US20180264095A1 - Population-based immunogenic peptide identification platform - Google Patents

Population-based immunogenic peptide identification platform Download PDF

Info

Publication number
US20180264095A1
US20180264095A1 US15/910,965 US201815910965A US2018264095A1 US 20180264095 A1 US20180264095 A1 US 20180264095A1 US 201815910965 A US201815910965 A US 201815910965A US 2018264095 A1 US2018264095 A1 US 2018264095A1
Authority
US
United States
Prior art keywords
cell epitope
antigen
hla class
molecules
subjects
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US15/910,965
Inventor
Julianna Lisziewicz
Levente Molnár
Enikõ R. TÖKE
József Toth
Orsolya Lorincz
Zsolt Csiszovszki
Eszter Somogyi
Katalin Pántya
Mónika Megyesi
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Treos Bio Ltd
Original Assignee
Treos Bio Zrt
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=61386864&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=US20180264095(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority claimed from EP17159242.1A external-priority patent/EP3369431A1/en
Priority claimed from EP17159243.9A external-priority patent/EP3370065A1/en
Priority claimed from GBGB1703809.2A external-priority patent/GB201703809D0/en
Application filed by Treos Bio Zrt filed Critical Treos Bio Zrt
Assigned to TREOS BIO ZRT. reassignment TREOS BIO ZRT. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: CSISZOVSZKI, ZSOLT, DR., LISZIEWICZ, JULIANNA, DR., LORINCZ, ORSOLYA, DR., MEGYESI, Mónika, MOLNÁR, Levente, PÁNTYA, Katalin, SOMOGYI, ESZTER, DR., TOKE, ENIKO R., DR., TOTH, József
Publication of US20180264095A1 publication Critical patent/US20180264095A1/en
Assigned to TREOS BIO LIMITED reassignment TREOS BIO LIMITED ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: TREOS BIO ZRT.
Priority to US17/454,225 priority Critical patent/US20220072114A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001184Cancer testis antigens, e.g. SSX, BAGE, GAGE or SAGE
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/39Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/6415Toxins or lectins, e.g. clostridial toxins or Pseudomonas exotoxins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/646Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the entire peptide or protein drug conjugate elicits an immune response, e.g. conjugate vaccines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6869Methods for sequencing
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5044Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
    • G01N33/5047Cells of the immune system
    • G01N33/505Cells of the immune system involving T-cells
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56966Animal cells
    • G01N33/56977HLA or MHC typing
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57484Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
    • GPHYSICS
    • G16INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16BBIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B15/00ICT specially adapted for analysing two-dimensional or three-dimensional molecular structures, e.g. structural or functional relations or structure alignment
    • G16B15/30Drug targeting using structural data; Docking or binding prediction
    • GPHYSICS
    • G16INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16BBIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B40/00ICT specially adapted for biostatistics; ICT specially adapted for bioinformatics-related machine learning or data mining, e.g. knowledge discovery or pattern finding
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55505Inorganic adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55544Bacterial toxins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55566Emulsions, e.g. Freund's adjuvant, MF59
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55588Adjuvants of undefined constitution
    • A61K2039/55594Adjuvants of undefined constitution from bacteria
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/58Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
    • A61K2039/585Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/605MHC molecules or ligands thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6075Viral proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/70Multivalent vaccine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0002Fungal antigens, e.g. Trichophyton, Aspergillus, Candida
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0008Antigens related to auto-immune diseases; Preparations to induce self-tolerance
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/52Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis

Definitions

  • the disclosure relates to methods of predicting whether a polypeptide is immunogenic for a specific human subject, methods of identifying fragments of a polypeptide that are immunogenic for a specific human subject, methods of preparing precision pharmaceutical compositions or kits comprising such polypeptide fragments, human subject-specific pharmaceutical compositions comprising such polypeptide fragments, and methods of treatment using such compositions.
  • peptides In antigen presenting cells (APC) protein antigens are processed into peptides. These peptides bind to human leukocyte antigen molecules (HLAs) and are presented on the cell surface as peptide-HLA complexes to T cells. Different individuals express different HLA molecules and different HLA molecules present different peptides. Therefore, according to the state of the art, a peptide, or a fragment of a larger polypeptide, is identified as immunogenic for a specific human subject if it is presented by a HLA molecule that is expressed by the subject. In other words, the state of the art describes immunogenic peptides as HLA-restricted epitopes.
  • HLA restricted epitopes induce T cell responses in only a fraction of individuals who express the HLA molecule. Peptides that activate a T cell response in one individual are inactive in others despite HLA allele matching. Therefore, it was unknown how an individual's HLA molecules present the antigen-derived epitopes that positively activate T cell responses.
  • the fragments of a polypeptide antigen that are immunogenic for a specific individual are those that can bind to multiple class I (activate cytotoxic T cells) or class II (activate helper T cells) HLAs expressed by that individual.
  • the disclosure provides a method of predicting the cytotoxic T cell response rate and/or the helper T cell response rate of a specific or target human population to administration of a polypeptide, or to administration of a pharmaceutical composition, kit or panel of polypeptides comprising one or more polypeptides as active ingredients, the method comprising
  • the disclosure further provides a method of predicting the clinical response rate of a specific or target human population to administration of a pharmaceutical composition, kit or panel of polypeptides comprising one or more polypeptides as active ingredients, the method comprising
  • the disclosure further provides methods of treatment of a human subject in need thereof, the method comprising administering to the subject a polypeptide, pharmaceutical composition or kit of the polypeptides of a panel of polypeptides that has been identified or selected based on the predicted immune or clinical response rate determined as described above; their use in a method of treatment of a relevant human subject; and their use in the manufacture of a medicament for treating a relevant subject.
  • the disclosure also provides a method of designing or preparing a polypeptide, or a polynucleic acid that encodes a polypeptide, for use in a method of inducing an immune response in a subject of a specific or target human population, the method comprising
  • the disclosure provides a method of inducing an immune response in a subject of a specific or target human population, the method comprising designing or preparing a polypeptide, a panel of polypeptides, a polynucleic acid encoding a polypeptide, or a pharmaceutical composition or kit for use in said specific or target human population as described above and administering the polypeptide(s), polynucleic acid, pharmaceutical composition or the active ingredient polypeptides of the kit to the subject.
  • the disclosure provides a polypeptide, panel of polypeptides, polynucleic acid, pharmaceutical composition or kit for use in a method of inducing an immune response in a subject of a specific or target human population, wherein the polypeptide, panel of polypeptides, polynucleic acid, pharmaceutical composition or kit is designed or prepared as described above for use in said specific or target human population, and wherein the composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • compositions, panel of polypeptides or kit for use in a method of inducing an immune response in a human subject
  • the pharmaceutical composition, panel of polypeptides or kit comprises as active ingredients a first and a second and optionally one or more additional peptides, wherein each peptide comprises an amino acid sequence that is a T cell epitope capable of binding to at least three HLA class I molecules of at least 10% of human subjects, wherein the T cell epitope of the first, second and optionally any additional regions are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • the disclosure provides a pharmaceutical composition, panel of polypeptides or kit for use in a method of inducing an immune response in a human subject, wherein the pharmaceutical composition, panel of polypeptides or kit comprises an active ingredient polypeptide comprising a first region and a second region and optionally one or more additional regions, wherein each region comprises an amino acid sequence that is a T cell epitope capable of binding to at least three HLA class I molecules of at least 10% of human subjects, wherein the T cell epitope of the first, second and optionally any additional regions are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • the disclosure provides a pharmaceutical composition, panel of polypeptides or kit for use in a method treating a cancer in a subject in need thereof, wherein the pharmaceutical composition, panel of polypeptides or kit comprises as active ingredients a first and a second peptide and optionally one or more additional peptides, wherein each peptide comprises an amino acid sequence that is an HLA class I-binding T cell epitope, and wherein for each said T cell epitope at least 10% of human subjects having cancer both
  • the disclosure provides a pharmaceutical composition, panel of polypeptides or kit for use in a method treating a cancer in a subject in need thereof, wherein the pharmaceutical composition, panel of polypeptides or kit comprises an active ingredient polypeptide comprising a first and a second region and optionally one or more additional regions, wherein each region comprises an amino acid sequence that is an HLA class I-binding T cell epitope, and wherein for each said T cell epitope at least 10% of human subjects having cancer both
  • the disclosure provides a pharmaceutical composition, panel of polypeptides or kit for use in a method treating a cancer selected from colorectal, breast, ovarian, melanoma, non-melanoma skin, lung, prostate, kidney, bladder, stomach, liver, cervix uteri, oesophagus, non-Hodgkin lymphoma, leukemia, pancreas, corpus uteri, lip, oral cavity, thyroid, brain, nervous system, gallbladder, larynx, pharynx, myeloma, nasopharynx, Hodgkin lymphoma, testis and Kaposi sarcoma in a subject in need thereof, wherein the pharmaceutical composition, panel of polypeptides or kit comprises as active ingredients a first and a second peptide and optionally one or more additional polypeptides, wherein each peptide comprises an amino acid sequence that is an HLA class I-binding T cell epitope, and wherein for each said T cell epi
  • the disclosure provides a pharmaceutical composition, panel of polypeptides or kit for use in a method treating a cancer selected from colorectal, breast, ovarian, melanoma, non-melanoma skin, lung, prostate, kidney, bladder, stomach, liver, cervix uteri, oesophagus, non-Hodgkin lymphoma, leukemia, pancreas, corpus uteri, lip, oral cavity, thyroid, brain, nervous system, gallbladder, larynx, pharynx, myeloma, nasopharynx, Hodgkin lymphoma, testis and Kaposi sarcoma in a subject in need thereof, wherein the pharmaceutical composition, panel of polypeptides or kit comprises an active ingredient polypeptide comprising a first and a second region and optionally one or more additional regions, wherein each region comprises an amino acid sequence that is an HLA class I-binding T cell epitope, and wherein for each said T cell epitope
  • the disclosure provides a method of treatment of a human subject in need thereof, the method comprising administering to the subject a polypeptide, a panel of polypeptides, a pharmaceutical composition or the active ingredient polypeptides of a kit described above, wherein the subject has been determined to express at least three HLA class I molecules and/or at least three HLA class II molecules capable of binding to the polypeptide or to one or more of the active ingredient polypeptides of the pharmaceutical composition or kit.
  • the invention provides a system comprising
  • compositions for treatment of a disease or disorder in a subject of a target human population comprising one or more polypeptides, each comprising at least a first region and a second region, (a) the first region being of 10-50 amino acids in length comprising a first amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and (b) the second region being of 10-50 amino acids in length comprising a second amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; wherein the amino acid sequence of the T cell epitope of each of first and second regions comprise different sequences.
  • the composition comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, or at least 12 different polypeptides. In some embodiments, the composition comprises 2-40 different polypeptides.
  • the T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population comprises 7 to 11 amino acids, and/or the T cell epitope that binds at least three HLA class II molecules of at least 10% of subjects in the target population comprises 13 to 17 amino acids.
  • the first region of 10-50 amino acids in length is from an antigen; and the second region of 10-50 amino acids in length is from a same or different antigen.
  • the epitopes of the first and second regions are from a single antigen. In some embodiments, the epitopes of the first and second regions are from two or more different antigens.
  • the antigen is a cancer-associated antigen, a tumor-associated antigen, or an antigen expressed by a target pathogenic organism, an antigen expressed by a virus, an antigen expressed by a bacterium, an antigen expressed by a fungus, an antigen associated with an autoimmune disorder, or is an allergen. In some embodiments, the antigen is selected from the antigens listed in Tables 2 to 7.
  • the two or more different antigens are selected from the antigens listed in Tables 2 to 7 and/or different cancer associated antigens.
  • one or more of the antigens are cancer testis antigens (CTAs).
  • the one or more polypeptides further comprise up to 10 amino acids flanking the T cell epitope that are not part of a consecutive sequence flanking the epitope in a corresponding antigen.
  • the one or more polypeptides have been screened to eliminate substantially all neoepitopes that span a junction between the first region and second region and that (i) corresponds to a fragment of a human polypeptide expressed in healthy cells; (ii) is a T cell epitope capable of binding to at least three HLA class I molecules of at least 10% of subjects in the target population; or (iii) meets both requirements (i) and (ii).
  • the target population is cancer patients and wherein each of the first region and second region comprises an amino acid sequence that is an HLA class I-binding T cell epitope, and wherein for each T cell epitope, at least 10% of subjects in the target population express a tumor associated antigen selected from the antigens listed in Table 2 that comprises the T cell epitope; and at least 10% of subjects in the target population have at least three HLA class I molecules capable of binding to the T cell epitope; wherein the T cell epitope of the first and second regions are different from each other.
  • the composition further comprises a pharmaceutically acceptable adjuvant, diluent, carrier, preservative, or combination thereof.
  • the adjuvant is selected from the group consisting of Montanide ISA-51, QS-21, GM-CSF, cyclophosamide, bacillus Calmette-Guerin (BCG), corynbacterium parvum , levamisole, azimezone, isoprinisone, dinitrochlorobenezene (DNCB), keyhole limpet hemocyanins (KLH), Freunds adjuvant (complete), Freunds adjuvant (incomplete), mineral gels, aluminum hydroxide (Alum), lysolecithin, pluronic polyols, polyanions, oil emulsions, dinitrophenol, diphtheria toxin (DT), and combinations thereof.
  • kits comprising, one or more separate containers each container comprising: (i) one or more polypeptides comprising at least a first region and a second region, (a) the first region of 10-50 amino acids in length comprising a first amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and (b) the second region of 10-50 amino acids in length comprising a second amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; wherein the amino acid sequence of the T cell epitope of each of first and second regions comprise different sequences and (ii) a pharmaceutically acceptable adjuvant, diluent, carrier, preservative, or combination thereof.
  • compositions comprising: one or more nucleic acid molecules expressing one or more polypeptides comprising at least a first region and a second region, (a) the first region of 10-50 amino acids in length comprising a first amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and (b) the second region of 10-50 amino acids in length comprising a second amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; wherein the amino acid sequence of the T cell epitope of each of first and second regions comprise different sequences.
  • a polypeptide or a polynucleic acid that encodes a polypeptide, for use in a method of inducing an immune response in a subject of a target human population, the method comprising:
  • Disclosed herein in certain embodiments are methods of inducing an immune response in a subject of a target human population, the method comprising, administering to the subject a pharmaceutical composition comprising one or more polypeptides comprising at least a first region and a second region, (a) the first region being of 10-50 amino acids in length comprising a first amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and (b) the second region being of 10-50 amino acids in length comprising a second amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; wherein the amino acid sequence of the T cell epitope of each of first and second regions comprise different sequences.
  • the method further comprises prior to the administering step, determining if the subject is likely to have an have a clinical response to administration of a pharmaceutical composition by (i) assaying a biological sample of the subject to determine HLA genotype of the subject; (ii) determining that the pharmaceutical composition comprises two or more sequences that are a T cell epitope capable of binding to at least three HLA class I molecules of the subject; and (iii) determining the probability that a tumor of the subject expresses one or more antigen corresponding to the T cell epitopes identified in step (ii) using population expression data for each antigen, to identify the likelihood of the subject to have a clinical response to administration of the pharmaceutical composition.
  • the first region of 10-50 amino acids in length is from an antigen; and the second region of 10-50 amino acids in length is from a same or different antigen.
  • the epitopes of the first and second regions are from two or more different antigens.
  • the antigen is a cancer-associated antigen, a tumor-associated antigen, or an antigen expressed by a target pathogenic organism, an antigen expressed by a virus, an antigen expressed by a bacterium, an antigen expressed by a fungus, an antigen associated with an autoimmune disorder, or is an allergen.
  • the T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population comprises 7 to 11 amino acids, and/or the T cell epitope that binds at least three HLA class II molecules of at least 10% of subjects in the target population comprises 13 to 17 amino acids.
  • compositions for treatment of a disease or disorder in a subject of a target human population comprising (a) at least two polypeptides, each of the at least two polypeptides being 10-50 amino acids in length comprising an amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population, and/or at least three HLA class II molecules of at least 10% of subjects in the target population, wherein the amino acid sequence of the T cell epitope of each of the at least two polypeptides are different from each other; and (b) a pharmaceutically-acceptable adjuvant.
  • the composition comprises at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, or at least 12 different polypeptides. In some embodiments, the composition comprises 3-40 different polypeptides.
  • the T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population comprises 7 to 11 amino acids, and/or the T cell epitope that binds at least three HLA class II molecules of at least 10% of subjects in the target population comprises 13 to 17 amino acids.
  • the epitopes of the amino acid sequences of the at least two polypeptides are from a single antigen.
  • the epitopes of the amino acid sequences of the at least two polypeptides are from two or more different antigens.
  • the antigen is a cancer-associated antigen, a tumor-associated antigen, or an antigen expressed by a target pathogenic organism, an antigen expressed by a virus, an antigen expressed by a bacterium, an antigen expressed by a fungus, an antigen associated with an autoimmune disorder, or is an allergen.
  • the antigen is selected from the antigens listed in Tables 2 to 7.
  • the two or more different antigens are selected from the antigens listed in Tables 2 to 7 and/or different cancer associated antigens.
  • one or more of the antigens are cancer testis antigens (CTAs).
  • CTAs cancer testis antigens
  • each of the at least two polypeptides being 10-50 amino acids in length is from an antigen a same or different antigen.
  • the at least two different polypeptides further comprise up to 10 amino acids flanking the T cell epitope that are not part of a consecutive sequence flanking the epitope in a corresponding antigen.
  • two of the at least two polypeptides are arranged end to end or overlapping in a joined polypeptide.
  • two or more different joined polypeptides, wherein the two or more different joined polypeptides comprise different epitopes from each other.
  • the joined polypeptides have been screened to eliminate substantially all neoepitopes that span a junction between the two polypeptides and that (i) corresponds to a fragment of a human polypeptide expressed in healthy cells; (ii) is a T cell epitope capable of binding to at least three HLA class I molecules of at least 10% of subjects in the target population; or (iii) meets both requirements (i) and (ii).
  • the target population is cancer patients and wherein each polypeptide comprises an amino acid sequence that is an HLA class I-binding T cell epitope, and wherein for each T cell epitope, at least 10% of subjects in the target population express a tumor associated antigen selected from the antigens listed in Table 2 that comprises the T cell epitope; and at least 10% of subjects in the target population have at least three HLA class I molecules capable of binding to the T cell epitope; wherein the T cell epitope of the at least two polypeptides are different from each other.
  • the composition further comprises a pharmaceutically acceptable diluent, carrier, preservative, or combination thereof.
  • the adjuvant is selected from the group consisting of Montanide ISA-51, QS-21, GM-CSF, cyclophosamide, bacillus Calmette-Guerin (BCG), corynbacterium parvum , levamisole, azimezone, isoprinisone, dinitrochlorobenezene (DNCB), keyhole limpet hemocyanins (KLH), Freunds adjuvant (complete), Freunds adjuvant (incomplete), mineral gels, aluminum hydroxide (Alum), lysolecithin, pluronic polyols, polyanions, oil emulsions, dinitrophenol, diphtheria toxin (DT), and combinations thereof.
  • compositions for treatment of a disease or disorder in a subject of a target human population comprising (a) a polypeptide of 10-50 amino acids in length and comprising a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and (b) a pharmaceutically-acceptable adjuvant.
  • the composition comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, or at least 12 different polypeptides, each of the different polypeptides being 10-50 amino acids in length comprising a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population, wherein the amino acid sequence of the T cell epitope of each of the different polypeptides are different from each other.
  • the composition comprises 2-40 different polypeptides.
  • the T cell epitope that binds at least three HLA class I molecules of the subject comprises 7 to 11 amino acids, and/or the T cell epitope that binds at least three HLA class II molecules comprises 13 to 17 amino acids.
  • the composition comprises at least two different polypeptides, wherein the epitopes of the at least two different polypeptides are from a single antigen. In some embodiments, the composition comprises at least two different polypeptides, wherein the epitopes of the at least two different polypeptides are from two or more different antigens.
  • the antigen is an antigen expressed by a cancer cell, a neoantigen expressed by a cancer cell, a cancer-associated antigen, a tumor-associated antigen, or an antigen expressed by a target pathogenic organism, an antigen expressed by a virus, an antigen expressed by a bacterium, an antigen expressed by a fungus, an antigen associated with an autoimmune disorder, or is an allergen.
  • the antigen is selected from the antigens listed in Tables 2 to 7.
  • the composition comprises at least two different polypeptides, wherein two of the polypeptides are arranged end to end or overlapping in a joined polypeptide.
  • the adjuvant is selected from the group consisting of Montanide ISA-51, QS-21, GM-CSF, cyclophosamide, bacillus Calmette-Guerin (BCG), corynbacterium parvum , levamisole, azimezone, isoprinisone, dinitrochlorobenezene (DNCB), keyhole limpet hemocyanins (KLH), Freunds adjuvant (complete), Freunds adjuvant (incomplete), mineral gels, aluminum hydroxide (Alum), lysolecithin, pluronic polyols, polyanions, oil emulsions, dinitrophenol, diphtheria toxin (DT), and combinations thereof.
  • the composition comprises at least two different polypeptides, wherein two of the at least two polypeptides are arranged end to end or overlapping in a joined polypeptide. In some embodiments, the composition comprises two or more different joined polypeptides, wherein the two or more different joined polypeptides comprise different epitopes from each other.
  • the joined polypeptides have been screened to eliminate substantially all neoepitopes that span a junction between the two polypeptides and that (i) corresponds to a fragment of a human polypeptide expressed in healthy cells of the subject; (ii) is a T cell epitope capable of binding to at least two HLA class I molecules of the subject; or (iii) meets both requirements (i) and (ii).
  • the at least two polypeptides do not comprise any amino acid sequences that (i) correspond to a fragment of a human polypeptide expressed in healthy cells; or (ii) correspond to a fragment of a human polypeptide expressed in healthy cells and is a T cell epitope capable of binding to at least two HLA class I molecules of the subject.
  • Disclosed herein in certain embodiments are methods of identifying and treating a subject of a target population of cancer patients who will likely have a clinical response to administration of a pharmaceutical composition of the disclosure, the method comprising, (i) assaying a biological sample of the subject to determine HLA genotype of the subject; (ii) determining that the pharmaceutical composition comprises two or more sequences that are a T cell epitope capable of binding to at least three HLA class I molecules of the subject; (iii) determining the probability that a tumor of the subject expresses one or more antigen corresponding to the T cell epitopes identified in step (ii) using population expression data for each antigen, to identify the likelihood of the subject to have a clinical response to administration of the pharmaceutical composition; and (iv) administering the composition of the disclosure to the identified subject.
  • the method further comprises prior to the administering step, assaying a tumor sample from the subject to determine that the three or more peptides of the pharmaceutical composition comprise two or more different amino acid sequences each of which is a fragment of a cancer-associated antigen expressed by cancer cells of the subject as determined in step (i); and a T cell epitope capable of binding to at least three HLA class I molecules of the subject; and confirming the subject as likely to have a clinical response to the method of treatment.
  • the composition comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, or at least 12 different polypeptides.
  • the composition comprises 2-40 different polypeptides.
  • the T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population comprises 7 to 11 amino acids, and/or the T cell epitope that binds at least three HLA class II molecules of at least 10% of subjects in the target population comprises 13 to 17 amino acids.
  • the first region of 10-50 amino acids in length is from an antigen; and the second region of 10-50 amino acids in length is from a same or different antigen.
  • the epitopes of the first and second regions are from a single antigen. In some embodiments, the epitopes of the first and second regions are from two or more different antigens.
  • the antigen is a cancer-associated antigen or a tumor-associated antigen. In some embodiments, the antigen is selected from the antigens listed in Table 2. In some embodiments, the two or more different antigens are selected from the antigens listed in Table 2 and/or different cancer associated antigens. In some embodiments, one or more of the antigens are cancer testis antigens (CTAs). In some embodiments, the one or more polypeptides further comprise up to 10 amino acids flanking the T cell epitope that are not part of a consecutive sequence flanking the epitope in a corresponding antigen.
  • CTAs cancer testis antigens
  • the one or more polypeptides have been screened to eliminate substantially all neoepitopes that span a junction between the first region and second region and that (i) corresponds to a fragment of a human polypeptide expressed in healthy cells; (ii) is a T cell epitope capable of binding to at least three HLA class I molecules of at least 10% of subjects in the target population; or (iii) meets both requirements (i) and (ii).
  • the target population is cancer patients and wherein each of the first region and second region comprises an amino acid sequence that is an HLA class I-binding T cell epitope, and wherein for each T cell epitope, at least 10% of subjects in the target population express a tumor associated antigen selected from the antigens listed in Table 2 that comprises the T cell epitope; and at least 10% of subjects in the target population have at least three HLA class I molecules capable of binding to the T cell epitope; wherein the T cell epitope of the first and second regions are different from each other.
  • the composition further comprises a pharmaceutically acceptable adjuvant, diluent, carrier, preservative, or combination thereof.
  • the adjuvant is selected from the group consisting of Montanide ISA-51, QS-21, GM-CSF, cyclophosamide, bacillus Calmette-Guerin (BCG), corynbacterium parvum , levamisole, azimezone, isoprinisone, dinitrochlorobenezene (DNCB), keyhole limpet hemocyanins (KLH), Freunds adjuvant (complete), Freunds adjuvant (incomplete), mineral gels, aluminum hydroxide (Alum), lysolecithin, pluronic polyols, polyanions, oil emulsions, dinitrophenol, diphtheria toxin (DT), and combinations thereof.
  • kits comprising: a first composition comprising (i) a first polypeptide of 10-50 amino acids in length and comprising a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and (ii) a pharmaceutically-acceptable adjuvant; and a second composition comprising (i) a second polypeptide of 10-50 amino acids in length and comprising a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and (ii) a pharmaceutically-acceptable adjuvant, wherein the first and second polypeptides comprise different T cell epitopes.
  • the first composition and/or the second composition comprise one or more additional polypeptides, wherein each additional polypeptide being of 10-50 amino acids in length comprising an amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population, wherein the amino acid sequences comprise different T cell epitopes.
  • Disclosed herein in certain embodiments are methods of identifying and treating a subject of a target population of cancer patients who will likely have an immune response to administration of a pharmaceutical composition of the disclosure, the method comprising, (i) assaying a biological sample of the subject to determine HLA genotype of the subject; (ii) determining that the pharmaceutical composition comprises two or more sequences that are a T cell epitope capable of binding to at least three HLA class I molecules of the subject; (iii) administering the composition of the disclosure to the identified subject.
  • compositions comprising: a nucleic acid molecule expressing two or more polypeptides, each polypeptide being 10-50 amino acids in length comprising a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population, wherein each of the two or more polypeptides comprises a different T cell epitope, wherein the polypeptides do not comprise amino acid sequences that are adjacent to each other in a corresponding antigen.
  • FIG. 1 ROC curve of HLA restricted PEPI biomarkers.
  • FIG. 2 ROC curve of ⁇ 1 PEPI3+ Test for the determination of the diagnostic accuracy.
  • FIGS. 3A-B Distribution of HLA class I PEPI3+ compared to CD8+ T cell responses measured by a state of art assay among peptide pools used in the CD8+ T cell response assays.
  • FIG. 3A HLA class I restricted PEPI3+s. The 90% Overall Percent of Agreement (OPA) among the T cell responses and PEPI3+ peptides demonstrate the utility of the disclosed peptides for prediction of vaccine induced T cell response set of individuals.
  • FIG. 3B Class I HLA restricted epitopes (PEPI1+). The OPA between predicted epitopes and CD8+ T cell responses was 28% (not statistically significant).
  • FIGS. 4A-B Distribution of HLA class II PEPIs compared to CD4+ T cell responses measured by a state of art assay among peptide pools used in the assays.
  • FIG. 4B The class II HLA restricted epitopes. OPA between class II HLA restricted epitopes and CD4+ T cell responses was 66% (not statistically significant).
  • FIGS. 5A-D Multiple HLA binding peptides that define the HPV-16 LPV vaccine specific T cell response set of 18 VIN-3 and 5 cervical cancer patients.
  • HLA class I restricted PEPI3 counts FIGS. 5A and 5B
  • HLA class II restricted PEPI3 counts FIGS. 5C and 5D
  • Light grey immune responders measured after vaccination in the clinical trial
  • Dark grey Immune non-responders measured after vaccination in the clinical trial.
  • Results show that ⁇ 3 HLA class I binding peptides predict the CD8+ T cell reactivity and ⁇ 4 HLA class II binding peptides predict the CD4+ T cell reactivity.
  • FIG. 6 The multiple HLA class I binding peptides that define the HPV vaccine specific T cell response set of 2 patients.
  • Panel A Four HPV antigens in the HPV vaccine. Boxes represent the length of the amino acid sequences from the N terminus to the C terminus.
  • Panel B Process to identify the multiple HLA binding peptides of two patients: HLA sequences of the patients labelled as 4-digit HLA genotype right from the patient's ID. The location of the 1 st amino acid of the 54 and 91 epitopes that can bind to the patient 12-11 and patient 14-5 HLAs (PEPI1+) respectively are depicted with lines.
  • PEPI2 represents the peptides selected from PEPI1+s that can bind to multiple HLAs of a patient (PEPI2+).
  • PEPI3 represent peptides that can bind to ⁇ 3 HLAs of a patient (PEPI3+).
  • PEPI4 represent peptides that can bind to ⁇ 4 HLAs of a patient (PEPI4+).
  • PEPI5 represent peptides that can bind to ⁇ 5 HLAs of a patient (PEPI5+).
  • PEPI6 represent peptides that can bind to 6 HLAs of a patient (PEPI6).
  • Panel C The DNA vaccine specific PEPI3+ set of two patients characterizes their vaccine specific T cell responses.
  • FIG. 7 Correlation between the ⁇ 1 PEPI3+ Score and CTL response rates of peptide targets determined in clinical trials.
  • FIG. 8 Correlation between the ⁇ 1 PEPI3+ Score and the clinical Immune Response Rate (IRR) of immunotherapy vaccines. Dashed lines: 95% confidence band.
  • FIG. 9 Correlation between the ⁇ 2 PEPI3+ Score and Disease Control Rate (DCR) of immunotherapy vaccines. Dashed lines: 95% confidence band.
  • FIG. 10 HLA map of the Rindopepimut on the HLA alleles of the subjects in the Model Population.
  • FIGS. 11A-B Provides of vaccine antigen expression in the XYZ patient's tumor cells.
  • FIG. 12 MRI findings of patient XYZ treated with personalised (PIT) vaccine. This late stage, heavily pretreated ovarian cancer patient had an unexpected objective response after the PIT vaccine treatment. These MRI findings suggest that PIT vaccine in combination with chemotherapy significantly reduced her tumor burden. The patient now continues the PIT vaccine treatment.
  • FIG. 15 CTA Expression Curve calculated by analyzing expression frequency data of tumor specific antigens (CTAs) in human breast cancer tissues. (No cell line data were included.)
  • FIGS. 16A-B Antigen expression distribution for breast cancer based on the calculation of multi-antigen responses from expression frequencies of the selected 10 different CTAs.
  • FIG. 16A non-cumulative distribution to calculate the expected value for the number of expressed antigens (AG50). This value shows that probably 6.14 vaccine antigens will be expressed by breast tumor cells.
  • FIG. 16B cumulative distribution curve of the minimum number of expressed antigens (CTA expression curve). This shows that minimum 4 vaccine antigens will be expressed with 95% probability in breast cancer cell (AG95).
  • AGP50 is a measure of the effectiveness of the disclosed breast cancer vaccine in attacking breast tumor in an unselected patient population.
  • AGP50 is a measure of the effectiveness of the disclosed breast cancer vaccine in attacking breast tumor in an unselected patient population.
  • FIG. 19 CTA Expression Curve calculated by analyzing expression frequency data of tumor specific antigens (CTAs) in human colorectal cancer tissues. (No cell line data were included.)
  • FIGS. 20A-B Antigen expression distribution for colorectal cancer based on the calculation of multi-antigen responses from expression frequencies of the selected 7 different CTAs.
  • FIG. 20A non-cumulative distribution to calculate the expected vale for the number of expressed vaccine antigens in colorectal cancers (AG50). This value shows that probably 4.96 vaccine antigens will be expressed by colorectal tumor cells.
  • FIG. 20B cumulative distribution curve of the minimum number of expressed antigens (CTA expression curve). This shows that minimum 3 antigens will be expressed with 95% probability in the colorectal cancer cell (AG95).
  • AGP50 is a measure of the effectiveness of the disclosed colorectal cancer vaccine in attacking colorectal tumors in an unselected patient population.
  • FIG. 23 Schot al. showing exemplary positions of amino acids in overlapping HLA class I- and HLA class-II binding epitopes in a 30-mer peptide.
  • FIGS. 24A-B Antigenicity of PolyPEPI1018 CRC Vaccine in a general population.
  • the antigenicity of PolyPEPI1018 in a subject is determined by the AP count, which indicates the number of vaccine antigens that induce T cell responses in a subject.
  • the AP count of PolyPEPI1018 was determined in each of the 433 subjects in the Model Population using the PEPI Test, and the AP50 count was then calculated for the Model Population.
  • the AP50 of PolyPEPI1018 in the Model Population is 4.73.
  • the mean number of immunogenic antigens (i.e., antigens with ⁇ 1 PEPI) in PolyPEPI1018 in a general population is 4.73.
  • Abbreviations: AP antigens with ⁇ 1 PEPI.
  • Left Panel Cumulative distribution curve.
  • Right Panel Distinct distribution curve.
  • FIGS. 25A-B Effectiveness of PolyPEPI1018 CRC Vaccine in a general population.
  • Vaccine induced T cells can recognize and kill tumor cells if a PEPI in the vaccine is presented by the tumor cell.
  • the number of AGPs (expressed antigens with PEPI) is an indicator of vaccine effectiveness in an individual, and is dependent on both the potency and antigenicity of PolyPEPI1018.
  • the mean number of immunogenic CTAs (i.e., AP [expressed antigens with ⁇ 1 PEPI]) in PolyPEPI1018 is 2.54 in the Model Population.
  • the likelihood that PolyPEPI1018 induces T cell responses against multiple antigens in a subject (i.e., mAGP) in the Model Population is 77%.
  • SEQ ID NOs: 1 to 20 set forth 9 mer T cell epitopes described in Table 30.
  • SEQ ID NOs: 21 to 40 set forth 9 mer T cell epitopes described in Table 33.
  • SEQ ID NOs: 41-71 (81 to 111) set forth the breast cancer vaccine peptides set forth in Table 31.
  • SEQ ID NOs 72-102 (112 to 142) set forth the colorectal cancer vaccine peptides set forth in Table 34.
  • SEQ ID Nos: 103-115 (159 to 171) set forth the additional peptide sequences described in Table 17.
  • SEQ ID NOs: 116-128 (362 to 374) set forth personalised vaccine peptides designed for patient XYZ described in Table 26.
  • SEQ ID NOs: 129-140 (375 to 386) set forth personalised vaccine peptides designed for patient ABC described in Table 29.
  • SEQ ID NOs: 141-188 (387 to 434) set forth further 9 mer T cell epitopes described in Table 41.
  • HLAs are encoded by the most polymorphic genes of the human genome. Each person has a maternal and a paternal allele for the three HLA class I molecules (HLA-A*, HLA-B*, HLA-C*) and four HLA class II molecules (HLA-DP*, HLA-DQ*, HLA-DRB1*, HLA-DRB3*/4*/5*). Practically, each person expresses a different combination of 6 HLA class I and 8 HLA class II molecules that present different epitopes from the same protein antigen. The function of HLA molecules is to regulate T cell responses. However up to date it was unknown how the HLAs of a person regulate T cell activation.
  • HLA-A*02:25 The nomenclature used to designate the amino acid sequence of the HLA molecule is as follows: gene name*allele:protein number, which, for instance, can look like: HLA-A*02:25.
  • “02” refers to the allele.
  • alleles are defined by serotypes—meaning that the proteins of a given allele will not react with each other in serological assays.
  • Protein numbers (“25” in the example above) are assigned consecutively as the protein is discovered. A new protein number is assigned for any protein with a different amino acid sequence (e.g. even a one amino acid change in sequence is considered a different protein number). Further information on the nucleic acid sequence of a given locus may be appended to the HLA nomenclature, but such information is not required for the methods described herein.
  • the HLA class I genotype or HLA class II genotype of an individual may refer to the actual amino acid sequence of each class I or class II HLA of an individual, or may refer to the nomenclature, as described above, that designates, minimally, the allele and protein number of each HLA gene.
  • An HLA genotype may be obtained or determined using any suitable method. For example, the sequence may be determined via sequencing the HLA gene loci using methods and protocols known in the art. Alternatively, the HLA set of an individual may be stored in a database and accessed using methods known in the art.
  • a given HLA of a subject will only present to T cells a limited number of different peptides produced by the processing of protein antigens in an APC.
  • display or “present”, when used in relation to HLA, references the binding between a peptide (epitope) and an HLA.
  • to “display” or “present” a peptide is synonymous with “binding” a peptide.
  • epitope refers to a sequence of contiguous amino acids contained within a protein antigen that possess a binding affinity for (is capable of binding to) one or more HLAs.
  • An epitope is HLA- and antigen-specific (HLA-epitope pairs, predicted with known methods), but not subject specific.
  • An epitope, a T cell epitope, a polypeptide, a fragment of a polypeptide or a composition comprising a polypeptide or a fragment thereof is “immunogenic” for a specific human subject if it is capable of inducing a T cell response (a cytotoxic T cell response or a helper T cell response) in that subject.
  • the helper T cell response is a Th1-type helper T cell response.
  • an epitope, a T cell epitope, a polypeptide, a fragment of a polypeptide or a composition comprising a polypeptide or a fragment thereof is “immunogenic” for a specific human subject if it is more likely to induce a T cell response or immune response in the subject than a different T cell epitope (or in some cases two different T cell epitopes each) capable of binding to just one HLA molecule of the subject.
  • T cell response and “immune response” are used herein interchangeably, and refer to the activation of T cells and/or the induction of one or more effector functions following recognition of one or more HLA-epitope binding pairs.
  • an “immune response” includes an antibody response, because HLA class II molecules stimulate helper responses that are involved in inducing both long lasting CTL responses and antibody responses. Effector functions include cytotoxicity, cytokine production and proliferation.
  • an epitope, a T cell epitope, or a fragment of a polypeptide is immunogenic for a specific subject if it is capable of binding to at least two, or in some cases at least three, class I or at least two, or in some cases at least three or at least four class II HLAs of the subject.
  • PEPI personal epitope
  • a “PEPI” is a fragment of a polypeptide consisting of a sequence of contiguous amino acids of the polypeptide that is a T cell epitope capable of binding to one or more HLA class I molecules of a specific human subject.
  • a “PEPI” is a fragment of a polypeptide consisting of a sequence of contiguous amino acids of the polypeptide that is a T cell epitope capable of binding to one or more HLA class II molecules of a specific human subject.
  • PEPI is a T cell epitope that is recognised by the HLA set of a specific individual.
  • PEPIs are specific to an individual because different individuals have different HLA molecules which each bind to different T cell epitopes.
  • PEPI1 refers to a peptide, or a fragment of a polypeptide, that can bind to one HLA class I molecule (or, in specific contexts, HLA class II molecule) of an individual.
  • PEPI1+ refers to a peptide, or a fragment of a polypeptide, that can bind to one or more HLA class I molecule of an individual.
  • PEPI2 refers to a peptide, or a fragment of a polypeptide, that can bind to two HLA class I (or II) molecules of an individual.
  • PEPI2+ refers to a peptide, or a fragment of a polypeptide, that can bind to two or more HLA class I (or II) molecules of an individual, i.e. a fragment identified according to a method of the disclosure.
  • PEPI3 refers to a peptide, or a fragment of a polypeptide, that can bind to three HLA class I (or II) molecules of an individual.
  • PEPI3+ refers to a peptide, or a fragment of a polypeptide, that can bind to three or more HLA class I (or II) molecules of an individual.
  • PEPI4 refers to a peptide, or a fragment of a polypeptide, that can bind to four HLA class I (or II) molecules of an individual.
  • PEPI4+ refers to a peptide, or a fragment of a polypeptide, that can bind to four or more HLA class I (or II) molecules of an individual.
  • PEPI5 refers to a peptide, or a fragment of a polypeptide, that can bind to five HLA class I (or II) molecules of an individual.
  • PEPI5+ refers to a peptide, or a fragment of a polypeptide, that can bind to five or more HLA class I (or II) molecules of an individual.
  • PEPI6 refers to a peptide, or a fragment of a polypeptide, that can bind to all six HLA class I (or six HLA class II) molecules of an individual.
  • epitopes presented by HLA class I molecules are about nine amino acids long and epitopes presented by HLA class II molecules are about fifteen amino acids long.
  • an epitope may be more or less than nine (for HLA Class I) or more or less than fifteen (for HLA Class II) amino acids long, as long as the epitope is capable of binding HLA.
  • an epitope that is capable of binding to class I HLA may be between 7, or 8 or 9 and 9 or 10 or 11 amino acids long.
  • An epitope that is capable of binding to a class II HLA may be between 13, or 14 or 15 and 15 or 16 or 17 amino acids long.
  • the disclosure herein includes, for example, a method of predicting whether a polypeptide is immunogenic for a relevant population or cohort of human subjects (e.g., in a model human population) or identifying a fragment of a polypeptide as immunogenic for a relevant population or cohort of human subjects (e.g., in a model human population), the method comprising the steps of
  • a T cell epitope is capable of binding to a given HLA if it has an IC50 or predicted IC50 of less than 5000 nM, less than 2000 nM, less than 1000 nM, or less than 500 nM.
  • T cell epitope presentation by multiple HLAs of an individual is generally needed to trigger a T cell response.
  • the methods of the disclosure comprise determining whether a polypeptide has a sequence that is a T cell epitope capable of binding to at least two HLA class I molecules or at least two HLA class II (PEPI2+) molecules of a human subject (e.g., in a model human population).
  • the best predictor of a cytotoxic T cell response to a given polypeptide is the presence of at least one T cell epitope that is presented by three or more HLA class I molecules of an individual ( ⁇ 1 PEPI3+). Accordingly, in some cases the method comprises determining whether a polypeptide has a sequence that is a T cell epitope capable of binding to at least three HLA class I molecules of a specific human subject. In some cases the method comprises determining whether a polypeptide has a sequence that is a T cell epitope capable of binding to just three HLA class I of a human subject (e.g., in a model human population).
  • a helper T cell response may be predicted by the presence of at least one T cell epitope that is presented by three or more ( ⁇ 1 PEPI3+) or 4 or more ( ⁇ 1 PEPI4+) HLA class II of an individual. Therefore in some cases, the method comprises determining whether a polypeptide has a sequence that is a T cell epitope capable of binding to at least three HLA class II of a human subject (e.g., in a model human population). In other cases, the method comprises determining whether a polypeptide has a sequence that is a T cell epitope capable of binding to at least four HLA class II of a human subject. In other cases, the method comprises determining whether a polypeptide has a sequence that is a T cell epitope capable of binding to at just three and/or just four HLA class II of a human subject.
  • the disclosed methods and compositions may be used to predict whether a polypeptide/fragment will induce both a cytotoxic T cell response and a helper T cell response in a human subject.
  • the polypeptide/fragment comprises both an amino acid sequence that is a T cell epitope capable of binding to multiple HLA class I molecules of the subject and an amino acid sequence that is a T cell epitope capable of binding to multiple HLA class II molecules of the subject.
  • the HLA class I-binding and HLA class II-binding epitopes may fully or partially overlap.
