6.1 or later, Pharsight Corporation); actual elapsed time from dosing will be used to estimate individual serum PK parameters. Dose proportionality and additional PK analyses were performed, as appropriate.
- Pharmacodynamic data was summarized descriptively. Where possible, the relationship between serum PK parameters or concentration of SEQ ID NO: 1 and pharmacodynamic responses was evaluated by correlation analysis or visual inspections.
- The presence of anti-SEQ ID NO: 1 antibodies were determined and the data was summarized by cohort/dose level.
- The baseline values, post-treatment values, and the changes in density of TILs, ratio of cytotoxic TILs, immunosuppressive TILs, and density of signals of immune-cell-mediated killing were summarized. The correlation between antitumor efficacy endpoints (best overall response, progression free survival) and baseline status (or values) for endpoints derived from tumor tissues was estimated. The efficacy endpoints were summarized separately based on baseline status, or low and high values. The correlation between antitumor efficacy endpoints (best overall response, progression free survival) and the change from baseline in post-treatment for endpoints derived from tumor tissues were estimated.
- Partial and Complete Responses in Patient's Receiving 6 μg/kg Dose of SEQ ID NO: 1
- Initial data from the
ongoing Phase 1/2 Study provided a partial response in a urethral melanoma patient during Part B monotherapy dose expansion cohort receiving 6 μg/kg of SEQ ID NO: 1. Prior to joining the study, the patient had been treated with surgical dissection for urethral melanoma followed by one year of adjuvant nivolumab treatment. While on the study this patient showed a reduction in serum lactate dehydrogenase (LDH) betweencycle 1 andcycle 8 treatments. While on the study, the patient had the following benefits during each cycle of treatment as follows: Cycle 2-stable disease (SD); 8% increase in target lesions from baseline; Cycle 4-SD; 17% reduction in target lesions form baselines;Cycle 6 partial response (PR) 32% reduction in lesions from baseline; Cycle 8-confirmed PR as per RECIST, 35% reduction in target lesions from baseline. - Partial and Complete Responses in Patient's
Receiving 3 Ug/Kg Dose of SEQ ID NO: 1 in Combination with Pembrolizumab - Initial data from the
ongoing Phase 1/2 Study in patients receiving a combination of 3 μg/kg dose of SEQ ID NO: 1 in combination with pembrolizumab yielded at least one complete responses (CR) and several partial responses (PR) in a patients having the following types of cancers respectively, Ovarian (CR); Ovarian (PR); Ovarian (PR) esophageal (PR); and TNBC (iPR by iRECIST). - Data from Expansion Dose of
Cohort 6 at 8 μg/Kg/Day
Pharmacokinetics of SEQ ID NO: 1 after IV Administration - As discussed in Example 1, RP2D was determined to be a daily dose of 6 μg/kg. As per the study design, a
new Cohort 6 began enrollment in the study to be tested at a daily dose of 8 μg/kg. Two patients were enrolled with up to 4 more patients expected to be enrolled. What follows is the data received from the first two patients to be enrolled. - SEQ ID NO: 1 serum concentration vs time profiles after the first IV dose (
Cycle 1 Day 1) of SEQ ID NO: 1 are depicted inFIG. 11 . Mean peak (Cmax) and total serum exposure (AUC) of SEQ ID NO: 1 across the dose range evaluated in Part A described in Example 1 are shown inFIG. 12 . - After the first IV dose of SEQ ID NO: 1, peak serum SEQ ID NO: 1 concentrations were reached at the end of the 30 min (0.5 h) infusion, and thereafter declined in an exponential manner. Systemic exposure to SEQ ID NO: 1 (Cmax and AUClast) increased with increase in dose. The increase in Cmax was approximately dose proportional over the dose range of 0.1 μg/kg to 8 μg/kg. The increase in AUClast was greater than dose proportional over the dose range 0.1 μg/kg to 3 μg/kg but approximately dose proportional from 3 μg/kg to 8 μg/kg.
- The 6 μg/kg dose was selected as the recommended
Phase 2 dose (Example 1) for IV dosing of SEQ ID NO: 1. Enrollment at the 8 μg/kg is ongoing with two patients treated at this dose level. - Pharmacodynamic Effects of SEQ ID NO: 1 after IV Administration
- The time course of cell populations of total NK cells, total CD8+ T cells and regulatory T cells (Treg) in peripheral blood after the first two cycles of treatment with IV SEQ ID NO: 1 are depicted in
FIG. 13 . The fold changes from baseline (FCB) onCycle 1 Day 8 (C1D8) andCycle 2 Day 8 (C2D8) in total NK cells, total CD8+ T cells and Treg across the dose range evaluated in the Phase are depicted inFIG. 14 . - SEQ ID NO: 1 induced dose dependent increase in circulating NK and CD8+ T cells with minimal, non-dose dependent effect on Treg cells, and the 6 and 8 ug/kg dose levels have the most robust elevation of NK cells and CD8+ T cells without a significant change in the Treg profile.
- In addition, in evaluating the serum cytokine concentrations in patients treated at the various dose levels of SEQ ID NO: 1, transient elevation of serum concentrations of interferon gamma (IFNγ) and IL-6 were observed in patients receiving higher doses (>1 μg/kg) of SEQ ID NO: 1 (
FIG. 15 ). The peak IL-6 response was interestingly observed at the 3 μg/kg dose level, with reduced serum IL-6 levels at doses higher than 3 μg/kg, including 6 and 8 μg/kg. - IL-6 is a pro-inflammatory cytokine that is not thought to contribute to the antitumor response but is likely associated with general inflammation and side effects of treatment including fever. Increased levels of IL-6 in the serum and tumor site has been demonstrated in several cancers. Usually this increase is accompanied with a poor prognosis and lower survival rate. Downregulation of IL-6 has been correlated with a better response to cancer treatment.
- IFNγ is a very important marker of cytotoxic effector cell function, and CD8+ T cells and NK cells produce IFNγ upon activation. IFNγ is associated with the antitumor immune response, and significant elevation was observed at the 3, 6, and 8 μg/kg dose levels of
SEQ ID 1. Notably, elevation of IFNγ was observed at the 6 and 8 ug/kg dose levels where the IL-6 levels were much lower than the peak level observed at 3 μg/kg. The IFNγ levels observed after treatment with 8 ug/kg SEQ ID NO: 1 were approximately 4 to 5-fold higher even than observed at 3 and 6 μg/kg. This suggests that the 6 and 8 μg/kg dose levels and potentially higher dose levels of 10, 12, 15 μg/kg or greater may have a particular advantage in terms of antitumor immune activity relative to inflammatory activity in comparison to lower dose levels of SEQ ID NO: 1. - The patent and scientific literature referred to herein establishes the knowledge that is available to those with skill in the art. All United States patents and published or unpublished United States patent applications cited herein are incorporated by reference. All published foreign patents and patent applications cited herein are hereby incorporated by reference. All other published references, documents, manuscripts and scientific literature cited herein are hereby incorporated by reference.
- While this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims. It should also be understood that the embodiments described herein are not mutually exclusive and that features from the various embodiments may be combined in whole or in part in accordance with the invention.
Claims (33)
1. A method of treating cancer in a patient comprising administering to the patient a dose of at least about 6 μg/kg/day to about 15 μg/kg per day of the fusion protein of SEQ ID NO: 1.
2. The method of claim 1 , wherein:
the dose is 6 μg/kg/day, 8 μg/kg/day, 10 μg/kg/day, 12 μg/kg/day, 14 μg/kg/day, or 15 μg/kg/day;
the patient has an improved safety profile as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment, optionally wherein the patient has a lower risk of capillary leak syndrome or cytokine release syndrome;
the dose is administered by intravenous (I.V.) injection or infusion;
the dose is a fixed dose based on a 60-70 kg human;
the dose is a fixed dose and wherein the patient is a child, optionally wherein the child weighs about 15 kg to about 50 kg;
the method results in at least a partial response in the patient;
the method further comprises repeating administration of the fusion protein if the cancer reoccurs, or a new cancer develops in the patient; or
the mean fold change from baseline (FCB) in IFNγ present in a patient's peripheral blood, serum or plasma is at least about 2-fold, at least about 3-fold, at least about 4-fold, or at least about 5-fold.
3. The method of claim 1 , wherein administration results in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in T regulatory (Treg) cells, optionally wherein:
the increase in circulating NK cells and CD8+ cells is at least 2 fold over baseline;
the increase in circulating NK cells and CD8+ cells is greater relative to the increase in circulating Treg cells;
an increase in circulating NK cells and CD8+ cells is greater relative to the increase in circulating Treg cells as compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating Treg cells in a patient receiving high dose rhIL-2 treatment; and/or
the patient has a lower risk of capillary leak syndrome.
4-10. (canceled)
11. The method of claim 1 , wherein the cancer being treated is a solid tumor or a blood cancer, optionally wherein:
the solid tumor is a carcinoma, sarcoma or lymphoma;
the cancer being treated is renal cell carcinoma (RCC), melanoma, breast cancer, pancreatic cancer, prostate cancer, non-small cell lung cancer, liver cancer, colon and rectal cancer, bladder cancer, cervical cancer, thyroid cancer, esophageal cancer, oral cancer, mesothelioma, and non-melanoma skin cancer;
the blood cancer is leukemia, non-Hodgkin lymphoma, Hodgkin lymphoma and multiple myeloma; and/or
the size of the solid tumor is reduced.
12-15. (canceled)
16. The method of claim 1 , wherein the fusion protein of SEQ ID NO: 1 is administered by intravenous injection or infusion at a dose of at least about 6 μg/kg to about 15 μg/kg per day as a once a day administration for about 1 day to about 5 days, optionally wherein:
the fusion protein is administered once a day for at least about 2 consecutive days, at least about 3 consecutive days, at least about 4 consecutive days, or at least about 5 consecutive days;
the fusion protein is administered once a day on non-consecutive days for no more than about 5 total non-consecutive of days of administration; and/or
the fusion protein is administered followed by a rest period of at least about 9 consecutive days, optionally wherein the rest period is at least about 16 consecutive days.
17-23. (canceled)
24. The method of claim 1 , wherein the fusion protein of SEQ ID NO: 1 is administered in at least two courses of treatment, the first course of treatment comprising administration by intravenous injection or infusion at a dose of at least about 6 μg/kg to about 15 μg/kg per day for a period of about 1 to about 5 consecutive or non-consecutive days followed by a rest period of at least about 9 consecutive days followed by a second course of treatment comprising administering the fusion protein of SEQ ID NO: 1 by intravenous injection or infusion at a dose of at least about 6 μg/kg to about 15 μg/kg per day for a period of at least about 1 to at least about 5 consecutive or nonconsecutive days, followed by a rest period of at least about 9 consecutive days optionally wherein:
administration of the fusion protein for the first course of treatment and for the second course of treatment is for a period of 5 consecutive days or 5 non-consecutive days prior to a rest period of at least about 9 days, optionally wherein the rest period is at least about 16 days or wherein the rest period during the first course of treatment is about 9 consecutive days and wherein the rest period for the second course of treatment is about 16 or more consecutive days;
the second course of treatment begins at least about 24 hours or more after completion of the first course of treatment; and/or
the method further comprises a third course of treatment following the second course of treatment, optionally wherein:
the third course of treatment begins within about 24 hours or more after completion of the second course of treatment;
the method further comprises a fourth course of treatment following the third course of treatment, optionally wherein the fourth course of treatment begins about 24 hours or more after completion of the third course of treatment; and/or
wherein subsequent courses of treatment begin about 24 hours or more after completion of the prior course of treatment until the cancer is treated or until the patient is no longer benefitting from the treatment.
25-33. (canceled)
34. The method of claim 1 , further comprising co-administering to the patient a therapeutically effective amount of a therapeutic agent, optionally wherein the therapeutic agent is a PARP inhibitor, a cytotoxic agent, a chemotherapeutic agent, or an immune checkpoint inhibitor, optionally wherein the immune checkpoint inhibitor inhibits the interaction of PD-1 and PD-L1, optionally wherein the immune checkpoint inhibitor is pembrolizumab.
35-38. (canceled)
39. The method of claim 34 , wherein the fusion protein of SEQ ID NO: 1 is administered in at least two courses of treatment, the first course of treatment comprising administration by intravenous injection or infusion at a dose of at least about 6 μg/kg to about 15 μg/kg per day once a day for 1 to 5 days followed by a rest period of at least about 16 consecutive days followed by a second course of treatment comprising administering by intravenous injection or infusion at a dose of at least about 6 μg/kg to about 15 μg/kg per day for a period 1 to 5 consecutive days, followed by a rest period of at least about 16 consecutive days and wherein the pembrolizumab is co-administered once during the 1 to 5 days of administration during the first course and second course of treatment.