  • such fragments of a polypeptide may be identified by selecting an amino acid sequence that is a T cell epitope capable of binding to multiple (e.g.
  • HLA class I molecules of the subject at least two or at least three
  • HLA class II molecules of the subject screening one or more longer fragments of the polypeptide that are extended at the N- and/or C-terminus for binding to one or more or the most possible (i.e. when no suitable HLA class II-binding PEPI3+s are available) HLA class II molecules of the subject or of a high percentage of subjects in a population.
  • Some subjects may have two HLA alleles that encode the same HLA molecule (for example, two copies for HLA-A*02:25 in case of homozygosity).
  • the HLA molecules encoded by these alleles bind all of the same T cell epitopes.
  • binding to at least two HLA molecules of the subject includes binding to the HLA molecules encoded by two identical HLA alleles in a single subject. In other words, “binding to at least two HLA molecules of the subject” and the like could otherwise be expressed as “binding to the HLA molecules encoded by at least two HLA alleles of the subject”.
  • polypeptide refers to a full-length protein, a portion of a protein, or a peptide characterized as a string of amino acids.
  • peptide refers to a short polypeptide comprising between 2, or 3, or 4, or 5, or 6, or 7, or 8, or 9, or 10, or 11, or 12, or 13, or 14, or 15 and 10, or 11, or 12, or 13, or 14, or 15, or 20, or 25, or 30, or 35, or 40, or 45, or 50 amino acids.
  • fragment or “fragment of a polypeptide” as used herein refer to a string of amino acids or an amino acid sequence typically of reduced length relative to the or a reference polypeptide and comprising, over the common portion, an amino acid sequence identical to the reference polypeptide.
  • a fragment according to the disclosure may be, where appropriate, included in a larger polypeptide of which it is a constituent.
  • the fragment may comprise the full length of the polypeptide, for example where the whole polypeptide, such as a 9 amino acid peptide, is a single T cell epitope.
  • the polypeptide is, or the polypeptide consists of all or part of an antigen that is, expressed by a pathogenic organism (for example, a bacteria or a parasite), a virus, or a cancer cell, that is associated with an autoimmune disorder or response or a disease-associated cell, or that is an allergen, or an ingredient of a medicine or pharmaceutical composition such as a vaccine or immunotherapy composition.
  • a pathogenic organism for example, a bacteria or a parasite
  • virus for example, a virus, or a cancer cell, that is associated with an autoimmune disorder or response or a disease-associated cell, or that is an allergen, or an ingredient of a medicine or pharmaceutical composition such as a vaccine or immunotherapy composition.
  • the method of the disclosure comprises an initial step of identifying or selecting a suitable polypeptide, for example a polypeptide as further described below.
  • the polypeptide or antigen may be expressed in the cells or specifically in diseased cells of the specific or target human population (e.g. a tumor-associated antigen, a polypeptide expressed by a virus, intracellular bacteria or parasite, or the in vivo product of a vaccine or immunotherapy composition) or acquired from the environment (e.g. a food, an allergen or a drug).
  • the polypeptide or antigen may be present in a sample taken from a subject of the specific or target human population.
  • Both polypeptide antigens and HLAs can be exactly defined by amino acid or nucleotide sequences and sequenced using methods known in the art.
  • the polypeptide or antigen may be a cancer- or tumor-associated antigen (TAA).
  • TAAs are proteins expressed in cancer or tumor cells.
  • the cancer or tumour cell may be present in a sample obtained from a subject of the specific or target human population.
  • TAAs include new antigens (neoantigens) expressed during tumorigenesis, products of oncogenes and tumor suppressor genes, overexpressed or aberrantly expressed cellular proteins (e.g. HER2, MUC1), antigens produced by oncogenic viruses (e.g. EBV, HPV, HCV, HBV, HTLV), cancer testis antigens (CTA)(e.g. MAGE family, NY-ESO) and cell-type-specific differentiation antigens (e.g.
  • TAA sequences may be found experimentally, or in published scientific papers, or through publicly available databases, such as the database of the Ludwig Institute for Cancer Research (www.cta.lncc.br/), Cancer Immunity database (cancerimmunity.org/peptide/) and the TANTIGEN Tumor T cell antigen database (cvc.dfci.harvard.edu/tadb/).
  • the polypeptide or antigen is not expressed or is minimally expressed in normal healthy cells or tissues, but is expressed (in those cells or tissues) in a high proportion of (with a high frequency in) subjects having a particular disease or condition, such as a type of cancer or a cancer derived from a particular cell type or tissue, for example breast cancer, ovarian cancer or melanoma.
  • a particular disease or condition such as a type of cancer or a cancer derived from a particular cell type or tissue, for example breast cancer, ovarian cancer or melanoma.
  • a further example is colorectal cancer.
  • non-limiting cancer examples include non-melanoma skin, lung, prostate, kidney, bladder, stomach, liver, cervix uteri, oesophagus, non-Hodgkin lymphoma, leukemia, pancreas, corpus uteri, lip, oral cavity, thyroid, brain, nervous system, gallbladder, larynx, pharynx, myeloma, nasopharynx, Hodgkin lymphoma, testis and Kaposi sarcoma.
  • the polypeptide may be expressed at low levels in normal healthy cells, but at high levels (overexpressed) in diseased (e.g. cancer) cells or in subjects having the disease or condition.
  • the polypeptide is expressed in, or expressed at a high level relative to normal healthy cells or subjects in, at least 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more of such individuals, or of a subject-matched human subpopulation or model or target population.
  • the population may be matched to the subject by ethnicity, geographical location, gender, age, disease, disease type or stage, genotype, or expression of one or more biomarkers.
  • the expression frequencies can be determined from published figures and scientific publications.
  • the method of the disclosure comprises a step of identifying or selecting such a polypeptide.
  • the polypeptide is associated with or highly (over-) expressed in cancer cells, or in solid tumors.
  • cancers include carcinomas, sarcomas, lymphomas, leukemias, germ cell tumors, or blastomas.
  • the cancer may or may not be a hormone related or dependent cancer (e.g., an estrogen or androgen related cancer).
  • the tumor may be malignant or benign.
  • the cancer may or may not be metastatic.
  • the polypeptide is a cancer testis antigens (CTA).
  • CTA cancer testis antigens
  • CTA are not typically expressed beyond embryonic development in healthy cells. In healthy adults, CTA expression is limited to male germ cells that do not express HLAs and cannot present antigens to T cells. Therefore, CTAs are considered expressional neoantigens when expressed in cancer cells.
  • CTA expression is (i) specific for tumor cells, (ii) more frequent in metastases than in primary tumors and (iii) conserved among metastases of the same patient (Gajewski ed. Targeted Therapeutics in Melanoma. Springer New York. 2012).
  • the polypeptide may be a mutational neoantigen, which is expressed by a cell, for example a cancer cell, of the individual, but altered from the analogous protein in a normal or healthy cell.
  • the methods of the disclosure comprise the step of identifying a polypeptide that is a mutational neoantigen, or that is a mutational neoantigen in the specific human subject, or of identifying a neoepitope.
  • the neoantigen may be present in a sample obtained from the subject.
  • Mutational neoantigens or neoepitopes can be used to target disease-associated cells, such as cancer cells, that express the neoantigen or a neoantigen comprising the neoepitope. Mutations in a polypeptide expressed by a cell, for example a cell in a sample taken from a subject, can be detected by, for example, sequencing, but the majority do not induce an immune response against the neoantigen-expressing cells.
  • the identification of mutational neoantigens that do induce an immune response is based on prediction of mutational HLA restricted epitopes and further in vitro testing of the immunogenicity of predicted epitopes in individual's blood specimen. This process is inaccurate, long and expensive.
  • the polypeptide is a mutational neoantigen
  • the immunogenic fragment of the polypeptide comprises a neoantigen specific mutation (or consists of a neoepitope).
  • the polypeptide may be a viral protein that is expressed intracellularly. Examples include HPV16 E6, E7; HIV Tat, Rev, Gag, Pol, Env; HTLV-Tax, Rex, Gag, Env, Human herpes virus proteins, Dengue virus proteins.
  • the polypeptide may be a parasite protein that is expressed intracellularly, for example malaria proteins.
  • the polypeptide may be an active ingredient of a pharmaceutical composition, such as a vaccine or immunotherapy composition, optionally a candidate active ingredient for a new pharmaceutical composition.
  • active ingredient refers to a polypeptide that is intended to induce an immune response and may include a polypeptide product of a vaccine or immunotherapy composition that is produced in vivo after administration to a subject.
  • the polypeptide may be produced in vivo by the cells of a subject to whom the composition is administered.
  • the polypeptide may be processed and/or presented by cells of the composition, for example autologous dendritic cells or antigen presenting cells pulsed with the polypeptide or comprising an expression construct encoding the polypeptide.
  • the pharmaceutical composition may comprise a polynucleotide or cell encoding one or more active ingredient polypeptides.
  • the polypeptide may be a target polypeptide antigen of a pharmaceutical, vaccine or immunotherapy composition.
  • a polypeptide is a target polypeptide antigen if the composition is intended or designed to induce an immune response (e.g. a cytotoxic T cell response) that targets or is directed at the polypeptide.
  • a target polypeptide antigen is typically a polypeptide that is expressed by a pathogenic organism, a virus or a diseased cell such as a cancer cell.
  • a target polypeptide antigens may be a TAA or a CTA. Presently, >200 clinical trials are investigating cancer vaccines with tumor antigens.
  • the polypeptide may be an allergen that enters the body of an individual through, for example, the skin, lung or oral routes.
  • Non-limiting examples of suitable polypeptides include those listed in one or more of Tables 2 to 6.
  • Genetic sequences may be obtained from the sequencing of biological materials. Sequencing can be done by any suitable method that determines DNA and/or RNA and/or amino acid sequences.
  • the disclosure utilizes both the HLA genotypes and amino acid sequences. However, methods to identify HLA genotype from genetic sequences of an individual and methods of obtaining amino acid sequences derived from DNA or RNA sequence data are not the subject of the disclosure.
  • AAA62707.1 AAA30429.1 AAA30478.1 NP_851372.1 ABW98943.1 ABW98945.1 ABW98953.1 NP_776953.1 AAA30430.1 AAA30431.1 AAB29137.1 AAA30433.1 NP_776719.1 Q28133.1 Q28050.1 CAA29664.1 AAA30615.1 CAA32835.1 AAA30413.1 P02754.3 ACG59280.1 AAA51411.1 CAA76847.1 NP_776945.1 NP_851341.1 P80207.1 P80208.1 S65144 S65145 AAN86249.1 XP_013623213.1 S65143 CAA46782.1 BAA09634.1 P69199.1 P81729.1 CAA57342.1 AAN11300.1 P30575.1 AAC48794.1 CAD82911.1 CAD82912.1 AAC48795.1 AAB30434.1 CAA76841.1 BAC10663.1 ACY38525.1 AHY24648.1 CAA68720.1 CCF72371.1 CCK33472.1 CAC
  • polypeptide antigens induce immune responses in only a fraction of human subjects.
  • diagnostic test that can predict whether a polypeptide antigen would likely induce an immune response in an individual.
  • a test that can predict whether a person is an immune responder to a vaccine or immunotherapy composition.
  • the polypeptide antigen-specific T cell response of an individual is defined by the presence within the polypeptide of one or more fragments that may be presented by multiple HLA class I or multiple HLA class II molecules of the individual.
  • the disclosure involves a method of predicting whether a subject will have an immune response to administration of a polypeptide, wherein an immune response is predicted if the polypeptide is immunogenic according to any method described herein.
  • a cytotoxic T cell response is predicted if the polypeptide comprises at least one amino acid sequence that is a T cell epitope capable of binding to at least two HLA class I molecules of the subject.
  • a helper T cell response is predicted if the polypeptide comprises at least one amino acid sequence that is a T cell epitope capable of binding to at least two HLA class II molecules of the subject.
  • No cytotoxic T cell response is predicted if the polypeptide does not comprise any amino acid sequence that is a T cell epitope capable of binding to at least two HLA class I molecules of the subject.
  • No helper T cell response is predicted if the polypeptide does not comprise any amino acid sequence that is a T cell epitope capable of binding to at least two HLA class II molecules of the subject.
  • the polypeptide is an active component of a pharmaceutical composition
  • the method comprises predicting the development or production of anti-drug antibodies (ADA) to the polypeptide.
  • the pharmaceutical composition may be a drug selected from those listed in Table 8.
  • ADA development will occur if, or to the extent that, an active component polypeptide is recognised by multiple HLA class II molecules of the subject, resulting in a helper T cell response to support an antibody response to the active component.
  • the presence of such epitopes (PEPIs) may predict the development of ADA in the subject.
  • the method may further comprise selecting or recommending for treatment of the human subject administration to the subject of a pharmaceutical composition that is predicted to induce low or no ADA, and optionally further administering the composition to the subject.
  • the method predicts that the pharmaceutical composition will induce unacceptable ADA and the method further comprises selecting or recommending or treating the subject with a different treatment or therapy.
  • the polypeptide may be a checkpoint inhibitor.
  • the method may comprise predicting whether the subject will respond to treatment with the checkpoint inhibitor.
  • Example drugs associated with ADA-related adverse events Drug ADA-related adverse event Abciximab anaphylaxis Adalimumab anti-drug antibodies and treatment failure Basiliximab anaphylaxis Cetuximab IgE, anaphlyaxis Epoetin Antibody-mediated pure red cell aplasia Erythropoietin pure red cell aplasia Etanercept no apparent effect on safety Factor-IX anaphylaxis Infliximab anaphylaxis OKT3 anaphylaxis Pegloticase anti-dug antibody, treatment failure rIFN-beta anaphylaxis recombinant factor VIII anaphylaxis Thrombopoietin thrombocitopenia Ustekinumab anti-ustekinumab antibodies, affected treatment efficacy
  • ⁇ 2 PEPI3+ The presence in a vaccine or immunotherapy composition of at least two polypeptide fragments (epitopes) that can bind to at least three HLA class I of an individual ( ⁇ 2 PEPI3+) is predictive for a clinical response. In other words, if ⁇ 2 PEPI3+ can be identified within the active ingredient polypeptide(s) of a vaccine or immunotherapy composition, then an individual is a likely clinical responder.
  • a “clinical response” or “clinical benefit” as used herein may be the prevention of or a delay in the onset of a disease or condition, the amelioration of one or more symptoms, the induction or prolonging of remission, or the delay of a relapse or recurrence or deterioration, or any other improvement or stabilisation in the disease status of a subject.
  • a “clinical response” may correlate to “disease control” or an “objective response” as defined by the Response Evaluation Criteria In Solid Tumors (RECIST) guidelines.
  • the disclosure involves a method of predicting whether the subject will have a clinical response to administration of a pharmaceutical composition such as a vaccine or immunotherapy composition comprising one or more polypeptides as active ingredients.
  • the method may comprise determining whether the one or more polypeptides together comprise at least two different sequences each of which is a T cell epitope capable of binding to at least two, or in some cases at least three HLA class I molecules of the subject; and predicting that the subject will have a clinical response to administration of the pharmaceutical composition if the one or more polypeptides together comprise at least two different sequences each of which is a T cell epitope capable of binding to at least two, or in some cases at least three HLA class I molecules of the subject; or that the subject will not have a clinical response to administration of the pharmaceutical composition if the one or more polypeptides together comprise no more that one sequence that is a T cell epitope capable of binding to at least two, or in some cases at least three HLA class I molecules of the subject.
  • two T cell epitopes are “different” from each other if they have different sequences, and in some cases also if they have the same sequence that is repeated in a target polypeptide antigen. In some cases the different T cell epitopes in a target polypeptide antigen do not overlap with one another.
  • all of the fragments of one or more polypeptides or active ingredient polypeptides that are immunogenic for a human subject are identified using the methods described herein.
  • the identification of at least one fragment of the polypeptide(s) that is a T cell epitope capable of binding to at least two, or at least three HLA class I molecules of the subject predicts that the polypeptide(s) will elicit or is likely to elicit a cytotoxic T cell response in the subject.
  • the identification of at least one fragment of the polypeptide(s) that is a T cell epitope capable of binding to at least two, or at least three, or at least four HLA class II molecules of the subject predicts that the polypeptide(s) will elicit or is likely to elicit a helper T cell response in the subject.
  • the identification of no fragments of the polypeptide(s) that are T cell epitopes capable of binding to at least two, or at least three HLA class I molecules of the subject predicts that the polypeptide(s) will not elicit or is not likely to elicit a cytotoxic T cell response in the subject.
  • the identification of no fragments of the polypeptide(s) that are T cell epitopes capable of binding to at least two, or at least three, or at least four HLA class II molecules of the subject predicts that the polypeptide(s) will not elicit or is not likely to elicit a helper T cell response in the subject.
  • the identification of at least two fragments of one or more active ingredient polypeptides of a vaccine or immunotherapy composition, wherein each fragment is a T cell epitope capable of binding to at least two, or at least three HLA class I molecules of the subject predicts that the subject is more likely to have, or will have a clinical response to the composition.
  • the identification of less than two fragments of the one or more polypeptides that are T cell epitopes capable of binding to at least two, or at least three HLA class I molecules of the subject predicts that the subject is less likely to have, or will not have, a clinical response to the composition.
  • one reason for the increased likelihood of deriving clinical benefit from a vaccine/immunotherapy comprising at least two multiple-HLA binding PEPIs is that diseased cell populations, such as cancer or tumor cells or cells infected by viruses or pathogens such as HIV, are often heterogenous both within and between affected subjects.
  • a specific cancer patient for example, may or may not express or overexpress a particular cancer associated target polypeptide antigen of a vaccine, or their cancer may comprise heterogeneous cell populations, some of which (over-)express the antigen and some of which do not.
  • the likelihood of developing resistance is decreased when more multiple HLA-binding PEPIs are included or targeted by a vaccine/immunotherapy because a patient is less likely to develop resistance to the composition through mutation of the target PEPI(s).
  • the likelihood that a subject will respond to treatment is therefore increased by (i) the presence of more multiple HLA-binding PEPIs in the active ingredient polypeptides; (ii) the presence of PEPIs in more target polypeptide antigens; and (iii) (over-)expression of the target polypeptide antigens in the subject or in diseased cells of the subject.
  • expression of the target polypeptide antigens in the subject may be known, for example if target polypeptide antigens are in a sample obtained from the subject.
  • the probability that a specific subject, or diseased cells of a specific subject, (over-)express a specific or any combination of target polypeptide antigens may be determined using population expression frequency data.
  • the population expression frequency data may relate to a subject- and/or disease-matched population or the intent-to-treat population.
  • the frequency or probability of expression of a particular cancer-associated antigen in a particular cancer or subject having a particular cancer, for example breast cancer can be determined by detecting the antigen in tumor, e.g. breast cancer tumor samples.
  • such expression frequencies may be determined from published figures and scientific publications.
  • a method of the invention comprises a step of determining the expression frequency of a relevant target polypeptide antigen in a relevant population.
  • biomarkers Disclosed is a range of pharmacodynamic biomarkers to predict the activity/effect of vaccines in individual human subjects as well as in populations of human subjects.
  • the biomarkers have been developed specifically for cancer vaccines, but similar biomarkers could be used for other vaccines or immunotherapy compositions. These biomarkers expedite more effective vaccine development and also decrease the development cost and may be used to assess and compare different compositions.
  • Exemplary biomarkers are as follows.
  • the results of a prediction as set out above may be used to inform a physician's decisions concerning treatment of the subject.
  • the polypeptide is an active ingredient, for example of a vaccine or immunotherapy composition
  • the method of the disclosure predicts that the subject will have, is likely to have, or has above a threshold minimum likelihood of having an immune response and/or a clinical response to a treatment comprising administering the active ingredient polypeptide to the subject, and the method further comprises selecting the treatment for or selecting the vaccine or immunotherapy composition for treatment of the specific human subject.
  • kits or panel of polypeptides comprising one or more polypeptides as active ingredients, wherein the pharmaceutical composition, kit or panel of polypeptides has been determined to have a threshold minimum likelihood of inducing a clinical response in the subject, wherein the likelihood of response has been determined using a method described herein.
  • a minimum PEPI3+ count for example 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 or more PEPI3+
  • a subject is selected for treatment if their likelihood of a response targeted at a predefined number of target polypeptide antigens, optionally wherein the target polypeptide antigens are (predicted to be) expressed, is above a predetermined threshold (e.g. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 or more).
  • a predetermined threshold e.g. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 or more.
  • the method may predict that the one or more polypeptide(s) of the composition will not elicit a T cell response and/or a clinical response in the subject and further comprise selecting a different treatment for the subject.
  • the differences among HLAs may influence the probability that a subject will experience immune-toxicity from a drug or polypeptide administered to the subject.
  • There may be a toxic immune response if a polypeptide administered to the subject comprises a fragment that corresponds to a fragment of an antigen expressed in normal healthy cells of the subject and that comprises an amino acid that is a T cell epitope capable of binding to multiple HLA class I molecules of the subject. Therefore, some cases in accordance with the disclosure, involve identifying a toxic immunogenic region or fragment of a polypeptide or identifying subjects who are likely to experience immune-toxicity in response to administration of one or more polypeptides or a fragments thereof.
  • the polypeptide may be an active ingredient of a vaccine or immunotherapy composition as described herein.
  • the method may comprise determining whether the polypeptide(s) comprises a sequence that is a T cell epitope capable of binding to at least two, or in other cases to at least three HLA class I molecules of the subject. In some cases the method comprises determining that the polypeptide comprises a sequence that is a T cell epitope capable of binding to at least four, or at least five HLA class I molecules of the subject; or an amino acid sequence that is a T cell epitope capable of binding to at least four, or at least five, or at least six or at least seven HLA class II of the subject. The method may further comprise identifying said sequence as toxic immunogenic for the subject or predicting a toxic immune response in the subject.
  • the method further comprises predicting no toxic immune response in the subject.
  • the method may further comprise selecting or recommending for treatment of the subject administration of one or more polypeptides or a pharmaceutical composition that is predicted to induce no or low immune-toxicity, and optionally further treating the subject by administering the polypeptide.
  • the disclosure also provides a method of treating a subject in need thereof by administrating to the subject such a polypeptide or composition.
  • a method described herein further comprises mutating a polypeptide that is predicted to be immunogenic for a subject, or that is predicted to be immunogenic in a proportion of subjects in a human population. Also provided is a method of reducing the immunogenicity of a polypeptide that has been identified as immunogenic in a subject or in a proportion of a human population as described herein.
  • the polypeptide may be mutated to reduce the number of PEPIs in the polypeptide or to reduce the number of HLA class I or class II molecules of the subject or of said population that bind to the fragment of the polypeptide that is identified as immunogenic in the subject or in a proportion of said population.
  • the mutation may reduce or prevent a toxic immune response or may increase the efficacy by preventing the ADA development in the subject or in a proportion of said population.
  • the mutated polypeptide may be further selected or recommended for treatment of the subject or of a subject of said population.
  • the subject may further be treated by administration of the mutated polypeptide.
  • the disclosure also provides a method of treating a subject in need thereof by administrating to the subject such a mutated polypeptide.
  • the methods described herein may be used to predict the response or response rate of a wider human population to administration of one or more polypeptides or compositions comprising one or more polypeptides.
  • a method of the disclosure may be repeated for a plurality of human subjects to predict the response or response rate in those subjects.
  • the method of the disclosure may be repeated for each subject in a relevant sample or model population of subjects and the results used to predict or define the response or response rate in a broader human population represented by the sample or model population.
  • the sample/model population may be relevant to the intent-to-treat population for a pharmaceutical composition.
  • a relevant population is one that is representative or similar to the population for whom or amongst whom treatment with the pharmaceutical composition is intended.
  • the sample/model population is representative for the whole human race.
  • the sample/model population may be disease- or subject-matched to the broader population (subpopulation), for example by ethnicity, geographical location, gender, age, disease or cancer, disease or cancer type or stage, genotype, expression of one or more biomarkers, partially by HLA genotype (for example subjects have one or more particular HLA alleles).
  • the sample/model population may have HLA class I and/or class II genomes that are representative of those found in the world population, or in subjects having a particular disease or condition, or ethnic background, from a particular geographical location, or having a particular disease-associated biomarker (for example, women having the BRCA mutation for a breast cancer vaccine).
  • the sample/model population is representative for at least 70%, or 75% or 80% or 84% or 85% or 86% or 90% or 95% of the broader population by HLA diversity and/or HLA frequency.
  • the method may comprise the step of selecting or defining a relevant sample or model population.
  • Each subject in the sample/model population is minimally defined by their HLA class I or class II genotype, e.g. complete 4-digit HLA class I genotype.
  • Data concerning the HLA genotype of the sample/model population may be stored or recorded in or retrieved from a database or be an in silico model human population.
  • the methods described herein may be used to conduct an in silico clinical trial that predicts the proportion of immune-responders or the proportion of clinical responders in a population for a given drug, such as a vaccine or immunotherapy composition. This is useful for pre-selecting drugs that are likely to have high rates of efficacy to undergo clinical testing.
  • a population of individuals or a subpopulation of individuals can comprise the study cohort of an in silico clinical trial conducted with a drug. Each individual in the study cohort is characterized by its HLA genotype.
  • the proportion of individuals in the study cohort having ⁇ 1 PEPI2+, or ⁇ 1 PEPI3+, or ⁇ 1 PEPI4+, or ⁇ 1 PEPI5+, derived from the polypeptides of the drug may be calculated.
  • the “PEPI Score” refers specifically to the ⁇ 1 PEPI3+ Score. This PEPI Score predicts the proportion of subjects with T cell responses in a clinical trial conducted with the same drug in a relevant cohort of subjects.
  • the disclosure provides a method of conducting an in silico trial for a vaccine or immunotherapy composition having one or more polypeptide active ingredients.
  • the in silico trial may predict the cytotoxic T cell response rate of a human population.
  • the method may comprise: (i) selecting or defining an in silico model human population comprising a plurality of subjects each defined by HLA class I genotype, wherein the in silico model human population may correspond to or be representative of, or relevant to the intend-to-treat, said human population in which the cytotoxic T cell response rate is to be predicted; (ii) determining for each subject in the in silico model human population whether the one or more active ingredient polypeptides comprise at least one sequence that is PEPI2+, PEPI3+, PEPI4+ or PEPI5+(depending the size, administration route and adjuvants of the polypeptide composition); and (iii) predicting the cytotoxic T cell response rate (of said human population), wherein a higher proportion of the in silico model human
  • the in silico trial may predict the clinical response rate of a human population.
  • the method may comprise (i) selecting or defining an in silico model human population comprising a plurality of subjects defined by HLA class I genotype, wherein the in silico model human population may correspond to or be representative of said human population (relevant to the intend-to-treat population) in which the clinical response rate is to be predicted; (ii) determining for each subject in the in silico model human population whether the one or more active ingredient polypeptides comprise at least two different sequences each of which is a T cell epitope capable of binding to at least three, or at least four, or at least five HLA class I of the subject; and (iii) predicting the clinical response rate (of said human population), wherein a higher proportion of the in silico model human population that meet the requirements of step (ii) predicts a higher clinical response rate
  • An equivalent method may be used to predict, for example, the immune toxicity rate, checkpoint inhibitor response rate, ADA development rate, or helper T cell response rate of a human population (or subpopulation) to administration of a polypeptide or pharmaceutical composition comprising one or more polypeptides as active ingredients.
  • the method may be repeated for one or more further polypeptides or fragments thereof or vaccine or pharmaceutical or immunotherapy compositions.
  • the polypeptides, fragments or compositions may be ranked according to their predicted response rates in said human population. This method is useful for selecting the most effective or most safe polypeptide drugs for the intent-to-treat population.
  • the disclosure provides a method of designing or preparing a polypeptide, or a polynucleic acid that encodes a polypeptide, for inducing an immune response, a cytotoxic T cell response or a helper T cell response in a human subject (e.g. in a target or intent-to-treat population).
  • the disclosure also provides an immunogenic composition, or pharmaceutical composition, kit or panel of peptides, methods of designing or preparing the same, compositions that may be obtained by those methods, and their use in a method of inducing an immune response, a cytotoxic T cell response, or a helper T cell response in the subject, or a method of treating, vaccinating or providing immunotherapy to a subject.
  • the methods involve identifying and/or selecting a T cell epitope that binds to multiple, e.g. at least three HLA class I molecules of individual subjects across the target population with a high frequency, and designing or/or preparing a polypeptide that comprises one or more such epitopes (PEPI3+s).
  • PEPI3+s Such high frequency population PEPI3+s may be referred to herein as “bestEPIs”.
  • BestEPIs induce immune responses in a high proportion of human subjects in the specific or target human population.
  • the polypeptide may be an active ingredient in a pharmaceutical composition or kit or panel of polypeptides for use in a method of treatment of a subject of the specific or target human population.
  • composition/kit may optionally further comprise at least one pharmaceutically acceptable diluent, carrier, or preservative and/or additional polypeptides that do not comprise any bestEPIs.
  • the polypeptides may be engineered or non-naturally occurring.
  • the kit may comprise one or more separate containers each containing one or more of the active ingredient peptides.
  • the composition/kit may be a personalised medicine to prevent, diagnose, alleviate, treat, or cure a disease of an individual, such as a cancer.
  • the bestEPI is capable of binding to multiple, for example to at least three HLA class I and/or to at least three HLA class II molecules of a high percentage of the subjects in a sample or model population, such as described herein.
  • a “high” percentage may be at least or more than 1%, 2%, 5%, 10%, 12%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49% or 50% of the relevant population or subpopulation of human subjects.
  • a “high” percentage is relative to the percentage of subjects in the population having other PEPI3+s.
  • the PEPI3+ may be the most frequent in the population, or more frequent than 50%, or 55% or 60% or 65% or 70% or 75% or 80% or 85% or 90% or 95% or 97% or 99% of all PEPI3+ and/or PEPI4+ and/or PEPI4+ in one or more reference target polypeptide antigens.
  • the probability that the target polypeptide antigen is expressed in a subject of the specific or target population is taken into account to determine the overall likelihood that the bestEPI will induce an immune response that targets a polypeptide antigen that is expressed by a subject of the specific or target human population.
  • the bestEPI is predicted to express both the relevant target polypeptide antigen and multiple, for example at least three HLA class I or at least three HLA class II molecules capable of binding to the bestEPI in at least or more than 1%, 2%, 5%, 10%, 12%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49% or 50% of the relevant population of human subjects.
  • multiple T cell epitopes/PEPI3+s optionally from one or more target polypeptide antigens may be ranked by the percentage of subjects in the model or intend-to-treat population having multiple, for example at least three HLA class I or at least three HLA class II molecules capable of binding to each fragment; or by the percentage of subjects in the model or intend-to-treat population that are predicted to express both the target polypeptide antigen comprising the fragment and multiple, for example at least three HLA class I or at least three HLA class II molecules capable of binding to the fragments.
  • the peptide or composition may be designed to comprise one or more PEPI3+s that are selected based on their ranking.
  • each bestEPI is a fragment of a target polypeptide antigen and polypeptides that comprise one or more of the bestEPIs are the target polypeptide antigens for the treatment, vaccination or immunotherapy.
  • the method may comprise the step of identifying one or more suitable target polypeptide antigens.
  • each target polypeptide antigen will be associated with the same disease or condition, pathogenic organism or group of pathogenic organisms or virus, or type of cancer.
  • composition, kit or panel may comprise, or the method may comprise selecting, for each bestEPI a sequence of up to 50, 45, 40, 35, 30, 25, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10 or 9 consecutive amino acids of the target polypeptide antigen, such as a polypeptide described herein, which consecutive amino acids comprise the amino acid sequence of the bestEPI.
  • amino acid sequence is flanked at the N and/or C terminus by additional amino acids that are not part of the consecutive sequence of the target polypeptide antigen. In some cases the sequence is flanked by up to 41 or 35 or 30 or 25 or 20 or 15 or 10, or 9 or 8 or 7 or 6 or 5 or 4 or 3 or 2 or 1 additional amino acid at the N and/or C terminus or between target polypeptide fragments.
  • each polypeptide either consists of a fragment of a target polypeptide antigen, or consists of two or more such fragments arranged end to end (arranged sequentially in the peptide end to end) or overlapping in a single peptide (where two or more of the fragments comprise partially overlapping sequences, for example where two bestEPIs in the same polypeptide are within 50 amino acids of each other).
  • neoepitopes When fragments of different polypeptides or from different regions of the same polypeptide are joined together in an engineered peptide there is the potential for neoepitopes to be generated around the join or junction.
  • Such neoepitopes encompass at least one amino acid from each fragment on either side of the join or junction, and may be referred to herein as junctional amino acid sequences.
  • the neoepitopes may induce undesired T cell responses against healthy cells (autoimmunity).
  • the peptides may be designed, or the polypeptides may be screened, to avoid, eliminate or minimise neoepitopes that correspond to a fragment of a protein expressed in normal healthy human cells and/or neoepitopes that are capable of binding to at least two, or in some cases at least three, or at least four HLA class I molecules of the subject, or in some cases at least two, or at least three or four or five HLA class II molecules of the subject.
  • the peptide is designed, or the polypeptide screened, to eliminate polypeptides having a junctional neoepitope that is capable of binding in more than a threshold percentage of human subjects in a specific, target or model population, to at least two HLA class I molecules expressed by individual subjects of the population.
  • the threshold is 30%, or 20%, or 15%, or 10%, or 5%, or 2%, or 1%, or 0.5% of said population.
  • the methods of the disclosure may be used to identify or screen for such neoepitopes as described herein. Alignment may be determined using known methods such as BLAST algorithms. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/).
  • the at least two bestEPIs of the composition polypeptides may both target a single antigen (e.g a polypeptide vaccine comprising two multiple HLA-binding PEPIs derived from a single antigen, for example a tumor associated antigen, targeted by the vaccine/immunotherapy) or may target different antigens (e.g. a polypeptide vaccine comprising one multiple HLA-binding PEPI derived from one antigen, e.g. a tumor associated antigen, and a second multiple HLA-binding PEPI derived from a different antigen, e.g. a different tumor associated antigen, both targeted by the vaccine/immunotherapy).
  • a single antigen e.g a polypeptide vaccine comprising two multiple HLA-binding PEPIs derived from a single antigen, for example a tumor associated antigen, targeted by the vaccine/immunotherapy
  • different antigens e.g. a polypeptide vaccine comprising one multiple HLA-binding PEPI
  • the active ingredient polypeptide(s) together comprise, or the method comprises selecting, a total of or at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 or more different bestEPIs.
  • the bestEPIs may be fragments of one or more different target polypeptide antigens.
  • each target polypeptide antigen that are immunogenic for a high proportion of subjects in a target population it is possible to incorporate multiple such fragments, optionally from multiple different target polypeptide antigens, in a single active ingredient polypeptide or multiple active ingredient polypeptides intended for use in combination or to maximise the number of T cell clones that can be activated by one or more polypeptides of a certain length.
  • exemplary CTA expression probabilities in breast cancer are as follows: MAGE C2: 21%; MAGE A1: 37%; SPC1: 38%; MAGE A9: 44%.
  • Treatment of patient ABC with a vaccine comprising PEPIs in only MAGE C2: 21% and MAGE A1 has a mAGP probability of 7%.
  • Treatment of patient ABC with a vaccine comprising PEPIs in only SPC1: 38%; MAGE A9 has a mAGP probability of 11%.
  • Treatment of patient ABC with a vaccine comprising PEPIs in MAGE C2: 21%; MAGE A1: 37%; SPC1: 38%; MAGE A9 has a mAGP probability of 44% (44>7+11).
  • Patient ABC's PIT vaccine described in Example 16 contains a further 8 PEPIs, and thus, the probability of having a mAGP is over 99.93%.
  • the bestEPIs of the active ingredient polypeptides are from two or more different target polypeptide antigens, for example different antigens associated with a specific disease or condition, for example different cancer- or tumor-associated antigens or antigens expressed by a target pathogen.
  • the PEPIs are from a total of or at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 or more different target polypeptide antigens.
  • the different target polypeptide antigens may be any different polypeptides that it is useful to target or that can be selectively targeted with different PEPI3+s.
  • different target polypeptide antigens are non-homologues or non-paralogues or have less than 95%, or 90%, or 85% or 80% or 75% or 70% or 60% or 50% sequence identity across the full length of each polypeptide.
  • different polypeptides are those that do not share any PEPI3+s.
  • the PEPI3+s are from different target polypeptide antigens when they are not shared with other polypeptide antigens targeted by the active ingredient polypeptides.
  • one or more or each of the immunogenic polypeptide fragments is from a polypeptide that is present in a sample taken from a human subject (e.g., of the target population). This indicates that the polypeptide is expressed in the subject, for example a cancer- or tumor-associated antigen or a cancer testis antigen expressed by cancer cells of the subject.
  • one or more or each of the polypeptides is a mutational neoantigen, or an expressional neoantigen of the subject.
  • One or more or each fragment may comprise a neoantigen specific mutation.
  • one or more or each of the immunogenic polypeptide fragments is from a target polypeptide antigen that is not generally expressed or is minimally expressed in normal healthy cells or tissue, but is expressed in a high proportion of (with a high frequency in) subjects or in the diseased cells of a subject having a particular disease or condition, as described above.
  • the method my comprise identifying or selecting such a target polypeptide antigen.
  • two or more or each of the immunogenic polypeptide fragments/bestEPIs are from different cancer- or tumor-associated antigens that are each (over-)expressed with a high frequency in subjects having a type of cancer or a cancer derived from a particular cell type or tissue.
  • the immunogenic polypeptide fragments are from a total of or at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 different cancer- or tumor-associated polypeptides.
  • one or more or each or at least one, at least two, at least three, at least four, at least five or at least six or at least seven of the polypeptides are selected from the antigens listed in any one of Tables 2 to 7.
  • one or more or each of the target polypeptide antigens is a cancer testis antigen (CTA).
  • CTA cancer testis antigen
  • the immunogenic polypeptide fragments/bestEPIs are from at least 1, or at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 CTAs, or from a total of 3 or more different target polypeptide antigens, optionally wherein 1, 2, or all three or at least three are CTAs, or from 4 or more different polypeptide antigens, optionally wherein 1, 2, 3 or all four or at least 1, 2, 3 or 4 are CTAs, or from 5 or more different polypeptide antigens, optionally wherein 1, 2, 3, 4 or all five or at least 1, 2, 3, 4, or 5 are CTAs, or from 6 or more different polypeptide antigens, optionally wherein 1, 2, 3, 4, 5 or all six or at least 1, 2, 3, 4, 5, or 6 are CTAs, or from 7 or more different polypeptide antigens, optionally wherein
  • one or more of the polypeptide fragments comprises an amino acid sequence that is a T cell epitope capable of binding to at least two, or at least three HLA class I of a high percentage of subjects in the population subject and one or more of the polypeptide fragments comprises an amino acid sequence that is a T cell epitope capable of binding to at least two, or at least three, or at least four HLA class II of the subject of a high percentage of subjects in the population, wherein the HLA class I and HLA class II binding fragments may optionally overlap.
  • a composition prepared by such a method may elicit both a cytotoxic T cell response and a helper T cell response in the subject.
  • the disclosure relates to a pharmaceutical composition, kit, or panels of polypeptides as described above having one or more polypeptides as active ingredient(s). These may be for use in a method of inducing an immune response, treating, vaccinating or providing immunotherapy to a subject, and the pharmaceutical composition may be a vaccine or immunotherapy composition.
  • a treatment comprises administering one or more polypeptides or pharmaceutical compositions that together comprise all of the active ingredient polypeptides of the treatment to the subject.
  • Multiple polypeptides or pharmaceutical compositions may be administered together or sequentially, for example all of the pharmaceutical compositions or polypeptides may be administered to the subject within a period of 1 year, or 6 months, or 3 months, or 60 or 50 or 40 or 30 days.
  • the immunogenic or pharmaceutical compositions or kits described herein may comprise, in addition to one or more immunogenic peptides, a pharmaceutically acceptable excipient, carrier, diluent, buffer, stabiliser, preservative, adjuvant or other materials well known to those skilled in the art. Such materials are preferably non-toxic and preferably do not interfere with the pharmaceutical activity of the active ingredient(s).
  • the pharmaceutical carrier or diluent may be, for example, water containing solutions. The precise nature of the carrier or other material may depend on the route of administration, e.g. oral, intravenous, cutaneous or subcutaneous, nasal, intramuscular, intradermal, and intraperitoneal routes.
  • the pharmaceutical compositions of the disclosure may comprise one or more “pharmaceutically acceptable carriers”. These are typically large, slowly metabolized macromolecules such as proteins, saccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, sucrose (Paoletti et al., 2001, Vaccine, 19:2118), trehalose (WO 00/56365), lactose and lipid aggregates (such as oil droplets or liposomes). Such carriers are well known to those of ordinary skill in the art.
  • the pharmaceutical compositions may also contain diluents, such as water, saline, glycerol, etc.
  • auxiliary substances such as wetting or emulsifying agents, pH buffering substances, and the like, may be present.
  • Sterile pyrogen-free, phosphate buffered physiologic saline is a typical carrier (Gennaro, 2000, Remington: The Science and Practice of Pharmacy, 20th edition, ISBN:0683306472).
  • compositions of the disclosure may be lyophilized or in aqueous form, i.e. solutions or suspensions. Liquid formulations of this type allow the compositions to be administered direct from their packaged form, without the need for reconstitution in an aqueous medium, and are thus ideal for injection.
  • the pharmaceutical compositions may be presented in vials, or they may be presented in ready filled syringes. The syringes may be supplied with or without needles. A syringe will include a single dose, whereas a vial may include a single dose or multiple doses.
  • Liquid formulations of the disclosure are also suitable for reconstituting other medicaments from a lyophilized form.
  • the disclosure provides a kit, which may comprise two vials, or may comprise one ready-filled syringe and one vial, with the contents of the syringe being used to reconstitute the contents of the vial prior to injection.
  • compositions of the disclosure may include an antimicrobial, particularly when packaged in a multiple dose format.
  • Antimicrobials may be used, such as 2-phenoxyethanol or parabens (methyl, ethyl, propyl parabens).
  • Any preservative is preferably present at low levels.
  • Preservative may be added exogenously and/or may be a component of the bulk antigens which are mixed to form the composition (e.g. present as a preservative in pertussis antigens).
  • compositions of the disclosure may comprise detergent e.g. Tween (polysorbate), DMSO (dimethyl sulfoxide), DMF (dimethylformamide).
  • Detergents are generally present at low levels, e.g. ⁇ 0.01%, but may also be used at higher levels, e.g. 0.01-50%.
  • compositions of the disclosure may include sodium salts (e.g. sodium chloride) and free phosphate ions in solution (e.g. by the use of a phosphate buffer).
  • sodium salts e.g. sodium chloride
  • free phosphate ions e.g. by the use of a phosphate buffer.
  • the pharmaceutical composition may be encapsulated in a suitable vehicle either to deliver the peptides into antigen presenting cells or to increase the stability.
  • a suitable vehicle is suitable for delivering a pharmaceutical composition of the disclosure.
  • suitable structured fluid delivery systems may include nanoparticles, liposomes, microemulsions, micelles, dendrimers and other phospholipid-containing systems. Methods of incorporating pharmaceutical compositions into delivery vehicles are known in the art.
  • the pharmacological compositions may comprise one or more adjuvants and/or cytokines.
  • Suitable adjuvants include an aluminum salt such as aluminum hydroxide or aluminum phosphate, but may also be a salt of calcium, iron or zinc, or may be an insoluble suspension of acylated tyrosine, or acylated sugars, or may be cationically or anionically derivatised saccharides, polyphosphazenes, biodegradable microspheres, monophosphoryl lipid A (MPL), lipid A derivatives (e.g.
  • 3-O-deacylated MPL [3D-MPL], quil A, Saponin, QS21, Freund's Incomplete Adjuvant (Difco Laboratories, Detroit, Mich.), Merck Adjuvant 65 (Merck and Company, Inc., Rahway, N.J.), AS-2 (Smith-Kline Beecham, Philadelphia, Pa.), CpG oligonucleotides, bioadhesives and mucoadhesives, microparticles, liposomes, polyoxyethylene ether formulations, polyoxyethylene ester formulations, muramyl peptides or imidazoquinolone compounds (e.g. imiquamod and its homologues).
  • Human immunomodulators suitable for use as adjuvants in the disclosure include cytokines such as interleukins (e.g. IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12, etc), macrophage colony stimulating factor (M-CSF), tumour necrosis factor (TNF), granulocyte, macrophage colony stimulating factor (GM-CSF) may also be used as adjuvants.
  • cytokines such as interleukins (e.g. IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12, etc)
  • M-CSF macrophage colony stimulating factor
  • TNF tumour necrosis factor
  • GM-CSF macrophage colony stimulating factor
  • the compositions comprise an adjuvant selected from the group consisting of Montanide ISA-51 (Seppic, Inc., Fairfield, N.J., United States of America), QS-21 (Aquila Biopharmaceuticals, Inc., Lexington, Mass., United States of America), GM-CSF, cyclophosamide, bacillus Calmette-Guerin (BCG), corynbacterium parvum , levamisole, azimezone, isoprinisone, dinitrochlorobenezene (DNCB), keyhole limpet hemocyanins (KLH), Freunds adjuvant (complete and incomplete), mineral gels, aluminum hydroxide (Alum), lysolecithin, pluronic polyols, polyanions, oil emulsions, dinitrophenol, diphtheria toxin (DT).
  • Montanide ISA-51 Seppic, Inc., Fairfield, N.J., United States of America
  • QS-21 Amla Biopharmaceuticals, Inc.
  • the cytokine may be selected from the group consisting of a transforming growth factor (TGF) such as but not limited to TGF- ⁇ and TGF- ⁇ ; insulin-like growth factor-I and/or insulin-like growth factor-II; erythropoietin (EPO); an osteoinductive factor; an interferon such as but not limited to interferon-. ⁇ , - ⁇ , and - ⁇ ; a colony stimulating factor (CSF) such as but not limited to macrophage-CSF (M-CSF); granulocyte-macrophage-CSF (GM-CSF); and granulocyte-CSF (G-CSF).
  • TGF transforming growth factor
  • TGF- ⁇ and TGF- ⁇ insulin-like growth factor-I and/or insulin-like growth factor-II
  • EPO erythropoietin
  • an osteoinductive factor such as but not limited to interferon-. ⁇ , - ⁇ , and - ⁇
  • CSF colony stimulating factor
  • the cytokine is selected from the group consisting of nerve growth factors such as NGF- ⁇ ; platelet-growth factor; a transforming growth factor (TGF) such as but not limited to TGF- ⁇ . and TGF- ⁇ ; insulin-like growth factor-I and insulin-like growth factor-II; erythropoietin (EPO); an osteoinductive factor; an interferon (IFN) such as but not limited to IFN- ⁇ , IFN- ⁇ , and IFN- ⁇ ; a colony stimulating factor (CSF) such as macrophage-CSF (M-CSF); granulocyte-macrophage-CSF (GM-CSF); and granulocyte-CSF (G-CSF); an interleukin (II) such as but not limited to IL-1, IL-1.alpha., IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12;
  • TGF
  • an adjuvant or cytokine can be added in an amount of about 0.01 mg to about 10 mg per dose, preferably in an amount of about 0.2 mg to about 5 mg per dose.
  • the adjuvant or cytokine may be at a concentration of about 0.01 to 50%, preferably at a concentration of about 2% to 30%.
  • compositions of the disclosure are prepared by physically mixing the adjuvant and/or cytokine with the PEPIs under appropriate sterile conditions in accordance with known techniques to produce the final product.
  • Vaccine and immunotherapy composition preparation is generally described in Vaccine Design (“The subunit and adjuvant approach” (eds Powell M. F. & Newman M. J. (1995) Plenum Press New York). Encapsulation within liposomes, which is also envisaged, is described by Fullerton, U.S. Pat. No. 4,235,877.
  • the compositions disclosed herein are prepared as a nucleic acid vaccine.
  • the nucleic acid vaccine is a DNA vaccine.
  • DNA vaccines, or gene vaccines comprise a plasmid with a promoter and appropriate transcription and translation control elements and a nucleic acid sequence encoding one or more polypeptides of the disclosure.
  • the plasmids also include sequences to enhance, for example, expression levels, intracellular targeting, or proteasomal processing.
  • DNA vaccines comprise a viral vector containing a nucleic acid sequence encoding one or more polypeptides of the disclosure.
  • compositions disclosed herein comprise one or more nucleic acids encoding peptides determined to have immunoreactivity with a biological sample.
  • the compositions comprise one or more nucleotide sequences encoding 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more peptides comprising a fragment that is a T cell epitope capable of binding to at least three HLA class I molecules and/or at least three HLA class II molecules of a patient.
  • the peptides are derived from an antigen that is expressed in cancer.
  • the DNA or gene vaccine also encodes immunomodulatory molecules to manipulate the resulting immune responses, such as enhancing the potency of the vaccine, stimulating the immune system or reducing immunosuppression.
  • Immunomodulatory molecules to manipulate the resulting immune responses, such as enhancing the potency of the vaccine, stimulating the immune system or reducing immunosuppression.
  • Strategies for enhancing the immunogenicity of DNA or gene vaccines include encoding of xenogeneic versions of antigens, fusion of antigens to molecules that activate T cells or trigger associative recognition, priming with DNA vectors followed by boosting with viral vector, and utilization of immunomodulatory molecules.
  • the DNA vaccine is introduced by a needle, a gene gun, an aerosol injector, with patches, via microneedles, by abrasion, among other forms. In some forms the DNA vaccine is incorporated into liposomes or other forms of nanobodies.
  • the DNA vaccine includes a delivery system selected from the group consisting of a transfection agent; protamine; a protamine liposome; a polysaccharide particle; a cationic nanoemulsion; a cationic polymer; a cationic polymer liposome; a cationic nanoparticle; a cationic lipid and cholesterol nanoparticle; a cationic lipid, cholesterol, and PEG nanoparticle; a dendrimer nanoparticle.
  • the DNA vaccines is administered by inhalation or ingestion.
  • the DNA vaccine is introduced into the blood, the thymus, the pancreas, the skin, the muscle, a tumor, or other sites.
  • the compositions disclosed herein are prepared as an RNA vaccine.
  • the RNA is non-replicating mRNA or virally derived, self-amplifying RNA.
  • the non-replicating mRNA encodes the peptides disclosed herein and contains 5′ and 3′ untranslated regions (UTRs).
  • the virally derived, self-amplifying RNA encodes not only the peptides disclosed herein but also the viral replication machinery that enables intracellular RNA amplification and abundant protein expression.
  • the RNA is directly introduced into the individual.
  • the RNA is chemically synthesized or transcribed in vitro.
  • the mRNA is produced from a linear DNA template using a T7, a T3, or an Sp6 phage RNA polymerase, and the resulting product contains an open reading frame that encodes the peptides disclosed herein, flanking UTRs, a 5′ cap, and a poly(A) tail.
  • various versions of 5′ caps are added during or after the transcription reaction using a vaccinia virus capping enzyme or by incorporating synthetic cap or anti-reverse cap analogues.
  • an optimal length of the poly(A) tail is added to mRNA either directly from the encoding DNA template or by using poly(A) polymerase.
  • the RNA encodes one or more peptides comprising a fragment that is a T cell epitope capable of binding to at least three HLA class I and/or at least three HLA class II molecules of a patient.
  • the fragments are derived from an antigen that is expressed in cancer.
  • the RNA includes signals to enhance stability and translation.
  • the RNA also includes unnatural nucleotides to increase the half-life or modified nucleosides to change the immunostimulatory profile.
  • the RNAs is introduced by a needle, a gene gun, an aerosol injector, with patches, via microneedles, by abrasion, among other forms.
  • the RNA vaccine is incorporated into liposomes or other forms of nanobodies that facilitate cellular uptake of RNA and protect it from degradation.
  • the RNA vaccine includes a delivery system selected from the group consisting of a transfection agent; protamine; a protamine liposome; a polysaccharide particle; a cationic nanoemulsion; a cationic polymer; a cationic polymer liposome; a cationic nanoparticle; a cationic lipid and cholesterol nanoparticle; a cationic lipid, cholesterol, and PEG nanoparticle; a dendrimer nanoparticle; and/or naked mRNA; naked mRNA with in vivo electroporation; protamine-complexed mRNA; mRNA associated with a positively charged oil-in-water cationic nanoemulsion; mRNA associated with a chemically modified dendrimer and complexed with polyethylene glycol (PEG)-lipid; protamine-com
  • PEG poly
  • the RNA vaccine is administered by inhalation or ingestion.
  • the RNA is introduced into the blood, the thymus, the pancreas, the skin, the muscle, a tumor, or other sites, and/or by an intradermal, intramuscular, subcutaneous, intranasal, intranodal, intravenous, intrasplenic, intratumoral or other delivery route.
  • Polynucleotide or oligonucleotide components may be naked nucleotide sequences or be in combination with cationic lipids, polymers or targeting systems. They may be delivered by any available technique.
  • the polynucleotide or oligonucleotide may be introduced by needle injection, preferably intradermally, subcutaneously or intramuscularly.
  • the polynucleotide or oligonucleotide may be delivered directly across the skin using a delivery device such as particle-mediated gene delivery.
  • the polynucleotide or oligonucleotide may be administered topically to the skin, or to mucosal surfaces for example by intranasal, oral, or intrarectal administration.
  • Uptake of polynucleotide or oligonucleotide constructs may be enhanced by several known transfection techniques, for example those including the use of transfection agents.
  • transfection agents include cationic agents, for example, calcium phosphate and DEAE-Dextran and lipofectants, for example, lipofectam and transfectam.
  • the dosage of the polynucleotide or oligonucleotide to be administered can be altered.
  • Administration is typically in a “prophylactically effective amount” or a “therapeutically effective amount” (as the case may be, although prophylaxis may be considered therapy), this being sufficient to result in a clinical response or to show clinical benefit to the individual, e.g. an effective amount to prevent or delay onset of the disease or condition, to ameliorate one or more symptoms, to induce or prolong remission, or to delay relapse or recurrence.
  • the dose may be determined according to various parameters, especially according to the substance used; the age, weight and condition of the individual to be treated; the route of administration; and the required regimen.
  • the amount of antigen in each dose is selected as an amount which induces an immune response.
  • a physician will be able to determine the required route of administration and dosage for any particular individual.
  • the dose may be provided as a single dose or may be provided as multiple doses, for example taken at regular intervals, for example 2, 3 or 4 doses administered hourly.
  • peptides, polynucleotides or oligonucleotides are typically administered in the range of 1 pg to 1 mg, more typically 1 pg to 10 ⁇ g for particle mediated delivery and 1 ⁇ g to 1 mg, more typically 1-100 ⁇ g, more typically 5-50 ⁇ g for other routes.
  • each dose will comprise 0.01-3 mg of antigen.
  • An optimal amount for a particular vaccine can be ascertained by studies involving observation of immune responses in subjects.
  • more than one peptide or composition of peptides is administered.
  • Two or more pharmaceutical compositions may be administered together/simultaneously and/or at different times or sequentially.
  • the disclosure includes sets of pharmaceutical compositions and uses thereof.
  • the use of combination of different peptides, optionally targeting different antigens, is important to overcome the challenges of genetic heterogeneity of tumors and HLA heterogeneity of individuals.
  • the use of peptides of the disclosure in combination expands the group of individuals who can experience clinical benefit from vaccination.
  • Multiple pharmaceutical compositions of PEPIs, manufactured for use in one regimen, may define a drug product.
  • Routes of administration include but are not limited to intranasal, oral, subcutaneous, intradermal, and intramuscular.
  • the subcutaneous administration is particularly preferred.
  • Subcutaneous administration may for example be by injection into the abdomen, lateral and anterior aspects of upper arm or thigh, scapular area of back, or upper ventrodorsal gluteal area.
  • compositions of the disclosure may also be administered in one, or more doses, as well as, by other routes of administration.
  • routes of administration include, intracutaneously, intravenously, intravascularly, intraarterially, intraperitnoeally, intrathecally, intratracheally, intracardially, intralobally, intramedullarly, intrapulmonarily, and intravaginally.
  • the compositions according to the disclosure may be administered once or several times, also intermittently, for instance on a monthly basis for several months or years and in different dosages.
  • Solid dosage forms for oral administration include capsules, tablets, caplets, pills, powders, pellets, and granules.
  • the active ingredient is ordinarily combined with one or more pharmaceutically acceptable excipients, examples of which are detailed above.
  • Oral preparations may also be administered as aqueous suspensions, elixirs, or syrups.
  • the active ingredient may be combined with various sweetening or flavoring agents, coloring agents, and, if so desired, emulsifying and/or suspending agents, as well as diluents such as water, ethanol, glycerin, and combinations thereof.
  • compositions of the disclosure may be administered, or the methods and uses for treatment according to the disclosure may be performed, alone or in combination with other pharmacological compositions or treatments, for example chemotherapy and/or immunotherapy and/or vaccine.
  • the other therapeutic compositions or treatments may for example be one or more of those discussed herein, and may be administered either simultaneously or sequentially with (before or after) the composition or treatment of the disclosure.
  • the treatment may be administered in combination with checkpoint blockade therapy/checkpoint inhibitors, co-stimulatory antibodies, cytotoxic or non-cytotoxic chemotherapy and/or radiotherapy, targeted therapy or monoclonal antibody therapy. It has been demonstrated that chemotherapy sensitizes tumors to be killed by tumor specific cytotoxic T cells induced by vaccination (Ramakrishnan et al. J Clin Invest. 2010; 120(4):1111-1124).
  • chemotherapy agents include alkylating agents including nitrogen mustards such as mechlorethamine (HN2), cyclophosphamide, ifosfamide, melphalan (L-sarcolysin) and chlorambucil; anthracyclines; epothilones; nitrosoureas such as carmustine (BCNU), lomustine (CCNU), semustine (methyl-CCNU) and streptozocin (streptozotocin); triazenes such as decarbazine (DTIC; dimethyltriazenoimidazole-carboxamide; ethylenimines/methylmelamines such as hexamethylmelamine, thiotepa; alkyl sulfonates such as busulfan; Antimetabolites including folic acid analogues such as methotrexate (amethopterin); alkylating agents, antimetabolites, pyrimidine analogs such as fluorouracil (5-fluor
  • the method of treatment is a method of vaccination or a method of providing immunotherapy.
  • immunotherapy is the treatment of a disease or condition by inducing or enhancing an immune response in an individual.
  • immunotherapy refers to a therapy that comprises the administration of one or more drugs to an individual to elicit T cell responses.
  • immunotherapy refers to a therapy that comprises the administration or expression of polypeptides that contain one or more PEPIs to an individual to elicit a T cell response to recognize and kill cells that display the one or more PEPIs on their cell surface in conjunction with a class I HLA.
  • immunotherapy comprises the administration of one or more PEPIs to an individual to elicit a cytotoxic T cell response against cells that display tumor associated antigens (TAAs) or cancer testis antigens (CTAs) comprising the one or more PEPIs on their cell surface.
  • TAAs tumor associated antigens
  • CTAs cancer testis antigens
  • immunotherapy refers to a therapy that comprises the administration or expression of polypeptides that contain one or more PEPIs presented by class II HLAs to an individual to elicit a T helper response to provide co-stimulation to cytotoxic T cells that recognize and kill diseased cells that display the one or more PEPIs on their cell surface in conjunction with a class I HLAs.
  • immunotherapy refers to a therapy that comprises administration of one or more drugs to an individual that re-activate existing T cells to kill target cells.
  • the theory is that the cytotoxic T cell response will eliminate the cells displaying the one or more PEPIs, thereby improving the clinical condition of the individual.
  • immunotherapy may be used to treat tumors. In other instances, immunotherapy may be used to treat intracellular pathogen-based diseases or disorders.
  • the disclosure relates to the treatment of cancer or the treatment of solid tumors.
  • the treatment may be of cancers or malignant or benign tumors of any cell, tissue, or organ type.
  • the cancer may or may not be metastatic.
  • Exemplary cancers include carcinomas, sarcomas, lymphomas, leukemias, germ cell tumors, or blastomas.
  • the cancer may or may not be a hormone related or dependent cancer (e.g., an estrogen or androgen related cancer).
  • the disclosure relates to the treatment of a viral, bacterial, fungal or parasitic infection, or any other disease or condition that may be treated by immunotherapy.
  • the disclosure provides a system comprising a storage module configured to store data comprising the class I and/or class II HLA genotypes of each subject of a model population of human subjects; and the amino acid sequence of one or more test polypeptides; wherein the model population is representative of a test target human population; and a computation module configured to identify and/or quantify the amino acid sequences in the one or more test polypeptides that are capable of binding to multiple class I HLA molecules of each subject in the model population and/or the amino acid sequences in the one or more test polypeptides that are capable of binding to multiple class II HLA molecules of each subject in the model population.
  • the system may further comprise an output module configured to display any output prediction or treatment selection or recommendation described herein or the value of any pharmodynamic biomarker described herein.
  • the method of item 1 or item 2 further comprising repeating the method for one or more further polypeptides, pharmaceutical compositions, kits or panels of polypeptides, and ranking the polypeptides, pharmaceutical compositions, kits or panels of polypeptides according to their predicted cytotoxic T cell, helper T cell and/or or clinical response rates in said specific or target human population.
  • any one of items 1 to 3 further comprising selecting or recommending treatment of a subject in need thereof by administration of one or more polypeptides or pharmaceutical compositions or the polypeptides of one or more kits or panels of polypeptides, based on their predicted response rate or response rate ranking.
  • the method of item 4 or item 5 further comprising administering one or more of the selected or recommended polypeptides or pharmaceutical compositions or the polypeptides of one or more kits or panels of polypeptides to the subject.
  • a method of treatment of a human subject in need thereof comprising administering to the subject one or more polypeptides or pharmaceutical compositions that have been selected or recommended for treatment of the subject using a method according to item 4 or item 5.
  • each polypeptide fragment is a T cell epitope capable of binding to at least three HLA class I molecules or at least three HLA class II molecules of at least one subject in the model population; and ranking the fragments by
  • the method of item 9 which comprises selecting one or more of the polypeptide fragments based on their ranking, and designing or preparing the polypeptide to comprise or the polynucleic acid to encode the one of more selected polypeptide fragments.
  • any one of items 8 to 10 further comprising designing or preparing a polypeptide, a panel of polypeptides, or a pharmaceutical composition or kit comprising one or more polypeptides as active ingredients for use in a method of inducing an immune response in a subject of the specific or target human population, wherein the polypeptide(s) or active ingredient polypeptides comprises at least two polypeptide fragments, optionally between 2 and 15 polypeptide fragments, selected according to the method of item 8 or item 10.
  • a method of inducing an immune response in a subject of a specific or target human population comprising designing or preparing a polypeptide, a panel of polypeptides, a polynucleic acid encoding a polypeptide, or a pharmaceutical composition or kit for use in said specific or target human population according to the method of any one of items 8 to 15 and administering the polypeptide(s), polynucleic acid, pharmaceutical composition or the active ingredient polypeptides of the kit to the subject.
  • a polypeptide, panel of polypeptides, polynucleic acid, pharmaceutical composition or kit for use in a method of inducing an immune response in a subject of a specific or target human population wherein the polypeptide, panel of polypeptides, polynucleic acid, pharmaceutical composition or kit is designed or prepared according to the method of any one of items 8 to 16 for use in said specific or target human population, and wherein the composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • a pharmaceutical composition, panel of polypeptides or kit for use in a method of inducing an immune response in a subject of a specific or target human population wherein the pharmaceutical composition, panel of polypeptides or kit comprises as active ingredients a first and a second and optionally one or more additional polypeptides, wherein each polypeptide comprises an amino acid sequence that is a T cell epitope capable of binding to at least three HLA class I molecules of at least 10% of subjects in the specific or target population, wherein the T cell epitope of the first, second and optionally any additional regions are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • a pharmaceutical composition, panel of polypeptides or kit for use in a method of inducing an immune response in a human subject wherein the pharmaceutical composition, panel of polypeptides or kit comprises an active ingredient polypeptide comprising a first region and a second region and optionally one or more additional regions, wherein each region comprises an amino acid sequence that is a T cell epitope capable of binding to at least three HLA class I molecules of at least 10% of subjects in the specific or target population, wherein the T cell epitope of the first, second and optionally any additional regions are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • a pharmaceutical composition, panel of polypeptides or kit for use in a method treating a cancer in a subject in need thereof wherein the pharmaceutical composition, panel of polypeptides or kit comprises as active ingredients a first and a second peptide and optionally one or more additional peptides, wherein each peptide comprises an amino acid sequence that is an HLA class I-binding T cell epitope wherein at least 10% of human subjects having cancer both
  • a pharmaceutical composition, panel of polypeptides or kit for use in a method treating a cancer in a subject in need thereof wherein the pharmaceutical composition, panel of polypeptides or kit comprises an active ingredient polypeptide comprising a first and a second region and optionally one or more additional regions, wherein each region comprises an amino acid sequence that is an HLA class I-binding T cell epitope wherein at least 10% of human subjects having cancer both
  • a method of treatment of a human subject in need thereof comprising administering to the subject a polypeptide, a panel of polypeptides, a pharmaceutical composition or the active ingredient polypeptides of a kit according to any one of items 17 to 25, wherein the subject has been determined to express at least three HLA class I molecules and/or at least three HLA class II molecules capable of binding to the polypeptide or to one or more of the active ingredient polypeptides of the pharmaceutical composition or kit.
  • a system comprising
  • HLA I-epitope binding prediction process was validated by comparison with HLA I-epitope pairs determined by laboratory experiments. A dataset was compiled of HLA I-epitope pairs reported in peer reviewed publications or public immunological databases.
  • the probability of multiple HLA binding to an epitope shows the relationship between the number of HLAs binding an epitope and the expected minimum number of real binding. Per PEPI definition three is the expected minimum number of HLA to bind an epitope (bold).
  • the validated HLA-epitope binding prediction process was used to determine all HLA-epitope binding pairs described in the Examples below.
  • the presentation of one or more epitopes of a polypeptide antigen by one or more HLA I of an individual is predictive for a CTL response was determined.
  • All of these clinical trials measured antigen specific CD8+ CTL responses (immunogenicity) in the study subjects after vaccination. In some cases, correlation between CTL responses and clinical responses were reported.
  • the 157 patient datasets (Table 11) were randomized with a standard random number generator to create two independent cohorts for training and evaluation studies. In some cases the cohorts contained multiple datasets from the same patient, resulting in a training cohort of 76 datasets from 48 patients and a test/validation cohort of 81 datasets from 51 patients.
  • **Immunoassays are based on T cell stimulation with antigen-specific peptide pools and quantify the released cytokines by different techniques.
  • CT Clinical trial
  • SBT Sequence Based Typing
  • SSO Sequence-Specific Oligonucleotide
  • ICS Intracellular cytokine staining
  • SSP Sequence-specific priming
  • the reported CTL responses of the training dataset were compared with the HLA I restriction profile of epitopes (9 mers) of the vaccine antigens.
  • the antigen sequences and the HLA I genotype of each patient were obtained from publicly available protein sequence databases or peer reviewed publications and the HLA I-epitope binding prediction process was blinded to patients' clinical CTL response data.
  • the number of epitopes from each antigen predicted to bind to at least 1 (PEPI1+), or at least 2 (PEPI2+), or at least 3 (PEPI3+), or at least 4 (PEPI4+), or at least 5 (PEPI5+), or all 6 (PEPI6) HLA class I molecules of each patient was determined and the number of HLA bound were used as classifiers for the reported CTL responses.
  • the true positive rate (sensitivity) and true negative rate (specificity) were determined from the training dataset for each classifier (number of HLA bound) separately.
  • ROC analysis was performed for each classifier.
  • the true positive rate (Sensitivity) was plotted in function of the false positive rate (1-Specificity) for different cut-off points ( FIG. 1 ).
  • Each point on the ROC curve represents a sensitivity/specificity pair corresponding to a particular decision threshold (epitope (PEPI) count).
  • the area under the ROC curve (AUC) is a measure of how well the classifier can distinguish between two diagnostic groups (CTL responder or non-responder).
  • the threshold count of PEPI3+(number of antigen-specific epitopes presented by 3 or more HLA of an individual) that best predicted a positive CTL response was 1 (Table 13).
  • at least one antigen-derived epitope is presented by at least 3 HLA class I of a subject ( ⁇ 1 PEPI3+)
  • the antigen can trigger at least one CTL clone, and the subject is a likely CTL responder.
  • ⁇ 1 PEPI3+ Test to predict likely CTL responders (“ ⁇ 1 PEPI3+ Test”) provided 76% diagnostic sensitivity (Table 13).
  • the test cohort of 81 datasets from 51 patients was used to validate the ⁇ 1 PEPI3+ threshold to predict an antigen-specific CTL response. For each dataset in the test cohort it was determined whether the ⁇ 1 PEPI3+ threshold was met (at least one antigen-derived epitope presented by at least three class I HLA of the individual). This was compared with the experimentally determined CTL responses reported from the clinical trials (Table 14).
  • Performance characteristic Description Result Positive 100%[A/(A + B)] The likelihood that an individual that 84% predictive meets the ⁇ 1 PEPI3+ threshold has value (PPV) antigen-specific CTL responses after treatment with immunotherapy. Sensitivity 100%[A/(A + C)] The proportion of subjects with antigen- 75% specific CTL responses after treatment with immunotherapy who meet the ⁇ 1 PEPI3+ threshold. Specificity 100%[D/(B + D)] The proportion of subjects without antigen- 55% specific CTL responses after treatment with immunotherapy who do not meet the ⁇ 1 PEPI3+ threshold.
  • Negative 100%[D/(C + D)] The likelihood that an individual who does 42% predictive not meet the ⁇ 1 PEPI3+ threshold does not value (NPV) have antigen-specific CTL responses after treatment with immunotherapy.
  • Overall 100%[(A + D)/N] The percentage of predictions based on 70% percent the ⁇ 1 PEPI3+ threshold that match agreement the experimentally determined result, (OPA) whether positive or negative. Fisher's exact (p) 0.01
  • ROC analysis determined the diagnostic accuracy, using the PEPI3+ count as cut-off values ( FIG. 2 ).
  • the AUC value 0.73.
  • an AUC of 0.7 to 0.8 is generally considered as fair diagnostic.
  • the ⁇ 1 PEPI3+ Test was compared with a previously reported method for predicting a specific human subject's CTL response to peptide antigens.
  • the HLA genotypes of 28 cervical cancer and VIN-3 patients that received the HPV-16 synthetic long peptide vaccine (LPV) in two different clinical trials were determined from DNA samples 8 9 10 .
  • the LPV consists of long peptides covering the HPV-16 viral oncoproteins E6 and E7.
  • the amino acid sequence of the LPV was obtained from these publications.
  • the publications also report the T cell responses of each vaccinated patient to pools of overlapping peptides of the vaccine.
  • PEPI3+s patient class I HLA
  • Peptides that comprised at least one PEPI3+( ⁇ 1 PEPI3+) were predicted to induce a CTL response.
  • Peptides that comprised no PEPI3+ were predicted not to induce a CTL response.
  • the ⁇ 1 PEPI3+ Test correctly predicted 489 out of 512 negative CTL responses and 8 out of 40 positive CTL responses measured after vaccination ( FIG. 3A ). Overall, the agreement between the ⁇ 1 PEPI3+ Test and experimentally determined CD8+ T cell reactivity was 90% (p ⁇ 0.001).
  • the sensitivity of the prediction of HLA class II restricted epitopes was 78%, since the State of Art tool predicted 84 positive responses (positive CD4+ T cell reactivity to a peptide pool for a person's DP alleles) out of 107 (sensitivity 78%).
  • the specificity was 22% since it could rule out 7 negative responses out of 31.
  • Example 6 the ⁇ 1 PEPI3+ Test Predicts T Cell Responses to Full Length LPV Polypeptides
  • the ⁇ 1 PEPI3+ Test was used to predict patient CD8+ and CD4+ T cell responses to the full length E6 and E7 polypeptide antigens of the LPV vaccine. Results were compared to the experimentally determined responses were reported.
  • the Test correctly predicted the CD8+ T cell reactivity (PEPI3+) of 11 out of 15 VIN-3 patients with positive CD8+ T cell reactivity test results (sensitivity 73%, PPV 85%) and of 2 out of 5 cervical cancer patients (sensitivity 40%, PPV 100%).
  • the CD4+ T cell reactivities (PEPI4+) were correctly predicted 100% both of VIN-3 and cervical cancer patients ( FIGS. 5A-D ).
  • pGX3001 is an HPV16 based DNA vaccine containing full length E6 and E7 antigens with a linker in between.
  • pGX3002 is an HPV18 based DNA vaccine containing full length E6 and E7 antigens with a linker in between.
  • a Phase II clinical trial investigated the T cell responses of 17 HPV-infected patients with cervical cancer who were vaccinated with both pGX3001 and pGX3002 (VGX-3100 vaccination) 1 .
  • FIGS. 5A-D and FIG. 6 shows for two illustrative patients (patient 12-11 and patient 14-5) the position of each epitope (9 mer) presented by at least 1 (PEPI1+), at least 2 (PEPI2+), at least 3 (PEPI3+), at least 4 (PEPI4+), at least 5 (PEPI5+), or all 6 (PEPI6) class I HLA of these patients within the full length sequence of the two HPV-16 and two HPV-18 antigens.
  • PEPI1+ PEPI1+
  • PEPI2+ at least 3
  • PEPI4+ at least 4
  • PEPI5+ at least 5
  • PEPI6 all 6
  • Patient 12-11 had an overall PEPI1+ count of 54 for the combined vaccines (54 epitopes presented by one or more class I HLA).
  • Patient 14-5 had a PEPI1+ count of 91. Therefore patient 14-5 has a higher PEPI1+ count than patient 12-11 with respect to the four HPV antigens.
  • the PEPI1+s represent the distinct vaccine antigen specific HLA restricted epitope sets of patients 12-11 and 14-5. Only 27 PEPI1+s were common between these two patients.
  • PEPI3+ counts (number of epitopes presented by three or more patient class I HLA)
  • the results for patients 12-11 and 14-5 were reversed.
  • Patient 12-11 had a PEPI3+ count of 8, including at least one PEPI3+ in each of the four HPV16/18 antigens.
  • Patient 14-5 had a PEPI3+ count of 0.
  • the diversity of the patient's PEPI3+ set resembled the diversity of T cell responses generally found in cancer vaccine trials.
  • Patients 12-3 and 12-6 similar to patient 14-5, did not have PEPI3+s predicting that the HPV vaccine could not trigger T cell immunity. All other patients had at least one PEPI3 predicting the likelihood that the HPV vaccine can trigger T cell immunity. 11 patients had multiple PEPI3+ predicting that the HPV vaccine likely triggers polyclonal T cell responses.
  • Patients 15-2 and 15-3 could mount high magnitude T cell immunity to E6 of both HPV, but poor immunity to E7.
  • Other patients 15-1 and 12-11 had the same magnitude response to E7 of HPV18 and HPV16, respectively.
  • Example 8 Design of a Model Population for Conducting in Silico Trials and Identifying Candidate Precision Vaccine Targets for Large Population
  • a database of a “Big Population” containing 7,189 subjects characterized with 4-digit HLA genotype and demographic information was also established.
  • the Big Population has 328 different HLA class I alleles.
  • the HLA allele distribution of the Model Population significantly correlated with the Big Population (Table 16) (Pearson p ⁇ 0.001). Therefore the 433 patient Model Population is representative for a 16 times larger population.
  • the Model Population is representative for 85% of the human race as given by HLA diversity as well as HLA frequency.
  • the objective of this study was to determine whether a model population, such as the one described in Example 8, may be used to predict CTL reactivity rates of vaccines, i.e. used in an in silico efficacy trials.
  • peptide vaccines derived from cancer antigens that induced T cell responses in a subpopulation of subjects were identified from peer reviewed publications. These peptides have been investigated in clinical trials enrolling a total of 172 patients (4 ethnicities). T cell responses induced by the vaccine peptides have been determined from blood specimens and reported. The immune response rate as the percentage of study subjects with positive T cell responses measured in the clinical trials was determined ( FIG. 7 ).
  • the 12 peptides were investigated with the ⁇ 1 PEPI3+ Test in each of the 433 subjects of the Model Population described in Example 8.
  • the “ ⁇ 1 PEPI3+ Score” for each peptide was calculated as the proportion of subjects in the Model Population having at least one vaccine derived epitope that could bind to at least three subject-specific HLA class I ( ⁇ 1 PEPI3+). If the corresponding clinical trial stratified patients for HLA allele selected population, the Model Population was also filtered for subjects with the respective allele(s) (Example: WT1, HLA-A*0201).
  • Each vaccine peptide of the 19 clinical trials was investigated with the ⁇ 1 PEPI3+ Test in each subject of the Model Population.
  • the ⁇ 1 PEPI3+ Score for each peptide was calculated as the proportion of subjects in the Model Population having at least one vaccine derived PEPI3+.
  • the experimentally determined response rates reported from the trials were compared with the PEPI Scores, as in Example 9 (Table 20).
  • Example 11 in Silico Trial Based on the Identification of Multiple HLA Binding Epitopes in a Multi-Peptide Vaccine Predict the Reported Clinical Trial Immune Response Rate
  • IMA901 is a therapeutic vaccine for renal cell cancer (RCC) comprising 9 peptides derived from tumor-associated peptides (TUMAPs) that are naturally presented in human cancer tissue.
  • RCC renal cell cancer
  • TUMAPs tumor-associated peptides
  • a total of 96 HLA-A*02+ subjects with advanced RCC were treated with IMA901 in two independent clinical studies (phase I and phase II).
  • Each of the 9 peptides of IMA901 have been identified in the prior art as HLA-A2-restricted epitopes. Based on currently accepted standards, they are all strong candidate peptides to boost T cell responses against renal cancer in the trial subjects, because their presence has been detected in renal cancer patients, and because the trial patients were specifically selected to have at least one HLA molecule capable of presenting each of the peptides.
  • phase I and phase II study results show the variability of the immune responses to the same vaccine in different trial cohorts. Overall, however, there was a good agreement between response rates predicted by the ⁇ 2 PEPI3+ Test and the reported clinical response rates.
  • Example 12 in Silico Trial Based on the Identification of Vaccine-Derived Multiple HLA Binding Epitopes Predict Reported Experimental Clinical Response Rates
  • DCRs Disease Control Rates
  • ORR objective response rate
  • MultiPEPI Score Overall Percentage Immunotherapy DCR (Predicted DCR) of Agreement IMA901 phase I 43% 27% 61% IMA901 phase II 22% 27% 81% Ipilimumab 60% 65% 92% HPV-SLP 60% 70% 86% HPV-SLP 62% 70% 89% gp100-2 peptides 15% 11% 73% Immucin 73% 59% 81% StimuVax 0% 0% 100% VGX-3100 50% 56% 89% TSPP peptide vaccine 48% 31% 65% KIF20A-66 peptide 26% 7% 27% vaccine Peptide vaccine 27% 10% 37% 7-peptide cocktail 10% 9% 90% vaccine GVX301 29% 7% 24% MAGE-A3 Trojan 35% 10% 29% PepCan 52% 26% 50% Melanoma peptide 12% 6% 50% vaccine
  • Example 13 in Silico Trials Based on the Identification of Multiple HLA Binding Epitopes Predict the Reported Cellular Immune Response Rates to a Vaccine Targeting a Mutational Antigen
  • the epidermal growth factor receptor variant III is a tumor-specific mutation broadly expressed in glioblastoma multiforme (GBM) and other neoplasms.
  • the mutation comprises an in-frame deletion of 801 bp from the extracellular domain of the EGFR that splits a codon and yields a novel glycine at the fusion junction.
  • 1, 2 This mutation encodes a constitutively active tyrosine kinase that increases tumor formation and tumor cell migration and enhances resistance against radiation and chemotherapy.
  • 3, 4, 5, 6, 7, 8, 9 This insertion results in a tumor-specific epitope which is not found in normal adult tissues making EGFRvIII a suitable target candidate for antitumor immunotherapy.
  • Rindopepimut is a 13-amino-acid peptide vaccine (LEEKKGNYVVTDHC) spanning the EGFRvIII mutation with an additional C-terminal cysteine residue.
  • the peptide conjugated to keyhole limpet hemocyanin (KLH) was administered to newly diagnosed EGFRvIII-expressing GBM patients.
  • the first three vaccinations were given biweekly, starting 4 weeks after the completion of radiation.
  • Subsequent vaccines were given monthly until radiographic evidence of tumor progression or death. All vaccines were given intradermally in the inguinal region. Immunologic evaluation showed only 3 out of 18 patients developing cellular immune response assessed by DTH reaction test.
  • FIG. 10 An HLA map of the Rindopepimut on the HLA alleles of the subjects in the Model Population ( FIG. 10 ) illustrates that very few HLA-A and HLA-C alleles can bind the vaccine epitopes which explains the lack of PEPI3+ in the in silico cohort.
  • TPO Thrombopoietin
  • EpiVax/Genentech used State of Art technology to identify class II HLA restricted epitopes and found that the most immunogenic region of the TPO is located in the C-terminal end of TPO (US20040209324 A1).
  • PEPI3+s multiple class II HLA binding epitopes from TPO in 400 HLA class II genotyped US subjects were determined. Most of the PEPI3+ peptides of these individuals located within the N terminal region of the TPO between 1-165 amino acids. PEPI3+ were sporadically identified in some subjects also in the C terminal region. However, our results were different from the State of Art.
  • This example describes the treatment of an ovarian cancer patient with a personalised immunotherapy composition, wherein the composition was specifically designed for the patient based on her HLA genotype based on the disclosure described herein.
  • This Example and Example 16 below provide clinical data to support the principals regarding binding of epitopes by multiple HLA of a subject to induce a cytotoxic T cell response on which the present disclosure is based.
  • the HLA class I and class II genotype of metastatic ovarian adenocarcinoma cancer patient XYZ was determined from a saliva sample.
  • each peptide was selected, each of which met the following two criteria: (i) derived from an antigen that is expressed in ovarian cancers, as reported in peer reviewed scientific publications; and (ii) comprises a fragment that is a T cell epitope capable of binding to at least three HLA class I of patient XYZ (Table 26).
  • each peptide is optimized to bind the maximum number of HLA class II of the patient.
  • PEPI3 peptides in this immunotherapy composition can induce T cell responses in XYZ with 84% probability and the two PEPI4 peptides (POC01-P2 and POC01-P5) with 98% probability, according to the validation of the PEPI Test shown in Table 10.
  • T cell responses target 13 antigens expressed in ovarian cancers. Expression of these cancer antigens in patient XYZ was not tested. Instead the probability of successful killing of cancer cells was determined based on the probability of antigen expression in the patient's cancer cells and the positive predictive value of the ⁇ 1 PEPI3+ Test (AGP count).
  • AGP count predicts the effectiveness of a vaccine in a subject: Number of vaccine antigens expressed in the patient's tumor (ovarian adenocarcinoma) with PEPI.
  • the AGP count indicates the number of tumor antigens that vaccine recognizes and induces a T cell response against the patient's tumor (hit the target).
  • the AGP count depends on the vaccine-antigen expression rate in the subject's tumor and the HLA genotype of the subject. The correct value must be between 0 (no PEPI presented by expressed antigen) and maximum number of antigens (all antigens are expressed and present a PEPI).
  • FIGS. 11A-B The probability that patient XYZ will express one or more of the 12 antigens is shown in FIGS. 11A-B .
  • a pharmaceutical composition for patient XYZ may be comprised of at least 2 from the 13 peptides (Table 26), because the presence in a vaccine or immunotherapy composition of at least two polypeptide fragments (epitopes) that can bind to at least three HLA of an individual ( ⁇ 2 PEPI3+) was determined to be predictive for a clinical response.
  • the peptides are synthetized, solved in a pharmaceutically acceptable solvent and mixed with an adjuvant prior to injection. It is desirable for the patient to receive personalized immunotherapy with at least two peptide vaccines, but preferable more to increase the probability of killing cancer cells and decrease the chance of relapse.
  • the 12 peptides were formulated as 4 ⁇ 3 ⁇ 4 peptide (POC01/1, POC01/2, POC01/3, POC01/4).
  • One treatment cycle is defined as administration of all 13 peptides within 30 days.
  • the HLA class I and class II genotype of metastatic breast cancer patient ABC was determined from a saliva sample.
  • twelve peptides were selected, each of which met the following two criteria: (i) derived from an antigen that is expressed in breast cancers, as reported in peer reviewed scientific publications; and (ii) comprises a fragment that is a T cell epitope capable of binding to at least three HLA class I of patient ABC (Table 29).
  • each peptide is optimized to bind the maximum number of HLA class II of the patient.
  • the twelve peptides target twelve breast cancer antigens. The probability that patient ABC will express one or more of the 12 antigens is shown in FIG. 13 .
  • the 12 peptides were formulated as 4 ⁇ 3 peptide (PBR01/1, PBR01/2, PBR01/3, PBR01/4).
  • One treatment cycle is defined as administration of all 12 different peptide vaccines within 30 days.
  • Diagnosis bilateral metastatic breast carcinoma: Right breast is ER positive, PR negative, Her2 negative; Left Breast is ER, PR and Her2 negative.
  • BRC-09 was treated with 5 cycles of PIT vaccine. She was feeling very well and she refused a PET CT examination in September 2017. In November she had symptoms, PET CT scan showed progressive disease, but she refused all treatments. In addition, her oncologist found out that she did not take Palbocyclib since spring/summer. Patient ABC passed away in January 2018.
  • the combination of pablocyclib and the personalised vaccine was likely to have been responsible for the remarkable early response observed following administration of the vaccine.
  • Palbocyclib has been shown to improve the activity of immunotherapies by increases CTA presentation by HLAs and decreasing the proliferation of Tregs: (Goel et al. Nature. 2017:471-475).
  • the PIT vaccine may be used as add-on to the state-of-art therapy to obtain maximal efficacy.
  • PEPI3+ Test and the Model Population described in Example 8 For select CTAs we used the PEPI3+ Test and the Model Population described in Example 8 to identify the 9 mer epitopes (PEPI3+s) that are most frequently presented by at least 3HLAs of the individuals in the Model Population. We refer to these epitopes herein as “bestEPIs”.
  • BestEPIs An illustrative example of the “PEPI3+ hotspot” analysis and bestEPI identification is shown in FIG. 14 for the PRAME antigen.
  • Ntotal number of samples analyzed for the expression of the certain antigen
  • N+ number of individuals expressing the certain antigen
  • N% expression frequency of the certain antigen
  • B% bestEPI frequency, ie. the percentage of individuals having the bestEPI within the model population
  • N%*B% expression frequency multiplied by the bestEPI frequency.
  • Tumor heterogeneity can be addressed by including peptide sequences that target multiple CTAs in a vaccine or immunotherapy regime.
  • the AG values described above characterize a vaccine independently from the target patient population. They can be used to predict the likelihood that a specific cancer (e.g. breast cancer) expresses antigens targeted by a specific vaccine or immunotherapy composition. AG values are based on known tumor heterogeneity, but do not take HLA heterogeneity into account.