40. The method of claim 24 , wherein:
the fusion protein is administered once a day for at least about 2 consecutive days at least about 3 consecutive days, at least about 4 consecutive days, or at least about 5 consecutive days;
the fusion protein of SEQ D NO: 1 is administered once a day on non-consecutive days for no more than about 5 total non-consecutive of days of administration;
the second course of treatment begins at least about 24 hours or more after completion of the first course of treatment; and/or
the method further comprises a third course of treatment following the second course of treatment, optionally wherein:
the third course of treatment begins within about 24 hours or more after completion of the second course of treatment;
the method further comprises a fourth course of treatment following the third course of treatment, optionally wherein the fourth course of treatment begins about 24 hours or more after completion of the third course of treatment; and/or
wherein subsequent courses of treatment begin about 24 hours or more after completion of the prior course of treatment until the cancer is treated or until the patient is no longer benefitting from the treatment.
41-50. (canceled)
51. The method of claim 39 , wherein the pembrolizumab is co-administered prior to, simultaneously with, or subsequent to, administration of the fusion protein of SEQ ID NO:1, optionally wherein:
the pembrolizumab is co-administered in a separate composition from the fusion protein of SEQ ID NO: 1;
the pembrolizumab is co-administered in an amount of 200 mg by I.V. injection or infusion;
the pembrolizumab is administered on the first day of administration of the fusion protein of SEQ ID NO: 1 during the first course of treatment;
the pembrolizumab is administered on the first day of administration of the fusion protein of SEQ ID NO: 1 during the second course of treatment; and/or
the pembrolizumab is administered on the first day of administration of the fusion protein of SEQ ID NO: 1 during subsequent courses of treatment.
52-56. (canceled)
57. The method of claim 34 , resulting in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in T regulatory (Treg) cells, optionally wherein:
the dose dependent increase in circulating NK cells and CD8+ cells is greater than the non-dose dependent increase in Treg cells;
the patient has an improved safety profile as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment;
the patient has a lower risk of cytokine release syndrome as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment; and/or
the patient has a lower risk of capillary leak syndrome as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment.
58-72. (canceled)
73. A method of treating cancer in a patient comprising administering to the patient a dose of at least about 40 μg/kg to about 70 μg/kg per day of the fusion protein of SEQ ID NO: 1 once weekly.
74. The method of claim 71, wherein the daily dose is about 50 μg/kg to about 60 μg/kg.
75. The method of claim 73 , comprising administering to the patient a dose of at least about 50 μg/kg to about 60 μg/kg per day of the fusion protein of SEQ ID NO: 1 once weekly, resulting in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in circulating T regulatory (Treg) cells, and wherein the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) is greater compared to the increase in circulating NK cells and CD8+ cells relative to the increase in circulating T regulatory (Treg) in a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment, and
wherein the patient has a lower risk of capillary leak syndrome as compared to a patient receiving high dose recombinant human IL-2 (rhlL-2) treatment, optionally wherein the dose is administered by intravenous injection or infusion.
76. (canceled)
77. A pharmaceutical composition comprising about 0.4 to about 1 mg of the fusion protein of SEQ ID NO: 1.
78. A method of treating cancer in a patient comprising administering to the patient a daily dose of at least about 3 μg/kg to about 5.5 μg/kg of the fusion protein of SEQ ID NO: 1 wherein administration results in a dose dependent increase in circulating NK cells and CD8+ cells in a patient in the absence of a dose dependent increase in circulating T regulatory (Treg) cells and wherein the increase in circulating NK cells and CD8+ cells is greater relative to the increase in circulating T regulatory cells (Treg).
79-84. (canceled)
85. A method for treating cancer in a patient comprising intravenously administering to the patient a dose of at about 16 μg/kg/day to about 70 μg/kg/day of the fusion protein of SEQ ID NO: 1 or a corresponding fixed dose based on an about 60-70 kg adult or about 12 kg to 50 kg or more child.
86. The method of claim 85 , wherein:
the dose is about 16 μg/kg/day to about 50 μg/kg/day of the fusion protein of SEQ ID NO: 1 or a corresponding fixed dose based on an about 60-70 kg adult or about 12 kg to 50 kg or more child, optionally wherein the corresponding fixed dose is about 5 μg to about 3 mg;
the mean fold change from baseline (FCB) in IFN′ present in a patient's peripheral blood, serum or plasma is at least about 2-fold, at least about 3-fold, at least about 4-fold, or at least about 5-fold; and/or
the fusion protein of SEQ ID NO: 1 is administered on non-consecutive days, optionally wherein:
the fusion protein of SEQ ID NO: 1 is administered once every 7 days, once every 14 days or once every 21 days of a treatment cycle;
the fusion protein of SEQ ID NO: 1 is administered on days 1, 7, 14 and 21 of a treatment cycle;
the fusion protein of SEQ ID NO: 1 is administered on days 1 and 14 of a treatment cycle; or
the fusion protein of SEQ ID NO: 1 is administered on days 1 and 21 of a treatment cycle.
87-96. (canceled)
97. The method of claim 2 , wherein: the mean fold change from baseline in IL-6 is less than 4-fold; and/or the dose of the fusion protein of SEQ ID NO: 1 is about 6 μg/kg/day or about 8 μg/kg/day.
98-101. (canceled)
102. The method of claim 85 , wherein: the mean fold change from baseline in IL-6 is less than 4-fold; and/or the dose of the fusion protein of SEQ ID NO: 1 is about 30 μg/kg/day or about 50 μg/kg/day.