  • HLA heterogeneity of a certain population can be characterised from the viewpoint of an immunotherapy or vaccine composition by the number of antigens representing PEPI3+. These are the vaccine-specific CTA antigens for which ⁇ 1 PEPI3+ is predicted, referred to herein as the “AP”.
  • the average number of antigens with PEPI3+(AP50) shows how the vaccine can induce immune response against the antigens targeted by the composition (breast cancer vaccine specific immune response).
  • Vaccines can be further characterized by AGP values that refers to antigens with PEPIs”.
  • This parameter is the combination of the previous two parameters: (1) AG is depending on the antigen expression frequencies in the specific tumor type but not on the HLA genotype of individuals in the population, and (2) AP is depending on the HLA genotype of individuals in a population without taking account the expression frequencies of the antigen.
  • the AGP is depending on both, the expression frequencies of vaccine antigens in the disease and the HLA genotype of individuals in a population.
  • the likelihood that a specific patient will have an immune response or a clinical response to treatment with one or more cancer vaccine peptides can be determined based on (i) the identification of PEPI3+ within the vaccine peptide(s) (9 mer epitopes capable of binding at least three HLA of the patient); and/or (ii) a determination of target antigen expression in cancer cells of the patient, for example as measured in a tumour biopsy. In some cases both parameters are ideally determined and the optimal combination of vaccine peptides is selected for use in treatment of the patient.
  • PEPI3+ analysis alone may be used if a determination of the expressed tumour antigens, for example by biopsy, is not possible, not advised, or unreliable due to biopsy error (i.e. biopsy tissue samples taken from a small portion of the tumor or metastasised tumors do not represent the complete repertoire of CTAs expressed in the patient).
  • the single peptide vaccines were immunogenic in 3%-23% of individuals.
  • the 30 mer peptides described in Example 18 above were each immunogenic in from 44% to 73% of individuals in the same cohorts. This result represents substantial improvement in immunogenicity of each peptide in PolyPEPI915.
  • Competing combination peptide products immune response rates were between 10-62%.
  • the invented PolyPEPI915 combination product were 96% in the Model Population and 93% in a breast cancer patient population, representing improvement in immunogenicity.
  • PolyPEPI915 vaccine Another improvement of using the PolyPEPI915 vaccine is the lower chance of tumor escape.
  • Each 30 mer peptide in PolyPEPI915 targets 2 tumor antigens. CTLs against more tumor antigens are more effective against heterologous tumor cells that CTLs against a single tumor antigen.
  • PolyPEPI915 vaccine is that individuals who likely respond to vaccination can be identified based on their HLA genotypes (sequence) and optionally antigen expression in their tumor using the methods described here. Pharmaceutical compositions with PolyPEPI vaccines will not be administered to individuals whose HLA cannot present any PEPI3 from the vaccines. During clinical trials correlation will be made between the mAGP or number of AGP in the PolyPEPI915 regimen and the duration of individual's responses. A vaccine combination with ⁇ 1 AGP is most likely required to destroy heterologous tumor cells.
  • Colorectal cancer CTAs were identified and ranked based on the overall expression frequencies of antigens found in colorectal cancer tumor samples as reported in peer reviewed publications ( FIG. 19 ) (Choi J, Chang H. The expression of MAGE and SSX, and correlation of COX2, VEGF, and survivin in colorectal cancer. Anticancer Res 2012. 32(2):559-564; Goossens-Beumer I J, Zeestraten E C, Benard A, Christen T, Reimers M S, Keijzer R, Sier C F, Morriss G J, Morreau H, Putter H, Vahrmeijer A L, van de Velde C J, Kuppen P J.
  • Ntotal number of biopsy samples (tumor specific antigen expression in human colorectal cancer tissues) analyzed for the expression of the certain antigen; N+: number of individuals expressing the certain antigen; N%: expression frequency of the certain antigen; B%: bestEPI frequency, ie. the percentage of induviduals having the bestEPI within the model population; N%*B%: expression frequency multiplied by the bestEPI frequency.
  • the PolyPEPI1018 Colorectal Cancer (CRC) Vaccine (PolyPEPI1018) composition is a peptide vaccine intended to be used as an add-on immunotherapy to standard-of-care CRC treatment options in patients identified as likely responders using a companion in vitro diagnostic test (CDx). Clinical trials are ongoing in the US and Italy to evaluate PolyPEPI1018 in metastatic colorectal cancer patients.
  • the product contains 6 peptides (6 of the 30 mer peptides PolyPEPI1015 described in examples 18 to 20 mixed with the adjuvant Montanide. The 6 peptides were selected to induce T cell responses against 12 epitopes from 7 cancer testis antigens (CTAs) that are most frequently expressed in CRC.
  • CTAs cancer testis antigens
  • the 6 peptides were optimized to induce long lasting CRC specific T cell responses.
  • Likely responder patients with T cell responses against multiple CTAs expressed in the tumor can be selected with a companion diagnostic (CDx).
  • CDx companion diagnostic
  • This example sets out the precision process used to design PolyPEPI1018. This process can be applied to design vaccines against other cancers and diseases.
  • tumor antigens are essential for the safety and efficacy of cancer vaccines.
  • the feature of a good antigen is to have restricted expression in normal tissues so that autoimmunity is prevented.
  • Several categories of antigen meet this requirement, including uniquely mutated antigens (e.g. p53), viral antigens (e.g. human papillomavirus antigens in cervical cancer), and differentiation antigens (e.g. CD20 in B-cell lymphoma).
  • CTAs cancer testis antigens
  • CTA expression knowledgebase contains CTAs that are expressed in CRC ranked in order by expression rate. Correlation studies conducted by the inventors (see Example 11) suggest that vaccines which induce CTL responses against multiple antigens that are expressed in tumor cells can benefit patients. Therefore, seven CTAs with high expression rates in CRC were selected for inclusion in PolyPEPI1018 development. Details are set out in Table 36.
  • Testis-Specific Protease-Like Protein 50 is an oncogene which induces cell proliferation, cell invasion, and tumor growth. It is frequently expressed in gastric-, breast-, cervical- and colorectal cancer samples; and rarely expressed in normal human tissues, except in spermatocytes of testes.
  • EpCAM 88.35% Epithelial Cell Adhesion Molecule is a tumor associated antigen, which is expressed in colon cancers and over-expressed in various human carcinomas. The high expression of EpCAM in cancer-initiating stem cells makes it a valuable target for cancer vaccines.
  • EpCAM is also expressed in at low or negligible levels in normal epithelial cells, with the exception of squamous epithelium, hepatocytes and keratinocytes.
  • Survivin 87.28% Survivin (Baculoviral IAP repeat-containing protein 5) is a multi-tasking protein that promotes cell proliferation and inhibits apoptosis. Though it is strongly expressed in fetal tissues and necessary for normal development, it is not expressed in most adult tissues. Survivin is expressed in various cancers including carcinomas. Normal tissues that express low level survivin include thymus, CD34 + bone-marrow-derived stem cells, and basal colonic epithelium.
  • CAGE1 74.47% Cancer-associated gene 1 protein is a typical CTA, which might play a role in cell proliferation and tumorigenesis.
  • CAGE1 is highly expressed in colorectal cancer tissues and weakly expressed in adjacent normal colorectal mucosa.
  • CAGE1 is expressed in melanoma, hepatoma, and breast tumors.
  • SPAG9 74.36% sperm-associated antigen 9 is involved in c-Jun N-terminal kinase-signaling and functions as a scaffold protein, thus playing an important role in cell survival, proliferation, apoptosis and tumor development.
  • SPAG9 expression was detected in epithelial ovarian cancer (90%), breast cancer (88%), cervical cancer (82%), renal cell cancer (88%) and colorectal cancer (74%) patients. None of the adjacent noncancerous tissues showed antigen expression. SPAG9 expression is restricted to testis.
  • FBXO39 38.60% FBXO39 (BCP-20) is a testis specific protein and is an important part of the E3 ubiquitin ligase complex. It participates in ubiquitination and has a role in regulating the cell cycle, immune responses, signaling, and proteasomal degradation of proteins.
  • FBXO39 is expressed in colon and breast cancers. FBXO39 expression has also been detected in ovary, placenta, and lung. FBXO39 expression is 100-fold higher in testis and 1,000- fold higher in colorectal cancers compared with normal tissue.
  • MAGEA8 43.75% Melanoma-associated antigen 8 function is not known, though it may play a role in embryonal development and tumor transformation or aspects of tumor progression.
  • MAGE-A8 gene is expressed in CRC and hepatocellular carcinoma. MAGE-A8 expression in normal tissues is restricted to the testis and the placenta.
  • the PEPI3+ biomarker predicts a subject's vaccine induced T cell responses.
  • the inventors developed and validated a test to accurately identify the PEPIs from antigen sequences and HLA genotypes (Examples 1, 2, 3).
  • the PEPI Test algorithm was used to identify the dominant PEPIs (besEPIs) from the 7 target CTAs to be included in PolyPEPI1018 CRC vaccine.
  • the dominant PEPIs identified with the process described here can induce CTL responses in the highest proportion of subjects:
  • the 12 dominant PEPIs that are derived from the 7 CTAs in PolyPEPI1018 are presented in the following table.
  • the PEPI % in Model Population indicates the proportion of 433 subjects with the indicated PEPI, i.e. the proportion of subjects where the indicated PEPI can induce CTL responses. There is very high variability (18%-78%) in the dominant PEPIs to induce CTL responses despite the optimization steps used in the identification process.
  • the inventors optimized each dominant PEPI to bind to most HLA class II alleles of most subjects. This should enhance efficacy, because it will induce CD4+T helper cells that can augment CD8 + CTL responses and contribute to long lasting T cell responses.
  • the example presented in FIG. 4 demonstrates that PEPIs that bind to 23 HLA class II alleles most likely activate T helper cells.
  • the 15-mer peptides selected with the process described here contain both HLA class I and class II binding dominant PEPIs. Therefore, these peptides can induce both CTL and T helper responses in the highest proportion of subjects.
  • the 12 optimized 15-mer peptides derived from the 7 CTAs in PolyPEPI1018 are presented in the Table 38. These peptides have different HLA class II binding characteristics. There is a high variability (0%-100%) in PEPI generation capacity ( ⁇ 3 HLA binding) among these peptides despite such an optimized personalized vaccine design.
  • CRC antigens alleles binding binding binding binding binding binding binding binding binding binding CRC-P1 TSP50 (83-97) 0 0% 0% 0% 0% 0% TSP50 (190-204) 4 100% 99% 88% 53% CRC-P2 EPCAM(139-153) 5 100% 100% 100% 98% SURVIVIN(127- 2 84% 58% 26% 11% 141) CRC-P3 EPCAM(251-265) 0 0% 0% 0% 0% MAGE-A8(113- 4 100% 100% 95% 72% 127) CRC-P6 CAGE(613-627) 5 100% 100% 99% 35% SURVIVIN(15-29) 3 100% 97% 83% 45% CRC-P7 CAGE(759-773) 3 100% 98% 87% 56% SPAG9(16-30) 1 66% 35% 9% 2% CRC-P8 FBXO39(95-109) 3 100% 94% 43% 13% FBXO39(284-298) 5 100% 100% 100% 100% 98% 98%
  • the 30-mer vaccine peptides have the following advantages compared to shorter peptides:
  • Each 30-mer peptide in PolyPEPI1018 consists of 2 HLA class I binding dominant PEPIs and at least one strong HLA class II binding PEPI. Strong binding PEPIs bind to 4 HLA class II alleles in ⁇ 50% of individuals. Therefore, the vaccine peptides are tailored to both HLA class I and class II alleles of individual subjects in a general population (which is a relevant population for CRC vaccine design).
  • Selected peptides for the PolyPEPI1018 composition are as shown in Table 39.
  • the inventors used the PEPI3+ Test to characterized the immunogenicity of PolyPEPI1018 in a cohort of 37 CRC patients with complete HLA genotype data. T cell responses were predicted in each patient against the same 9 mer peptides that will be used in clinical trials. These peptides represent the 12 dominant PEPI3+ within the PolyPEP11018 peptides. The 9 mers are shown in Table 39.
  • PEPI3+ prediction depends on the actual number of HLAs predicted to bind a particular epitope. Specifically, the inventors have determined that the probability that one HLA-restricted epitope induces a T cell response in a subject is typically 4%, which explains the poor sensitivity of the state-of-art prediction methods based on HLA restricted epitope prediction. Applying the PEPI3+ methodology, the inventors determined the probability that T cell response to each of the dominant PEPI3+-specific would be induced by PolyPEPI1018 in the 37 CRC patients. The results from this analysis are summarized in the Table 40.
  • a method was developed that can be performed on any antigen to determine its potential to induce toxic immune reaction, like autoimmunity.
  • the method is referred to herein as immunoBLAST.
  • PolyPEPI1018 contains six 30-mer polypeptides. Each polypeptide consists of two 15-mer peptide fragments derived from antigens expressed in CRC. Neoepitopes might be generated in the joint region of the two 15-mer peptides and could induce undesired T cell responses against healthy cells (autoimmunity). This was assesses using the inventors applied the immunoBLAST methodology.
  • a 16-mer peptide for each of the 30-mer components of PolyPEP1018 was designed. Each 16-mer contains 8 amino acids from the end of the first 15 residues of the 30-mer and 8 amino acids from the beginning of the second 15 residues of the 30-mer—thus precisely spanning the joint region of the two 15-mers. These 16-mers are then analysed to identify cross-reactive regions of local similarity with human sequences using BLAST (https://blast.ncbi.nlm.nih.gov/Blast.cgi), which compares protein sequences to sequence databases and calculates the statistical significance of matches. 8-mers within the 16-mers were selected as the examination length since that length represents the minimum length needed for a peptide to form an epitope, and is the distance between the anchor points during HLA binding.
  • the positions of amino acids in a polypeptide are numbered.
  • the start positions of potential 9-mer peptides that can bind to HLAs and form neoepitopes are the 8 amino acids in positions 8-15.
  • the ratio of possible neoepitope generating peptides is 36.4% (8/22).
  • the PEPI3+ Test was used to identify neoepitopes and neoPEPI among the 9-mer epitopes in the joint region.
  • the risk of PolyPEPI1018 inducing unwanted T cell responses was assessed in the 433 subjects in the Model Population by determining the proportion of subjects with PEPI3+ among the 9-mers in the joint region.
  • the result of neoepitope/neoPEPI analysis is summarized in table 41.
  • the average predicted epitope number that could be generated by intracellular processing was 40.12.
  • Neoepitopes were frequently generated; 11.61 out of 40.12 (28.9%) epitopes are neoepitopes.
  • Most of the peptides were able to be identified as a neoepitope, but the number of subjects that present neoepitopes varied.
  • Epitopes harbored by PolyPEPI1018 create an average of 5.21 PEPI3+. These PEPIs can activate T cells in a subject. The amount of potential neoPEPIs was much lower than neoepitopes (3.7%). There is a marginal possibility that these neoPEPIs compete on T cell activation with PEPIs in some subjects. Importantly, the activated neoPEPI specific T cells had no targets on healthy tissue.
  • Neoepitopes of PolyPEPI1018 Epitope & PEPI3+ binding in 433 Subjects of the Model Population Poly- Epitope Binding (1 x HLA) PEPI3+ binding (3 x HLA) PEPI1018 Neo- Neo- Peptide Potential EPI EPI ID: Neoepitope Sub# Sub% NeoEPI count Sub# Sub% NeoEPI count CRC-P1 QFPVSEGKS 0 0.0% 7 0 0.0% 3 FPVSEGKSR 160 37.0% X 1 0.2% X PVSEGKSRY 150 34.6% X 0 0.0% VSEGKSRYR 194 44.8% X 1 0.2% X SEGKSRYRA 113 26.1% X 0 0.0% EGKSRYRAQ 77 17.8% X 0 0.0% GKSRYRAQR 37 8.5% X 0 0.0% KSRYRAQRF 337 77.8% X 33 7.6% X CRC-P2 IELKHKART 32 7.4% X 7 0
  • the inventors have developed pharmacodynamic biomarkers to predict the activity/effect of vaccines in individual human subjects as well as in populations of human subjects. These biomarkers expedite more effective vaccine development and also decrease the development cost.
  • the inventors have the following tools:
  • Antigen expression knowledgebase The inventors have collected data from experiments published in peer reviewed scientific journals regarding the tumor antigens expressed by tumor cells and organized by tumor type to create a database of CTA expression levels—CTA database (CTADB). As of April 2017, the CTADB contained data from 145 CTAs from 41,132 tumor specimens, and was organized by the CTA expression frequencies in different types of cancer.
  • CTADB CTA database
  • silico trial populations The inventors have also collected data on the HLA genotypes of several different model populations. Each individual in the populations has complete 4-digit HLA genotype and ethnicity data. The populations are summarized in Table 42.
  • Table 43 shows the antigenicity and effectiveness of PolyPEPI1018 in 37 CRC patients using AP and AGP50, respectively.
  • the AP and AGP50 have high variability.
  • the most immunogenic antigen in PolyPEPI1018 was FOX039; each patient had a PEPI3+.
  • FOX039 is expressed only 39% of CRC tumors, suggesting that 61% of patients will have FOX039 specific T cell responses that do not recognize the tumor.
  • the least immunogenic antigen was MAGE-A8; none of the 37 CRC patients had a PEPI3+ despite the antigen being expressed in 44% of CRC tumors.
  • AGP50 indicates the mean number of expressed antigens in CRC tumor with PEPIs. Patients with higher AGP50 values are more likely to respond to PolyPEPI1018 since higher AGP50 values indicate that the vaccine can induce T cell responses against more antigens expressed in CRC cells.
  • the last column in the Table 43 shows the probability of mAGP (multiple AGP; i.e., at least 2 AGPs) in each of the 37 CRC patients.
  • the average mAGP in patients with CRC is 66%, suggesting that there is a 66% likelihood that a CRC patient will induce T cell responses against multiple antigens expressed in the tumor.
  • Antigen expression data can be obtained from achieved tumor specimen and organized in databases. 4-digit HLA genotyping can be done from a saliva specimen. It is a validated test performed by certified laboratories worldwide for transplantation and paternity testing. These assessments will allow drug developers and physicians to gain deeper insights into the immunogenicity and activity of tumor response and the possible emergence of resistance.
  • the antigenicity of PolyPEPI1018 in a subject is determined by the AP count, which indicates the number of vaccine antigens that induce T cell responses in a subject.
  • the AP count of PolyPEPI1018 was determined in each of the 433 subjects in the Model Population using the PEPI Test, and the AP50 count was then calculated for the Model Population.
  • the AP50 of PolyPEPI1018 in the Model Population is 3.62. Therefore, the mean number of immunogenic antigens (i.e., antigens with ⁇ 1 PEPI) in PolyPEPI1018 in a general population is 3.62.
  • Vaccine induced T cells can recognize and kill tumor cells if a PEPI in the vaccine is presented by the tumor cell.
  • the number of AGPs (expressed antigens with PEPI) is an indicator of vaccine effectiveness in an individual, and is dependent on both the potency and antigenicity of PolyPEPI1018.
  • the mean number of immunogenic CTAs i.e., AP [expressed antigens with ⁇ 1 PEPI]) in PolyPEPI1018 is 2.54 in the Model Population.
  • Table 44 shows the comparison of the immunogenicity, antigenicity, and effectiveness of PolyPEPI1018 in different populations.
  • Example 24 Personalised Immunotherapy Composition for Treatment of Patient with Late Stage Metastatic Breast Cancer
  • IBC Inflammatory breast cancer
  • inflammatory breast cancer is a rare, but aggressive form of locally advanced breast cancer. It's called inflammatory breast cancer because its main symptoms are swelling and redness (the breast often looks inflamed).
  • Most inflammatory breast cancers are invasive ductal carcinomas (begin in the milk ducts). This type of breast cancer is associated with the expression of oncoproteins of high risk Human Papilloma Virus. Indeed, HPV16 DNA was diagnosed in the tumor of this patient.
  • T4 Tumor of any size with direct extension to the chest wall and/or to the skin (ulceration or skin nodules)
  • pN3a Metastases in ⁇ 10 axillary lymph nodes (at least 1 tumor deposit ⁇ 2.0 mm); or metastases to the infraclavicular (level III axillary lymph) nodes.
  • T cell responses were measured cells in peripheral mononuclear cells 2 weeks after the 1 st vaccination with the mix of peptides PBRC05_P1, PBRC05_P2, PBRC05_P3, PBRC05_P4, PBRC05_P5, PBRC05_P6, PBRC05_P7.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Cell Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Physics & Mathematics (AREA)
  • Epidemiology (AREA)
  • Biotechnology (AREA)
  • Mycology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Analytical Chemistry (AREA)
  • Biochemistry (AREA)
  • Oncology (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Food Science & Technology (AREA)
  • Organic Chemistry (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Zoology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Toxicology (AREA)
  • Biophysics (AREA)
  • Spectroscopy & Molecular Physics (AREA)
  • Medical Informatics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)

Abstract

The disclosure relates to methods of identifying fragments of a polypeptide that are immunogenic for a specific human subject, methods of preparing pharmaceutical compositions comprising such polypeptide fragments, pharmaceutical compositions comprising such polypeptide fragments, and methods of treatment using such compositions. The methods comprise identifying a fragment of the polypeptide that binds to multiple HLA of individual subjects.

Description

    CROSS-REFERENCE
  • This application claims the benefit of priority to European Application No. 17159242.1, filed on Mar. 3, 2017, European Application No. 17159243.9, filed on Mar. 3, 2017, and Great Britain Application No. 1703809.2, filed on Mar. 9, 2017, each of which are incorporated herein by reference in their entireties.
  • SEQUENCE LISTING
  • The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created Mach 2, 2018, is named “52895702201_SL.txt” and is 50,662 bytes in size.
  • FIELD
  • The disclosure relates to methods of predicting whether a polypeptide is immunogenic for a specific human subject, methods of identifying fragments of a polypeptide that are immunogenic for a specific human subject, methods of preparing precision pharmaceutical compositions or kits comprising such polypeptide fragments, human subject-specific pharmaceutical compositions comprising such polypeptide fragments, and methods of treatment using such compositions.
  • BACKGROUND
  • For decades, scientists have assumed that chronic diseases were beyond the reach of a person's natural defences. Recently, however, significant tumor regressions observed in individuals treated with antibodies that block immune inhibitory molecules have accelerated the field of cancer immunotherapy. These clinical findings demonstrate that re-activation of existing T cell responses results in meaningful clinical benefit for individuals. These advances have renewed enthusiasm for developing cancer vaccines that induce tumor specific T cell responses.
  • Despite the promise, current immunotherapy is effective only in a fraction of individuals. In addition, most cancer vaccine trials have failed to demonstrate statistically significant efficacy because of a low rate of tumor regression and antitumor T cell responses in individuals. Similar failures were reported with therapeutic and preventive vaccines that sought to include T cell responses in the fields of HIV and allergy. There is a need to overcome the clinical failures of immunotherapies and vaccines.
  • SUMMARY
  • In antigen presenting cells (APC) protein antigens are processed into peptides. These peptides bind to human leukocyte antigen molecules (HLAs) and are presented on the cell surface as peptide-HLA complexes to T cells. Different individuals express different HLA molecules and different HLA molecules present different peptides. Therefore, according to the state of the art, a peptide, or a fragment of a larger polypeptide, is identified as immunogenic for a specific human subject if it is presented by a HLA molecule that is expressed by the subject. In other words, the state of the art describes immunogenic peptides as HLA-restricted epitopes. However, HLA restricted epitopes induce T cell responses in only a fraction of individuals who express the HLA molecule. Peptides that activate a T cell response in one individual are inactive in others despite HLA allele matching. Therefore, it was unknown how an individual's HLA molecules present the antigen-derived epitopes that positively activate T cell responses.
  • As provided herein multiple HLA expressed by an individual need to present the same peptide in order to trigger a T cell response. Therefore the fragments of a polypeptide antigen that are immunogenic for a specific individual are those that can bind to multiple class I (activate cytotoxic T cells) or class II (activate helper T cells) HLAs expressed by that individual.
  • Accordingly, in a first aspect the disclosure provides a method of predicting the cytotoxic T cell response rate and/or the helper T cell response rate of a specific or target human population to administration of a polypeptide, or to administration of a pharmaceutical composition, kit or panel of polypeptides comprising one or more polypeptides as active ingredients, the method comprising
      • (i) selecting or defining a relevant model human population comprising a plurality of subjects each defined by HLA class I genotype and/or HLA class II genotype;
      • (ii) determining for each subject in the model human population whether the polypeptide or polypeptides together comprise
        • (a) at least one amino acid sequence that is a T cell epitope capable of binding to at least two HLA class I molecules of the subject; and/or
        • (b) at least one amino acid sequence that is a T cell epitope capable of binding to at least two HLA class II molecules of the subject; and
      • (iii) predicting
        • A. the cytotoxic T cell response rate of said human population, wherein a higher proportion of the model human population meeting the requirements of step (ii)(a) predicts a higher cytotoxic T cell response rate in said human population; and/or
        • B. the helper T cell response rate of said human population, wherein a higher proportion of the model human population meeting the requirements of step (ii)(b) predicts a higher helper T cell response rate in said human population.
  • The disclosure further provides a method of predicting the clinical response rate of a specific or target human population to administration of a pharmaceutical composition, kit or panel of polypeptides comprising one or more polypeptides as active ingredients, the method comprising
      • (i) selecting or defining a relevant model human population comprising a plurality of subjects each defined by HLA class I genotype;
      • (ii) determining
        • (a) for each subject in the model human population whether the one or more active ingredient polypeptides together comprise at least two different amino acid sequences each of which is a T cell epitope capable of binding to at least two HLA class I molecules of the subject, optionally wherein the at least two different amino acid sequences are comprised in the amino acid sequence of two different polypeptide antigens targeted by the active ingredient polypeptide(s);
        • (b) in the model population the mean number of target polypeptide antigens that comprise at least one amino acid sequence that is
          • A. a T cell epitope capable of binding to at least three HLA class I molecules of the individual subjects of the model population; and
          • B. comprised in the amino acid sequence of the active ingredient polypeptide(s); and/or
        • (c) in the model population the mean number of expressed target polypeptide antigens that comprise at least one amino acid sequence that is
          • A. a T cell epitope capable of binding to at least three HLA class I molecules of the individual subjects of the model population; and
          • B. comprised in the amino acid sequence of the active ingredient polypeptide(s); and
      • (iii) predicting the clinical response rate of said human population, wherein a higher proportion of the model human population meeting the requirements of step (ii)(a), or a higher mean number of target polypeptides in step (ii)(b), or a higher mean number of expressed target polypeptides in step (ii)(c) predicts a higher clinical response rate in said human population.
  • The disclosure further provides methods of treatment of a human subject in need thereof, the method comprising administering to the subject a polypeptide, pharmaceutical composition or kit of the polypeptides of a panel of polypeptides that has been identified or selected based on the predicted immune or clinical response rate determined as described above; their use in a method of treatment of a relevant human subject; and their use in the manufacture of a medicament for treating a relevant subject.
  • The disclosure also provides a method of designing or preparing a polypeptide, or a polynucleic acid that encodes a polypeptide, for use in a method of inducing an immune response in a subject of a specific or target human population, the method comprising
      • (i) selecting or defining
        • (a) a relevant model human population comprising a plurality of subjects each defined by HLA class I genotype and/or by HLA class II genotype; and/or
        • (b) a relevant model human population comprising a plurality of subjects each defined by HLA class I genotype and one relevant model human population comprising a plurality of subjects each defined by HLA class II genotype;
      • (ii) identifying a fragment of up to 50 consecutive amino acids of a target polypeptide antigen that comprises or consists of
        • A. a T cell epitope capable, in a high percentage of the subjects of a model population selected or defined in step (i) that is defined by HLA class I genotype, of binding to at least three HLA class I molecules of the individual subjects;
        • B. a T cell epitope capable, in a high percentage of the subjects of a model population selected or defined in step (i) that is defined by HLA class II genotype, of binding to at least three HLA class II molecules of the individual subjects; or
        • C. a T cell epitope capable, in a high percentage of the subjects of a model population selected or defined in step (i) that is defined by HLA class I genotype, of binding to at least three HLA class I molecules of the individual subjects and a T cell epitope capable, in a high percentage of the subjects of a model population selected or defined in step (i) that is defined by HLA class II genotype, of binding to at least three HLA class II molecules of the individual subjects;
      • (iii) if the polypeptide fragment selected in step (ii) consists of an amino acid sequence that is an HLA class I-binding epitope, optionally selecting a longer fragment of the target polypeptide antigen, which longer fragment comprises or consists of an amino acid sequence that
        • D. comprises the fragment selected in step (ii); and
        • E. is an HLA class II molecule-binding T cell epitope capable, in a high percentage of the subjects of a model population selected or defined in step (i) that is defined by HLA class II genotype, of binding to at least three, or the most possible HLA class II molecules of the individual subjects; and
      • (iv) designing or preparing a polypeptide, or a polynucleic acid that encodes a polypeptide that comprises or consists of one or more polypeptide fragments identified in step (ii) or step (iii), optionally wherein the polypeptide fragment is flanked at the N and/or C terminus by additional amino acids that are not part of the sequence of the target polypeptide antigen.
  • The disclosure provides a method of inducing an immune response in a subject of a specific or target human population, the method comprising designing or preparing a polypeptide, a panel of polypeptides, a polynucleic acid encoding a polypeptide, or a pharmaceutical composition or kit for use in said specific or target human population as described above and administering the polypeptide(s), polynucleic acid, pharmaceutical composition or the active ingredient polypeptides of the kit to the subject.
  • The disclosure provides a polypeptide, panel of polypeptides, polynucleic acid, pharmaceutical composition or kit for use in a method of inducing an immune response in a subject of a specific or target human population, wherein the polypeptide, panel of polypeptides, polynucleic acid, pharmaceutical composition or kit is designed or prepared as described above for use in said specific or target human population, and wherein the composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • This disclosure provides a pharmaceutical composition, panel of polypeptides or kit for use in a method of inducing an immune response in a human subject, wherein the pharmaceutical composition, panel of polypeptides or kit comprises as active ingredients a first and a second and optionally one or more additional peptides, wherein each peptide comprises an amino acid sequence that is a T cell epitope capable of binding to at least three HLA class I molecules of at least 10% of human subjects, wherein the T cell epitope of the first, second and optionally any additional regions are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • The disclosure provides a pharmaceutical composition, panel of polypeptides or kit for use in a method of inducing an immune response in a human subject, wherein the pharmaceutical composition, panel of polypeptides or kit comprises an active ingredient polypeptide comprising a first region and a second region and optionally one or more additional regions, wherein each region comprises an amino acid sequence that is a T cell epitope capable of binding to at least three HLA class I molecules of at least 10% of human subjects, wherein the T cell epitope of the first, second and optionally any additional regions are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • The disclosure provides a pharmaceutical composition, panel of polypeptides or kit for use in a method treating a cancer in a subject in need thereof, wherein the pharmaceutical composition, panel of polypeptides or kit comprises as active ingredients a first and a second peptide and optionally one or more additional peptides, wherein each peptide comprises an amino acid sequence that is an HLA class I-binding T cell epitope, and wherein for each said T cell epitope at least 10% of human subjects having cancer both
      • i. express a tumor associated antigen selected from the antigens listed in Table 2 or Table 5 below that comprises said T cell epitope; and
      • ii. have at least three HLA class I molecules capable of binding to said T cell epitope;
        wherein said T cell epitope of the first, second and optionally any additional peptides are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • The disclosure provides a pharmaceutical composition, panel of polypeptides or kit for use in a method treating a cancer in a subject in need thereof, wherein the pharmaceutical composition, panel of polypeptides or kit comprises an active ingredient polypeptide comprising a first and a second region and optionally one or more additional regions, wherein each region comprises an amino acid sequence that is an HLA class I-binding T cell epitope, and wherein for each said T cell epitope at least 10% of human subjects having cancer both
      • (a) express a tumor associated antigen selected from the antigens listed in Table 2 or Table 5 below that comprises said T cell epitope; and
      • (b) have at least three HLA class I molecules capable of binding to said T cell epitope; wherein said T cell epitope of the first, second and optionally any additional regions are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • The disclosure provides a pharmaceutical composition, panel of polypeptides or kit for use in a method treating a cancer selected from colorectal, breast, ovarian, melanoma, non-melanoma skin, lung, prostate, kidney, bladder, stomach, liver, cervix uteri, oesophagus, non-Hodgkin lymphoma, leukemia, pancreas, corpus uteri, lip, oral cavity, thyroid, brain, nervous system, gallbladder, larynx, pharynx, myeloma, nasopharynx, Hodgkin lymphoma, testis and Kaposi sarcoma in a subject in need thereof, wherein the pharmaceutical composition, panel of polypeptides or kit comprises as active ingredients a first and a second peptide and optionally one or more additional polypeptides, wherein each peptide comprises an amino acid sequence that is an HLA class I-binding T cell epitope, and wherein for each said T cell epitope at least 10% of human subjects having said cancer both
      • (a) express a tumor associated antigen selected from the antigens listed in Table 2 or Table 5 below that comprises said T cell epitope; and
      • (b) have at least three HLA class I molecules capable of binding to said T cell epitope; wherein said T cell epitope of the first, second and optionally any additional peptides are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • The disclosure provides a pharmaceutical composition, panel of polypeptides or kit for use in a method treating a cancer selected from colorectal, breast, ovarian, melanoma, non-melanoma skin, lung, prostate, kidney, bladder, stomach, liver, cervix uteri, oesophagus, non-Hodgkin lymphoma, leukemia, pancreas, corpus uteri, lip, oral cavity, thyroid, brain, nervous system, gallbladder, larynx, pharynx, myeloma, nasopharynx, Hodgkin lymphoma, testis and Kaposi sarcoma in a subject in need thereof, wherein the pharmaceutical composition, panel of polypeptides or kit comprises an active ingredient polypeptide comprising a first and a second region and optionally one or more additional regions, wherein each region comprises an amino acid sequence that is an HLA class I-binding T cell epitope, and wherein for each said T cell epitope at least 10% of human subjects having said cancer both
      • (a) express a tumor associated antigen selected from the antigens listed in Table 2 or Table 5 below that comprises said T cell epitope; and
      • (b) have at least three HLA class I molecules capable of binding to said T cell epitope; wherein said T cell epitope of the first, second and optionally any additional polypeptides are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • The disclosure provides a method of treatment of a human subject in need thereof, the method comprising administering to the subject a polypeptide, a panel of polypeptides, a pharmaceutical composition or the active ingredient polypeptides of a kit described above, wherein the subject has been determined to express at least three HLA class I molecules and/or at least three HLA class II molecules capable of binding to the polypeptide or to one or more of the active ingredient polypeptides of the pharmaceutical composition or kit.
  • In a further aspect the invention provides a system comprising
      • (a) a storage module configured to store data comprising the class I and/or class II HLA genotypes of each subject of a model population of human subjects; and the amino acid sequence of one or more test polypeptides; wherein the model population is representative of a test target human population; and
      • (b) a computation module configured to identify and/or quantify the amino acid sequences in the one or more test polypeptides that are capable of binding to multiple class I HLA molecules of each subject in the model population and/or the amino acid sequences in the one or more test polypeptides that are capable of binding to multiple class II HLA molecules of each subject in the model population.
  • Provided herein in certain embodiments are pharmaceutical compositions for treatment of a disease or disorder in a subject of a target human population, comprising one or more polypeptides, each comprising at least a first region and a second region, (a) the first region being of 10-50 amino acids in length comprising a first amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and (b) the second region being of 10-50 amino acids in length comprising a second amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; wherein the amino acid sequence of the T cell epitope of each of first and second regions comprise different sequences. In some embodiments, the composition comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, or at least 12 different polypeptides. In some embodiments, the composition comprises 2-40 different polypeptides. In some embodiments, the T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population comprises 7 to 11 amino acids, and/or the T cell epitope that binds at least three HLA class II molecules of at least 10% of subjects in the target population comprises 13 to 17 amino acids. In some embodiments, the first region of 10-50 amino acids in length is from an antigen; and the second region of 10-50 amino acids in length is from a same or different antigen. In some embodiments, the epitopes of the first and second regions are from a single antigen. In some embodiments, the epitopes of the first and second regions are from two or more different antigens. In some embodiments, the antigen is a cancer-associated antigen, a tumor-associated antigen, or an antigen expressed by a target pathogenic organism, an antigen expressed by a virus, an antigen expressed by a bacterium, an antigen expressed by a fungus, an antigen associated with an autoimmune disorder, or is an allergen. In some embodiments, the antigen is selected from the antigens listed in Tables 2 to 7. In some embodiments, the two or more different antigens are selected from the antigens listed in Tables 2 to 7 and/or different cancer associated antigens. In some embodiments, one or more of the antigens are cancer testis antigens (CTAs). In some embodiments, the one or more polypeptides further comprise up to 10 amino acids flanking the T cell epitope that are not part of a consecutive sequence flanking the epitope in a corresponding antigen. In some embodiments, the one or more polypeptides have been screened to eliminate substantially all neoepitopes that span a junction between the first region and second region and that (i) corresponds to a fragment of a human polypeptide expressed in healthy cells; (ii) is a T cell epitope capable of binding to at least three HLA class I molecules of at least 10% of subjects in the target population; or (iii) meets both requirements (i) and (ii). In some embodiments, the target population is cancer patients and wherein each of the first region and second region comprises an amino acid sequence that is an HLA class I-binding T cell epitope, and wherein for each T cell epitope, at least 10% of subjects in the target population express a tumor associated antigen selected from the antigens listed in Table 2 that comprises the T cell epitope; and at least 10% of subjects in the target population have at least three HLA class I molecules capable of binding to the T cell epitope; wherein the T cell epitope of the first and second regions are different from each other. In some embodiments, the composition further comprises a pharmaceutically acceptable adjuvant, diluent, carrier, preservative, or combination thereof. In some embodiments, the adjuvant is selected from the group consisting of Montanide ISA-51, QS-21, GM-CSF, cyclophosamide, bacillus Calmette-Guerin (BCG), corynbacterium parvum, levamisole, azimezone, isoprinisone, dinitrochlorobenezene (DNCB), keyhole limpet hemocyanins (KLH), Freunds adjuvant (complete), Freunds adjuvant (incomplete), mineral gels, aluminum hydroxide (Alum), lysolecithin, pluronic polyols, polyanions, oil emulsions, dinitrophenol, diphtheria toxin (DT), and combinations thereof.
  • Disclosed herein, in certain embodiments, are kits comprising, one or more separate containers each container comprising: (i) one or more polypeptides comprising at least a first region and a second region, (a) the first region of 10-50 amino acids in length comprising a first amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and (b) the second region of 10-50 amino acids in length comprising a second amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; wherein the amino acid sequence of the T cell epitope of each of first and second regions comprise different sequences and (ii) a pharmaceutically acceptable adjuvant, diluent, carrier, preservative, or combination thereof. In some embodiments, the kit further comprises a package insert.
  • Disclosed herein, in certain embodiments, are pharmaceutical compositions comprising: one or more nucleic acid molecules expressing one or more polypeptides comprising at least a first region and a second region, (a) the first region of 10-50 amino acids in length comprising a first amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and (b) the second region of 10-50 amino acids in length comprising a second amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; wherein the amino acid sequence of the T cell epitope of each of first and second regions comprise different sequences.
  • Disclosed herein, in certain embodiments are methods of preparing a polypeptide, or a polynucleic acid that encodes a polypeptide, for use in a method of inducing an immune response in a subject of a target human population, the method comprising:
      • (i) selecting:
        • (a) a relevant model human population comprising a plurality of subjects each defined by HLA class I genotype and/or by HLA class II genotype; or
        • (b) one relevant model human population comprising a plurality of subjects each defined by HLA class I genotype and one relevant model human population comprising a plurality of subjects each defined by HLA class II genotype;
      • (ii) identifying a fragment of up to 50 consecutive amino acids of an antigen that comprises:
        • (a) a T cell epitope capable, in a high percentage of subjects of the model population selected in step (i) that is defined by HLA class I genotype, of binding to at least three HLA class I molecules of individual subjects of the model population;
        • (b) a T cell epitope capable, in a high percentage of subjects of the model population selected in step (i) that is defined by HLA class II genotype, of binding to at least three HLA class II molecules of individual subjects of the model population; or
        • (c) a T cell epitope capable, in a high percentage of subjects of the model population selected in step (i) that is defined by HLA class I genotype, of binding to at least three HLA class I molecules of individual subjects of the model population and a T cell epitope capable, in a high percentage of subjects of the model population selected in step (i) that is defined by HLA class II genotype, of binding to at least three HLA class II molecules of individual subjects of the model population; and
      • (iii) preparing a polypeptide, or a polynucleic acid that encodes a polypeptide that comprises one or more fragments identified in step (ii). In some embodiments, the method further comprises prior to step (iii), selecting a longer fragment of the antigen if the fragment selected in step (ii) is an HLA class I-binding epitope, which longer fragment comprises an amino acid sequence that (a) comprises the fragment selected in step (ii); and (b) is an HLA class II molecule-binding T cell epitope capable, in a high percentage of subjects of the model population selected in step (i) that is defined by HLA class II genotype, of binding to at least three, or the most possible HLA class II molecules of individual subjects of the model population. In some embodiments, the method further comprises prior to step (iii), repeating steps (i) to (ii) to identify on or more additional amino acid sequences of up to 50 consecutive amino acids of the same or a different polypeptide to the first amino acid sequence.
  • Disclosed herein in certain embodiments are methods of inducing an immune response in a subject of a target human population, the method comprising, administering to the subject a pharmaceutical composition comprising one or more polypeptides comprising at least a first region and a second region, (a) the first region being of 10-50 amino acids in length comprising a first amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and (b) the second region being of 10-50 amino acids in length comprising a second amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; wherein the amino acid sequence of the T cell epitope of each of first and second regions comprise different sequences. In some embodiments, the method further comprises prior to the administering step, determining if the subject is likely to have an have a clinical response to administration of a pharmaceutical composition by (i) assaying a biological sample of the subject to determine HLA genotype of the subject; (ii) determining that the pharmaceutical composition comprises two or more sequences that are a T cell epitope capable of binding to at least three HLA class I molecules of the subject; and (iii) determining the probability that a tumor of the subject expresses one or more antigen corresponding to the T cell epitopes identified in step (ii) using population expression data for each antigen, to identify the likelihood of the subject to have a clinical response to administration of the pharmaceutical composition. In some embodiments, the first region of 10-50 amino acids in length is from an antigen; and the second region of 10-50 amino acids in length is from a same or different antigen. In some embodiments, the epitopes of the first and second regions are from two or more different antigens. In some embodiments, the antigen is a cancer-associated antigen, a tumor-associated antigen, or an antigen expressed by a target pathogenic organism, an antigen expressed by a virus, an antigen expressed by a bacterium, an antigen expressed by a fungus, an antigen associated with an autoimmune disorder, or is an allergen. In some embodiments, the T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population comprises 7 to 11 amino acids, and/or the T cell epitope that binds at least three HLA class II molecules of at least 10% of subjects in the target population comprises 13 to 17 amino acids.