103. (canceled)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US16/898,008 US20210038684A1 (en) | 2019-06-11 | 2020-06-10 | Compositions and Methods for Cancer Immunotherapy |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201962860182P | 2019-06-11 | 2019-06-11 | |
US201962924356P | 2019-10-22 | 2019-10-22 | |
US201962932160P | 2019-11-07 | 2019-11-07 | |
US16/898,008 US20210038684A1 (en) | 2019-06-11 | 2020-06-10 | Compositions and Methods for Cancer Immunotherapy |
Publications (1)
Publication Number | Publication Date |
---|---|
US20210038684A1 true US20210038684A1 (en) | 2021-02-11 |
Family
ID=71092539
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/898,008 Pending US20210038684A1 (en) | 2019-06-11 | 2020-06-10 | Compositions and Methods for Cancer Immunotherapy |
US16/897,920 Active 2040-08-06 US11246906B2 (en) | 2019-06-11 | 2020-06-10 | Compositions and methods for subcutaneous administration of cancer immunotherapy |
US17/568,251 Active 2040-07-15 US11980652B2 (en) | 2019-06-11 | 2022-01-04 | Compositions and methods for subcutaneous administration of cancer immunotherapy |
Family Applications After (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/897,920 Active 2040-08-06 US11246906B2 (en) | 2019-06-11 | 2020-06-10 | Compositions and methods for subcutaneous administration of cancer immunotherapy |
US17/568,251 Active 2040-07-15 US11980652B2 (en) | 2019-06-11 | 2022-01-04 | Compositions and methods for subcutaneous administration of cancer immunotherapy |
Country Status (12)
Country | Link |
---|---|
US (3) | US20210038684A1 (en) |
EP (2) | EP3982998A1 (en) |
JP (2) | JP2022535610A (en) |
KR (2) | KR20220044481A (en) |
CN (2) | CN114423446A (en) |
AU (2) | AU2020291109A1 (en) |
BR (2) | BR112021024966A2 (en) |
CA (2) | CA3143097A1 (en) |
IL (2) | IL288754A (en) |
MA (1) | MA56176A (en) |
MX (2) | MX2021015354A (en) |
WO (2) | WO2020249687A1 (en) |
Cited By (36)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2021216920A1 (en) | 2020-04-22 | 2021-10-28 | Iovance Biotherapeutics, Inc. | Systems and methods for coordinating manufacturing of cells for patient-specific immunotherapy |
WO2021226085A1 (en) | 2020-05-04 | 2021-11-11 | Iovance Biotherapeutics, Inc. | Selection of improved tumor reactive t-cells |
WO2021226061A1 (en) | 2020-05-04 | 2021-11-11 | Iovance Biotherapeutics, Inc. | Processes for production of tumor infiltrating lymphocytes and uses of the same in immunotherapy |
WO2022076606A1 (en) | 2020-10-06 | 2022-04-14 | Iovance Biotherapeutics, Inc. | Treatment of nsclc patients with tumor infiltrating lymphocyte therapies |
WO2022076952A1 (en) | 2020-10-06 | 2022-04-14 | Iovance Biotherapeutics, Inc. | Treatment of nsclc patients with tumor infiltrating lymphocyte therapies |
WO2022125941A1 (en) | 2020-12-11 | 2022-06-16 | Iovance Biotherapeutics, Inc. | Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with braf inhibitors and/or mek inhibitors |
WO2022133140A1 (en) | 2020-12-17 | 2022-06-23 | Iovance Biotherapeutics, Inc. | Treatment with tumor infiltrating lymphocyte therapies in combination with ctla-4 and pd-1 inhibitors |
WO2022133149A1 (en) | 2020-12-17 | 2022-06-23 | Iovance Biotherapeutics, Inc. | Treatment of cancers with tumor infiltrating lymphocytes |
WO2022147196A2 (en) | 2020-12-31 | 2022-07-07 | Iovance Biotherapeutics, Inc. | Devices and processes for automated production of tumor infiltrating lymphocytes |
WO2022165260A1 (en) | 2021-01-29 | 2022-08-04 | Iovance Biotherapeutics, Inc. | Methods of making modified tumor infiltrating lymphocytes and their use in adoptive cell therapy |
WO2022170219A1 (en) | 2021-02-05 | 2022-08-11 | Iovance Biotherapeutics, Inc. | Adjuvant therapy for cancer |
WO2022187741A2 (en) | 2021-03-05 | 2022-09-09 | Iovance Biotherapeutics, Inc. | Tumor storage and cell culture compositions |
WO2022198141A1 (en) | 2021-03-19 | 2022-09-22 | Iovance Biotherapeutics, Inc. | Methods for tumor infiltrating lymphocyte (til) expansion related to cd39/cd69 selection and gene knockout in tils |
WO2022204564A2 (en) | 2021-03-25 | 2022-09-29 | Iovance Biotherapeutics, Inc. | Methods and compositions for t-cell coculture potency assays and use with cell therapy products |
WO2022212948A1 (en) * | 2021-04-02 | 2022-10-06 | Duke University | Methods for determining tumor immune status |
WO2022225981A2 (en) | 2021-04-19 | 2022-10-27 | Iovance Biotherapeutics, Inc. | Chimeric costimulatory receptors, chemokine receptors, and the use of same in cellular immunotherapies |
WO2022245754A1 (en) | 2021-05-17 | 2022-11-24 | Iovance Biotherapeutics, Inc. | Pd-1 gene-edited tumor infiltrating lymphocytes and uses of same in immunotherapy |
WO2023004074A2 (en) | 2021-07-22 | 2023-01-26 | Iovance Biotherapeutics, Inc. | Method for cryopreservation of solid tumor fragments |
WO2023009716A1 (en) | 2021-07-28 | 2023-02-02 | Iovance Biotherapeutics, Inc. | Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with kras inhibitors |
WO2023039488A1 (en) | 2021-09-09 | 2023-03-16 | Iovance Biotherapeutics, Inc. | Processes for generating til products using pd-1 talen knockdown |
WO2023049862A1 (en) | 2021-09-24 | 2023-03-30 | Iovance Biotherapeutics, Inc. | Expansion processes and agents for tumor infiltrating lymphocytes |