  • Disclosed herein in certain embodiments are pharmaceutical compositions for treatment of a disease or disorder in a subject of a target human population, comprising (a) at least two polypeptides, each of the at least two polypeptides being 10-50 amino acids in length comprising an amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population, and/or at least three HLA class II molecules of at least 10% of subjects in the target population, wherein the amino acid sequence of the T cell epitope of each of the at least two polypeptides are different from each other; and (b) a pharmaceutically-acceptable adjuvant. In some embodiments, the composition comprises at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, or at least 12 different polypeptides. In some embodiments, the composition comprises 3-40 different polypeptides. In some embodiments, the T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population comprises 7 to 11 amino acids, and/or the T cell epitope that binds at least three HLA class II molecules of at least 10% of subjects in the target population comprises 13 to 17 amino acids. In some embodiments, the epitopes of the amino acid sequences of the at least two polypeptides are from a single antigen. In some embodiments, the epitopes of the amino acid sequences of the at least two polypeptides are from two or more different antigens. In some embodiments, the antigen is a cancer-associated antigen, a tumor-associated antigen, or an antigen expressed by a target pathogenic organism, an antigen expressed by a virus, an antigen expressed by a bacterium, an antigen expressed by a fungus, an antigen associated with an autoimmune disorder, or is an allergen. In some embodiments, the antigen is selected from the antigens listed in Tables 2 to 7. In some embodiments, the two or more different antigens are selected from the antigens listed in Tables 2 to 7 and/or different cancer associated antigens. In some embodiments, one or more of the antigens are cancer testis antigens (CTAs). In some embodiments, each of the at least two polypeptides being 10-50 amino acids in length is from an antigen a same or different antigen. In some embodiments, the at least two different polypeptides further comprise up to 10 amino acids flanking the T cell epitope that are not part of a consecutive sequence flanking the epitope in a corresponding antigen. In some embodiments, two of the at least two polypeptides are arranged end to end or overlapping in a joined polypeptide. In some embodiments, two or more different joined polypeptides, wherein the two or more different joined polypeptides comprise different epitopes from each other. In some embodiments, the joined polypeptides have been screened to eliminate substantially all neoepitopes that span a junction between the two polypeptides and that (i) corresponds to a fragment of a human polypeptide expressed in healthy cells; (ii) is a T cell epitope capable of binding to at least three HLA class I molecules of at least 10% of subjects in the target population; or (iii) meets both requirements (i) and (ii). In some embodiments, the target population is cancer patients and wherein each polypeptide comprises an amino acid sequence that is an HLA class I-binding T cell epitope, and wherein for each T cell epitope, at least 10% of subjects in the target population express a tumor associated antigen selected from the antigens listed in Table 2 that comprises the T cell epitope; and at least 10% of subjects in the target population have at least three HLA class I molecules capable of binding to the T cell epitope; wherein the T cell epitope of the at least two polypeptides are different from each other. In some embodiments, the composition further comprises a pharmaceutically acceptable diluent, carrier, preservative, or combination thereof. In some embodiments, the adjuvant is selected from the group consisting of Montanide ISA-51, QS-21, GM-CSF, cyclophosamide, bacillus Calmette-Guerin (BCG), corynbacterium parvum, levamisole, azimezone, isoprinisone, dinitrochlorobenezene (DNCB), keyhole limpet hemocyanins (KLH), Freunds adjuvant (complete), Freunds adjuvant (incomplete), mineral gels, aluminum hydroxide (Alum), lysolecithin, pluronic polyols, polyanions, oil emulsions, dinitrophenol, diphtheria toxin (DT), and combinations thereof.
  • Disclosed herein in certain embodiments are pharmaceutical compositions for treatment of a disease or disorder in a subject of a target human population, comprising (a) a polypeptide of 10-50 amino acids in length and comprising a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and (b) a pharmaceutically-acceptable adjuvant. In some embodiments, the composition comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, or at least 12 different polypeptides, each of the different polypeptides being 10-50 amino acids in length comprising a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population, wherein the amino acid sequence of the T cell epitope of each of the different polypeptides are different from each other. In some embodiments, the composition comprises 2-40 different polypeptides. In some embodiments, the T cell epitope that binds at least three HLA class I molecules of the subject comprises 7 to 11 amino acids, and/or the T cell epitope that binds at least three HLA class II molecules comprises 13 to 17 amino acids. In some embodiments, the composition comprises at least two different polypeptides, wherein the epitopes of the at least two different polypeptides are from a single antigen. In some embodiments, the composition comprises at least two different polypeptides, wherein the epitopes of the at least two different polypeptides are from two or more different antigens. In some embodiments, the antigen is an antigen expressed by a cancer cell, a neoantigen expressed by a cancer cell, a cancer-associated antigen, a tumor-associated antigen, or an antigen expressed by a target pathogenic organism, an antigen expressed by a virus, an antigen expressed by a bacterium, an antigen expressed by a fungus, an antigen associated with an autoimmune disorder, or is an allergen. In some embodiments, the antigen is selected from the antigens listed in Tables 2 to 7. In some embodiments, the composition comprises at least two different polypeptides, wherein two of the polypeptides are arranged end to end or overlapping in a joined polypeptide. In some embodiments, the adjuvant is selected from the group consisting of Montanide ISA-51, QS-21, GM-CSF, cyclophosamide, bacillus Calmette-Guerin (BCG), corynbacterium parvum, levamisole, azimezone, isoprinisone, dinitrochlorobenezene (DNCB), keyhole limpet hemocyanins (KLH), Freunds adjuvant (complete), Freunds adjuvant (incomplete), mineral gels, aluminum hydroxide (Alum), lysolecithin, pluronic polyols, polyanions, oil emulsions, dinitrophenol, diphtheria toxin (DT), and combinations thereof. In some embodiments, the composition comprises at least two different polypeptides, wherein two of the at least two polypeptides are arranged end to end or overlapping in a joined polypeptide. In some embodiments, the composition comprises two or more different joined polypeptides, wherein the two or more different joined polypeptides comprise different epitopes from each other. In some embodiments, the joined polypeptides have been screened to eliminate substantially all neoepitopes that span a junction between the two polypeptides and that (i) corresponds to a fragment of a human polypeptide expressed in healthy cells of the subject; (ii) is a T cell epitope capable of binding to at least two HLA class I molecules of the subject; or (iii) meets both requirements (i) and (ii). In some embodiments, the at least two polypeptides do not comprise any amino acid sequences that (i) correspond to a fragment of a human polypeptide expressed in healthy cells; or (ii) correspond to a fragment of a human polypeptide expressed in healthy cells and is a T cell epitope capable of binding to at least two HLA class I molecules of the subject.
  • Disclosed herein in certain embodiments are methods of identifying and treating a subject of a target population of cancer patients who will likely have a clinical response to administration of a pharmaceutical composition of the disclosure, the method comprising, (i) assaying a biological sample of the subject to determine HLA genotype of the subject; (ii) determining that the pharmaceutical composition comprises two or more sequences that are a T cell epitope capable of binding to at least three HLA class I molecules of the subject; (iii) determining the probability that a tumor of the subject expresses one or more antigen corresponding to the T cell epitopes identified in step (ii) using population expression data for each antigen, to identify the likelihood of the subject to have a clinical response to administration of the pharmaceutical composition; and (iv) administering the composition of the disclosure to the identified subject. In some embodiments, the method further comprises prior to the administering step, assaying a tumor sample from the subject to determine that the three or more peptides of the pharmaceutical composition comprise two or more different amino acid sequences each of which is a fragment of a cancer-associated antigen expressed by cancer cells of the subject as determined in step (i); and a T cell epitope capable of binding to at least three HLA class I molecules of the subject; and confirming the subject as likely to have a clinical response to the method of treatment. In some embodiments, the composition comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, or at least 12 different polypeptides. In some embodiments, the composition comprises 2-40 different polypeptides. In some embodiments, the T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population comprises 7 to 11 amino acids, and/or the T cell epitope that binds at least three HLA class II molecules of at least 10% of subjects in the target population comprises 13 to 17 amino acids. In some embodiments, the first region of 10-50 amino acids in length is from an antigen; and the second region of 10-50 amino acids in length is from a same or different antigen. In some embodiments, the epitopes of the first and second regions are from a single antigen. In some embodiments, the epitopes of the first and second regions are from two or more different antigens. In some embodiments, the antigen is a cancer-associated antigen or a tumor-associated antigen. In some embodiments, the antigen is selected from the antigens listed in Table 2. In some embodiments, the two or more different antigens are selected from the antigens listed in Table 2 and/or different cancer associated antigens. In some embodiments, one or more of the antigens are cancer testis antigens (CTAs). In some embodiments, the one or more polypeptides further comprise up to 10 amino acids flanking the T cell epitope that are not part of a consecutive sequence flanking the epitope in a corresponding antigen. In some embodiments, the one or more polypeptides have been screened to eliminate substantially all neoepitopes that span a junction between the first region and second region and that (i) corresponds to a fragment of a human polypeptide expressed in healthy cells; (ii) is a T cell epitope capable of binding to at least three HLA class I molecules of at least 10% of subjects in the target population; or (iii) meets both requirements (i) and (ii). In some embodiments, the target population is cancer patients and wherein each of the first region and second region comprises an amino acid sequence that is an HLA class I-binding T cell epitope, and wherein for each T cell epitope, at least 10% of subjects in the target population express a tumor associated antigen selected from the antigens listed in Table 2 that comprises the T cell epitope; and at least 10% of subjects in the target population have at least three HLA class I molecules capable of binding to the T cell epitope; wherein the T cell epitope of the first and second regions are different from each other. In some embodiments, the composition further comprises a pharmaceutically acceptable adjuvant, diluent, carrier, preservative, or combination thereof. In some embodiments, the adjuvant is selected from the group consisting of Montanide ISA-51, QS-21, GM-CSF, cyclophosamide, bacillus Calmette-Guerin (BCG), corynbacterium parvum, levamisole, azimezone, isoprinisone, dinitrochlorobenezene (DNCB), keyhole limpet hemocyanins (KLH), Freunds adjuvant (complete), Freunds adjuvant (incomplete), mineral gels, aluminum hydroxide (Alum), lysolecithin, pluronic polyols, polyanions, oil emulsions, dinitrophenol, diphtheria toxin (DT), and combinations thereof.
  • Disclosed herein in certain embodiments are kits comprising: a first composition comprising (i) a first polypeptide of 10-50 amino acids in length and comprising a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and (ii) a pharmaceutically-acceptable adjuvant; and a second composition comprising (i) a second polypeptide of 10-50 amino acids in length and comprising a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and (ii) a pharmaceutically-acceptable adjuvant, wherein the first and second polypeptides comprise different T cell epitopes. In some embodiments, the first composition and/or the second composition comprise one or more additional polypeptides, wherein each additional polypeptide being of 10-50 amino acids in length comprising an amino acid sequence that is a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population, wherein the amino acid sequences comprise different T cell epitopes.
  • Disclosed herein in certain embodiments are methods of identifying and treating a subject of a target population of cancer patients who will likely have an immune response to administration of a pharmaceutical composition of the disclosure, the method comprising, (i) assaying a biological sample of the subject to determine HLA genotype of the subject; (ii) determining that the pharmaceutical composition comprises two or more sequences that are a T cell epitope capable of binding to at least three HLA class I molecules of the subject; (iii) administering the composition of the disclosure to the identified subject.
  • Disclosed herein in certain embodiments are pharmaceutical compositions comprising: a nucleic acid molecule expressing two or more polypeptides, each polypeptide being 10-50 amino acids in length comprising a T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population, wherein each of the two or more polypeptides comprises a different T cell epitope, wherein the polypeptides do not comprise amino acid sequences that are adjacent to each other in a corresponding antigen.
  • The disclosure will now be described in more detail, by way of example and not limitation, and by reference to the accompanying drawings. Many equivalent modifications and variations will be apparent, to those skilled in the art when given this disclosure. Accordingly, the exemplary embodiments of the disclosure set forth are considered to be illustrative and not limiting. Various changes to the described embodiments may be made without departing from the scope of the disclosure. All documents cited herein, whether supra or infra, are expressly incorporated by reference in their entirety.
  • The present disclosure includes the combination of the aspects and preferred features described except where such a combination is clearly impermissible or is stated to be expressly avoided. As used in this specification and the appended claims, the singular forms “a”, “an”, and “the” include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to “a peptide” includes two or more such peptides.
  • Section headings are used herein for convenience only and are not to be construed as limiting in any way.
  • DESCRIPTION OF THE FIGURES
  • FIG. 1—ROC curve of HLA restricted PEPI biomarkers.
  • FIG. 2—ROC curve of ≥1 PEPI3+ Test for the determination of the diagnostic accuracy.
  • FIGS. 3A-B—Distribution of HLA class I PEPI3+ compared to CD8+ T cell responses measured by a state of art assay among peptide pools used in the CD8+ T cell response assays. FIG. 3A: HLA class I restricted PEPI3+s. The 90% Overall Percent of Agreement (OPA) among the T cell responses and PEPI3+ peptides demonstrate the utility of the disclosed peptides for prediction of vaccine induced T cell response set of individuals. FIG. 3B: Class I HLA restricted epitopes (PEPI1+). The OPA between predicted epitopes and CD8+ T cell responses was 28% (not statistically significant). Darkest grey: True positive (TP), both peptide and T cell responses were detected; Light grey: False negative (FN), only T cell responses were detected; Lightest grey: False positive (FP), only peptide were detected; Dark grey: True negative (TN): neither peptides nor T cell responses were detected.
  • FIGS. 4A-B—Distribution of HLA class II PEPIs compared to CD4+ T cell responses measured by a state of art assay among peptide pools used in the assays. FIG. 4A: HLA class II restricted PEPI4+s. 67% OPA between PEPI4+ and CD4+ T-cell responses (p=0.002). FIG. 4B: The class II HLA restricted epitopes. OPA between class II HLA restricted epitopes and CD4+ T cell responses was 66% (not statistically significant). Darkest grey: True positive (TP), both peptide and T cell responses were detected; Light grey: False negative (FN), only T cell responses were detected; Lightest grey: False positive (FP), only peptide were detected; Dark grey: True negative (TN): neither peptides nor T cell responses were detected.
  • FIGS. 5A-D—Multiple HLA binding peptides that define the HPV-16 LPV vaccine specific T cell response set of 18 VIN-3 and 5 cervical cancer patients. HLA class I restricted PEPI3 counts (FIGS. 5A and 5B) and HLA class II restricted PEPI3 counts (FIGS. 5C and 5D) derived from LPV antigens of each patient. Light grey: immune responders measured after vaccination in the clinical trial; Dark grey: Immune non-responders measured after vaccination in the clinical trial. Results show that ≤3 HLA class I binding peptides predict the CD8+ T cell reactivity and ≥4 HLA class II binding peptides predict the CD4+ T cell reactivity.
  • FIG. 6—The multiple HLA class I binding peptides that define the HPV vaccine specific T cell response set of 2 patients. Panel A: Four HPV antigens in the HPV vaccine. Boxes represent the length of the amino acid sequences from the N terminus to the C terminus. Panel B: Process to identify the multiple HLA binding peptides of two patients: HLA sequences of the patients labelled as 4-digit HLA genotype right from the patient's ID. The location of the 1st amino acid of the 54 and 91 epitopes that can bind to the patient 12-11 and patient 14-5 HLAs (PEPI1+) respectively are depicted with lines. PEPI2 represents the peptides selected from PEPI1+s that can bind to multiple HLAs of a patient (PEPI2+). PEPI3 represent peptides that can bind to ≤3 HLAs of a patient (PEPI3+). PEPI4 represent peptides that can bind to ≤4 HLAs of a patient (PEPI4+). PEPI5 represent peptides that can bind to ≤5 HLAs of a patient (PEPI5+). PEPI6 represent peptides that can bind to 6 HLAs of a patient (PEPI6). Panel C: The DNA vaccine specific PEPI3+ set of two patients characterizes their vaccine specific T cell responses.
  • FIG. 7—Correlation between the ≤1 PEPI3+ Score and CTL response rates of peptide targets determined in clinical trials.
  • FIG. 8—Correlation between the ≤1 PEPI3+ Score and the clinical Immune Response Rate (IRR) of immunotherapy vaccines. Dashed lines: 95% confidence band.
  • FIG. 9—Correlation between the ≤2 PEPI3+ Score and Disease Control Rate (DCR) of immunotherapy vaccines. Dashed lines: 95% confidence band.
  • FIG. 10—HLA map of the Rindopepimut on the HLA alleles of the subjects in the Model Population.
  • FIGS. 11A-B—Probability of vaccine antigen expression in the XYZ patient's tumor cells. There is over 95% probability that 5 out of the 12 target antigens in the vaccine regimen is expressed in the patient's tumor. Consequently, the 12 peptide vaccines together can induce immune responses against at least 5 ovarian cancer antigens with 95% probability (AGP95). It has 84% probability that each peptide will induce immune responses in the XYZ patient. AGP50 is the mean (expected value)=7.9 (it is a measure of the effectiveness of the vaccine in attacking the tumor of XYZ patient).
  • FIG. 12—MRI findings of patient XYZ treated with personalised (PIT) vaccine. This late stage, heavily pretreated ovarian cancer patient had an unexpected objective response after the PIT vaccine treatment. These MRI findings suggest that PIT vaccine in combination with chemotherapy significantly reduced her tumor burden. The patient now continues the PIT vaccine treatment.
  • FIGS. 13A-B—Probability of vaccine antigen expression in the ABC patient's tumor cells. There is over 95% probability that 4 out of the 13 target antigens in the vaccine is expressed in the patient's tumor. Consequently, the 12 peptide vaccines together can induce immune responses against at least 4 breast cancer antigens with 95% probability (AGP95). It has 84% probability that each peptide will induce immune responses in the ABC patient. AGP50 is the mean (expected value) of the discrete probability distribution=6.45 (it is a measure of the effectiveness of the vaccine in attacking the tumor of ABC patient).
  • FIG. 14—Peptide hotspot analysis example: PRAME antigen hotspot on 433 patients of the Model Population. On the y axis are the 433 patients of the Model Population, on the x axis is the amino acid sequence of the PRAME antigen (CTA). Each data point represents a PEPI presented by ≥3 HLA class I of one patient starting at the specified amino acid position. The two most frequent PEPIs (called bestEPIs) of the PRAME antigen are highlighted in dark gray (peptide hotspots=PEPI Hotspots).
  • FIG. 15—CTA Expression Curve calculated by analyzing expression frequency data of tumor specific antigens (CTAs) in human breast cancer tissues. (No cell line data were included.)
  • FIGS. 16A-B—Antigen expression distribution for breast cancer based on the calculation of multi-antigen responses from expression frequencies of the selected 10 different CTAs. FIG. 16A: non-cumulative distribution to calculate the expected value for the number of expressed antigens (AG50). This value shows that probably 6.14 vaccine antigens will be expressed by breast tumor cells. FIG. 16B: cumulative distribution curve of the minimum number of expressed antigens (CTA expression curve). This shows that minimum 4 vaccine antigens will be expressed with 95% probability in breast cancer cell (AG95).
  • FIGS. 17A-B—PEPI representing antigens: breast cancer vaccine-specific CTA antigens with ≥1 PEPI, called as “AP”) distribution within the Model Population (n=433) for breast cancer vaccine. FIG. 17A: non-cumulative distribution of AP where the average number of APs is: AP50=5.30, meaning that in average almost 6 CTAs will have PEPIs in the Model Population.
  • FIG. 17B: cumulative distribution curve of the minimum number of APs in the Model Population (n=433). This shows that at least one vaccine antigen will have PEPIs in 95% of the Model Population (n=433) (AP95=1).
  • FIGS. 18A-B—PEPI represented expressed antigen (breast cancer vaccine-specific CTA antigens expressed by the tumor, for which ≥1 PEPI is predicted, called as “AGP”) distribution within the model population (n=433) calculated with CTA expression rates for breast cancer. FIG. 18A: non-cumulative distribution of AGP where the expected value for number expressed CTAs represented by PEPI is AGP50=3.37. AGP50 is a measure of the effectiveness of the disclosed breast cancer vaccine in attacking breast tumor in an unselected patient population. AGP50=3.37 means that at least 3 CTAs from the vaccine will probably be expressed by the breast tumor cells and present PEPIs in the Model Population. FIG. 18B: cumulative distribution curve of the minimum number of AGPs in the Model Population (n=433) shows that at least 1 of the vaccine CTAs will present PEPIs in 92% of the population and the remaining 8% of the population will likely have no AGP at all (AGP95=0, AGP92=1).
  • FIG. 19—CTA Expression Curve calculated by analyzing expression frequency data of tumor specific antigens (CTAs) in human colorectal cancer tissues. (No cell line data were included.)
  • FIGS. 20A-B—Antigen expression distribution for colorectal cancer based on the calculation of multi-antigen responses from expression frequencies of the selected 7 different CTAs. FIG. 20A: non-cumulative distribution to calculate the expected vale for the number of expressed vaccine antigens in colorectal cancers (AG50). This value shows that probably 4.96 vaccine antigens will be expressed by colorectal tumor cells. FIG. 20B: cumulative distribution curve of the minimum number of expressed antigens (CTA expression curve). This shows that minimum 3 antigens will be expressed with 95% probability in the colorectal cancer cell (AG95).
  • FIGS. 21A-B—PEPI represented antigen (colorectal cancer vaccine-specific CTA antigens for which ≥1 PEPI is predicted. Called as “AP”) distribution within the model population (n=433) for colorectal cancer. FIG. 21A: non-cumulative distribution of AP where the average number of APs is: AP50=4.73, meaning that in average 5 CTAs will be represented by PEPIs in the model population FIG. 21B: cumulative distribution curve of the minimum number of APs in the model population (n=433). This shows that 2 or more antigens will be represented by PEPIs in 95% of the model population (n=433) (AP95=2).
  • FIGS. 22A-B—PEPI represented expressed antigen (colorectal cancer vaccine-specific CTA antigens expressed by the tumor, for which ≥1 PEPI is predicted. Called as “AGP”) distribution within the model population (n=433) calculated with CTA expression rates for colorectal cancer. FIG. 22A: non-cumulative distribution of AGP where the expected value for number expressed CTAs represented by PEPI is AGP50=2.54. AGP50 is a measure of the effectiveness of the disclosed colorectal cancer vaccine in attacking colorectal tumors in an unselected patient population. AGP50=2.54 means that at least 2-3 CTAs from the vaccine will probably be expressed by the colorectal tumor cells and present PEPIs in the Model Population. FIG. 22B: cumulative distribution curve of the minimum number of AGPs in the Model Population (n=433) shows that at least 1 of the vaccine CTAs will be expressed and also present PEPIs in 93% of the population (AGP93=1).
  • FIG. 23—Schematic showing exemplary positions of amino acids in overlapping HLA class I- and HLA class-II binding epitopes in a 30-mer peptide.
  • FIGS. 24A-B—Antigenicity of PolyPEPI1018 CRC Vaccine in a general population. The antigenicity of PolyPEPI1018 in a subject is determined by the AP count, which indicates the number of vaccine antigens that induce T cell responses in a subject. The AP count of PolyPEPI1018 was determined in each of the 433 subjects in the Model Population using the PEPI Test, and the AP50 count was then calculated for the Model Population. The AP50 of PolyPEPI1018 in the Model Population is 4.73. The mean number of immunogenic antigens (i.e., antigens with ≥1 PEPI) in PolyPEPI1018 in a general population is 4.73. Abbreviations: AP=antigens with ≥1 PEPI. Left Panel: Cumulative distribution curve. Right Panel: Distinct distribution curve.
  • FIGS. 25A-B—Effectiveness of PolyPEPI1018 CRC Vaccine in a general population. Vaccine induced T cells can recognize and kill tumor cells if a PEPI in the vaccine is presented by the tumor cell. The number of AGPs (expressed antigens with PEPI) is an indicator of vaccine effectiveness in an individual, and is dependent on both the potency and antigenicity of PolyPEPI1018. The mean number of immunogenic CTAs (i.e., AP [expressed antigens with ≥1 PEPI]) in PolyPEPI1018 is 2.54 in the Model Population. The likelihood that PolyPEPI1018 induces T cell responses against multiple antigens in a subject (i.e., mAGP) in the Model Population is 77%.
  • DESCRIPTION OF THE SEQUENCES
  • SEQ ID NOs: 1 to 20 set forth 9 mer T cell epitopes described in Table 30.
  • SEQ ID NOs: 21 to 40 set forth 9 mer T cell epitopes described in Table 33.
  • SEQ ID NOs: 41-71 (81 to 111) set forth the breast cancer vaccine peptides set forth in Table 31.
  • SEQ ID NOs 72-102 (112 to 142) set forth the colorectal cancer vaccine peptides set forth in Table 34.
  • SEQ ID NOs: 103-115 (159 to 171) set forth the additional peptide sequences described in Table 17.
  • SEQ ID NOs: 116-128 (362 to 374) set forth personalised vaccine peptides designed for patient XYZ described in Table 26.
  • SEQ ID NOs: 129-140 (375 to 386) set forth personalised vaccine peptides designed for patient ABC described in Table 29.
  • SEQ ID NOs: 141-188 (387 to 434) set forth further 9 mer T cell epitopes described in Table 41.
  • DETAILED DESCRIPTION HLA Genotypes
  • HLAs are encoded by the most polymorphic genes of the human genome. Each person has a maternal and a paternal allele for the three HLA class I molecules (HLA-A*, HLA-B*, HLA-C*) and four HLA class II molecules (HLA-DP*, HLA-DQ*, HLA-DRB1*, HLA-DRB3*/4*/5*). Practically, each person expresses a different combination of 6 HLA class I and 8 HLA class II molecules that present different epitopes from the same protein antigen. The function of HLA molecules is to regulate T cell responses. However up to date it was unknown how the HLAs of a person regulate T cell activation.
  • The nomenclature used to designate the amino acid sequence of the HLA molecule is as follows: gene name*allele:protein number, which, for instance, can look like: HLA-A*02:25. In this example, “02” refers to the allele. In most instances, alleles are defined by serotypes—meaning that the proteins of a given allele will not react with each other in serological assays. Protein numbers (“25” in the example above) are assigned consecutively as the protein is discovered. A new protein number is assigned for any protein with a different amino acid sequence (e.g. even a one amino acid change in sequence is considered a different protein number). Further information on the nucleic acid sequence of a given locus may be appended to the HLA nomenclature, but such information is not required for the methods described herein.
  • The HLA class I genotype or HLA class II genotype of an individual may refer to the actual amino acid sequence of each class I or class II HLA of an individual, or may refer to the nomenclature, as described above, that designates, minimally, the allele and protein number of each HLA gene. An HLA genotype may be obtained or determined using any suitable method. For example, the sequence may be determined via sequencing the HLA gene loci using methods and protocols known in the art. Alternatively, the HLA set of an individual may be stored in a database and accessed using methods known in the art.
  • HLA-Epitope Binding
  • A given HLA of a subject will only present to T cells a limited number of different peptides produced by the processing of protein antigens in an APC. As used herein, “display” or “present”, when used in relation to HLA, references the binding between a peptide (epitope) and an HLA. In this regard, to “display” or “present” a peptide is synonymous with “binding” a peptide.
  • As used herein, the term “epitope” or “T cell epitope” refers to a sequence of contiguous amino acids contained within a protein antigen that possess a binding affinity for (is capable of binding to) one or more HLAs. An epitope is HLA- and antigen-specific (HLA-epitope pairs, predicted with known methods), but not subject specific. An epitope, a T cell epitope, a polypeptide, a fragment of a polypeptide or a composition comprising a polypeptide or a fragment thereof is “immunogenic” for a specific human subject if it is capable of inducing a T cell response (a cytotoxic T cell response or a helper T cell response) in that subject. In some cases the helper T cell response is a Th1-type helper T cell response. In some cases an epitope, a T cell epitope, a polypeptide, a fragment of a polypeptide or a composition comprising a polypeptide or a fragment thereof is “immunogenic” for a specific human subject if it is more likely to induce a T cell response or immune response in the subject than a different T cell epitope (or in some cases two different T cell epitopes each) capable of binding to just one HLA molecule of the subject.
  • The terms “T cell response” and “immune response” are used herein interchangeably, and refer to the activation of T cells and/or the induction of one or more effector functions following recognition of one or more HLA-epitope binding pairs. In some cases an “immune response” includes an antibody response, because HLA class II molecules stimulate helper responses that are involved in inducing both long lasting CTL responses and antibody responses. Effector functions include cytotoxicity, cytokine production and proliferation. According to the present disclosure, an epitope, a T cell epitope, or a fragment of a polypeptide is immunogenic for a specific subject if it is capable of binding to at least two, or in some cases at least three, class I or at least two, or in some cases at least three or at least four class II HLAs of the subject.
  • For the purposes of this disclosure we have coined the term “personal epitope”, or “PEPI” to distinguish subject specific epitopes from HLA specific epitopes. A “PEPI” is a fragment of a polypeptide consisting of a sequence of contiguous amino acids of the polypeptide that is a T cell epitope capable of binding to one or more HLA class I molecules of a specific human subject. In other cases a “PEPI” is a fragment of a polypeptide consisting of a sequence of contiguous amino acids of the polypeptide that is a T cell epitope capable of binding to one or more HLA class II molecules of a specific human subject. In other words a “PEPI” is a T cell epitope that is recognised by the HLA set of a specific individual. In contrast to an “epitope”, PEPIs are specific to an individual because different individuals have different HLA molecules which each bind to different T cell epitopes.
  • “PEPI1” as used herein refers to a peptide, or a fragment of a polypeptide, that can bind to one HLA class I molecule (or, in specific contexts, HLA class II molecule) of an individual. “PEPI1+” refers to a peptide, or a fragment of a polypeptide, that can bind to one or more HLA class I molecule of an individual.
  • “PEPI2” refers to a peptide, or a fragment of a polypeptide, that can bind to two HLA class I (or II) molecules of an individual. “PEPI2+” refers to a peptide, or a fragment of a polypeptide, that can bind to two or more HLA class I (or II) molecules of an individual, i.e. a fragment identified according to a method of the disclosure.
  • “PEPI3” refers to a peptide, or a fragment of a polypeptide, that can bind to three HLA class I (or II) molecules of an individual. “PEPI3+” refers to a peptide, or a fragment of a polypeptide, that can bind to three or more HLA class I (or II) molecules of an individual.
  • “PEPI4” refers to a peptide, or a fragment of a polypeptide, that can bind to four HLA class I (or II) molecules of an individual. “PEPI4+” refers to a peptide, or a fragment of a polypeptide, that can bind to four or more HLA class I (or II) molecules of an individual.
  • “PEPI5” refers to a peptide, or a fragment of a polypeptide, that can bind to five HLA class I (or II) molecules of an individual. “PEPI5+” refers to a peptide, or a fragment of a polypeptide, that can bind to five or more HLA class I (or II) molecules of an individual.
  • “PEPI6” refers to a peptide, or a fragment of a polypeptide, that can bind to all six HLA class I (or six HLA class II) molecules of an individual.
  • Generally speaking, epitopes presented by HLA class I molecules are about nine amino acids long and epitopes presented by HLA class II molecules are about fifteen amino acids long. For the purposes of this disclosure, however, an epitope may be more or less than nine (for HLA Class I) or more or less than fifteen (for HLA Class II) amino acids long, as long as the epitope is capable of binding HLA. For example, an epitope that is capable of binding to class I HLA may be between 7, or 8 or 9 and 9 or 10 or 11 amino acids long. An epitope that is capable of binding to a class II HLA may be between 13, or 14 or 15 and 15 or 16 or 17 amino acids long.
  • Therefore the disclosure herein includes, for example, a method of predicting whether a polypeptide is immunogenic for a relevant population or cohort of human subjects (e.g., in a model human population) or identifying a fragment of a polypeptide as immunogenic for a relevant population or cohort of human subjects (e.g., in a model human population), the method comprising the steps of
      • (i) determining whether the polypeptide comprises:
        • a. a sequence of 7 to 11 consecutive amino acids that is capable of binding to at least two HLA class I of the subject; or
        • b. a sequence of 13 to 17 consecutive amino acids that is capable of binding to at least two HLA class II of the subject; and
      • (ii) predicting that the polypeptide is immunogenic for the subject if the polypeptide comprises at least one sequence that meets the requirements of step (i); or predicting that the polypeptide is not immunogenic for the subject if the polypeptide does not comprise at least one sequence that meets the requirements of step (i); or identifying said consecutive sequence of amino acids as the sequence of a fragment of the polypeptide that is immunogenic for the subject.
  • Using techniques known in the art, it is possible to determine the epitopes that will bind to a known HLA. Any suitable method may be used, provided that the same method is used to determine multiple HLA-epitope binding pairs that are directly compared. For example, biochemical analysis may be used. It is also possible to use lists of epitopes known to be bound by a given HLA. It is also possible to use predictive or modelling software to determine which epitopes may be bound by a given HLA. Examples are provided in Table 1. In some cases a T cell epitope is capable of binding to a given HLA if it has an IC50 or predicted IC50 of less than 5000 nM, less than 2000 nM, less than 1000 nM, or less than 500 nM.
  • TABLE 1
    Example software for determining epitope-HLA binding
    EPITOPE PREDICTION TOOLS WEB ADDRESS
    BIMAS, NIH www-bimas.cit.nih.gov/molbio/hla_bind/
    PPAPROC, Tubingen Univ.
    MHCPred, Edward Jenner Inst. of
    Vaccine Res.
    EpiJen, Edward Jenner Inst. of http://www.ddg-pharmfac.net/epijen/EpiJen/EpiJen.htm
    Vaccine Res.
    NetMHC, Center for Biological http://www.cbs.dtu.dk/services/NetMHC/
    Sequence Analysis
    SVMHC, Tubingen Univ. http://abi.inf.uni-tuebingen.de/Services/SVMHC/
    SYFPEITHI, Biomedical Informatics, http://www.syfpeithi.de/bin/MHCServer.dll/Epitope
    Heidelberg Prediction.htm
    ETK EPITOOLKIT, Tubingen Univ. http://etk.informatik.uni-tuebingen.de/epipred/
    PREDEP, Hebrew Univ. Jerusalem http://margalit.huji.ac.il/Teppred/mhc-bind/index.html
    RANKPEP, MIF Bioinformatics http://bio.dfci.harvard.edu/RANKPEP/
    IEDB, Immune Epitope Database http://tools.immuneepitope.org/main/html/tcell_tools.html
    EPITOPE DATABASES WEB ADDRESS
    MHCBN, Institute of Microbial http://www.imtech.res.in/raghava/mhcbn/
    Technology, Chandigarh, INDIA
    SYFPEITHI, Biomedical Informatics, http://www.syfpeithi.de/
    Heidelberg
    AntiJen, Edward Jenner Inst. of http://www.ddg-
    Vaccine Res. pharmfac.net/antijen/AntiJen/antijenhomepage.htm
    EPIMHC database of MHC ligands, http://immunax.dfci.harvard.edu/epimhc/
    MIF Bioinformatics
    IEDB, Immune Epitope Database http://www.iedb.org/
  • As provided herein T cell epitope presentation by multiple HLAs of an individual is generally needed to trigger a T cell response. Accordingly, the methods of the disclosure comprise determining whether a polypeptide has a sequence that is a T cell epitope capable of binding to at least two HLA class I molecules or at least two HLA class II (PEPI2+) molecules of a human subject (e.g., in a model human population).
  • The best predictor of a cytotoxic T cell response to a given polypeptide is the presence of at least one T cell epitope that is presented by three or more HLA class I molecules of an individual (≥1 PEPI3+). Accordingly, in some cases the method comprises determining whether a polypeptide has a sequence that is a T cell epitope capable of binding to at least three HLA class I molecules of a specific human subject. In some cases the method comprises determining whether a polypeptide has a sequence that is a T cell epitope capable of binding to just three HLA class I of a human subject (e.g., in a model human population). A helper T cell response may be predicted by the presence of at least one T cell epitope that is presented by three or more (≥1 PEPI3+) or 4 or more (≥1 PEPI4+) HLA class II of an individual. Therefore in some cases, the method comprises determining whether a polypeptide has a sequence that is a T cell epitope capable of binding to at least three HLA class II of a human subject (e.g., in a model human population). In other cases, the method comprises determining whether a polypeptide has a sequence that is a T cell epitope capable of binding to at least four HLA class II of a human subject. In other cases, the method comprises determining whether a polypeptide has a sequence that is a T cell epitope capable of binding to at just three and/or just four HLA class II of a human subject.
  • In some cases, the disclosed methods and compositions may be used to predict whether a polypeptide/fragment will induce both a cytotoxic T cell response and a helper T cell response in a human subject. The polypeptide/fragment comprises both an amino acid sequence that is a T cell epitope capable of binding to multiple HLA class I molecules of the subject and an amino acid sequence that is a T cell epitope capable of binding to multiple HLA class II molecules of the subject. The HLA class I-binding and HLA class II-binding epitopes may fully or partially overlap. In some cases such fragments of a polypeptide may be identified by selecting an amino acid sequence that is a T cell epitope capable of binding to multiple (e.g. at least two or at least three) HLA class I molecules of the subject, and then screening one or more longer fragments of the polypeptide that are extended at the N- and/or C-terminus for binding to one or more or the most possible (i.e. when no suitable HLA class II-binding PEPI3+s are available) HLA class II molecules of the subject or of a high percentage of subjects in a population.
  • Some subjects may have two HLA alleles that encode the same HLA molecule (for example, two copies for HLA-A*02:25 in case of homozygosity). The HLA molecules encoded by these alleles bind all of the same T cell epitopes. For the purposes of this disclosure “binding to at least two HLA molecules of the subject” as used herein includes binding to the HLA molecules encoded by two identical HLA alleles in a single subject. In other words, “binding to at least two HLA molecules of the subject” and the like could otherwise be expressed as “binding to the HLA molecules encoded by at least two HLA alleles of the subject”.
  • Polypeptide Antigens
  • As used herein, the term “polypeptide” refers to a full-length protein, a portion of a protein, or a peptide characterized as a string of amino acids. As used herein, the term “peptide” refers to a short polypeptide comprising between 2, or 3, or 4, or 5, or 6, or 7, or 8, or 9, or 10, or 11, or 12, or 13, or 14, or 15 and 10, or 11, or 12, or 13, or 14, or 15, or 20, or 25, or 30, or 35, or 40, or 45, or 50 amino acids.
  • The terms “fragment” or “fragment of a polypeptide” as used herein refer to a string of amino acids or an amino acid sequence typically of reduced length relative to the or a reference polypeptide and comprising, over the common portion, an amino acid sequence identical to the reference polypeptide. Such a fragment according to the disclosure may be, where appropriate, included in a larger polypeptide of which it is a constituent. In some cases the fragment may comprise the full length of the polypeptide, for example where the whole polypeptide, such as a 9 amino acid peptide, is a single T cell epitope.
  • In some cases the polypeptide is, or the polypeptide consists of all or part of an antigen that is, expressed by a pathogenic organism (for example, a bacteria or a parasite), a virus, or a cancer cell, that is associated with an autoimmune disorder or response or a disease-associated cell, or that is an allergen, or an ingredient of a medicine or pharmaceutical composition such as a vaccine or immunotherapy composition. In some cases the method of the disclosure comprises an initial step of identifying or selecting a suitable polypeptide, for example a polypeptide as further described below.
  • The polypeptide or antigen may be expressed in the cells or specifically in diseased cells of the specific or target human population (e.g. a tumor-associated antigen, a polypeptide expressed by a virus, intracellular bacteria or parasite, or the in vivo product of a vaccine or immunotherapy composition) or acquired from the environment (e.g. a food, an allergen or a drug). The polypeptide or antigen may be present in a sample taken from a subject of the specific or target human population. Both polypeptide antigens and HLAs can be exactly defined by amino acid or nucleotide sequences and sequenced using methods known in the art.
  • The polypeptide or antigen may be a cancer- or tumor-associated antigen (TAA). TAAs are proteins expressed in cancer or tumor cells. The cancer or tumour cell may be present in a sample obtained from a subject of the specific or target human population. Examples of TAAs include new antigens (neoantigens) expressed during tumorigenesis, products of oncogenes and tumor suppressor genes, overexpressed or aberrantly expressed cellular proteins (e.g. HER2, MUC1), antigens produced by oncogenic viruses (e.g. EBV, HPV, HCV, HBV, HTLV), cancer testis antigens (CTA)(e.g. MAGE family, NY-ESO) and cell-type-specific differentiation antigens (e.g. MART-1). TAA sequences may be found experimentally, or in published scientific papers, or through publicly available databases, such as the database of the Ludwig Institute for Cancer Research (www.cta.lncc.br/), Cancer Immunity database (cancerimmunity.org/peptide/) and the TANTIGEN Tumor T cell antigen database (cvc.dfci.harvard.edu/tadb/).
  • In some cases the polypeptide or antigen is not expressed or is minimally expressed in normal healthy cells or tissues, but is expressed (in those cells or tissues) in a high proportion of (with a high frequency in) subjects having a particular disease or condition, such as a type of cancer or a cancer derived from a particular cell type or tissue, for example breast cancer, ovarian cancer or melanoma. A further example is colorectal cancer. Other non-limiting cancer examples include non-melanoma skin, lung, prostate, kidney, bladder, stomach, liver, cervix uteri, oesophagus, non-Hodgkin lymphoma, leukemia, pancreas, corpus uteri, lip, oral cavity, thyroid, brain, nervous system, gallbladder, larynx, pharynx, myeloma, nasopharynx, Hodgkin lymphoma, testis and Kaposi sarcoma. Alternatively, the polypeptide may be expressed at low levels in normal healthy cells, but at high levels (overexpressed) in diseased (e.g. cancer) cells or in subjects having the disease or condition. In some cases the polypeptide is expressed in, or expressed at a high level relative to normal healthy cells or subjects in, at least 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more of such individuals, or of a subject-matched human subpopulation or model or target population. For example the population may be matched to the subject by ethnicity, geographical location, gender, age, disease, disease type or stage, genotype, or expression of one or more biomarkers.
  • In some cases the expression frequencies can be determined from published figures and scientific publications. In some cases the method of the disclosure comprises a step of identifying or selecting such a polypeptide.
  • In some cases the polypeptide is associated with or highly (over-) expressed in cancer cells, or in solid tumors. Exemplary cancers include carcinomas, sarcomas, lymphomas, leukemias, germ cell tumors, or blastomas. The cancer may or may not be a hormone related or dependent cancer (e.g., an estrogen or androgen related cancer). The tumor may be malignant or benign. The cancer may or may not be metastatic.
  • In some cases the polypeptide is a cancer testis antigens (CTA). CTA are not typically expressed beyond embryonic development in healthy cells. In healthy adults, CTA expression is limited to male germ cells that do not express HLAs and cannot present antigens to T cells. Therefore, CTAs are considered expressional neoantigens when expressed in cancer cells.
  • CTA expression is (i) specific for tumor cells, (ii) more frequent in metastases than in primary tumors and (iii) conserved among metastases of the same patient (Gajewski ed. Targeted Therapeutics in Melanoma. Springer New York. 2012).
  • The polypeptide may be a mutational neoantigen, which is expressed by a cell, for example a cancer cell, of the individual, but altered from the analogous protein in a normal or healthy cell. In some cases the methods of the disclosure comprise the step of identifying a polypeptide that is a mutational neoantigen, or that is a mutational neoantigen in the specific human subject, or of identifying a neoepitope. For example the neoantigen may be present in a sample obtained from the subject. Mutational neoantigens or neoepitopes can be used to target disease-associated cells, such as cancer cells, that express the neoantigen or a neoantigen comprising the neoepitope. Mutations in a polypeptide expressed by a cell, for example a cell in a sample taken from a subject, can be detected by, for example, sequencing, but the majority do not induce an immune response against the neoantigen-expressing cells. Currently, the identification of mutational neoantigens that do induce an immune response is based on prediction of mutational HLA restricted epitopes and further in vitro testing of the immunogenicity of predicted epitopes in individual's blood specimen. This process is inaccurate, long and expensive.