WO2023077015A2 (en) | 2021-10-27 | 2023-05-04 | Iovance Biotherapeutics, Inc. | Systems and methods for coordinating manufacturing of cells for patient-specific immunotherapy |
WO2023086803A1 (en) | 2021-11-10 | 2023-05-19 | Iovance Biotherapeutics, Inc. | Methods of expansion treatment utilizing cd8 tumor infiltrating lymphocytes |
WO2023147488A1 (en) | 2022-01-28 | 2023-08-03 | Iovance Biotherapeutics, Inc. | Cytokine associated tumor infiltrating lymphocytes compositions and methods |
WO2023147486A1 (en) | 2022-01-28 | 2023-08-03 | Iovance Biotherapeutics, Inc. | Tumor infiltrating lymphocytes engineered to express payloads |
EP4241790A1 (en) | 2022-03-07 | 2023-09-13 | InnaTher Gene Therapy S.à.r.l. | Expression system for the treatment of cancer |
EP4241791A1 (en) | 2022-03-07 | 2023-09-13 | InnaTher Gene Therapy S.à.r.l. | Combined gene and radio therapy for the treatment of cancer |
WO2023154894A3 (en) * | 2022-02-11 | 2023-09-21 | Alkermes Pharma Ireland Limited | Compositions and methods for cancer immunotherapy |
WO2023196877A1 (en) | 2022-04-06 | 2023-10-12 | Iovance Biotherapeutics, Inc. | Treatment of nsclc patients with tumor infiltrating lymphocyte therapies |
WO2023201369A1 (en) | 2022-04-15 | 2023-10-19 | Iovance Biotherapeutics, Inc. | Til expansion processes using specific cytokine combinations and/or akti treatment |
WO2023220608A1 (en) | 2022-05-10 | 2023-11-16 | Iovance Biotherapeutics, Inc. | Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with an il-15r agonist |
WO2024011114A1 (en) | 2022-07-06 | 2024-01-11 | Iovance Biotherapeutics, Inc. | Devices and processes for automated production of tumor infiltrating lymphocytes |
WO2024030758A1 (en) | 2022-08-01 | 2024-02-08 | Iovance Biotherapeutics, Inc. | Chimeric costimulatory receptors, chemokine receptors, and the use of same in cellular immunotherapies |
WO2024055017A1 (en) | 2022-09-09 | 2024-03-14 | Iovance Biotherapeutics, Inc. | Processes for generating til products using pd-1/tigit talen double knockdown |
WO2024055018A1 (en) | 2022-09-09 | 2024-03-14 | Iovance Biotherapeutics, Inc. | Processes for generating til products using pd-1/tigit talen double knockdown |
WO2024098027A1 (en) | 2022-11-04 | 2024-05-10 | Iovance Biotherapeutics, Inc. | Methods for tumor infiltrating lymphocyte (til) expansion related to cd39/cd103 selection |
Families Citing this family (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20210038684A1 (en) | 2019-06-11 | 2021-02-11 | Alkermes Pharma Ireland Limited | Compositions and Methods for Cancer Immunotherapy |
CN114555110A (en) * | 2019-10-18 | 2022-05-27 | 奥克梅斯制药爱尔兰有限公司 | Immunomodulatory IL-2 agents in combination with immune checkpoint inhibitors |
CA3175356A1 (en) * | 2020-04-15 | 2021-10-21 | Jared LOPES | Immunostimulatory agents in combination with angiogenesis inhibitors |
EP4135748A1 (en) * | 2020-04-15 | 2023-02-22 | Alkermes Pharma Ireland Limited | Immunostimulatory agents in combination with angiogenesis inhibitors |
CN115916242A (en) * | 2020-05-11 | 2023-04-04 | 奥克梅斯制药爱尔兰有限公司 | IL-2 fusion polypeptide compositions and methods of making and using the same |
CA3207652A1 (en) | 2021-03-26 | 2022-09-29 | Stephanie Cornen | Cytokine anchors for nkp46-binding nk cell engager proteins |
WO2022258691A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkg2d, a cytokine receptor, a tumour antigen and cd16a |
WO2022258678A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkp30, a cytokine receptor, a tumour antigen and cd16a |
CN117616050A (en) | 2021-06-09 | 2024-02-27 | 先天制药公司 | Multispecific proteins that bind to NKP46, cytokine receptor, tumor antigen and CD16A |
CN117003852A (en) * | 2022-07-07 | 2023-11-07 | 北京大学 | Topology modification of interleukin-2 and its application as autoimmune disease medicine |
Family Cites Families (53)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5766920A (en) | 1982-08-11 | 1998-06-16 | Cellcor, Inc. | Ex vivo activation of immune cells |
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
CN1007907B (en) * | 1985-04-30 | 1990-05-09 | 弗·哈夫曼-拉罗彻有限公司 | Purification of recombinant interleukin-2 |
WO1988000970A2 (en) | 1986-08-08 | 1988-02-11 | Regents Of The University Of Minnesota | Method of culturing leukocytes |
US5126132A (en) | 1989-08-21 | 1992-06-30 | The United States Of America As Represented By The Department Of Health And Human Services | Tumor infiltrating lymphocytes as a treatment modality for human cancer |
US5728388A (en) | 1989-10-03 | 1998-03-17 | Terman; David S. | Method of cancer treatment |
US6887471B1 (en) | 1991-06-27 | 2005-05-03 | Bristol-Myers Squibb Company | Method to inhibit T cell interactions with soluble B7 |
AU7478394A (en) | 1993-08-06 | 1995-02-28 | Cytel Corporation | Methods for (ex vivo) therapy using peptide-loaded antigen presenting cells for the activation of ctl |
US5827642A (en) | 1994-08-31 | 1998-10-27 | Fred Hutchinson Cancer Research Center | Rapid expansion method ("REM") for in vitro propagation of T lymphocytes |
JP3926842B2 (en) | 1995-03-08 | 2007-06-06 | ザ・スクリプス・リサーチ・インステイチユート | ANTIGEN PRESENTATION SYSTEM AND T-CELL ACTIVATION METHOD |
US6051227A (en) | 1995-07-25 | 2000-04-18 | The Regents Of The University Of California, Office Of Technology Transfer | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
US5855887A (en) | 1995-07-25 | 1999-01-05 | The Regents Of The University Of California | Blockade of lymphocyte down-regulation associated with CTLA-4 signaling |
JP2002515756A (en) | 1997-01-31 | 2002-05-28 | ヘモソル インク. | Method of producing selected lymphocytes |
AU6703198A (en) | 1997-03-21 | 1998-10-20 | Brigham And Women's Hospital | Immunotherapeutic ctla-4 binding peptides |
US6682736B1 (en) | 1998-12-23 | 2004-01-27 | Abgenix, Inc. | Human monoclonal antibodies to CTLA-4 |
ES2706547T3 (en) | 1998-12-23 | 2019-03-29 | Pfizer | Human monoclonal antibodies for CTLA-4 |
US7109003B2 (en) | 1998-12-23 | 2006-09-19 | Abgenix, Inc. | Methods for expressing and recovering human monoclonal antibodies to CTLA-4 |
NZ517202A (en) | 1999-08-24 | 2004-05-28 | Medarex Inc | Human CTLA-4 antibodies and their uses |
US7605238B2 (en) | 1999-08-24 | 2009-10-20 | Medarex, Inc. | Human CTLA-4 antibodies and their uses |
ATE362535T1 (en) | 2000-03-02 | 2007-06-15 | Univ Southern California | MUTATED CYCLIN G1 PROTEIN |
EP1417232B1 (en) | 2001-06-13 | 2014-12-03 | Genmab A/S | Human monoclonal antibodies to epidermal growth factor receptor (egfr) |
US7354928B2 (en) | 2001-11-01 | 2008-04-08 | The Regents Of The University Of Michigan | Small molecule inhibitors targeted at Bcl-2 |
PT1537878E (en) | 2002-07-03 | 2010-11-18 | Ono Pharmaceutical Co | Immunopotentiating compositions |
ES2367430T3 (en) | 2002-12-23 | 2011-11-03 | Wyeth Llc | ANTIBODIES AGAINST PD-1 AND ITS USES. |
US7435592B2 (en) | 2003-05-13 | 2008-10-14 | Immunovative Therapies, Ltd. | Compositions for allogeneic cell therapy |
US7402431B2 (en) | 2004-03-01 | 2008-07-22 | Immunovative Therapies, Ltd. | T-cell therapy formulation |
BRPI0413326A (en) | 2003-08-04 | 2006-10-10 | Bristol Myers Squibb Co | methods for treating cardiovascular disease by employing a soluble ctla4 molecule |
US20060057121A1 (en) | 2004-09-10 | 2006-03-16 | Demao Yang | Compositions and treatments using ex vivo activated cells for myelosuppressed patients |
RU2406760C3 (en) | 2005-05-09 | 2017-11-28 | Оно Фармасьютикал Ко., Лтд. | HUMAN MONOCLONAL ANTIBODIES TO PROGRAMMABLE DEATH 1 PROTECTION (PD-1) AND METHODS OF CANCER TREATMENT USING ANTI-PD-1-ANTI-BODY, INDEPENDENTLY OR IN COMBINATION WITH OTHER IMMUNETURAH AND I And I And I And I, In The Combine, I And I Do Not Allocate To Them, Combined With Other Overarching |
CN101248089A (en) | 2005-07-01 | 2008-08-20 | 米德列斯公司 | Human monoclonal antibodies to programmed death ligand 1(PD-L1) |
WO2007112453A2 (en) * | 2006-03-28 | 2007-10-04 | Neopro Labs, Llc | Methods amd compositions for treating conditions |
PT2066349E (en) | 2006-09-08 | 2012-07-02 | Medimmune Llc | Humanized anti-cd19 antibodies and their use in treatment of tumors, transplantation and autoimmune diseases |
SI2170959T1 (en) | 2007-06-18 | 2014-04-30 | Merck Sharp & Dohme B.V. | Antibodies to human programmed death receptor pd-1 |
WO2009100140A1 (en) | 2008-02-04 | 2009-08-13 | Medarex, Inc. | Anti-clta-4 antibodies with reduced blocking of binding of ctla-4 to b7 and uses thereof |
CA2736829C (en) | 2008-09-12 | 2018-02-27 | Isis Innovation Limited | Pd-1 specific antibodies and uses thereof |
AU2009290543B2 (en) | 2008-09-12 | 2015-09-03 | Oxford University Innovation Limited | PD-1 specific antibodies and uses thereof |
EP3133086B1 (en) | 2008-09-26 | 2018-08-01 | Dana-Farber Cancer Institute, Inc. | Human anti-pd-1, pd-l1, and pd-l2 antibodies and uses thereof |
CN104479018B (en) | 2008-12-09 | 2018-09-21 | 霍夫曼-拉罗奇有限公司 | Anti- PD-L1 antibody and they be used to enhance the purposes of T cell function |
JP5844159B2 (en) | 2009-02-09 | 2016-01-13 | ユニヴェルシテ デクス−マルセイユUniversite D’Aix−Marseille | PD-1 antibody and PD-L1 antibody and use thereof |
TW201134488A (en) | 2010-03-11 | 2011-10-16 | Ucb Pharma Sa | PD-1 antibodies |
RU2625034C2 (en) | 2011-04-20 | 2017-07-11 | МЕДИММЬЮН, ЭлЭлСи | Antibodies and other molecules binding b7-h1 and pd-1 |
US9844582B2 (en) | 2012-05-22 | 2017-12-19 | Massachusetts Institute Of Technology | Synergistic tumor treatment with extended-PK IL-2 and therapeutic agents |
EP3553086A1 (en) | 2012-05-31 | 2019-10-16 | Sorrento Therapeutics Inc. | Antigen binding proteins that bind pd-l1 |
JP6234446B2 (en) * | 2012-06-08 | 2017-11-22 | アルカーメス,インコーポレイテッド | Fusion polypeptide comprising an active protein linked to a mucin domain polypeptide |
CN109395064A (en) * | 2013-04-19 | 2019-03-01 | 赛腾制药 | The derivative treatment of the cell factor of reduced vascular leak syndrome |
CA3080200A1 (en) | 2013-09-13 | 2015-03-19 | Beigene Switzerland Gmbh | Anti-pd1 antibodies and their use as therapeutics and diagnostics |
MA40094B1 (en) * | 2014-08-06 | 2022-05-31 | Univ Miami | Interleukin-2/interleukin-2 alpha receptor fusion proteins and methods of use |
AU2015364396B2 (en) * | 2014-12-19 | 2018-08-09 | Alkermes, Inc. | Single chain Fc fusion proteins |
CN106552259B (en) * | 2015-09-24 | 2022-03-29 | 中国科学院上海巴斯德研究所 | Fusion protein and application thereof in treating diseases |
GB201712032D0 (en) * | 2017-07-26 | 2017-09-06 | Bioinvent Int Ab | Antibodies and uses thereof |