  • The identification of mutational epitopes (e.g., neoepitopes) that bind to multiple HLA molecules reproducibly define the immunogenicity of mutational neoantigens. Therefore, in some cases in accordance with the disclosure, the polypeptide is a mutational neoantigen, and the immunogenic fragment of the polypeptide comprises a neoantigen specific mutation (or consists of a neoepitope).
  • The polypeptide may be a viral protein that is expressed intracellularly. Examples include HPV16 E6, E7; HIV Tat, Rev, Gag, Pol, Env; HTLV-Tax, Rex, Gag, Env, Human herpes virus proteins, Dengue virus proteins. The polypeptide may be a parasite protein that is expressed intracellularly, for example malaria proteins.
  • The polypeptide may be an active ingredient of a pharmaceutical composition, such as a vaccine or immunotherapy composition, optionally a candidate active ingredient for a new pharmaceutical composition. The term “active ingredient” as used herein refers to a polypeptide that is intended to induce an immune response and may include a polypeptide product of a vaccine or immunotherapy composition that is produced in vivo after administration to a subject. For a DNA or RNA immunotherapy composition, the polypeptide may be produced in vivo by the cells of a subject to whom the composition is administered. For a cell-based composition, the polypeptide may be processed and/or presented by cells of the composition, for example autologous dendritic cells or antigen presenting cells pulsed with the polypeptide or comprising an expression construct encoding the polypeptide. The pharmaceutical composition may comprise a polynucleotide or cell encoding one or more active ingredient polypeptides.
  • In other cases the polypeptide may be a target polypeptide antigen of a pharmaceutical, vaccine or immunotherapy composition. A polypeptide is a target polypeptide antigen if the composition is intended or designed to induce an immune response (e.g. a cytotoxic T cell response) that targets or is directed at the polypeptide. A target polypeptide antigen is typically a polypeptide that is expressed by a pathogenic organism, a virus or a diseased cell such as a cancer cell. A target polypeptide antigens may be a TAA or a CTA. Presently, >200 clinical trials are investigating cancer vaccines with tumor antigens.
  • The polypeptide may be an allergen that enters the body of an individual through, for example, the skin, lung or oral routes.
  • Non-limiting examples of suitable polypeptides include those listed in one or more of Tables 2 to 6.
  • Genetic sequences may be obtained from the sequencing of biological materials. Sequencing can be done by any suitable method that determines DNA and/or RNA and/or amino acid sequences. The disclosure utilizes both the HLA genotypes and amino acid sequences. However, methods to identify HLA genotype from genetic sequences of an individual and methods of obtaining amino acid sequences derived from DNA or RNA sequence data are not the subject of the disclosure.
  • TABLE 2
    LIST OF NAMED TUMOUR ANTIGENS WITH CORRESPONDING
    ACCESSION NUMBERS. CTAs = bold and *
    5T4 Q13641.1 A1BG P04217.1 A33 Q99795.1
    A4GALT Q9NPC4.1 AACT P01011.1 AAG Q9M6E9.1 ABI1 Q8IZP0.1
    ABI2 Q9NYB9.1 ABL1 P00519.1 ABL-BCR Q8WUG5.1 ABLIM3 O94929.1
    ABLL P42684.1 ABTB1 Q969K4.1 ACACA Q13085.1 ACBD4 Q8NC06.1
    ACO1 P21399.1 ACRBP Q8NEB7.1* ACTL6A O96019.1 ACTL8 Q9H568.1*
    ACTN4 O43707.1 ACVR1 Q04771.1 ACVR1B P36896.1 ACVR2B Q13705.1
    ACVRL1 P37023.1 ACS2B Q68CK6.1 ACSL5 Q9ULC5.1 ADAM-15 Q13444.1
    ADAM17 P78536.1 ADAM2 Q99965.1* ADAM29 Q9UKF5.1* ADAM7 Q9H2U9.1
    ADAP1 O75689.1 ADFP Q99541.1 ADGRA3 Q8IWK6.1 ADGRF1 Q5T601.1
    ADGRF2 Q8IZF7.1 ADGRL2 O95490.1 ADHFE1 Q8IWW8.1 AEN Q8WTP8.1
    AFF1 P51825.1 AFF4 Q9UHB7.1 AFP P02771.1 AGAP2 Q99490.1
    AGO1 Q9UL18.1 AGO3 Q9H9G7.1 AGO4 Q9HCK5.1 AGR2 O95994.1
    AIFM2 Q9BRQ8.1 AIM2 O14862.1 AKAP-13 Q12802.1 AKAP-3 O75969.1*
    AKAP-4 Q5JQC9.1* AKIP1 Q9NQ31.1 AKT1 P31749.1 AKT2 P31751.1
    AKT3 Q9Y243.1 ALDH1A1 P00352.1 ALK Q9UM73.1 ALKBH1 Q13686.1
    ALPK1 Q96QP1.1 AMIGO2 Q865J2.1 ANG2 O15123.1 ANKRD45 Q5TZF3.1*
    ANO1 Q5XXA6.1 ANP32A P39687.1 ANXA2 P07355.1 APC P25054.1
    APEH P13798.1 APOA2 P02652.1 APOD P05090.1 APOL1 O14791.1
    AR P10275.1 ARAF P10398.1 ARF4L P49703.1 ARHGEF5 Q12774.1
    ARID3A Q99856.1 ARID4A P29374.1 ARL6IP5 O75915.1 ARMC3 B4DXS3.1*
    ARMC8 Q8IUR7.1 ARTC1 P52961.1 ARX Q96Q53.1* ATAD2 Q6PL18.1
    ATIC P31939.1 AURKC Q9UQB9.1 AXIN1 O15169.1 AXL P30530.1
    BAAT Q14032.1 BAFF Q9Y275.1 BAGE-1 Q13072.1* BAGE-2 Q86Y30.1*
    BAGE-3 Q86Y29.1* BAGE-4 Q86Y28.1 BAGE-5 Q86Y27.1* BAI1 O14514.1
    BAL P19835.1 BALF2 P03227.1 BALF4 P03188.1 BALF5 P03198.1
    BARF1 P03228.1 BBRF1 P03213.1 BCAN Q96GW7.1 BCAP31 P51572.1
    BCL-2 P10415.1 BCL2L1 Q07817.1 BCL6 P41182.1 BCL9 O00512.1
    BCR P11274.1 BCRF1 P03180.1 BDLF3 P03224.1 BGLF4 P13288.1
    BHLF1 P03181.1 BHRF1 P03182.1 BILF1 P03208.1 BILF2 P03218.1
    BIN1 O00499.1 BING-4 O15213.1 BIRC7 Q96CA5.1 BLLF1 P03200.1
    BLLF2 P03199.1 BMI1 P35226.1 BMLF1 Q04360.1 BMPR1B O00238.1
    BMRF1 P03191.1 BNLF2a P00739.1 BNLF2b Q8AZJ3.1 BNRF1 P03179.1
    BRAF1 P15056.1 BRD4 O60885.1 BRDT Q58F21.1* BRI3BP Q8WY22.1
    BRINP1 O60477.1 BRLF1 P03209.1 BTBD2 Q9BX70.1 BUB1B O60566.1
    BVRF2 P03234.1 BXLF1 P03177.1 BZLF1 P03206.1 C15orf60 Q7Z4M0.1*
    CA 12-5 Q8WXI7.1 CA 19-9 Q969X2.1 CA195 Q5TG92.1 CA9 Q16790.1
    CABYR O75952.1* CADM4 Q8NFZ8.1 CAGE1 Q8CT20.1* CALCA P01258.1
    CALR3 Q96L12.1 CAN P35658.1 CASC3 O15234.1 CASC5 Q8NG31.1*
    CASP5 P51878.1 CASP8 Q14790.1 CBFA2T2 O43439.1 CBFA2T3 O75081.1
    CBL P22681.1 CBLB Q13191.1 CC3 Q9BUP3.1 CCDC110 Q8TBZ0.1*
    CCDC33 Q8N5R6.1* CCDC36 Q8IYA8.1* CCDC6 Q16204.1 CCDC62 Q6P9F0.1*
    CCDC68 Q9H2F9.1 CCDC83 Q8IWF9.1* CCL13 Q99616.1 CCL2 P13500.1
    CCL7 P80098.1 CCNA1 P78396.1* CCNA2 P20248.1 CCNB1 P14635.1
    CCND1 P24385.1 CCNE2 096020.1 CCNI Q14094.1 CCNL1 Q9UK58.1
    CCR2 P41597.1 CD105 P17813.1 CD123 P26951.1 CD13 P15144.1
    CD133 O43490.1 CD137 Q07011.1 CD138 P18827.1 CD157 Q10588.1
    CD16A P08637.1 CD178 P48023.1 CD19 P15391.1 CD194 P51679.1
    CD2 P06729.1 CD20 P11836.1 CD21 P20023.1 CD22 P20273.1
    CD229 Q9HBG7.1 CD23 P06734.1 CD27 P26842.1 CD28 P10747.1
    CD30 P28908.1 CD317 Q10589.1 CD33 P20138.1 CD350 Q9ULW2.1
    CD36 P16671.1 CD37 P11049.1 CD4 P01730.1 CD40 P25942.1
    CD40L P29965.1 CD45 P08575.1 CD47 Q08722.1 CD51 P06756.1
    CD52 P31358.1 CD55 P08174.1 CD61 P05106.1 CD70 P32970.1
    CD74 P08922.1 CD75 P15907.1 CD79B P40259.1 CD80 P33681.1
    CD86 P42081.1 CD8a P01732.1 CD8b P10966.1 CD95 P25445.1
    CD98 P08195.1 CDC123 O75794.1 CDC2 P06493.1 CDC27 P30260.1
    CDC73 Q6P1J9.1 CDCA1 Q9BZD4.1* CDCP1 Q9H5V8.1 CDH3 P22223.1
    CDK2AP1 O14519.1 CDK4 P11802.1 CDK7 P50613.1 CDKN1A P38936.1
    CDKN2A P42771.1 CEA P06731.1 CEACAM1 Q86UE4.1 CENPK Q9BS16.1
    CEP162 Q5TB80.1 CEP290 O15078.1* CEP55 Q53EZ4.1* CFL1 P23528.1
    CH3L2 Q15782.1 CHEK1 O14757.1 CK2 P19784.1 CLCA2 Q9UQC9.1
    CLOCK O15516.1 CLPP Q16740.1 CMC4 P56277.1 CML66 Q96RS6.1
    CO-029 P19075.1 COTL1 Q14019.1 COX2 P35354.1 COX6B2 Q6YFQ2.1*
    CPSF1 Q10570.1 CPXCR1 Q8N123.1* CREBL2 O60519.1 CREG1 O75629.1
    Cripto P13385.1 CRISP2 P16562.1* *CRK P46108.1 CRKL P46109.1
    CRLF2 Q9HC73.1 CSAGE Q6PB30.1 CT45 Q5HYN5.1* CT45A2 Q5DJT8.1*
    CT45A3 Q8NHU0.1* CT45A4 Q8N7B7.1* CT45A5 Q6NSH3.1* CT45A6 P0DMU7.1*
    CT46 Q86X24.1* CT47 Q5JQC4.1* CT47B1 P0C2P7.1* CTAGE2 Q96RT6.1*
    cTAGE5 O15320.1* CTCFL Q8NI51.1* CTDSP2 O14595.1 CTGF P29279.1
    CTLA4 P16410.1 CTNNA2 P26232.1* CTNNB1 P35222.1 CTNND1 O60716.1
    CTSH P09668.1 CTSP1 A0RZH4.1* CTTN Q14247.1 CXCR4 P61073.1
    CXorf48 Q8WUE5.1* CXorf61 Q5H943.1* Cyclin-E P24864.1 CYP1B1 Q16678.1
    CypB P23284.1 CYR61 O00622.1 CS1 P28290.1 CSAG1 Q6PB30.1*
    CSDE1 O75534.1 CSF1 P09603.1 CSF1R P07333.1 CSF3R Q99062.1
    CSK P41240.1 CSK23 Q8NEV1.1 DAPK3 O43293.1 DAZ1 Q9NQZ3.1
    DBPC Q9Y2T7.1 DCAF12 Q5T6F0.1* DCT P40126.1 DCUN1D1 Q96GG9.1
    DCUN1D3 Q8IWE4.1 DDR1 Q08345.1 DDX3X O00571.1 DDX6 P26196.1
    DEDD O75618.1 DEK P35659.1 DENR O43583.1 DEPDC1 Q5TB30.1
    DFNA5 O60443.1 DGAT2 Q96PD7.1 DHFR P00374.1 DKK1 O94907.1
    DKK3 Q9UBP4.1 DKKL1 Q9UK85.1* DLEU1 O43261.1 DMBT1 Q9UGM3.1
    DMRT1 Q9Y5R6.1* DNAJB8 Q8NHS0.1* DNAJC8 O75937.1 DNMT3A Q9Y6K1.1
    DPPA2 Q7Z7J5.1* DR4 O00220.1 DR5 O14763.1 DRG1 Q9Y295.1*
    DSCR8 Q96T75.1 E2F3 O00716.1 E2F6 O75461.1 E2F8 A0AVK6.1
    EBNA1 P03211.1 EBNA2 P12978.1 EBNA3 P12977.1 EBNA4 P03203.1
    EBNA6 P03204.1 EBNA-LP Q8AZK7.1 E-cadherin P12830.1 ECT2 Q9H8V3.1
    ECTL2 Q00858.1 EDAG Q9BXL5.1* EEF2 P13639.1 EFNA1 P20827.1
    EFS O43281.1 EFTUD2 Q15029.1 EGFL7 Q9UHF1.1 EGFR p00533.1
    E124 O14681.1 EIF4EBP1 Q13541.1 ELF3 P78545.1 ELF4 Q99607.1
    ELOVL4 Q9GZR5.1* EMP1 P54849.1 ENAH Q8N8S7.1 Endosialin Q9HCU0.1
    ENO1 P06733.1 ENO2 P09104.1 ENO3 P13929.1 ENTPD5 O75356.1
    EpCAM P16422.1 EPHA2 P29317.1 EPHA3 P29320.1 EPHB2 P29323.1
    EPHB4 P54760.1 EPHB6 O15197.1 EPS8 Q12929.1 ERBB3 P21860.1
    ERBB4 Q15303.1 EREG O14944.1 ERG P11308.1 ERVK-18 O42043.1
    ERVK-19 O71037.1 ESR1 P03372.1 ETAA1 Q9NY74.1 ETS1 P14921.1
    ETS2 P15036.1 ETV1 P50549.1 ETV5 P41161.1 ETV6 P41212.1
    EVI5 O60447.1 EWSR1 Q01844.1 EYA2 O00167.1 EZH2 Q15910.1
    FABP7 O15540.1 FAM133A Q8N9E0.1* FAM13A O94988.1 FAM46D Q8NEK8.1*
    FAM58BP P0C7Q3.1 FANCG O15287.1 FATE1 Q969F0.1* FBXO39 Q8N4B4.1*
    FBXW11 Q9UKB1.1 FCHSD2 O94868.1 FER P16591.1 FES P07332.1
    FEV Q99581.1 FGF10 O15520.1 FGF23 Q9GZV9.1 FGF3 P11487.1
    FGF4 P08620.1 FGF5 P12034.1 FGFR1 P11362.1 FGFR2 P21802.1
    FGFR3 P22607.1 FGFR4 P22455.1 FGR P09769.1 FLI1 Q01543.1
    FLT3 P36888.1 FMNL1 O95466.1 FMOD Q06828.1 FMR1NB Q8N0W7.1*
    FN1 P02751.1 Fn14 Q9NP84.1 FNIP2 Q9P278.1 FOLR1 P15328.1
    FOS P01100.1 FosB P53539.1 FOSL1 P15407.1 FOXM1 Q08050.1
    FOXO1 Q12778.1 FOXO3 O43524.1 FRAT1 Q92837.1 FRMD3 A2A2Y4.1
    FSIP1 Q8NA03.1 FSIP2 Q5CZCO.1 FSTL3 O95633.1 FTHL17 Q9BXU8.1*
    FUNDC2 Q9BWH2.1 FUS P35637.1 FUT1 P19526.1 FUT3 P21217.1
    FYN P06241.1 GAB2 Q9UQC2.1 GADD45G O95257.1 GAGE-1 Q13065.1
    GAGE12B/C/D/E A1L429.1 GAGE12F P0CL80.1 GAGE12G P0CL81.1 GAGE12H A6NDE8.1
    GAGE12I P0CL82.1 GAGE12J A6NER3.1 GAGE-2 Q6NT46.1 GAGE-3 Q13067.1
    GAGE-4 Q13068.1 GAGE-5 Q13069.1 GAGE-6 Q13070.1 GAGE-7 O76087.1
    GAGE-8 Q9UEU5.1 GALGT2 Q00973.1 GAS7 O60861.1 GASZ Q8WWH4.1
    GATA-3 P23771.1 GBU4-5 Q587J7.1 GCDFP-15 P12273.1 GFAP P14136.1
    GFI1 Q99684.1 Ghrelin Q9UBU3.1 GHSR Q92847.1 GIPC1 O14908.1
    GITR Q9Y5U5.1 GKAP1 Q5VSY0.1 GLI1 P08151.1 Glypican-3 P51654.1
    GML Q99445.1 GNA11 P29992.1 GNAQ P50148.1 GNB2L1 P63244.1
    GOLGA5 Q8TBA6.1 gp100 P40967.1 gp75 P17643.1 Gp96 P14625.1
    GPAT2 Q6NUI2.1* GPATCH2 Q9NW75.1* GPC-3 P51654.1 GPNMB Q14956.1
    GPR143 P51810.1 GPR89A B7ZAQ6.1 GRB2 P62993.1 GRP78 P11021.1
    GUCY1A3 Q02108.1 H3F3A P84243.1 HAGE Q9NXZ2.1* hANP P01160.1
    HBEGF Q99075.1 hCG-beta P01233.1 HDAC1 Q13547.1 HDAC2 Q92769.1
    HDAC3 O15379.1 HDAC4 P56524.1 HDAC5 Q9UQL6.1 HDAC6 Q9UBN7.1
    HDAC7 Q8WUI4.1 HDAC8 Q9BY41.1 HDAC9 Q9UKV0.1 HEATR1 Q9H583.1
    Hepsin P05981.1 Her2/neu P04626.1 HERC2 O95714.1 HERV-K104 P61576.1
    HEXB P07686.1 HEXIM1 O94992.1 HGRG8 Q9Y5A9.1 HIPK2 Q9H2X6.1
    HJURP Q8NCD3.1 HMGB1 P09429.1 HMOX1 P09601.1 HNRPL P14866.1
    HOM-TES-85 Q9P127.1* HORMAD1 Q86X24.1* HORMAD2 Q8N7B1.1* HPSE Q9Y251.1
    HPV16 E6 P03126.1 HPV16 E7 P03129.1 HPV18 E6 P06463.1 HPV18 E7 P06788.1
    HRAS P01112.1 HSD17B13 Q7Z5P4.1 HSP105 Q92598.1 HSP60 P10809.1
    HSPA1A P08107.1 HSPB9 Q9BQS6.1* HST-2 P10767.1 HT001 Q2TB18.1
    hTERT O14746.1 HUS1 O60921.1 ICAM-1 P05362.1 IDH1 O75874.1
    IDO1 P14902.1 IER3 P46695.1 IGF1R P08069.1 IGFS11 Q5DX21.1*
    IL13RA2 Q14627.1* IMP-3 Q9NV31.1* ING3 Q9NXR8.1 INPPL1 O15357.1
    INTS6 Q9UL03.1 IRF4 Q15306.1 IRS4 O14654.1 ITGA5 P08648.1
    ITGB8 P26012.1 ITPA Q9BY32.1 ITPR2 Q14571.1 JAK2 O60674.1
    JAK3 P52333.1 JARID1B Q9UGL1.1* JAZF1 Q86VZ6.1 JNK1 P45983.1
    JNK2 P45984.1 JNK3 P53779.1 JTB O76095.1 JUN P05412.1
    JUP P14923.1 K19 P08727.1 KAAG1 Q9UBP8.1 Kallikrein 14 Q9P0G3.1
    Kallikrein 4 Q9Y5K2.1 KAT6A Q92794.1 KDM1A O60341.1 KDM5A P29375.1
    KIAA0100 Q14667.1* KIAA0336 Q8IWJ2.1 KIAA1199 Q8WUJ3.1 KIAA1641 A6QL64.1
    KIF11 P52732.1 KIF1B O60333.1 KIF20A O95235.1 KIT P10721.1
    KLF4 O43474.1 KLHL41 O60662.1 KLK10 O43240.1 KMT2D O14686.1
    KOC1 O00425.1 K-ras P01116.1 KRIT1 O00522.1 KW-12 P62913.1
    KW-2 Q96RS0.1 KW-5 (SEBD4) Q9HOZ9.1 KW-7 O75475.1 L1CAM P32004.1
    L53 Q96EL3.1 L6 Q9BTT4.1 LAG3 P18627.1 Lage-1 O75638.1*
    LATS1 O95835.1 LATS2 Q9NRM7.1 LCMT2 O60294.1 LCP1 P13796.1
    LDHC P07864.1* LDLR P01130.1 LEMD1 Q68G75.1* Lengsin Q5TDP6.1
    LETMD1 Q6P1Q0.1 LGALS3BP Q08380.1 LGALS8 O00214.1 LIN7A O14910.1
    LIPI Q6XZB0.1* LIV-1 Q13433.1 LLGL1 Q15334.1 LMO1 P25800.1
    LMO2 P25791.1 LMP1 P03230.1 LMP2 P13285.1 LOC647107 Q8TAI5.1*
    LOXL2 Q9Y4K0.1 LRP1 Q07954.1 LRRN2 O75325.1 LTF P02788.1
    LTK P29376.1 LZTS1 Q9Y250.1 LY6K Q17RY6.1* LYN P07948.1
    LYPD6B Q8NI32.1* MAEA Q7L5Y9.1 MAEL Q96JY0.1* MAF O75444.1
    MAFF Q9ULX9.1 MAFG O15525.1 MAFK O60675.1 MAGE-A1 P43355.1*
    MAGE-A10 P43363.1* MAGE-A11 P43364.1* MAGE-A12 P43365.1* MAGE-A2 P43356.1*
    MAGE-A2B Q6P448.1* MAGE-A3 P43357.1* MAGE-A4 P43358.1* MAGE-A5 P43359.1*
    MAGE-A6 P43360.1* MAGE-A8 P43361.1* MAGE-A9 P43362.1* MAGE-B1 P43366.1*
    MAGE-B2 O15479.1* MAGE-B3 O15480.1* MAGE-B4 O15481.1* MAGE-B5 Q9BZ81.1*
    MAGE-B6 Q8N7X4.1* MAGE-C1 O60732.1* MAGE-C2 Q9UBF1.1* MAGE-C3 Q8TD91.1*
    mammaglobin-A Q13296.1 MANF P55145.1 MAP2K2 P36507.1 MAP2K7 O14733.1
    MAP3K7 O43318.1 MAP4K5 Q9Y4K4.1 MART1 Q16655.1 MART-2 Q5VTY9.1
    MAS1 P04201.1 MC1R Q01726.1 MCAK Q99661.1* MCF2 P10911.1
    MCF2L O15068.1 MCL1 Q07820.1 MCTS1 Q9ULC4.1 MCSP Q6UVK1.1
    MDK P21741.1 MDM2 Q00987.1 MDM4 O15151.1 ME1 P48163.1
    ME491 P08962.1 MECOM Q03112.1 MELK Q14680.1 MEN1 O00255.1
    MERTK Q12866.1 MET P08581.1 MFGE8 Q08431.1 MFHAS1 Q9Y4C4.1
    MFI2 P08582.1 MGAT5 Q09328.1 Midkine P21741.1 MIF P14174.1
    MKI67 P46013.1 MLH1 P40692.1 MLL Q03164.1 MLLT1 Q03111.1
    MLLT10 P55197.1 MLLT11 Q13015.1 MLLT3 P42568.1 MLLT4 P55196.1
    MLLT6 P55198.1 MMP14 P50281.1 MMP2 P08253.1 MMP7 P09237.1
    MMP9 P14780.1 MOB3B Q86TA1.1 MORC1 Q86VD1.1* MPHOSPH1 Q96Q89.1*
    MPL P40238.1 MRAS O14807.1 MRP1 P33527.1 MRP3 O15438.1
    MRPL28 Q13084.1 MRPL30 Q8TCC3.1 MRPS11 P82912.1 MSLN Q13421.1
    MTA1 Q13330.1 MTA2 O94776.1 MTA3 Q9BTC8.1 MTCP1 P56278.1
    MTSS1 O43312.1 MUC-1 P15941.1 MUC-2 Q02817.1 MUC-3 Q02505.1
    MUC-4 Q99102.1 MUC-5AC P98088.1 MUC-6 Q6W4X9.1 MUM1 Q2TAK8.1
    MUM2 Q9Y5R8.1 MYB P10242.1 MYC P01106.1 MYCL P12524.1
    MYCLP1 P12525.1 MYCN P04198.1 MYD88 Q99836.1 MYEOV Q96EZ4.1
    MYO1B O43795.1 NA88-A P0C5K6.1* NAE1 Q13564.1 Napsin-A O96009.1
    NAT6 Q93015.1 NBAS A2RRP1.1 NBPF12 Q5TAG4.1 NCOA4 Q13772.1
    NDC80 O14777.1 NDUFC2 O95298.1 Nectin-4 Q96NY8.1 NEK2 P51955.1
    NEMF O60524.1 NENF Q9UMX5.1 NEURL1 O76050.1 NFIB O00712.1
    NFKB2 Q00653.1 NF-X1 Q12986.1 NFYC Q13952.1 NGAL P80188.1
    NGEP Q6IWH7.1 NKG2D-L1 Q9BZM6.1 NKG2D-L2 Q9BZM5.1 NKG2D-L3 Q9BZM4.1
    NKG2D-L4 Q8TD07.1 NKX3.1 Q99801.1 NLGN4X Q8N0W4.1 NLRP4 Q96MN2.1*
    NNMT P40261.1 NOL4 O94818.1* NOTCH2 Q04721.1 NOTCH3 Q9UM47.1
    NOTCH4 Q99466.1 NOV P48745.1 NPM1 P06748.1 NR6A1 Q15406.1*
    N-RAS P01111.1 NRCAM Q92823.1 NRP1 O14786.1 NSE1 Q96KN4.1
    NSE2 Q96KN1.1 NTRK1 P04629.1 NUAK1 O60285.1 NUGGC Q68CJ6.1
    NXF2 Q9GZY0.1* NXF2B Q5JRM6.1* NY-BR-1 Q9BXX3.1 NYD-TSPG Q9BWV7.1
    NY-ESO-1 P78358.1* NY-MEL-1 P57729.1 OCA2 Q04671.1 ODF1 Q14990.1*
    ODF2 Q5BJF6.1* ODF3 Q96PU9.1* ODF4 Q2M2E3.1* OGG1 O15527.1
    OCT O15294.1 OIP5 O43482.1* OS9 Q13438.1 OTOA Q05BM7.1*
    OX40 P43489.1 OX4OL P23510.1 P53 P04637.1 P56-LCK P06239.1
    PA2G4 Q9UQ80.1 PAGE1 O75459.1* PAGE2 Q7Z2X2.1* PAGE2B Q5JRK9.1*
    PAGE3 Q5JUK9.1* PAGE4 O60829.1* PAGE5 Q96GU1.1* PAK2 Q13177.1
    PANO1 I0J062.1 PAP Q06141.1 PAPOLG Q9BWT3.1 PARK2 O60260.1
    PARK7 Q99497.1 PARP12 Q9H0J9.1 PASD1 Q8IV76.1* PAX3 P23760.1
    PAX5 Q02548.1 PBF P00751.1 PBK Q96KB5.1* PBX1 P40424.1
    PCDC1 Q15116.1 PCM1 Q15154.1 PCNXL2 A6NKB5.1 PDGFB P01127.1
    PDGFRA P16234.1 PEPP2 Q9HAU0.1* PGF P49763.1 PGK1 P00558.1
    PHLDA3 Q9Y5J5.1 PHLPP1 O60346.1 PIAS1 O75925.1 PIAS2 O75928.1
    PIK3CA P42336.1 PIK3CD O00329.1 PIK3R2 O00459.1 PIM1 P11309.1
    PIM2 Q9P1W9.1 PIM3 Q86V86.1 PIR O00625.1 PIWIL1 Q96J94.1*
    PIWIL2 Q8TC59.1* PIWIL3 Q7Z3Z3.1 PIWIL4 Q7Z3Z4.1 PKN3 Q6P5Z2.1
    PLA2G16 P53816.1 PLAC1 Q9HBJ0.1* PLAG1 Q6DJT9.1 PLEKHG5 O94827.1
    PLK3 Q9H4B4.1 PLS3 P13797.1 PLVAP Q9BX97.1 PLXNB1 O43157.1
    PLXNB2 O15031.1 PML P29590.1 PML-RARA Q96QH2.1 POTEA Q6S8J7.1*
    POTEB Q6S5H4.1* POTEC B2RU33.1* POTED Q86YR6.1* POTEE Q6S8J3.1*
    POTEG Q6S5H5.1* POTEH Q6S545.1* PP2A P63151.1 PPAPDC1B Q8NEB5.1
    PPFIA1 Q13136.1 PPIG Q13427.1 PPP2R1B P30154.1 PRAME P78395.1*
    PRDX5 P30044.1 PRKAA1 Q13131.1 PRKCI P41743.1 PRM1 P04553.1*
    PRM2 P04554.1* PRMT3 O60678.1 PRMT6 Q96LA8.1 PDL1 Q9NZQ7.1
    PROM1 O43490.1 PRSS54 Q6PEW0.1* PRSS55 Q6UWB4.1* PRTN3 P24158.1
    PRUNE Q86TP1.1 PRUNE2 Q8WUY3.1 PSA P07288.1 PSCA D3DWI6.1
    PSMA Q04609.1 PSMD10 O75832.1 PSGR Q9H255.1 PSP-94 Q1L6U9.1
    PTEN P60484.1 PTH-rP P12272.1 PTK6 Q13882.1 PTPN20A Q4JDL3.1*
    PTPRK Q15262.1 PTPRZ P23471.1 PTTG-1 O95997.1 PTTG2 Q9NZH5.1
    PTTG3 Q9NZH4.1 PXDNL A1KZ92.1 RAB11FIP3 O75154.1 RAB8A P61006.1
    RAD1 O60671.1 RAD17 O75943.1 RAD51C O43502.1 RAF1 P04049.1
    RAGE-1 Q9UQ07.1 RAP1A P62834.1 RARA P10276.1 RASSF10 A6NK89.1
    RB1 P06400.1 RBL2 Q08999.1 RBM46 Q8TBY0.1* RBP4 P02753.1
    RCAS1 O00559.1 RCVRN P35243.1 RECQL4 O94761.1 RET P07949.1
    RGS22 Q8NE09.1* RGS5 O15539.1 RHAMM O75330.1 RhoC P08134.1
    RHOXF2 Q9BQY4.1 RL31 P62888.1 RNASET2 O00584.1 RNF43 Q68DV7.1
    RNF8 O76064.1 RON Q04912.1 ROPN1A Q9HAT0.1* ROR1 Q01973.1
    RPA1 O95602.1 RPL10A P62906.1 RPL7A P62424.1 RPS2 P15880.1
    RPS6KA5 O75582.1 RPSA P08865.1 RQCD1 Q92600.1* RRAS2 P62070.1
    RSL1D1 O76021.1 RTKN Q9BST9.1 RUNX1 Q01196.1 RUNX2 Q13950.1
    RYK P34925.1 SAGE1 Q9NXZ1.1* SART2 Q9UL01.1 SART3 Q15020.1
    SASH1 O94885.1 sCLU P10909.1 SCRN1 Q12765.1 SDCBP O00560.1
    SDF-1 P48061.1 SDHD O14521.1 SEC31A O94979.1 SEC63 Q9UGP8.1
    Semaphorin 4D Q92854.1 SEMG1 P04279.1* SFN P31947.1 SH2B2 O14492.1
    SH2D1B O14796.1 SH3BP1 Q9Y3L3.1 SHB Q15464.1 SHC3 Q92529.1
    SIRT2 Q8IXJ6.1 SIVA1 O15304.1 SKI P12755.1 SLBP A9UHW6.1
    SLC22A10 Q63ZE4.1 SLC25A47 Q6Q0C1.1 SLC35A4 Q96G79.1 SLC45A3 Q96JT2.1
    SLC4A1AP Q9BWU0.1 SLCO6A1 Q86UG4.1* SLITRK6 Q9H5Y7.1 Sm23 P27701.1
    SMAD5 Q99717.1 SMAD6 O43541.1 SMO Q99835.1 Smt3B P61956.1
    SNRPD1 P62314.1 SOS1 Q07889.1 SOX-2 P48431.1 SOX-6 P35712.1
    SOX-11 P35716.1 SPA17 Q15506.1* SPACA3 Q8IXA5.1* SPAG1 Q07617.1*
    SPAG17 Q6Q759.1* SPAG4 Q9NPE6.1* SPAG6 O75602.1* SPAG8 Q99932.1*
    SPAG9 O60271.1* SPANXA1 Q9NS26.1* SPANXB Q9N525.1* SPANXC Q9NY87.1*
    SPANXD Q9BXN6.1* SPANXE Q8TAD1.1* SPANXN1 Q5VSR9.1* SPANXN2 Q5MJ10.1*
    SPANXN3 Q5MJ09.1* SPANXN4 Q5MJ08.1* SPANXN5 Q5MJ07.1* SPATA19 Q7Z5L4.1*
    SPEF2 Q9C093.1* SPI1 P17947.1 SPINLW1 O95925.1* SPO11 Q9Y5K1.1*
    SRC P12931.1 SSPN Q14714.1 SSX-1 Q16384.1* SSX-2 Q16385.1*
    SSX-3 Q99909.1* SSX-4 O60224.1* SSX-5 O60225.1* SSX-6 Q7RTT6.1*
    SSX-7 Q7RTT5.1* SSX-9 Q7RTT3.1* ST18 O60284.1 STAT1 P42224.1
    STEAP1 Q9UHE8.1 STK11 Q15831.1 STK25 O00506.1 STK3 Q13188.1
    STN Q9H668.1 SUPT7L O94864.1 Survivin O15392.1 SUV39H1 O43463.1
    SYCE1 Q8N0S2.1 SYCP1 Q15431.1 SYCP3 Q8IZU3.1 SYT Q15532.1
    TA-4 Q96RI8.1 TACC1 O75410.1 TAF1B Q53T94.1 TAF4 O00268.1
    TAF7L Q5H9L4.1* TAG-1 Q02246.1* TALI P17542.1 TAL2 Q16559.1
    TAPBP O15533.1 TATI P00995.1 TAX1BP3 O14907.1 TBC1D3 Q8IZP1.1
    TBP-1 P17980.1 TCL1A P56279.1 TCL1B O95988.1 TDHP Q9BT92.1
    TDRD1 Q9BXT4.1* TDRD4 Q9BXT8.1* TDRD6 O60522.1* TEXT5 Q96M29.1*
    TEX101 Q9BY14.1* TEX14 Q8IWB6.1* TEX15 Q9BXT5.1* TEX38 Q6PEX7.1*
    TF P02787.1 TFDP3 Q5H910.1* TFE3 P19532.1 TGFBR1 P36897.1
    TGFBR2 P37173.1 THEG Q9P2T0.1* TIE2 Q02763.1 TIPRL O75663.1
    TLR2 O60603.1 TMEFF1 Q8IYR6.1* TMEFF2 Q9UIK5.1* TMEM108 Q6UXF1.1*
    TMEM127 O75204.1 TMPRSS12 Q86W55.1* TNC P24821.1 TNFRSF17 Q02223.1
    TNFSF15 O95150.1 TNK2 Q07912.1 TOMM34 Q15785.1 TOP2A P11388.1
    TOP2B Q02880.1 TOR3A Q9H497.1 TP73 O15350.1 TPA1 8N543.1
    TPGS2 Q68CL5.1 TPI1 P60174.1 TPL2 P41279.1 TPM4 P67936.1
    TPO P40225.1 TPPP2 P59282.1* TPR P12270.1 TPTE P56180.1*
    TRAF5 O00463.1 TRAG-3 Q9Y5P2.1* TRGC2 P03986.1 TRIM24 O15164.1
    TRIM37 O94972.1 TRIM68 Q6AZZ1.1 TRPM8 Q7Z2W7.1 TSGA10 Q9BZW7.1*
    TSP50 Q9UI38.1* TSPAN6 O43657.1 TSPY1 Q01534.1* TSPY2 A6NKD2.1*
    TSPY3 Q6B019.1* TSPYL1 Q9H0U9.1 TSSK6 Q9BXA6.1* TTC23 Q5W5X9.1
    TTK P33981.1* TULP2 O00295.1* TUSC2 O75896.1 TWEAK O43508.1
    TXNIP Q9H3M7.1 TYMS P04818.1 TYR P14679.1 U2 snRNP B P08579.1
    U2AF1 Q01081.1 UBD O15205.1 UBE2A P49459.1 UBE2C O00762.1
    UBE2V1 Q13404.1 UBE4B O95155.1 UBR5 O95071.1 UBXD5 Q5T124.1
    UFL1 O94874.1 URI1 O94763.1 URLC10 Q17RY6.1 UR0C1 Q96N76.1
    USP2 O75604.1 USP4 Q13107.1 VAV1 P15498.1 VCX3A Q9NNX9.1
    VEGFR1 P17948.1 VEGFR2 P35968.1 VHL P40337.1 VIM P08670.1
    VWA5A O00534.1 WHSC2 Q9H3P2.1 WISP1 O95388.1 WNK2 Q9Y351.1
    WNT10B O00744.1 WNT3 P56703.1 WNT-5a P41221.1 WT1 P19544.1
    WWP1 Q9H0M0.1 XAGE-1 Q9HD64.1* XAGE-2 Q96GT9.1* XAGE-3 Q8WTP9.1*
    XAGE-4 Q8WWM0.1 XAGE-5 Q8WWM1.1* XBP1 P17861.1 XPO1 O14980.1
    XRCC3 O43542.1 YB-1 P67809.1 YEATS4 O95619.1 YES1 P07947.1
    YKL-40 P36222.1 ZBTB7A O95365.1 ZBTB7C A1YPR0.1 ZEB1 P37275.1
    ZFYVE19 Q96K21.1 ZNF165 P49910.1* ZNF185 O15231.1 ZNF217 O75362.1
    ZNF320 A2RRD8.1 ZNF395 Q9H8N7.1 ZNF645 Q8N7E2.1* ZUBR1 Q5T4S7.1
    ZW10 O43264.1 ZWINT O95229.1
  • TABLE 2
    LIST OF NAMED TUMOUR ANTIGENS WITH CORRESPONDING
    ACCESSION NUMBERS CTAs = bold and *
    5T4 Q13641.1 A1BG P04217.1 A33 Q99795.1
    A4GALT Q9NPC4.1 AACT P01011.1 AAG Q9M6E9.1 ABI1 Q8IZP0.1
    ABI2 Q9NYB9.1 ABL1 P00519.1 ABL-BCR Q8WUG5.1 ABLIM3 O94929.1
    ABLL P42684.1 ABTB1 Q969K4.1 ACACA Q13085.1 ACBD4 Q8NC06.1
    ACO1 P21399.1 ACRBP Q8NEB7.1 ACTL6A O96019.1 ACTL8 Q9H568.1
    ACTN4 O43707.1 ACVR1 Q04771.1 ACVR1B P36896.1 ACVR2B Q13705.1
    ACVRL1 P37023.1 ACS2B Q68CK6.1 ACSL5 Q9ULC5.1 ADAM-15 Q13444.1
    ADAM17 P78536.1 ADAM2 Q99965.1 ADAM29 Q9UKF5.1 ADAM7 Q9H2U9.1
    ADAP1 O75689.1 ADFP Q99541.1 ADGRA3 Q8IWK6.1 ADGRF1 Q5T601.1
    ADGRF2 Q8IZF7.1 ADGRL2 O95490.1 ADHFE1 Q8IWW8.1 AEN Q8WTP8.1
    AFF1 P51825.1 AFF4 Q9UHB7.1 AFP P02771.1 AGAP2 Q99490.1
    AGO1 Q9UL18.1 AGO3 Q9H9G7.1 AGO4 Q9HCK5.1 AGR2 O95994.1
    AIFM2 Q9BRQ8.1 AIM2 O14862.1 AKAP-13 Q12802.1 AKAP-3 O75969.1
    AKAP-4 Q5JQC9.1 AKIP1 Q9NQ31.1 AKT1 P31749.1 AKT2 P31751.1
    AKT3 Q9Y243.1 ALDH1A1 P00352.1 ALK Q9UM73.1 ALKBH1 Q13686.1
    ALPK1 Q96QP1.1 AMIGO2 Q86SJ2.1 ANG2 O15123.1 ANKRD45 Q5TZF3.1
    ANO1 Q5XXA6.1 ANP32A P39687.1 ANXA2 P07355.1 APC P25054.1
    APEH P13798.1 APOA2 P02652.1 APOD P05090.1 APOL1 O14791.1
    AR P10275.1 ARAF P10398.1 ARF4L P49703.1 ARHGEF5 Q12774.1
    ARID3A Q99856.1 ARID4A P29374.1 ARL6IP5 O75915.1 ARMC3 B4DXS3.1
    ARMC8 Q8IUR7.1 ARTC1 P52961.1 ARX Q96QS3.1 ATAD2 Q6PL18.1
    ATIC P31939.1 AURKC Q9UQB9.1 AXIN1 O15169.1 AXL P30530.1
    BAAT Q14032.1 BAFF Q9Y275.1 BAGE-1 Q13072.1 BAGE-2 Q86Y30.1
    BAGE-3 Q86Y29.1 BAGE-4 Q86Y28.1 BAGE-5 Q86Y27.1 BAI1 O14514.1
    BAL P19835.1 BALF2 P03227.1 BALF4 P03188.1 BALF5 P03198.1
    BARF1 P03228.1 BBRF1 P03213.1 BCAN Q96GW7.1 BCAP31 P51572.1
    BCL-2 P10415.1 BCL2L1 Q07817.1 BCL6 P41182.1 BCL9 O00512.1
    BCR P11274.1 BCRF1 P03180.1 BDLF3 P03224.1 BGLF4 P13288.1
    BHLF1 P03181.1 BHRF1 P03182.1 BILF1 P03208.1 BILF2 P03218.1
    BIN1 O00499.1 BING-4 O15213.1 BIRC7 Q96CA5.1 BLLF1 P03200.1
    BLLF2 P03199.1 BMI1 P35226.1 BMLF1 Q04360.1 BMPR1B O00238.1
    BMRF1 P03191.1 BNLF2a P00739.1 BNLF2b Q8AZJ3.1 BNRF1 P03179.1
    BRAF1 P15056.1 BRD4 O60885.1 BRDT Q58F21.1 BRI3BP Q8WY22.1
    BRINP1 O60477.1 BRLF1 P03209.1 BTBD2 Q9BX70.1 BUB1B O60566.1
    BVRF2 P03234.1 BXLF1 P03177.1 BZLF1 P03206.1 C15orf60 Q7Z4M0.1
    CA 12-5 Q8WXI7.1 CA 19-9 Q969X2.1 CA195 Q5TG92.1 CA9 Q16790.1
    CABYR O75952.1 CADM4 Q8NFZ8.1 CAGE1 Q8CT20.1 CALCA P01258.1
    CALR3 Q96L12.1 CAN P35658.1 CASC3 O15234.1 CASC5 Q8NG31.1
    CASP5 P51878.1 CASP8 Q14790.1 CBFA2T2 O43439.1 CBFA2T3 O75081.1
    CBL P22681.1 CBLB Q13191.1 CC3 Q9BUP3.1 CCDC110 Q8TBZ0.1
    CCDC33 Q8N5R6.1 CCDC36 Q8IYA8.1 CCDC6 Q16204.1 CCDC62 Q6P9F0.1
    CCDC68 Q9H2F9.1 CCDC83 Q8IWF9.1 CCL13 Q99616.1 CCL2 P13500.1
    CCL7 P80098.1 CCNA1 P78396.1 CCNA2 P20248.1 CCNB1 P14635.1
    CCND1 P24385.1 CCNE2 O96020.1 CCNI Q14094.1 CCNL1 Q9UK58.1
    CCR2 P41597.1 CD105 P17813.1 CD123 P26951.1 CD13 P15144.1
    CD133 O43490.1 CD137 Q07011.1 CD138 P18827.1 CD157 Q10588.1
    CD16A P08637.1 CD178 P48023.1 CD19 P15391.1 CD194 P51679.1
    CD2 P06729.1 CD20 P11836.1 CD21 P20023.1 CD22 P20273.1
    CD229 Q9HBG7.1 CD23 P06734.1 CD27 P26842.1 CD28 P10747.1
    CD30 P28908.1 CD317 Q10589.1 CD33 P20138.1 CD350 Q9ULW2.1
    CD36 P16671.1 CD37 P11049.1 CD4 P01730.1 CD40 P25942.1
    CD40L P29965.1 CD45 P08575.1 CD47 Q08722.1 CD51 P06756.1
    CD52 P31358.1 CD55 P08174.1 CD61 P05106.1 CD70 P32970.1
    CD74 P08922.1 CD75 P15907.1 CD79B P40259.1 CD80 P33681.1
    CD86 P42081.1 CD8a P01732.1 CD8b P10966.1 CD95 P25445.1
    CD98 P08195.1 CDC123 O75794.1 CDC2 P06493.1 CDC27 P30260.1
    CDC73 Q6P1J9.1 CDCA1 Q9BZD4.1 CDCP1 Q9H5V8.1 CDH3 P22223.1
    CDK2AP1 O14519.1 CDK4 P11802.1 CDK7 P50613.1 CDKN1A P38936.1
    CDKN2A P42771.1 CEA P06731.1 CEACAM1 Q86UE4.1 CENPK Q9BS16.1
    CEP162 Q5TB80.1 CEP290 O15078.1 CEP55 Q53EZ4.1 CFL1 P23528.1
    CH3L2 Q15782.1 CHEK1 O14757.1 CK2 P19784.1 CLCA2 Q9UQC9.1
    CLOCK O15516.1 CLPP Q16740.1 CMC4 P56277.1 CML66 Q96RS6.1
    CO-029 P19075.1 COTL1 Q14019.1 COX2 P35354.1 COX6B2 Q6YFQ2.1
    CPSF1 Q10570.1 CPXCR1 Q8N123.1 CREBL2 O60519.1 CREG1 O75629.1
    Cripto P13385.1 CRISP2 P16562.1 CRK P46108.1 CRKL P46109.1
    CRLF2 Q9HC73.1 CSAGE Q6PB30.1 CT45 Q5HYN5.1 CT45A2 Q5DJT8.1
    CT45A3 Q8NHU0.1 CT45A4 Q8N7B7.1 CT45A5 Q6NSH3.1 CT45A6 P0DMU7.1
    CT46 Q86X24.1 CT47 Q5JQC4.1 CT47B1 P0C2P7.1 CTAGE2 Q96RT6.1
    cTAGE5 O15320.1 CTCFL Q8NI51.1 CTDSP2 O14595.1 CTGF P29279.1
    CTLA4 P16410.1 CTNNA2 P26232.1 CTNNB1 P35222.1 CTNND1 O60716.1
    CTSH P09668.1 CTSP1 A0RZH4.1 CTTN Q14247.1 CXCR4 P61073.1
    CXorf48 Q8WUE5.1 CXorf61 Q5H943.1 Cyclin-E P24864.1 CYP1B1 Q16678.1
    CypB P23284.1 CYR61 O00622.1 CS1 P28290.1 CSAG1 Q6PB30.1
    CSDE1 O75534.1 CSF1 P09603.1 CSF1R P07333.1 CSF3R Q99062.1
    CSK P41240.1 CSK23 Q8NEV1.1 DAPK3 O43293.1 DAZ1 Q9NQZ3.1
    DBPC Q9Y2T7.1 DCAF12 Q5T6F0.1 DCT P40126.1 DCUN1D1 Q96GG9.1
    DCUN1D3 Q8IWE4.1 DDR1 Q08345.1 DDX3X O00571.1 DDX6 P26196.1
    DEDD O75618.1 DEK P35659.1 DENR O43583.1 DEPDC1 Q5TB30.1
    DFNA5 O60443.1 DGAT2 Q96PD7.1 DHFR P00374.1 DKK1 O94907.1
    DKK3 Q9UBP4.1 DKKL1 Q9UK85.1 DLEU1 O43261.1 DMBT1 Q9UGM3.1
    DMRT1 Q9Y5R6.1 DNAJB8 Q8NHS0.1 DNAJC8 O75937.1 DNMT3A Q9Y6K1.1
    DPPA2 Q7Z7J5.1 DR4 O00220.1 DR5 O14763.1 DRG1 Q9Y295.1
    DSCR8 Q96T75.1 E2F3 O00716.1 E2F6 O75461.1 E2F8 A0AVK6.1
    EBNA1 P03211.1 EBNA2 P12978.1 EBNA3 P12977.1 EBNA4 P03203.1
    EBNA6 P03204.1 EBNA-LP Q8AZK7.1 E-cadherin P12830.1 ECT2 Q9H8V3.1
    ECTL2 Q00858.1 EDAG Q9BXL5.1 EEF2 P13639.1 EFNA1 P20827.1
    EFS O43281.1 EFTUD2 Q15029.1 EGFL7 Q9UHF1.1 EGFR p00533.1
    EI24 O14681.1 EIF4EBP1 Q13541.1 ELF3 P78545.1 ELF4 Q99607.1
    ELOVL4 Q9GZR5.1 EMP1 P54849.1 ENAH Q8N8S7.1 Endosialin Q9HCU0.1
    ENO1 P06733.1 ENO2 P09104.1 ENO3 P13929.1 ENTPD5 O75356.1
    EpCAM P16422.1 EPHA2 P29317.1 EPHA3 P29320.1 EPHB2 P29323.1
    EPHB4 P54760.1 EPHB6 O15197.1 EPS8 Q12929.1 ERBB3 P21860.1
    ERBB4 Q15303.1 EREG O14944.1 ERG P11308.1 ERVK-18 O42043.1
    ERVK-19 O71037.1 ESR1 P03372.1 ETAA1 Q9NY74.1 ETS1 P14921.1
    ETS2 P15036.1 ETV1 P50549.1 ETV5 P41161.1 ETV6 P41212.1
    EVI5 O60447.1 EWSR1 Q01844.1 EYA2 O00167.1 EZH2 Q15910.1
    FABP7 O15540.1 FAM133A Q8N9E0.1 FAM13A O94988.1 FAM46D Q8NEK8.1
    FAM58BP P0C7Q3.1 FANCG O15287.1 FATE1 Q969F0.1 FBXO39 Q8N4B4.1
    FBXW11 Q9UKB1.1 FCHSD2 O94868.1 FER P16591.1 FES P07332.1
    FEV Q99581.1 FGF10 O15520.1 FGF23 Q9GZV9.1 FGF3 P11487.1
    FGF4 P08620.1 FGF5 P12034.1 FGFR1 P11362.1 FGFR2 P21802.1
    FGFR3 P22607.1 FGFR4 P22455.1 FGR P09769.1 FLI1 Q01543.1
    FLT3 P36888.1 FMNL1 O95466.1 FMOD Q06828.1 FMR1NB Q8N0W7.1
    FN1 P02751.1 Fn14 Q9NP84.1 FNIP2 Q9P278.1 FOLR1 P15328.1
    FOS P01100.1 FosB P53539.1 FOSL1 P15407.1 FOXM1 Q08050.1
    FOXO1 Q12778.1 FOXO3 O43524.1 FRAT1 Q92837.1 FRMD3 A2A2Y4.1
    FSIP1 Q8NA03.1 FSIP2 Q5CZC0.1 FSTL3 O95633.1 FTHL17 Q9BXU8.1
    FUNDC2 Q9BWH2.1 FUS P35637.1 FUT1 P19526.1 FUT3 P21217.1
    FYN P06241.1 GAB2 Q9UQC2.1 GADD45G O95257.1 GAGE-1 Q13065.1
    GAGE12B/C/D/E A1L429.1 GAGE12F P0CL80.1 GAGE12G P0CL81.1 GAGE12H A6NDE8.1
    GAGE12I P0CL82.1 GAGE12J A6NER3.1 GAGE-2 Q6NT46.1 GAGE-3 Q13067.1
    GAGE-4 Q13068.1 GAGE-5 Q13069.1 GAGE-6 Q13070.1 GAGE-7 O76087.1
    GAGE-8 Q9UEU5.1 GALGT2 Q00973.1 GAS7 O60861.1 GASZ Q8WWH4.1
    GATA-3 P23771.1 GBU4-5 Q587J7.1 GCDFP-15 P12273.1 GFAP P14136.1
    GFI1 Q99684.1 Ghrelin Q9UBU3.1 GHSR Q92847.1 GIPC1 O14908.1
    GITR Q9Y5U5.1 GKAP1 Q5VSY0.1 GLI1 P08151.1 Glypican-3 P51654.1
    GML Q99445.1 GNA11 P29992.1 GNAQ P50148.1 GNB2L1 P63244.1
    GOLGA5 Q8TBA6.1 gp100 P40967.1 gp75 P17643.1 Gp96 P14625.1
    GPAT2 Q6NUI2.1 GPATCH2 Q9NW75.1 GPC-3 P51654.1 GPNMB Q14956.1
    GPR143 P51810.1 GPR89A B7ZAQ6.1 GRB2 P62993.1 GRP78 P11021.1
    GUCY1A3 Q02108.1 H3F3A P84243.1 HAGE Q9NXZ2.1 hANP P01160.1
    HBEGF Q99075.1 hCG-beta P01233.1 HDAC1 Q13547.1 HDAC2 Q92769.1
    HDAC3 O15379.1 HDAC4 P56524.1 HDAC5 Q9UQL6.1 HDAC6 Q9UBN7.1
    HDAC7 Q8WUI4.1 HDAC8 Q9BY41.1 HDAC9 Q9UKV0.1 HEATR1 Q9H583.1
    Hepsin P05981.1 Her2/neu P04626.1 HERC2 O95714.1 HERV-K104 P61576.1
    HEXB P07686.1 HEXIM1 O94992.1 HGRG8 Q9Y5A9.1 HIPK2 Q9H2X6.1
    HJURP Q8NCD3.1 HMGB1 P09429.1 HMOX1 P09601.1 HNRPL P14866.1
    HOM-TES-85 Q9P127.1 HORMAD1 Q86X24.1 HORMAD2 Q8N7B1.1 HPSE Q9Y251.1
    HPV16 E6 P03126.1 HPV16 E7 P03129.1 HPV18 E6 P06463.1 HPV18 E7 P06788.1
    HRAS P01112.1 HSD17B13 Q7Z5P4.1 HSP105 Q92598.1 HSP60 P10809.1
    HSPA1A P08107.1 HSPB9 Q9BQS6.1 HST-2 P10767.1 HT001 Q2TB18.1
    hTERT O14746.1 HUS1 O60921.1 ICAM-1 P05362.1 IDH1 O75874.1
    IDO1 P14902.1 IER3 P46695.1 IGF1R P08069.1 IGFS11 Q5DX21.1
    IL13RA2 Q14627.1 IMP-3 Q9NV31.1 ING3 Q9NXR8.1 INPPL1 O15357.1
    INTS6 Q9UL03.1 IRF4 Q15306.1 IRS4 O14654.1 ITGA5 P08648.1
    ITGB8 P26012.1 ITPA Q9BY32.1 ITPR2 Q14571.1 JAK2 O60674.1
    JAK3 P52333.1 JARID1B Q9UGL1.1 JAZF1 Q86VZ6.1 JNK1 P45983.1
    JNK2 P45984.1 JNK3 P53779.1 JTB O76095.1 JUN P05412.1
    JUP P14923.1 K19 P08727.1 KAAG1 Q9UBP8.1 Kallikrein 14 Q9P0G3.1
    Kallikrein 4 Q9Y5K2.1 KAT6A Q92794.1 KDM1A O60341.1 KDM5A P29375.1
    KIAA0100 Q14667.1 KIAA0336 Q8IWJ2.1 KIAA1199 Q8WUJ3.1 KIAA1641 A6QL64.1
    KIF11 P52732.1 KIF1B O60333.1 KIF20A O95235.1 KIT P10721.1
    KLF4 O43474.1 KLHL41 O60662.1 KLK10 O43240.1 KMT2D O14686.1
    KOC1 O00425.1 K-ras P01116.1 KRIT1 O00522.1 KW-12 P62913.1
    KW-2 Q96RS0.1 KW-5 (SEBD4) Q9H0Z9.1 KW-7 O75475.1 L1CAM P32004.1
    L53 Q96EL3.1 L6 Q9BTT4.1 LAG3 P18627.1 Lage-1 O75638.1
    LATS1 O95835.1 LATS2 Q9NRM7.1 LCMT2 O60294.1 LCP1 P13796.1
    LDHC P07864.1 LDLR P01130.1 LEMD1 Q68G75.1 Lengsin Q5TDP6.1
    LETMD1 Q6P1Q0.1 LGALS3BP Q08380.1 LGALS8 O00214.1 LIN7A O14910.1
    LIPI Q6XZE0.1 LIV-1 Q13433.1 LLGL1 Q15334.1 LMO1 P25800.1
    LMO2 P25791.1 LMP1 P03230.1 LMP2 P13285.1 L00647107 Q8TAI5.1
    LOXL2 Q9Y4K0.1 LRP1 Q07954.1 LRRN2 O75325.1 LTF P02788.1
    LTK P29376.1 LZTS1 Q9Y250.1 LY6K Q17RY6.1 LYN P07948.1
    LYPD6B Q8NI32.1 MAEA Q7L5Y9.1 MAEL Q96JY0.1 MAF O75444.1
    MAFF Q9ULX9.1 MAFG O15525.1 MAFK O60675.1 MAGE-A1 P43355.1
    MAGE-A10 P43363.1 MAGE-A11 P43364.1 MAGE-A12 P43365.1 MAGE-A2 P43356.1
    MAGE-A2B Q6P448.1 MAGE-A3 P43357.1 MACE-A4 P43358.1 MAGE-A5 P43359.1
    MAGE-A6 P43360.1 MAGE-A8 P43361.1 MAGE-A9 P43362.1 MAGE-B1 P43366.1
    MAGE-B2 O15479.1 MAGE-B3 O15480.1 MAGE-B4 O15481.1 MAGE-B5 Q9BZ81.1
    MAGE-E6 Q8N7X4.1 MAGE-C1 O60732.1 MAGE-C2 Q9UBF1.1 MAGE-C3 Q8TD91.1
    mammaglobin-A Q13296.1 MANF P55145.1 MAP2K2 P36507.1 MAP2K7 O14733.1
    MAP3K7 O43318.1 MAP4K5 Q9Y4K4.1 MART1 Q16655.1 MART-2 Q5VTY9.1
    MAS1 P04201.1 MC1R Q01726.1 MCAK Q99661.1 MCF2 P10911.1
    MCF2L O15068.1 MCL1 Q07820.1 MCTS1 Q9ULC4.1 MCSP Q6UVK1.1
    MDK P21741.1 MDM2 Q00987.1 MDM4 O15151.1 ME1 P48163.1
    ME491 P08962.1 MECOM Q03112.1 MELK Q14680.1 MEN1 O00255.1
    MERTK Q12866.1 MET P08581.1 MFGE8 Q08431.1 MFHAS1 Q9Y4C4.1
    MFI2 P08582.1 MGAT5 Q09328.1 Midkine P21741.1 MIF P14174.1
    MKI67 P46013.1 MLH1 P40692.1 MLL Q03164.1 MLLT1 Q03111.1
    MLLT10 P55197.1 MLLT11 Q13015.1 MLLT3 P42568.1 MLLT4 P55196.1
    MLLT6 P55198.1 MMP14 P50281.1 MMP2 P08253.1 MMP7 P09237.1
    MMP9 P14780.1 MOB3B Q86TA1.1 MORC1 Q86VD1.1 MPHOSPH1 Q96Q89.1
    MPL P40238.1 MRAS O14807.1 MRP1 P33527.1 MRP3 O15438.1
    MRPL28 Q13084.1 MRPL30 Q8TCC3.1 MRPS11 P82912.1 MSLN Q13421.1
    MTA1 Q13330.1 MTA2 O94776.1 MTA3 Q9BTC8.1 MTCP1 P56278.1
    MTSS1 O43312.1 MUC-1 P15941.1 MUC-2 Q02817.1 MUC-3 Q02505.1
    MUC-4 Q99102.1 MUC-5AC P98088.1 MUC-6 Q6W4X9.1 MUM1 Q2TAK8.1
    MUM2 Q9Y5R8.1 MYB P10242.1 MYC P01106.1 MYCL P12524.1
    MYCLP1 P12525.1 MYCN P04198.1 MYD88 Q99836.1 MYEOV Q96EZ4.1
    MYO1B O43795.1 NA88-A P005K6.1 NAE1 Q13564.1 Napsin-A O96009.1
    NAT6 Q93015.1 NBAS A2RRP1.1 NBPF12 Q5TAG4.1 NCOA4 Q13772.1
    NDC80 O14777.1 NDUFC2 O95298.1 Nectin-4 NEK2 P51955.1 Q96NY8.1
    NEMF O60524.1 NENF Q9UMX5.1 NEURL1 O76050.1 NFIB O00712.1
    NFKB2 Q00653.1 NF-X1 Q12986.1 NFYC Q13952.1 NGAL P80188.1
    NGEP Q6IWH7.1 NKG2D-L1 Q9BZM6.1 NKG2D-L2 Q9BZM5.1 NKG2D-L3 Q9BZM4.1
    NKG2D-L4 Q8TD07.1 NKX3.1 Q99801.1 NLGN4X Q8N0W4.1 NLRP4 Q96MN2.1
    NNMT P40261.1 NOL4 O94818.1 NOTCH2 Q04721.1 NOTCH3 Q9UM47.1
    NOTCH4 Q99466.1 NOV P48745.1 NPM1 P06748.1 NR6A1 Q15406.1
    N-RAS P01111.1 NRCAM Q92823.1 NRP1 O14786.1 NSE1 Q96KN4.1
    NSE2 Q96KN1.1 NTRK1 P04629.1 NUAK1 O60285.1 NUGGC Q68CJ6.1
    NXF2 Q9GZY0.1 NXF2B Q5JRM6.1 NY-BR-1 Q9BXX3.1 NYD-TSPG Q9BWV7.1
    NY-ESO-1 P78358.1 NY-MEL-1 P57729.1 OCA2 Q04671.1 ODF1 Q14990.1
    ODF2 Q5BJF6.1 ODF3 Q96PU9.1 ODF4 Q2M2E3.1 OGG1 O15527.1
    OCT O15294.1 OIP5 O43482.1 OS9 Q13438.1 OTOA Q05BM7.1
    OX40 P43489.1 OX40L P23510.1 P53 P04637.1 P56-LCK P06239.1
    PA2G4 Q9UQ80.1 PAGE1 O75459.1 PAGE2 Q7Z2X2.1 PAGE2B Q5JRK9.1
    PAGE3 Q5JUK9.1 PAGE4 O60829.1 PAGES Q96GU1.1 PAK2 Q13177.1
    PANO1 I0J062.1 PAP Q06141.1 PAPOLG Q9BWT3.1 PARK2 O60260.1
    PARK7 Q99497.1 PARP12 Q9H0J9.1 PASD1 Q8IV76.1 PAX3 P23760.1
    PAX5 Q02548.1 PBF P00751.1 PBK Q96KB5.1 PBX1 P40424.1
    PCDC1 Q15116.1 PCM1 Q15154.1 PCNXL2 A6NKB5.1 PDGFB P01127.1
    PDGFRA P16234.1 PEPP2 Q9HAU0.1 PGF P49763.1 PGK1 P00558.1
    PHLDA3 Q9Y5J5.1 PHLPP1 O60346.1 PIAS1 O75925.1 PIAS2 O75928.1
    PIK3CA P42336.1 PIK3CD O00329.1 PIK3R2 O00459.1 PIM1 P11309.1
    PIM2 Q9P1W9.1 PIM3 Q86V86.1 PIR O00625.1 PIWIL1 Q96J94.1
    PIWIL2 Q8TC59.1 PIWIL3 Q7Z3Z3.1 PIWIL4 Q7Z3Z4.1 PKN3 Q6P5Z2.1
    PLA2G16 P53816.1 PLAC1 Q9HBJ0.1 PLAG1 Q6DJT9.1 PLEKHG5 O94827.1
    PLK3 Q9H4B4.1 PLS3 P13797.1 PLVAP Q9BX97.1 PLXNB1 O43157.1
    PLXNB2 O15031.1 PML P29590.1 PML-RARA Q96QH2.1 POTEA Q6S8J7.1
    POTEB Q6S5H4.1 POTEC B2RU33.1 POTED Q86YR6.1 POTEE Q6S8J3.1
    POTEG Q6S5H5.1 POTEH Q6S545.1 PP2A P63151.1 PPAPDC1B Q8NEB5.1
    PPFIA1 Q13136.1 PPIG Q13427.1 PPP2R1B P30154.1 PRAME P78395.1
    PRDX5 P30044.1 PRKAA1 Q13131.1 PRKCI P41743.1 PRM1 P04553.1
    PRM2 P04554.1 PRMT3 O60678.1 PRMT6 Q96LA8.1 PDL1 Q9NZQ7.1
    PROM1 O43490.1 PRSS54 Q6PEW0.1 PRSS55 Q6UWB4.1 PRTN3 P24158.1
    PRUNE Q86TP1.1 PRUNE2 Q8WUY3.1 PSA P07288.1 PSCA D3DWI6.1
    PSMA Q04609.1 PSMD10 O75832.1 PSGR Q9H255.1 PSP-94 Q1L6U9.1
    PTEN P60484.1 PTH-rP P12272.1 PTK6 Q13882.1 PTPN20A Q4JDL3.1
    PTPRK Q15262.1 PTPRZ P23471.1 PTTG-1 O95997.1 PTTG2 Q9NZH5.1
    PTTG3 Q9NZH4.1 PXDNL A1KZ92.1 RAB11FIP3 O75154.1 RAB8A P61006.1
    RAD1 O60671.1 RAD17 O75943.1 RAD51C O43502.1 RAF1 P04049.1
    RAGE-1 Q9UQ07.1 RAP1A P62834.1 RARA P10276.1 RASSF10 A6NK89.1
    RB1 P06400.1 RBL2 Q08999.1 RBM46 Q8TBY0.1 RBP4 P02753.1
    RCAS1 O00559.1 RCVRN P35243.1 RECQL4 O94761.1 RET P07949.1
    RGS22 Q8NE09.1 RGS5 O15539.1 RHAMM O75330.1 RhoC P08134.1
    RHOXF2 Q9BQY4.1 RL31 P62888.1 RNASET2 O00584.1 RNF43 Q68DV7.1
    RNF8 O76064.1 RON Q04912.1 ROPN1A Q9HAT0.1 ROR1 Q01973.1
    RPA1 O95602.1 RPL10A P62906.1 RPL7A P62424.1 RPS2 P15880.1
    RPS6KA5 O75582.1 RPSA P08865.1 RQCD1 Q92600.1 RRAS2 P62070.1
    RSL1D1 O76021.1 RTKN Q9BST9.1 RUNX1 Q01196.1 RUNX2 Q13950.1
    RYK P34925.1 SAGE1 Q9NXZ1.1 SART2 Q9UL01.1 SART3 Q15020.1
    SASH1 O94885.1 sCLU P10909.1 SCRN1 Q12765.1 SDCBP O00560.1
    SDF-1 P48061.1 SDHD O14521.1 SEC31A O94979.1 SEC63 Q9UGP8.1
    Semaphorin 4D Q92854.1 SEMG1 P04279.1 SFN P31947.1 SH2B2 O14492.1
    SH2D1B O14796.1 SH3BP1 Q9Y3L3.1 SHE Q15464.1 SHC3 Q92529.1
    SIRT2 Q8IXJ6.1 SIVA1 O15304.1 SKI P12755.1 SLBP A9UHW6.1
    SLC22A10 Q63ZE4.1 SLC25A47 Q6Q0C1.1 SLC35A4 Q96G79.1 SLC45A3 Q96JT2.1
    SLC4A1AP Q9BWU0.1 SLCO6A1 Q86UG4.1 SLITRK6 Q9H5Y7.1 Sm23 P27701.1
    SMAD5 Q99717.1 SMAD6 O43541.1 SMO Q99835.1 Smt3B P61956.1
    SNRPD1 P62314.1 SOS1 Q07889.1 SOX-2 P48431.1 SOX-6 P35712.1
    SOX-11 P35716.1 SPA17 Q15506.1 SPACA3 Q8IXA5.1 SPAG1 Q07617.1
    SPAG17 Q6Q759.1 SPAG4 Q9NPE6.1 SPAG6 O75602.1 SPAG8 Q99932.1
    SPAG9 O60271.1 SPANXA1 Q9N526.1 SPANXB Q9N525.1 SPANXC Q9NY87.1
    SPANXD Q9BXN6.1 SPANXE Q8TAD1.1 SPANXN1 Q5VSR9.1 SPANXN2 Q5MJ10.1
    SPANXN3 Q5MJ09.1 SPANXN4 Q5MJ08.1 SPANXN5 Q5MJ07.1 SPATA19 Q7Z5L4.1
    SPEF2 Q9C093.1 SPI1 P17947.1 SPINLW1 O95925.1 SPO11 Q9Y5K1.1
    SRC P12931.1 SSPN Q14714.1 SSX-1 Q16384.1 SSX-2 Q16385.1
    SSX-3 Q99909.1 SSX-4 O60224.1 SSX-5 O60225.1 SSX-6 Q7RTT6.1
    SSX-7 Q7RTT5.1 SSX-9 Q7RTT3.1 ST18 O60284.1 STAT1 P42224.1
    STEAP1 Q9UHE8.1 STK11 Q15831.1 STK25 O00506.1 STK3 Q13188.1
    STN Q9H668.1 SUPT7L O94864.1 Survivin O15392.1 SUV39H1 O43463.1
    SYCE1 Q8N052.1 SYCP1 Q15431.1 SYCP3 Q8IZU3.1 SYT Q15532.1
    TA-4 Q96RI8.1 TACC1 O75410.1 TAF1B Q53T94.1 TAF4 O00268.1
    TAF7L Q5H9L4.1 TAG-1 Q02246.1 TAL1 P17542.1 TAL2 Q16559.1
    TAPBP O15533.1 TATI P00995.1 TAX1BP3 O14907.1 TBC1D3 Q8IZP1.1
    TBP-1 P17980.1 TCL1A P56279.1 TCL1B O95988.1 TDHP Q9BT92.1
    TDRD1 Q9BXT4.1 TDRD4 Q9BXT8.1 TDRD6 O60522.1 TEKT5 Q96M29.1
    TEX101 Q9BY14.1 TEX14 Q8IWB6.1 TEX15 Q9BXT5.1 TEX38 Q6PEX7.1
    TF P02787.1 TFDP3 Q5H9I0.1 TFE3 P19532.1 TGFBR1 P36897.1
    TGFBR2 P37173.1 THEG Q9P2T0.1 TIE2 Q02763.1 TIPRL O75663.1
    TLR2 O60603.1 TMEFF1 Q8IYR6.1 TMEFF2 Q9UIK5.1 TMEM108 Q6UXF1.1
    TMEM127 O75204.1 TMPRSS12 Q86W55.1 TNC P24821.1 TNFRSF17 Q02223.1
    TNFSF15 O95150.1 TNK2 Q07912.1 TOMM34 Q15785.1 TOP2A P11388.1
    TOP2B Q02880.1 TOR3A Q9H497.1 TP73 O15350.1 TPA1 8N543.1
    TPGS2 Q68CL5.1 TPI1 P60174.1 TPL2 P41279.1 TPM4 P67936.1
    TPO P40225.1 TPPP2 P59282.1 TPR P12270.1 TPTE P56180.1
    TRAF5 O00463.1 TRAG-3 Q9Y5P2.1 TRGC2 P03986.1 TRIM24 O15164.1
    TRIM37 O94972.1 TRIM68 Q6AZZ1.1 TRPM8 Q7Z2W7.1 TSGA10 Q9BZW7.1
    TSP50 Q9UI38.1 TSPAN6 O43657.1 TSPY1 Q01534.1 TSPY2 A6NKD2.1
    TSPY3 Q6B019.1 TSPYL1 Q9H0U9.1 TSSK6 Q9BXA6.1 TTC23 Q5W5X9.1
    TTK P33981.1 TULP2 O00295.1 TUSC2 O75896.1 TWEAK O43508.1
    TXNIP Q9H3M7.1 TYMS P04818.1 TYR P14679.1 U2 snRNP B P08579.1
    U2AF1 Q01081.1 UBD O15205.1 UBE2A P49459.1 UBE2C O00762.1
    UBE2V1 Q13404.1 UBE4B O95155.1 UBR5 O95071.1 UBXD5 Q5T124.1
    UFL1 O94874.1 URI1 O94763.1 URLC10 Q17RY6.1 UROC1 Q96N76.1
    USP2 O75604.1 USP4 Q13107.1 VAV1 P15498.1 VCX3A Q9NNX9.1
    VEGFR1 P17948.1 VEGFR2 P35968.1 VHL P40337.1 VIM P08670.1
    VWA5A O00534.1 WHSC2 Q9H3P2.1 WISP1 O95388.1 WNK2 Q9Y351.1
    WNT10B O00744.1 WNT3 P56703.1 WNT-5a P41221.1 WT1 P19544.1
    WWP1 Q9HOM0.1 XAGE-1 Q9HD64.1 XAGE-2 Q96GT9.1 XAGE-3 Q8WTP9.1
    XAGE-4 Q8WWM0.1 XAGE-5 Q8WWM1.1 XBP1 P17861.1 XPO1 O14980.1
    XRCC3 O43542.1 YB-1 P67809.1 YEATS4 O95619.1 YES1 P07947.1
    YKL-40 P36222.1 ZBTB7A O95365.1 ZBTB7C A1YPR0.1 ZEB1 P37275.1
    ZFYVE19 Q96K21.1 ZNF165 P49910.1 ZNF185 O15231.1 ZNF217 O75362.1
    ZNF320 A2RRD8.1 ZNF395 Q9H8N7.1 ZNF645 Q8N7E2.1 ZUBR1 Q5T4S7.1
    ZW10 O43264.1 ZWINT O95229.1
  • TABLE 3
    LIST OF ACCESSION NUMBERS FOR VIRAL ANTIGENS FROM IEDB
    Q76R62.1 P03182.1 P09258.1 P09310.1 P03227.1 P89466.1 P04601.1
    P13285.1 P09991.1 P03468.1 A2T3Q0.1 P0C6X7.1 P89448.1 P12978.1 P09257.1
    P50641.1 P14075.1 20178567.1 Q01023.1 P03188.1 P04585.1 P00767.1 P12977.1
    P89467.1 Q9W850.1 Q00683.1 P04591.1 P03211.1 9628706.1 P03460.1 P08666.1
    P03485.1 Q04360.1 Q913Y7.1 P89449.1 Q81871.1 P03452.1 P17763.1 P89430.1
    P03410.1 P04012.1 P27958.1 Q6WB99.1 P25212.1 Q9PZT1.1 P68593.1 P03203.1
    P29996.1 9629374.1 P59633.1 O42053.1 P0C6L3.1 P59635.1 Q9YZN9.1 Q6WB95.1
    P10233.1 P89475.1 Q6WB98.1 Q6SW67.1 Q7TFA0.1 P0CK17.1 P59594.1 1980491.1
    P14079.1 P15423.1 1891762.1 P09259.1 P09269.1 Q77Q38.1 Q786F2.1 Q6SW99.1
    P24771.1 F5HB98.1 9629370.1 P68336.1 P03300.1 1980486.1 Q69027.1 P28284.1
    P13290.1 9626585.1 P06923.1 P14076.1 P03346.1 O42062.1 P07566.1 P03204.1
    Q69091.1 P09255.1 P03206.1 O36634.1 P10205.1 F5HCM1.1 P0CK16.1 Q6WB97.1
    Q85601.1 P89468.1 Q69467.1 P03218.1 Q786F3.1 P59637.1 1891763.1 Q6WB94.1
    P03231.1 Q91K92.1 Q6WBA1.1 P03466.1 P14335.1 P26670.1 Q9PZT0.1 1985356.1
    Q2HR63.1 P59634.1 Q6SW59.1 P03277.1 P59595.1 Q69028.1 P03383.1 P03261.1
    P03200.1 P04578.1 P06484.1 F5HC97.1 S5TC82.1 P18095.1 Q96895.1 P18094.1
    9629372.1 P50791.1 P03230.1 P13845.1 9629712.1 P03209.1 P03129.1 Q76R61.1
    P03228.1 P0C206.1 Q9WMB5.1 P03226.1 Q9QR69.1 O36633.1 O42049.1 P03496.1
    P03428.1 P03431.1 P0C0U1.1 P03433.1 P03508.1 1980456.1 P00739.1 P69726.1
    P69723.1 1980490.1 532129755.1 P03120.1 P04020.1 P06922.1 P03114.1 P03314.1
    P06790.1 P06788.1 P06927.1 P03101.1 P03107.1 P06794.1 530787712.1 P04013.1
    Q80872.1 P04014.1 P03126.1 P36811.1 P06463.1 P26554.1 P04016.1 P14078.1
    P03191.1 1980471.1 P06821.1 P00797.1 F5HF49.1 P00045.1 P04296.1 P04485.1
    P10230.1 P10221.1 P06487.1 P10215.1 P04293.1 P10211.1 P10209.1 P10225.1
    P10224.1 P10238.1 P10185.1 P08392.1 P10231.1 P06492.1 P04290.1 P08393.1
    P08543.1 P10210.1 P08617.1 F5HB53.1 P04019.1 P04015.1 P89442.1 P89452.1
    P89462.1 P59632.1 O36635.1 P07210.1 Q83884.1 Q8JUX5.1 P03089.1 Q66479.1
    P03185.1 P0CAP6.1 P04618.1 56160929.1 1980519.1 P08669.1 P14348.1 P03212.1
    P03179.1 45617- 1511872.1 302317869.1 P69899.1 P09247.1 Q05127.1 P18272.1
    other.1
    Q9YMG2.1 Q05128.1 302371215.1 302371218.1 Q5XX08.1 302371214.1 P14336.1 138948-
    other.1
    P08292.1 1803956.1 P35253.1 1891726.1 P09308.1 P03189.1 667489389.1 P09272.1
    34365530.1 Q05320.1 P59596.1 P32886.1 55097.1 P03316.1 P03276.1 Q81870.1
    Q81862.1 64320.1 1933190.1
  • TABLE 4
    LIST OF ACCESSION NUMBERS FOR BACTERIAL ANTIGENS FROM IEDB
    B8ZUD1.1 P09621.1 P9WPE5.1 Q2GI62.1 P0A5B8.1 O50443.1 Q5NEZ3.1
    P9WQF5.1 P9WK95.1 O05311.1 P9WQD7.1 P9WKG3.1 P9WHE5.1 P0CD83.1 P9WHB9.1
    P9WH91.1 P9WHE3.1 P9WNK7.1 A0A0F3MKF3.1 A1JIP3.1 B2RKS6.1 P0A1D3.1 P0A6F5.1
    P0C0Z7.1 P0C923.1 P61439.1 Q9Z708.1 P0A521.1 P9WPE7.1 Q79FJ2.1 B8ZR84.1
    I6Y3P5.1 Q2FYP2.1 P9WG41.1 P96890.1 O06625.1 I6X654.1 Q8YIE1.1 P9WQ81.1
    I6XWA1.1 P11311.1 O53900.1 P9WIR7.1 P9WQB1.1 B8ZUC6.1 O06802.1 P9WMK1.1
    P9WG37.1 Q2FWC4.1 Q2GGE3.1 O33347.1 P9WJ09.1 P9WJ11.1 P9WF23.1 O69703.1
    I6X4K0.1 B2RM93.1 P71888.1 P9WFW3.1 P9WPV1.1 P9WPU7.1 P9WPV3.1 P9WPU5.1