JP2021502423A (en) | 2017-11-13 | 2021-01-28 | バイオエクセル セラピューティクス,インコーポレイテッド | Methods and Compositions for Treating Cancer by Modifying Multiple Arms of the Immune System |
US20210038684A1 (en) | 2019-06-11 | 2021-02-11 | Alkermes Pharma Ireland Limited | Compositions and Methods for Cancer Immunotherapy |
-
2020
- 2020-06-10 US US16/898,008 patent/US20210038684A1/en active Pending
- 2020-06-10 US US16/897,920 patent/US11246906B2/en active Active
- 2020-06-11 CA CA3143097A patent/CA3143097A1/en active Pending
- 2020-06-11 AU AU2020291109A patent/AU2020291109A1/en active Pending
- 2020-06-11 JP JP2021573568A patent/JP2022535610A/en active Pending
- 2020-06-11 KR KR1020227000553A patent/KR20220044481A/en unknown
- 2020-06-11 MA MA056176A patent/MA56176A/en unknown
- 2020-06-11 WO PCT/EP2020/066226 patent/WO2020249687A1/en unknown
- 2020-06-11 BR BR112021024966A patent/BR112021024966A2/en unknown
- 2020-06-11 CN CN202080055682.XA patent/CN114423446A/en active Pending
- 2020-06-11 AU AU2020292590A patent/AU2020292590A1/en active Pending
- 2020-06-11 MX MX2021015354A patent/MX2021015354A/en unknown
- 2020-06-11 KR KR1020227000547A patent/KR20220044480A/en unknown
- 2020-06-11 CA CA3143098A patent/CA3143098A1/en active Pending
- 2020-06-11 EP EP20732576.2A patent/EP3982998A1/en active Pending
- 2020-06-11 EP EP20732575.4A patent/EP3983530A1/en active Pending
- 2020-06-11 JP JP2021573569A patent/JP2022535972A/en active Pending
- 2020-06-11 BR BR112021025035A patent/BR112021025035A2/en unknown
- 2020-06-11 WO PCT/EP2020/066234 patent/WO2020249693A1/en unknown
- 2020-06-11 MX MX2021015353A patent/MX2021015353A/en unknown
- 2020-06-11 CN CN202080056860.0A patent/CN114555126A/en active Pending
-
2021
- 2021-12-07 IL IL288754A patent/IL288754A/en unknown
- 2021-12-07 IL IL288756A patent/IL288756A/en unknown
-
2022
- 2022-01-04 US US17/568,251 patent/US11980652B2/en active Active
Non-Patent Citations (2)
Title |
---|
Nair et al. ("A simple practice guide for dose conversion between animals and human." J Basic Clin Pharm. 2016 Mar;7(2):27-31) (Year: 2016) * |
Vaishampayan et al. ("A phase I trial of ALKS 4230, an engineered cytokine activator of NK and effector T cells, in patients with advanced solid tumors." Journal of Clinical Oncology 2017 35:15_suppl, TPS3111-TPS3111) (Year: 2017) * |
Cited By (39)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2021216920A1 (en) | 2020-04-22 | 2021-10-28 | Iovance Biotherapeutics, Inc. | Systems and methods for coordinating manufacturing of cells for patient-specific immunotherapy |
WO2021226085A1 (en) | 2020-05-04 | 2021-11-11 | Iovance Biotherapeutics, Inc. | Selection of improved tumor reactive t-cells |
WO2021226061A1 (en) | 2020-05-04 | 2021-11-11 | Iovance Biotherapeutics, Inc. | Processes for production of tumor infiltrating lymphocytes and uses of the same in immunotherapy |
WO2022076606A1 (en) | 2020-10-06 | 2022-04-14 | Iovance Biotherapeutics, Inc. | Treatment of nsclc patients with tumor infiltrating lymphocyte therapies |
WO2022076952A1 (en) | 2020-10-06 | 2022-04-14 | Iovance Biotherapeutics, Inc. | Treatment of nsclc patients with tumor infiltrating lymphocyte therapies |
WO2022125941A1 (en) | 2020-12-11 | 2022-06-16 | Iovance Biotherapeutics, Inc. | Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with braf inhibitors and/or mek inhibitors |
WO2022133140A1 (en) | 2020-12-17 | 2022-06-23 | Iovance Biotherapeutics, Inc. | Treatment with tumor infiltrating lymphocyte therapies in combination with ctla-4 and pd-1 inhibitors |
WO2022133149A1 (en) | 2020-12-17 | 2022-06-23 | Iovance Biotherapeutics, Inc. | Treatment of cancers with tumor infiltrating lymphocytes |
WO2022147196A2 (en) | 2020-12-31 | 2022-07-07 | Iovance Biotherapeutics, Inc. | Devices and processes for automated production of tumor infiltrating lymphocytes |
WO2022165260A1 (en) | 2021-01-29 | 2022-08-04 | Iovance Biotherapeutics, Inc. | Methods of making modified tumor infiltrating lymphocytes and their use in adoptive cell therapy |
WO2022170219A1 (en) | 2021-02-05 | 2022-08-11 | Iovance Biotherapeutics, Inc. | Adjuvant therapy for cancer |
WO2022187741A2 (en) | 2021-03-05 | 2022-09-09 | Iovance Biotherapeutics, Inc. | Tumor storage and cell culture compositions |
WO2022198141A1 (en) | 2021-03-19 | 2022-09-22 | Iovance Biotherapeutics, Inc. | Methods for tumor infiltrating lymphocyte (til) expansion related to cd39/cd69 selection and gene knockout in tils |
WO2022204564A2 (en) | 2021-03-25 | 2022-09-29 | Iovance Biotherapeutics, Inc. | Methods and compositions for t-cell coculture potency assays and use with cell therapy products |
WO2022212948A1 (en) * | 2021-04-02 | 2022-10-06 | Duke University | Methods for determining tumor immune status |
WO2022225981A2 (en) | 2021-04-19 | 2022-10-27 | Iovance Biotherapeutics, Inc. | Chimeric costimulatory receptors, chemokine receptors, and the use of same in cellular immunotherapies |
WO2022245754A1 (en) | 2021-05-17 | 2022-11-24 | Iovance Biotherapeutics, Inc. | Pd-1 gene-edited tumor infiltrating lymphocytes and uses of same in immunotherapy |
WO2023004074A2 (en) | 2021-07-22 | 2023-01-26 | Iovance Biotherapeutics, Inc. | Method for cryopreservation of solid tumor fragments |