    O50391.1 P9W1D7.1 P9WPC3.1 P96901.1 O84848.1 Q2FUX4.1 A0A0M1YNY3.1 P49944.1
    P9WPQ9.1 Q45010.1 Q2FZK7.1 P9WMN3.1 P9WPQ1.1 Q45013.1 O53666.1 Q5NEH1.1
    P9WHR5.1 P9WIE5.1 Q5NEQ3.1 P9WNF3.1 F2QBN0.1 B8ZTB7.1 P0C922.1 P9WMJ9.1
    Q5NGW2.1 P01556.1 Q8DMZ4.1 P33768.1 Q2FUY2.1 Q5NG56.1 X8CE55.1 Q5NGE4.1
    P94973.1 O06827.1 P96872.1 I6X9Y7.1 I6XFZ8.1 O50442.1 O53697.1 O53978.1
    P95137.1 P95144.1 O53519.1 Q79FZ8.1 P9WJF5.1 P71629.1 P9WJS3.1 P9WPB7.1
    Q7D9T1.1 P9WHS1.1 O06393.1 P9WP69.1 P9WPN5.1 P9WNX3.1 O53380.1 I6YAU3.1
    P0A4V2.1 P9WQP3.1 P0C2T2.1 P9WQP1.1 P9WQN9.1 O53311.1 P9WIS7.1 O06159.1
    H2GU79.1 Q2G2Q0.1 P9WNV1.1 P9WNV5.1 Q8YE98.1 Q59191.1 P9WGY7.1 P9WGY9.1
    Q2G2W1.1 P9WGH1.1 P9WNG9.1 P9WNG7.1 O84591.1 Q9Z7A6.1 P9WGR1.1 P96404.1
    I6YGS0.1 Q6MX18.1 P9WNK5.1 053692.1 P9WNK3.1 P9WNK1.1 P9WNJ9.1 P9WNJ7.1
    P9WNJ5.1 P9WNJ3.1 P9WNJ1.1 P9WNI9.1 P96903.1 P9WNB1.1 P9WJE1.1 P9WJD9.1
    P9WJD7.1 P9WJD3.1 P9WJC5.1 P9WJC3.1 P9WJC1.1 P9WNQ3.1 P9WJE5.1 P9WJC7.1
    O84646.1 I6YDV4.1 P11439.1 Q5NFJ1.1 P9WNE5.1 P14738.1 P11089.1 H7C7G3.1
    L7N6B9.1 16XFI7.1 O05578.1 P96218.1 P9WN39.1 P9WN59.1 Q8YBI3.1 P9WN83.1
    P9WJA9.1 P9WMY9.1 Q5NH51.1 O53673.1 P9WIP9.1 P0CE15.1 P72041.1 Q5NEM8.1
    Q5NI16.1 P9WJA3.1 P0A4Q1.1 P9WIP1.1 P9WIN9.1 P9WNF5.1 O50846.1 Q59947.1
    H7C7N8.1 Q5NEC6.1 O84606.1 P9WQJ9.1 P9WQJ7.1 P9WQ71.1 O53611.1 P9WKL1.1
    P9WKJ7.1 D5V9Y8.1 P0CC04.1 P23700.1 P9WJN5.1 Q5NHJ0.1 Q5NEY9.1 P15917.1
    Q2G155.1 O34094.1 Q8F8E1.1 O69661.1 H6MMU4.1 P9WK61.1 P9WK55.1 Q8YGS9.1
    O50811.1 P9WQ59.1 P9WIN7.1 P9WIR1.1 O50430.1 D5VCH6.1 Q5NHI7.1 P9WFU9.1
    I6XFY8.1 B2RH54.1 Q46409.1 P30690.1 A0A0J5IWN3.1 A0PSI5.1 A4TAC4.1 B1MB69.1
    B2HSY2.1 B8ZSN3.1 E4WHS0.1 P9WK17.1 V5XE39.1 I6X7G8.1 I6Y461.1 I6YGB1.1
    I6YC99.1 Q79FY7.1 I6X5Z8.1 I6Y479.1 I6YA32.1 O05461.1 Q2G1E2.1 P9WK19.1
    I6YAW3.1 Q5NGG4.1 O51624.1 P9WJW5.1 Q50584.1 B2RHG1.1 Q5NFL7.1 P9WQN7.1
    P9WHH3.1 O84639.1 Q5NF24.1 P9WJH1.1 P9WJH5.1 O53203.1 P55969.1 O50418.1
    Q5NGE0.1 H7C7K8.1 O54584.1 G1UB30.1 Q5NH85.1 G1UB25.1 P0A3N8.1 E1X6Y5.1
    Q5NEP7.1 Q8YHH0.1 P38006.1 P43838.1 P43839.1 P0CL67.1 P0CL66.1 Q0SLZ0.1
    Q07337.1 G5IX16.1 O07721.1 O53254.1 P75330.1 I6Y936.1 L7N649.1 L7N656.1
    L7N693.1 Q79FK4.1 Q79FR3.1 Q79FR5.1 Q79G04.1 Q79FS8.1 Q6MWX1.1 Q79FV6.1
    Q79FS5.1 Q79FQ7.1 Q79FP3.1 Q79FP2.1 Q79FK9.1 Q79FE6.1 I6XEF1.1 Q79FD4.1
    Q6MX26.1 Q6MX50.1 L7N680.1 O53695.1 I6X8R2.1 O53246.1 I6Y0L1.1 Q2G282.1
    P14283.1 P04977.1 P9WMX7.1 P9WFR1.1 P9WN09.1 O86345.1 P9WGU1.1 P9WGT9.1
    P9WGT7.1 P9WPF7.1 P9WIB3.1 P9WMM9.1 P9WHM5.1 P9WQE9.1 Q8DQ08.1 Q8DQ07.1
    I6Y231.1 P9WHV9.1 O05877.1 O07236.1 O86370.1 O06404.1 O06410.1 B8ZRL2.1
    O06807.1 O33269.1 Q79FA9.1 Q79FK6.1 Q8VKN2.1 L7N675.1 Q79FK5.1 L0T7Y7.1
    Q79F19.1 Q79FE1.1 Q6MWX9.1 O84616.1 O84647.1 P9WQ27.1 O84288.1 I6X9S5.1
    P9WJW3.1 P9WPS9.1 P95149.1 O53632.1 I6Y293.1 L0T243.1 P9WP43.1 P9WKC9.1
    P96402.1 P71810.1 O06417.1 P96365.1 L0T5B2.1 P96264.1 P9WJK5.1 P9WJQ9.1
    O84419.1 O84818.1 Q8YG32.1 O06608.1 O07175.1 P9WGA3.1 O53323.1 P96354.1
    P9WIM9.1 B8ZRT2.1 P9WK93.1 P13423.1 O84583.1 P9WG63.1 P9WIM1.1 P9WKJ3.1
    P9WNZ7.1 P9WK31.1 Q50701.1 P9WID3.1 Q8YC41.1 P9WPL3.1 P9WNI3.1 P9WNI7.1
    P9WNI5.1 P9WQ49.1 P9WMG1.1 Q2GGR3.1 P9WK71.1 O33192.1 P9WND5.1 P9WFL9.1
    P9WMB7.1 P9WJ79.1 P9WND7.1 Q63RA7.1 Q631D0.1 I6YET7.1 Q9S010.1 P9WGC9.1
    Q50700.1 Q5NFR6.1 P9WGK3.1 P9WHI1.1 P9WHV3.1 Q5NIA7.1 P9WG27.1 P9WF73.1
    P9WGA1.1 P9WIB9.1 P9WGL3.1 O51381.1 P9WI83.1 P9WI79.1 P9WFT7.1 Q8YGS6.1
    P05788.1 P17835.1 P9WIK9.1 Q5NHP7.1 P9WJU5.1 P9WGE7.1 Q2G2B2.1 P04958.1
    P9WG67.1 P9WKE1.1 O07226.1 P9WJ13.1 P9WHF3.1 P9WF43.1 Q7D7L0.1 P9WMF9.1
    P9WGN1.1 P9WKJ9.1 P60230.1 P9WKH7.1 O53699.1 P9WHT7.1 P9WJS5.1 Q5NII0.1
    Q8YDZ3.1 Q9RPX7.1 P9WN67.1 O05576.1 Q5NHL4.1 P9WN15.1 P9WMD5.1 P9WMF5.1
    P9WG85.1 P9WJW7.1 P9WIH1.1 P9WIG1.1 P9WIG3.1 P9WIF5.1 P9WIF1.1 P9WIE7.1
    P9WHW9.1 P9WI41.1 P9WI39.1 P9WI37.1 P9WI25.1 Q11031.1 P9WI47.1 P9WI23.1
    P9WI19.1 P9WI11.1 P9WI45.1 P9WI07.1 P9WI05.1 Q79FH3.1 P9WI43.1 P9WHZ7.1
    P9WHZ5.1 P9WHZ3.1 P9WHY9.1 P9WHY7.1 P9WHY5.1 Q6MX07.1 P9WHY3.1 Q6MWY2.1
    Q50703.1 P9WHX3.1 P96221.1 Q7D589.1 P9WMA3.1 P9WKW1.1 P9WKS9.1 P9WM29.1
    P9WGC1.1 P9WLZ5.1 P9WLZ3.1 P9WLX1.1 P9WLV9.1 P9WLS7.1 P9WLQ1.1 P9WLJ1.1
    P9WLH9.1 P9WLF3.1 P9WL97.1 P9WL87.1 P9WL85.1 P9WL83.1 P9WL67.1 P9WL63.1
    P9WL51.1 P9WL47.1 P9WNH3.1 P9WGL7.1 P9WQM5.1 P9WPD9.1 A0A098A1N7.1 A0A098A2B0.1
    A2RGM0.1 A5LVF6.1 A5MKZ9.1 B8ZQI8.1 B8ZQM3.1 B8ZQT5.1 B8ZR82.1 B8ZRH1.1
    B8ZS71.1 B8ZS85.1 B8ZS86.1 B8ZSJ5.1 B8ZSL3.1 B8ZSL7.1 B8ZSM6.1 B8ZT30.1
    B8ZTD0.1 B8ZTS2.1 B8ZTV5.1 B8ZU53.1 B8ZUA4.1 B8ZUE5.1 B8ZUF0.1 B8ZUT6.1
    B8ZUX6.1 C0R9U8.1 C6DPT8.1 C6DQ35.1 E1XJN6.1 G8W6L3.1 G8W6L7.1 G8W6U7.1
    H6MNY3.1 H6MQD5.1 H8HRN0.1 H8HW90.1 H8L8K3.1 I6TQ53.1 I6TX52.1 P005B9.1
    Q1BYS7.1 R4MDK6.1 S5F815.1 W6GWM1.1 P9WFC9.1 P9WFJ9.1 P14916.1 P69996.1
    P9WFC5.1 Q8VKQ6.1 P9WHS3.1 A5MKI6.1
  • TABLE 5
    LIST OF ACCESSION NUMBERS FOR FUNGAL ANTIGENS FROM IEDB and
    UNIPROT
    Q5ANA3.1 Q5A3P6.1 Q59VM7.1 Q5A1A9.1 Q5APF0.1 Q8J0P4.1 Q4WHG0.1 Q4WQ87.1
    Q59X67.1 Q59Z17.1 Q59ZI3.1 Q5AA33.1 B8N4Q9.1 Q4WAW6.1 Q4WAJ6.1 Q4X1V0.1
    A0A1D8PQ86.1 Q59ZB1.1 Q873N2.1 Q59L72.1 B8NIF0.1 P46075.1 Q4WCL1.1 Q4WRP2.1
    Q59L12.1 Q59LC9.1 P48989.1 Q5AFC2.1 B8N406.1 Q4WGL5.1 Q9HEQ8.1 Q4WVI6.1
    P46593.1 P82611.1 Q5ADV5.1 Q59SG9.1 P41750.1 O00092.1 Q4WEN1.1 Q4WCV3.1
    P0DJ06.1 O94038.1 Q59WD3.1 Q59RQ0.1 B8NM71.1 Q4WLW8.1 Q4WI37.1 Q4WNI1.1
    P29717.1 P46589.1 Q59W04.1 Q59RK9.1 B8MYS6.1 Q8X176.1 Q4WZS1.1 Q4WQH4.1
    Q9UW14.1 Q5AF56.1 Q59VN0.1 P31353.1 B8N8Q9.1 Q96UX3.1 Q4WDA4.1 Q4WDE1.1
    Q92207.1 P83773.1 Q59WB9.1 Q5ACM4.1 B8N8R3.1 Q4WPF5.1 Q4WLS7.1 Q4WJT7.1
    Q5A8T7.1 Q59YU1.1 Q59P53.1 Q5ACI8.1 B8N417.1 Q92450.1 Q4WWM6.1 Q4WLG1.1
    Q5A8T4.1 Q59YV2.1 Q5A432.1 Q5AB93.1 B8N8R0.1 Q4WAW9.1 Q4WP81.1 Q4WQR6.1
    P43076.1 Q5ABE5.1 Q5AK64.1 Q5ALL8.1 B8NM74.1 A4GYZ0.1 Q6MYT0.1 Q4WZS2.1
    Q5AP53.1 Q59LF2.1 A0A1D8PNZ7.1 Q5A4X8.1 B8N106.1 Q4WAW3.1 Q4WTL0.1 Q4WXP0.1
    Q5AL52.1 Q8NJN3.1 Q59Q30.1 Q5AD34.1 B8NHY4.1 Q70J59.1 Q4WXV2.1 Q4WU59.1
    P43079.1 Q5ALN1.1 A0A1D8PN12.1 Q59V02.1 B8NJG8.1 Q4X1A4.1 Q4X0Z3.1 Q4WUG4.1
    Q5AD07.1 Q59572.1 Q5AK24.1 Q5AHC0.1 B8NM66.1 E9R876.1 Q4WN25.1 Q4WIK9.1
    Q5A0E5.1 Q59K86.1 Q5AFT2.1 Q59Y11.1 B8MYL0.1 M4VQY9.1 Q4WN21.1 Q4WYP0.1
    Q5AKU6.1 Q5AGD1.1 Q5A0W6.1 Q59QA5.1 B8NM62.1 Q4WF53.1 Q4X1N0.1 Q4X0B5.1
    Q59RL7.1 P79023.1 P0CB63.1 Q5AMJ5.1 B8NGT5.1 Q4WZ64.1 Q4WQV2.1 Q4WYK9.1
    G1UB61.1 Q59LP6.1 Q59U11.1 Q5AMF7.1 B8NM64.1 Q4WAZ0.1 Q4WZP2.1 Q4WY33.1
    Q5ABC6.1 Q5AP87.1 P83775.1 Q5ABW2.1 B8NV37.1 Q4WR16.1 Q4WVK2.1 Q4X1F8.1
    A0A1D8PQB9.1 P22274.1 Q5APF2.1 Q5APJ9.1 B8N151.1 Q4WLB9.1 Q4WUA0.1 Q4WA45.1
    P87020.1 Q5AC48.1 Q59VP2.1 Q5AM72.1 B8NEJ3.1 Q4WQS0.1 A4DA84.1 Q4WKD7.1
    P0CY27.1 Q5AP59.1 Q5AEE1.1 Q5ACU3.1 B8N8M2.1 Q4WEP7.1 Q4WJX0.1 Q4WCH5.1
    Q59XX2.1 Q59MV1.1 Q5AMR5.1 Q5A1V3.1 B8MYV0.1 E9R9Y3.1 Q4WP38.1 Q4WXY3.1
    Q59U10.1 Q5AL27.1 Q59SU5.1 Q59RF7.1 B8N717.1 P41748.1 Q4X1D7.1 Q4WPL7.1
    Q59RW5.1 Q5AJD2.1 Q59VP1.1 Q5ACN3.1 B8NJG3.1 Q4WYG3.1 Q4W9Z9.1 Q4X136.1
    Q59MQ0.1 P0CU38.1 Q5ADQ0.1 Q5AHE8.1 B8N8R1.1 P87184.1 Q4WE62.1 Q4WZ44.1
    Q5ABU7.1 Q59QC5.1 Q5AK59.1 Q5AHA4.1 B8NJH2.1 Q4WBS1.1 Q4WZL3.1 Q4WTC7.1
    Q9Y7F0.1 Q5A5N6.1 Q59RH5.1 Q5AEG7.1 B8NQ51.1 Q70DX9.1 Q4WB37.1 Q4WMK2.1
    Q5AC08.1 Q59Q79.1 Q5ACW8.1 Q59V01.1 B8NM63.1 Q4WG16.1 Q4W9Z4.1 Q4WNC9.1
    P30575.1 Q5AH38.1 Q5AGM0.1 Q5AK97.1 B8NM73.1 Q96X30.1 Q4WDD0.1 Q4WY67.1
    Q5AAG6.1 Q5AMN3.1 Q59VN2.1 Q5A1B2.1 B8NYX0.1 Q4WV19.1 Q4WKB9.1 Q4WU12.1
    O74189.1 Q5A1Z5.1 O94069.1 Q5AJK6.1 B8N3P7.1 Q4WAZ6.1 Q4WU07.1 Q4WA61.1
    Q59W62.1 Q5A6K2.1 P0CY20.1 Q59L96.1 B8NJH1.1 Q4W944.1 Q4WBL6.1 Q4WA58.1
    P0CY34.1 Q59L25.1 Q59XQ1.1 Q59MD0.1 B8MXJ7.1 Q4WTV7.1 Q4WX13.1 Q4WA60.1
    Q5A1D3.1 Q5A922.1 O94048.1 Q5AG46.1 B8NJB0.1 Q4WMJ9.1 Q4WV71.1 Q4WX36.1
    Q5AJU7.1 Q5AFG1.1 Q5ADX2.1 Q59VW6.1 B8NPS7.1 Q4WZ65.1 Q4X0C2.1 Q4WA62.1
    Q5A4H5.1 Q5ALR8.1 P46586.1 Q5A8I6.1 B8N7Z8.1 A0A067Z9B6.1 Q4WRU4.1 Q4WA59.1
    Q59Y31.1 Q5AEI2.1 P83776.1 Q9UW24.1 B8NSV5.1 Q66WM4.1 Q4WGS4.1 Q4WXQ7.1
    P0CY29.1 Q5AI71.1 Q5A895.1 Q59Q38.1 B8MZA3.1 Q6T267.1 Q4WP13.1 Q4WVA0.1
    Q5ANJ4.1 Q5ABA6.1 Q59PP0.1 Q5ADL0.1 B8NLY9.1 Q4WLW5.1 Q4WHG5.1 Q4WDN4.1
    Q59NH8.1 Q5ABX0.1 Q5AHH4.1 Q5AH11.1 B8NR69.1 Q4WMJ0.1 Q4WPF7.1 Q4WK03.1
    P0CY33.1 Q5A4N0.1 Q96UX5.1 Q59W55.1 B8MZ41.1 Q4WQU0.1 Q4WH83.1 Q4WCG2.1
    Q00310.1 Q59TN9.1 P87206.1 Q5AC37.1 B8N7S7.1 Q4WMJ8.1 Q4WXW1.1 Q4WX99.1
    Q5A0W9.1 Q5A557.1 Q5A029.1 Q5A7Q3.1 B8NR71.1 Q4WWW8.1 Q8NJM2.1 Q4WV10.1
    Q5A4M8.1 Q59UG3.1 Q5A1E0.1 Q59PV6.1 A0A0D9MRV9.1 Q4WZ63.1 Q4WWD3.1 Q4WIS6.1
    Q5AJC0.1 P0C075.1 Q59XL0.1 P0CH96.1 P55790.1 Q4WVN4.1 Q4WPU8.1 Q4WP65.1
    Q595U1.1 Q59R09.1 Q5A6U1.1 P83782.1 B8NM72.1 Q4WAY8.1 Q4WN99.1 Q4WUK1.1
    Q5AG71.1 Q9B8D4.1 Q5A8I8.1 Q5A660.1 B8MW78.1 Q4WY07.1 P0C959.1 Q4WKN3.1
    Q5AMT2.1 Q9B8D3.1 Q59PR9.1 Q59YT1.1 Q9P900.1 Q4WZ66.1 Q4X0S7.1 Q4WG58.1
    Q59KY8.1 Q9B8D5.1 O74261.1 P53709.1 B8NDE2.1 Q4WQZ5.1 Q4WPW2.1 Q4WXX9.1
    Q59LY1.1 Q59LR2.1 Q96VB9.1 Q5ACX1.1 B8NJF4.1 O42630.1 Q4X1U0.1 Q4WC37.1
    Q59UT4.1 Q5AED9.1 Q5AQ47.1 Q5ADP9.1 B8NIV9.1 P0C7S9.1 Q4WP57.1 Q4X1Y0.1
    Q5ABC5.1 Q5A4W8.1 Q5A985.1 Q92210.1 B8NG16.1 Q4WI46.1 Q4WPH9.1 Q4WZL8.1
    Q59MV9.1 Q5ANH2.1 Q59ZW2.1 Q59MA3.1 B8NX60.1 Q4WQY4.1 Q4WDK5.1 Q4WR80.1
    Q59MD2.1 Q5A649.1 P83784.1 Q5AFK3.1 B8NM75.1 Q4WAY3.1 Q4WI71.1 Q4WY53.1
    Q5A8N2.1 Q5AI22.1 Q59P11.1 Q59563.1 B8MZZ6.1 Q4WT66.1 Q4WYS7.1 Q4WL88.1
    P40953.1 Q5A950.1 Q5ADN8.1 Q5A0Y2.1 B8NM67.1 Q6MY57.1 Q4WY08.1 Q4WGV9.1
    Q5APR8.1 Q5ANC9.1 Q5A849.1 Q5ALW7.1 B8NRX2.1 P0C954.1 Q4WND3.1 Q4WC29.1
    P10613.1 Q59UH7.1 Q5A7R7.1 Q59W52.1 B8NXJ2.1 Q4W946.1 Q4X1D2.1 Q4WKV8.1
    Q5A5Q6.1 Q5ALX8.1 Q59XB0.1 Q59542.1 B8NMD3.1 Q4WMJ5.1 Q6MY91.1 Q4WYA5.1
    Q5A4F3.1 Q5AI37.1 Q59P96.1 Q5A961.1 B8NBI2.1 Q70GH4.1 Q4WRV2.1 Q4WCM6.1
    P43094.1 Q5ABV4.1 Q59SR6.1 Q59ST6.1 B8NPA4.1 Q4WUL6.1 Q4WRX4.1 Q4WKB2.1
    Q9P940.1 Q5AKU4.1 Q9P975.1 Q59N74.1 B8N803.1 P61832.1 Q4WP03.1 Q4WNG7.1
    Q5AJY5.1 Q59VY1.1 O94083.1 Q5A6P6.1 B8NPT0.1 Q4WG11.1 Q4WTA6.1 Q4WRE8.1
    P39827.1 Q59Z51.1 Q5AIA4.1 Q59XM0.1 B8MXP5.1 Q4WYU4.1 Q4WZJ0.1 Q9P8P4.1
    Q59WF4.1 Q59LV8.1 Q59YF4.1 Q5A4N5.1 B8NIB8.1 Q4WYR6.1 Q4W958.1 Q4WJS4.1
    P83774.1 Q59X11.1 Q59XW9.1 Q5A6M2.1 B8N9H4.1 Q4WNE1.1 Q4X054.1 Q4WHW1.1
    Q59Q46.1 Q5ABQ7.1 Q59WU8.1 Q5A5M7.1 B8NNK9.1 Q4WQZ6.1 Q4X113.1 Q4WYG7.1
    Q59X23.1 Q59PZ3.1 Q5AAR0.1 Q5A6N8.1 B8NI03.1 Q4WWC6.1 Q4W9V1.1 Q4WJH4.1
    P46614.1 O13332.1 Q5AQ62.1 Q9UVJ4.1 B8NM76.1 Q6Q487.1 Q4WDF1.1 Q4WJM6.1
    Q5AQ33.1 Q5AHD6.1 Q59R35.1 Q59V88.1 B8NM79.1 P0C957.1 Q4WWN2.1 Q4WMB6.1
    P82610.1 A0A1D8PPG4.1 Q5A847.1 Q59RA0.1 B8NJG9.1 Q4WM08.1 Q4WTH0.1 Q4WMU9.1
    Q5AP80.1 Q5ADW3.1 Q5A6A4.1 Q59XU5.1 B8NPL7.1 Q4W9B8.1 Q4WJQ1.1 Q4WIF3.1
    P46598.1 Q5AML6.1 Q5A4Q1.1 Q5AH12.1 B8NMR5.1 Q4WWJ1.1 Q4WKL7.1 Q4WEH7.1
    Q5A506.1 Q5A846.1 P0CY22.1 Q59ZX3.1 B8NP65.1 E9RCR4.1 Q4WX90.1 Q4WT34.1
    Q5A599.1 A0A1D8PPI5.1 P42800.1 Q5AB48.1 B8N5S6.1 Q4WM67.1 Q4WG69.1 Q4WT99.1
    Q59NP5.1 P0CT51.1 Q59KI4.1 Q5A3Q0.1 B8NJ86.1 Q4WUN7.1 Q4WM32.1 Q4X0N1.1
    Q5AHA0.1 Q59MA6.1 Q59JU3.1 Q5A6M0.1 P41747.1 E9QRF2.1 Q4WTI3.1 Q4WSA8.1
    Q07730.1 Q5ALW2.1 P83777.1 Q5AL29.1 P41765.1 Q4WK60.1 Q4WHX4.1 Q4WLD1.1
    Q5AD05.1 Q5ABU8.1 Q5A310.1 Q59KG2.1 B8N6V7.1 Q4WZ61.1 Q4WXE9.1 Q4WMU5.1
    Q5AME2.1 Q5AEC6.1 Q59N80.1 O42825.1 B8NKE9.1 Q4W945.1 Q4X0X6.1 O13410.1
    P41797.1 Q5A4X0.1 Q5AJ77.1 O59931.1 B8NGU6.1 Q4WMA6.1 Q4W8Z9.1 Q4WG40.1
    P0CY24.1 Q59LX9.1 Q59ZV4.1 Q5AM44.1 B8NBP9.1 Q4WNS8.1 Q4WEB4.1 Q4WLD5.1
    Q5ACZ2.1 Q59PE7.1 Q59XA7.1 Q59RP7.1 B8N8R2.1 Q4WDE9.1 Q4WDH3.1 Q4WLD4.1
    Q5ABE2.1 Q5ACL9.1 Q59L13.1 Q5AK94.1 B8NKI4.1 Q4WUR1.1 Q4X1N4.1 Q4WLD2.1
    Q59M56.1 Q5ABT8.1 Q5AG97.1 Q5AKB1.1 B8NQQ7.1 Q4WQ08.1 Q4WMP0.1 Q4WLC9.1
    Q5AK51.1 Q5AMH3.1 Q5AB15.1 Q59VM4.1 B8NJH0.1 Q4WF61.1 A4D9B6.1 Q4WQ54.1
    Q59UT5.1 Q5AEF0.1 Q59566.1 Q5A246.1 B8NKB9.1 Q7LKT3.1 Q4WD45.1 Q4WAZ8.1
    Q5AAF4.1 Q5AJC1.1 Q59KN8.1 Q5AJ92.1 B8NM78.1 Q4WQZ3.1 Q4WM95.1 Q4X161.1
    G1UBC2.1 Q59VP0.1 Q5A8X9.1 Q5A2V2.1 B8NTP7.1 Q4WAZ3.1 Q4X0I8.1 Q4WB00.1
    Q5ADT1.1 Q5AGC7.1 Q5AFP8.1 Q5ABP8.1 B8MWJ5.1 Q4WNV0.1 Q4WLV6.1 Q4WQ14.1
    O59923.1 Q5AQ12.1 Q9P8W1.1 Q5AAV3.1 B8N7G5.1 Q4WRZ5.1 Q4W9R2.1 Q4WP12.1
    Q5AL03.1 Q59X94.1 Q9P8W0.1 Q59SN0.1 B8NER4.1 Q4WPF2.1 Q4WAW8.1 Q4WCR3.1
    Q5A2Z7.1 Q5AFX2.1 Q9P4E7.1 Q5ACU6.1 B8NJH3.1 Q8TFZ1.1 Q4WMS0.1 Q4WAQ9.1
    Q59VH7.1 Q5A1E3.1 Q9P8V9.1 Q9Y7C4.1 B8NDL1.1 Q4WB03.1 Q4WAW5.1 Q6MYX6.1
    Q59KZ1.1 O43101.1 Q5A7Q6.1 Q9HFQ7.1 B8NWY6.1 P40292.1 Q4WAX0.1 Q4WZJ6.1
    Q5A960.1 Q59WU0.1 Q5A6N1.1 Q5A3J1.1 B8NC58.1 Q4WPN0.1 Q4WTQ4.1 Q4WP59.1
    Q5AFA2.1 Q5A893.1 Q5AI58.1 P40910.1 B8NIM4.1 Q4X1D4.1 Q4WJ80.1 Q4WLC8.1
    Q5A5U4.1 P43069.1 Q9P4E5.1 Q5AQ57.1 B8NXI4.1 Q4WBW4.1 Q4WD43.1 Q4WVM1.1
    Q5AQ36.1 Q59LN9.1 P0CH67.1 Q5ACL4.1 B8NJG5.1 Q4X180.1 Q4WD44.1 Q4WLP9.1
    Q9URB4.1 Q5AA40.1 Q5A387.1 Q5A449.1 B8NYD8.1 Q4WQZ4.1 Q4WD46.1 Q4WHD2.1
    Q5AL36.1 Q59545.1 Q59NB8.1 Q59527.1 B8NYX1.1 Q4WZ69.1 Q4WD48.1 Q4W9T6.1
    P86029.1 Q5AM60.1 Q92209.1 Q59VF9.1 B8NX76.1 Q4WFK4.1 Q4WD42.1 Q4WR79.1
    O13289.1 Q5AD67.1 Q5A7M3.1 Q5A755.1 B8NL00.1 Q4WUE0.1 Q4WAX1.1 Q4WHF8.1
    P43063.1 Q59LV5.1 Q59QC4.1 O42817.1 B8NSP6.1 Q4WHP6.1 Q4WY16.1 Q4WV23.1
    Q5A651.1 Q5AG86.1 Q59PT4.1 Q5AJ85.1 B8N215.1 Q4WWC5.1 Q4WMJ1.1 Q4WYA1.1
    Q59YH3.1 Q59ST8.1 Q5AKW3.1 Q59P44.1 B8NP78.1 Q4WTN9.1 Q4WBL2.1 Q6MY48.1
    P82612.1 O93803.1 Q9P4E8.1 Q59KC4.1 B8NE46.1 Q4WR17.1 Q4WIQ0.1 Q9UUZ6.1
    P53705.1 Q5AFT3.1 Q9P4E6.1 Q59XV0.1 B8NMK3.1 Q4WA15.1 Q4WID9.1 Q4WRH5.1
    Q5AMQ6.1 Q5A519.1 Q59MJ2.1 Q5ABV6.1 B8NG97.1 Q4WZ11.1 Q4WPG0.1 Q4WEU2.1
    Q9Y7W4.1 O74161.1 Q59LL4.1 Q59UH5.1 B8N316.1 E9RD40.1 Q4WDM5.1 Q8NKF4.1
    Q5A688.1 Q59RN6.1 Q59543.1 Q5A869.1 B8NYW9.1 A4DA85.1 Q4WYV0.1 Q9HGV0.1
    P25997.1 Q5A3Z5.1 Q59P87.1 Q5AEF2.1 B8NBJ4.1 P54267.1 Q4WEY4.1 Q4X156.1
    Q5AHG6.1 P31225.1 Q5AEN6.1 Q5A0W7.1 B8N7E5.1 P0C958.1 Q4WN24.1 Q4WXZ5.1
    Q8TGH6.1 Q59QC6.1 Q59LF9.1 P83783.1 B8NM69.1 Q4WQZ7.1 Q4WQ21.1 Q4X1R1.1
    Q5ABD0.1 Q9I589.1 Q5ADX5.1 Q59XP0.1 B8N306.1 Q9Y8D9.1 Q4WNN2.1 Q4WXX4.1
    Q5AL16.1 Q5A8W9.1 P83778.1 Q5AP66.1 B8N7Z0.1 Q4WBR2.1 Q4WAH2.1 Q4WJE9.1
    Q59RR0.1 Q5APG6.1 Q5AG31.1 Q5AGZ9.1 B8NJB2.1 Q4WL66.1 Q4WT40.1 P41746.1
    Q59KM8.1 Q59YD9.1 Q5AHZ7.1 Q5AFE4.1 B8NWE1.1 Q4WVG8.1 Q4WFT3.1 Q4WDF7.1
    Q5A220.1 Q5AEN1.1 Q5ACU4.1 Q59PE4.1 B8NIM7.1 Q4WZ68.1 Q4WQM4.1 Q4X0T4.1
    Q92206.1 Q8X1E6.1 Q59PD6.1 Q59LF3.1 B8NKA3.1 Q8TGG8.1 Q4X0W8.1 Q4WNX1.1
    Q59Z29.1 P56553.1 Q5A940.1 Q9P8E3.1 B8NK45.1 Q4X0A9.1 Q873N1.1 Q4WTM9.1
    Q5AK66.1 Q59WI7.1 Q59M70.1 Q59578.1 B8NBX4.1 Q4WHG1.1 Q4WR23.1 Q4WQM6.1
    P46273.1 Q5ALY0.1 Q5A917.1 Q59L89.1 B8NVK8.1 Q4WVE3.1 Q4WEI5.1 Q4WV66.1
    Q5AFI4.1 Q5A0A9.1 Q5ANA8.1 P46250.1 B8NI10.1 Q4X162.1 Q4WE68.1 Q4WKH9.1
    Q5ALV2.1 Q5A884.1 Q5A3M6.1 Q5AQ76.1 B8NSW2.1 Q6A3P9.1 Q4WR21.1 Q4WI01.1
    Q5A312.1 Q9B8D8.1 Q59MC8.1 Q5AI21.1 B8NA06.1 Q4WQI1.1 Q4WTC4.1 Q873W8.1
    Q5A3V6.1 Q59PZ7.1 Q5A3K2.1 Q96W54.1 B8NLL0.1 O43102.1 Q4WPV8.1 Q4WPW8.1
    Q59TB2.1 Q9B1P9.1 Q5A644.1 P0CU35.1 B8NBB2.1 Q7Z8P9.1 Q4WYF1.1 Q4X1W8.1
    Q59KI0.1 Q59MA9.1 Q59ZH9.1 O94150.1 B8NBM3.1 Q4WAY4.1 Q4WJM7.1 Q4WV30.1
    Q5APU2.1 Q5ACH7.1 Q71U11.1 Q5ADT9.1 B8NA66.1 Q4X1Q4.1 Q4WHP5.1 Q4WUG9.1
    O42766.1 P0C8K9.1 Q5AJF1.1 Q5A0L9.1 B8NUL8.1 Q4WJ90.1 Q4WHU1.1 Q4WYF4.1
    Q5A446.1 Q59MF9.1 Q59YV0.1 Q5ACV9.1 B8N076.1 Q4X117.1 Q4WT68.1 Q4WK80.1
    Q59UY7.1 Q5AI44.1 Q59585.1 Q5A1D5.1 B8NVB7.1 Q4WBU0.1 Q4U3Y2.1 Q4WGU1.1
    Q5A6T5.1 Q5AL10.1 Q59PP6.1 Q5A744.1 B8NBC2.1 Q4X228.1 Q4WSM6.1 Q4WYK1.1
    G1UB63.1 Q5AED6.1 Q59X40.1 Q5A455.1 B8NJL4.1 Q6MYX3.1 Q4W9B9.1 Q4WNC1.1
    Q59QC7.1 Q5AGE5.1 O94030.1 Q5AAU3.1 B8NR70.1 Q4X084.1 Q4WHB7.1 Q4WQC5.1
    P34948.1 Q59LQ5.1 Q5AL63.1 Q9C0L9.1 B8NGP8.1 Q4X251.1 Q4WNA1.1 Q4WJS7.1
    P46592.1 P0C8L0.1 Q5A0Y8.1 Q5AFV3.1 B8NXS9.1 Q4WHZ9.1 Q4WHH4.1 Q4WHK3.1
    Q5A872.1 Q5A301.1 Q5A723.1 Q5A360.1 B8NDZ1.1 Q4WLA7.1 Q4WA21.1 Q4X0M4.1
    Q59QW5.1 Q59X26.1 Q5A1A0.1 Q5AI90.1 B8NW70.1 Q4WXH8.1 Q4WCP8.1 Q4WLI5.1
    Q59WH0.1 Q5AML2.1 Q5A4G2.1 Q5AD73.1 B8MW97.1 Q4WAS9.1 Q4WVH0.1 Q4WP54.1
    Q5A1N6.1 Q59W50.1 Q5A970.1 Q5AD77.1 B8N9M2.1 Q4WZ60.1 Q4WUJ6.1 Q4WNH8.1
    Q5AAJ8.1 Q59ZG8.1 Q59Y46.1 P87219.1 B8N195.1 Q4WYG2.1 Q4WWP1.1 Q4WTT2.1
    Q5AG40.1 Q59VC6.1 Q5AHC2.1 Q59QH6.1 B8MYS5.1 A4D9R3.1 Q4WS57.1 Q4WEL6.1
    Q59P39.1 Q59ZY9.1 Q59V93.1 Q59PT6.1 B8NNI2.1 Q4WR20.1 Q4WVD9.1 Q4WI38.1
    Q5AJB1.1 Q5AL13.1 Q59515.1 Q5A5N5.1 B8NJZ7.1 Q4WA22.1 Q4WK77.1 Q4WTT7.1
    Q59UP6.1 Q59NY7.1 Q59RR3.1 Q5ADL4.1 B8N6H2.1 Q4WM60.1 Q4WCL2.1 Q4WWS3.1
    Q5AMH6.1 Q5AP89.1 Q5APQ8.1 Q5AM84.1 B8NIX4.1 Q0H904.1 Q4WN75.1 Q4WVH3.1
    Q59SF7.1 Q59XY0.1 P87207.1 Q5AK73.1 B8NGC8.1 P78574.1 Q4WES5.1 Q4WD95.1
    Q59VX8.1 Q5ADL9.1 Q59MZ9.1 Q5A4H9.1 B8N970.1 Q4WAR8.1 Q4WVT3.1 Q4WLP1.1
    Q59WG7.1 P53698.1 Q59Y41.1 Q5ALX5.1 B8MY73.1 Q4WNK7.1 Q4WVV6.1 Q4WQI6.1
    Q5AFN8.1 Q5AJX2.1 Q59552.1 Q5A748.1 B8N6W5.1 P78746.1 Q4WP83.1 Q4WCJ7.1
    Q59TP1.1 Q5APS5.1 Q59U73.1 Q5ALU2.1 B8N3L3.1 Q4WPF8.1 Q4WAY7.1 Q4WTT8.1
    Q5AF39.1 Q59PG6.1 Q9Y872.1 Q5A2B9.1 B8NPS8.1 Q4WX43.1 Q4WX89.1 Q4WWR2.1
    Q5AP97.1 Q59NP1.1 Q5AGA9.1 Q5ALX3.1 B8NTI4.1 Q4WQL4.1 Q4WYT0.1 Q4WWL0.1
    Q5A5U9.1 Q59PD3.1 Q59VL7.1 Q5A1M3.1 B8MYS7.1 Q4WBE1.1 Q4WNT9.1 Q4WZT9.1
    Q5AF41.1 Q5ACW2.1 Q59KJ7.1 Q5A4H4.1 B8NM70.1 Q4WQT2.1 Q4WVS4.1 Q4X0I7.1
    O13318.1 Q5ANB2.1 Q5AP90.1 Q5AA26.1 B8MYS8.1 Q4WBT5.1 A4D9J5.1 Q4WU00.1
    Q5AA09.1 Q5AJD0.1 Q5AD72.1 Q5ANL6.1 B8N6M6.1 Q4WQZ2.1 Q4W9B7.1 Q4WRW0.1
    Q5A762.1 Q5A4P9.1 Q59559.1 P87218.1 B8NCU7.1 Q4WD47.1 Q4WNC6.1 Q4W9V0.1
    P46587.1 P78599.1 Q5APM7.1 Q59KF3.1 B8N5T6.1 Q4WCZ8.1 Q4WJW8.1 Q4WYJ7.1
    Q5A287.1 Q5APC8.1 Q5A2Z1.1 Q59N29.1 B8MVS3.1 Q4WB01.1 Q4WH96.1 Q4WHY5.1
    Q59X49.1 Q59LU0.1 Q59TD3.1 Q5A0L7.1 B8NCM8.1 Q4WBK6.1 Q4X0I5.1 Q4WEP0.1
    Q5ADM9.1 Q5APT8.1 P84149.1 Q59UG4.1 B8NW36.1 Q4WRQ7.1 Q4WMS9.1 Q4WXD3.1
    Q5AH02.1 Q59PR3.1 Q5AI97.1 Q5AHK2.1 B8NJG7.1 Q4WTQ6.1 Q4WAH4.1 Q4WJ02.1
    Q5A4X5.1 Q5A2W2.1 Q5A2A2.1 Q5ADP6.1 B8N7Z6.1 Q4WJ21.1 Q4WI13.1 Q4WP96.1
    Q5A4E3.1 Q5A4E2.1 Q5A044.1 Q5AK62.1 B8NGU1.1 Q4WPQ8.1 Q4WJA1.1 Q4WN54.1
    Q5A761.1 Q5A309.1 Q59P03.1 Q59YF0.1 B8NC10.1 Q4WR62.1 Q4W9R7.1 Q4WCW2.1
    Q9UW23.1 A0A1D8PL26.1 Q59TU0.1 Q5AAJ7.1 B8N4P0.1 Q4WD56.1 Q4WPP2.1 Q4WPM6.1
    P53704.1 P0CU37.1 Q5APK7.1 Q5A8H7.1 B8NPN0.1 Q4WIN6.1 Q4WWQ6.1 Q4WWW3.1
    Q59VR1.1 Q5AF95.1 Q59ST1.1 Q59U81.1 B8NQ08.1 Q4U3E8.1 Q4WNI0.1 Q4WSI0.1
    G1UB67.1 Q59MW2.1 Q5A7N3.1 Q5APB6.1 B8N3N5.1 Q4X195.1 Q4WDG1.1 Q4WNY4.1
    P52496.1 Q59550.1 Q5ANP2.1 Q59WD5.1 Q00049.1 P0C955.1 Q4X0Z7.1 Q4WVF4.1
    Q9HEW1.1 Q5AD78.1 O59933.1 Q5ABA2.1 B8NDP1.1 Q4WRH9.1 Q4WMS3.1 Q4WP02.1
    Q5A6B6.1 Q5AMM4.1 Q3MPQ4.1 Q5A861.1 B8NEM4.1 Q4WVD1.1 Q4WN42.1 Q4WWH6.1
    Q5A1W9.1 Q5AAW3.1 Q59MP1.1 Q5AH87.1 Q9P8Z9.1 Q4WID6.1 Q4WJH6.1 Q4WVE5.1
    P30418.1 Q59MG1.1 Q59MB6.1 P33181.1 B8MZJ8.1 Q4WFX9.1 Q4WYS1.1 Q4WHP3.1
    Q59SN6.1 Q5ACK7.1 Q5A216.1 Q59Q43.1 B8NX10.1 Q4WRE4.1 Q4WJ01.1 Q4WRE2.1
    Q5A343.1 Q5A218.1 Q9UVL1.1 Q5A860.1 B8NV05.1 Q4WC60.1 Q4WGL2.1 Q4WYX0.1
    Q5ABZ2.1 Q595J9.1 Q59Y57.1 Q59ZW9.1 B8NEI6.1 Q4WR18.1 Q4WP49.1 Q4WRB8.1
    Q59MJ1.1 Q5AD49.1 Q5AGA0.1 A0A1D8P178.1 B8MZI5.1 Q4WQY6.1 Q4WPE6.1 Q4WI88.1
    Q5AJ71.1 Q59NX9.1 Q5A687.1 Q59R24.1 B8NSJ0.1 Q4WXK4.1 Q4WWW9.1 Q4WQL0.1
    O74201.1 Q5A119.1 Q59R28.1 Q5AHJ5.1 B8NDR8.1 Q4WI96.1 Q4WKB5.1 Q4WDZ0.1
    Q5AK54.1 Q59K07.1 Q5AJS6.1 P0C0X3.1 B8NDQ2.1 Q4WVH4.1 Q4WA38.1 Q4WA70.1
    O93852.1 Q5AKA5.1 Q5AD59.1 Q59KL6.1 B8N9M0.1 A4D9R2.1 Q4WHL1.1 Q4WQ82.1
    Q5AIR7.1 Q59QC2.1 Q5AG73.1 P43072.1 B8NLN6.1 P0C956.1 Q4X1X0.1 Q4WMX7.1
    Q5A8K2.1 Q5AL45.1 Q5AND1.1 Q5AF54.1 B8N9X2.1 Q4WR22.1 Q4WRX2.1 Q4X0V2.1
    Q8TGB2.1 P0CY19.1 Q59NG5.1 Q59W44.1 B8NM08.1 Q4WQY8.1 Q4WDH9.1 Q4WI16.1
    Q5A477.1 Q5AGC4.1 Q59N20.1 P48990.1 B8NSD4.1 Q4WJJ3.1 Q4WMG1.1 Q4WXA1.1
    Q5AP95.1 Q5ALP1.1 Q59WJ5.1 Q59U67.1 B8N122.1 Q4X265.1 Q4WDE0.1 Q4WCV5.1
    Q5AF03.1 Q5AK42.1 Q5AA50.1 Q5ANB7.1 B8NCF0.1 Q9UVX3.1 Q4WCX4.1 Q4W9M7.1
    Q5AMQ4.1 Q5APG7.1 Q5A319.1 Q5A3Y5.1 B8NKS1.1 Q4WR19.1 Q4X122.1 Q4WQY9.1
    Q5ANI6.1 Q59Y20.1 Q5AD27.1 Q59512.1 B8N3R8.1 Q4WTF3.1 Q4WZF1.1 Q4WX30.1
    P78595.1 Q5ALL3.1 Q5AHI7.1 Q5APA2.1 B8NG55.1 Q4WLY1.1 Q4WMU1.1 Q4WUT7.1
    Q87414.1 Q5AAT0.1 Q5ANE3.1 P12461.1 B8N0Q7.1 Q4WMU3.1 Q4WGB7.1 Q4WIQ2.1
    Q9UWF6.1 Q59QD6.1 Q59506.1 Q59TN1.1 B8N513.1 Q4WQG5.1 A4DA73.1 Q4X022.1
    Q9UW12.1 Q5AML1.1 P87185.1 Q5A416.1 B8N4F5.1 Q4WPE9.1 Q4WD81.1 Q4WQZ0.1
    Q5AAL9.1 Q5ACM9.1 Q5AM50.1 043133.1 B8NT06.1 Q4WAZ4.1 Q4WHG0.1 Q4WE58.1
    Q5AD56.1 Q59Z14.1 Q9B8C8.1 Q59MI8.1 B8NHF2.1 Q4WLN7.1 Q4WAJ6.1 Q4WJR4.1
    Q5A757.1 Q5AAG1.1 Q9B8C9.1 Q5A302.1 B8MWR8.1 Q4WRB0.1 Q4WCL1.1 Q4WQZ1.1
    P28870.1 Q59YL9.1 Q9B8D2.1 Q5AH60.1 B8N4G0.1 Q4WC55.1 Q9HEQ8.1 Q4WQY7.1
    Q59NX5.1 Q59PL9.1 Q9B8D1.1 Q5A692.1 B8N9M5.1 Q4WMV5.1 Q4WEN1.1 Q4WQY5.1
    Q5ABG1.1 Q59QL0.1 Q59M69.1 Q59Q39.1 Q00278.1 Q4WAZ2.1 Q4WI37.1 Q4WXT2.1
    Q5AP52.1 Q5A1U8.1 Q59VX9.1 Q59NW5.1 B8NPX1.1 Q92197.1 Q4WZ51.1 Q8J130.1
    P0CY31.1 O74198.1 Q59YD8.1 Q5A6Q4.1 B8NYW8.1 Q4WSE8.1 Q4WDA4.1 Q4WJX5.1
    P13649.1 Q5A013.1 Q59QH0.1 P43075.1 B8N219.1 Q4WX94.1 Q4WLS7.1 Q4X1I8.1
    Q5AG77.1 P87163.1 Q5A8A2.1 Q59Q36.1 B8NQK0.1 Q4WLD0.1 Q4WWM6.1 Q4WVW4.1
    Q9UW13.1 Q5AI86.1 Q9B8D7.1 Q92410.1 Q12732.1 Q4WUK5.1 Q4WP81.1 Q4WTH1.1
    P0CU34.1 Q5AM80.1 Q9UW25.1 Q5A1M4.1 Q9HEY7.1 Q8TGG5.1 Q6MYT0.1 Q4WLI9.1
    P40954.1 Q5A6Q7.1 Q59XY9.1 Q5ANC8.1 Q6UEG8.1 Q4WTK9.1 Q4WTL0.1 Q4WQJ5.1
    Q04802.1 Q5AGV4.1 Q5A2T0.1 Q5A4K7.1 O42716.1 Q4WVU5.1 Q4WXV2.1 Q4WQJ2.1
    P0CY35.1 Q5AJ82.1 Q5AGW8.1 Q5ADL8.1 Q9UW95.1 Q4WLM7.1 Q4X0Z3.1 Q4WK56.1
    Q5AAU5.1 Q5AIA1.1 Q5ADS3.1 Q59RQ2.1 Q9Y8D9.1 Q4W9P4.1 Q4WN25.1 Q4WJS2.1
    Q59VQ8.1 Q5A9Z6.1 Q5ACR4.1 Q5APC0.1 A2SZW8.1 Q4WIT0.1 Q4WN21.1 Q4WJT9.1
    Q59VF4.1 Q5AGC1.1 P0CU36.1 Q5A931.1 Q2U2U3.1 Q4WQB9.1 Q4X1N0.1 Q4WUV8.1
    Q5A0X8.1 Q59ZV5.1 Q5A2Y7.1 Q59VW7.1 Q00258.1 Q4WGK6.1 Q4WQV2.1 Q4WX68.1
    O13426.1 Q59VP7.1 Q5A368.1 Q