WO2023009716A1 (en) | 2021-07-28 | 2023-02-02 | Iovance Biotherapeutics, Inc. | Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with kras inhibitors |
WO2023039488A1 (en) | 2021-09-09 | 2023-03-16 | Iovance Biotherapeutics, Inc. | Processes for generating til products using pd-1 talen knockdown |
WO2023049862A1 (en) | 2021-09-24 | 2023-03-30 | Iovance Biotherapeutics, Inc. | Expansion processes and agents for tumor infiltrating lymphocytes |
WO2023077015A2 (en) | 2021-10-27 | 2023-05-04 | Iovance Biotherapeutics, Inc. | Systems and methods for coordinating manufacturing of cells for patient-specific immunotherapy |
WO2023086803A1 (en) | 2021-11-10 | 2023-05-19 | Iovance Biotherapeutics, Inc. | Methods of expansion treatment utilizing cd8 tumor infiltrating lymphocytes |
WO2023147488A1 (en) | 2022-01-28 | 2023-08-03 | Iovance Biotherapeutics, Inc. | Cytokine associated tumor infiltrating lymphocytes compositions and methods |
WO2023147486A1 (en) | 2022-01-28 | 2023-08-03 | Iovance Biotherapeutics, Inc. | Tumor infiltrating lymphocytes engineered to express payloads |
WO2023154894A3 (en) * | 2022-02-11 | 2023-09-21 | Alkermes Pharma Ireland Limited | Compositions and methods for cancer immunotherapy |
WO2023170087A1 (en) | 2022-03-07 | 2023-09-14 | Innather Gene Therapy S. À R.L. | Expression system for the treatment of cancer |
WO2023170078A1 (en) | 2022-03-07 | 2023-09-14 | Innather Gene Therapy S. À R.L. | Combined gene and radio therapy for the treatment of cancer |
EP4241790A1 (en) | 2022-03-07 | 2023-09-13 | InnaTher Gene Therapy S.à.r.l. | Expression system for the treatment of cancer |
EP4241791A1 (en) | 2022-03-07 | 2023-09-13 | InnaTher Gene Therapy S.à.r.l. | Combined gene and radio therapy for the treatment of cancer |
WO2023196877A1 (en) | 2022-04-06 | 2023-10-12 | Iovance Biotherapeutics, Inc. | Treatment of nsclc patients with tumor infiltrating lymphocyte therapies |
US11981921B2 (en) | 2022-04-15 | 2024-05-14 | Iovance Biotherapeutics, Inc. | TIL expansion processes using specific cytokine combinations and/or AKTi treatment |
WO2023201369A1 (en) | 2022-04-15 | 2023-10-19 | Iovance Biotherapeutics, Inc. | Til expansion processes using specific cytokine combinations and/or akti treatment |
WO2023220608A1 (en) | 2022-05-10 | 2023-11-16 | Iovance Biotherapeutics, Inc. | Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with an il-15r agonist |
WO2024011114A1 (en) | 2022-07-06 | 2024-01-11 | Iovance Biotherapeutics, Inc. | Devices and processes for automated production of tumor infiltrating lymphocytes |
WO2024030758A1 (en) | 2022-08-01 | 2024-02-08 | Iovance Biotherapeutics, Inc. | Chimeric costimulatory receptors, chemokine receptors, and the use of same in cellular immunotherapies |
WO2024055017A1 (en) | 2022-09-09 | 2024-03-14 | Iovance Biotherapeutics, Inc. | Processes for generating til products using pd-1/tigit talen double knockdown |
WO2024055018A1 (en) | 2022-09-09 | 2024-03-14 | Iovance Biotherapeutics, Inc. | Processes for generating til products using pd-1/tigit talen double knockdown |
WO2024098027A1 (en) | 2022-11-04 | 2024-05-10 | Iovance Biotherapeutics, Inc. | Methods for tumor infiltrating lymphocyte (til) expansion related to cd39/cd103 selection |
Also Published As
Publication number | Publication date |
---|---|
MX2021015354A (en) | 2022-04-11 |
CA3143098A1 (en) | 2020-12-17 |
EP3982998A1 (en) | 2022-04-20 |
CN114555126A (en) | 2022-05-27 |
BR112021024966A2 (en) | 2022-02-15 |
CN114423446A (en) | 2022-04-29 |
IL288754A (en) | 2022-02-01 |
JP2022535610A (en) | 2022-08-09 |
IL288756A (en) | 2022-02-01 |
JP2022535972A (en) | 2022-08-10 |
EP3983530A1 (en) | 2022-04-20 |
US11980652B2 (en) | 2024-05-14 |
KR20220044481A (en) | 2022-04-08 |
US20210052694A1 (en) | 2021-02-25 |
WO2020249693A1 (en) | 2020-12-17 |
MX2021015353A (en) | 2022-04-07 |
BR112021025035A2 (en) | 2022-02-22 |
MA56176A (en) | 2022-04-20 |
CA3143097A1 (en) | 2020-12-17 |
KR20220044480A (en) | 2022-04-08 |
US20220241370A1 (en) | 2022-08-04 |
WO2020249687A1 (en) | 2020-12-17 |
US11246906B2 (en) | 2022-02-15 |
AU2020292590A1 (en) | 2022-02-03 |
AU2020291109A1 (en) | 2022-02-03 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20210038684A1 (en) | Compositions and Methods for Cancer Immunotherapy | |
JP2021502423A (en) | Methods and Compositions for Treating Cancer by Modifying Multiple Arms of the Immune System | |
US20180128833A1 (en) | Methods of treating with tumor membrane vesicle-based immunotherapy and predicting therapeutic response thereto | |
US20230181633A1 (en) | Methods of treating cancer using a combination of tumor membrane vesicles and metformin | |
US20210338656A1 (en) | Immunostimulatory agents in combination with angiogenesis inhibitors | |
WO2023154894A2 (en) | Compositions and methods for cancer immunotherapy | |
US11834483B2 (en) | Immunostimulatory agents in combination with angiogenesis inhibitors | |
US20230064990A1 (en) | Dosing regimens and methods for treating cancer | |
CN110678192A (en) | Oncolytic vaccinia virus in combination therapy with immune checkpoint inhibitors |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: APPLICATION DISPATCHED FROM PREEXAM, NOT YET DOCKETED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |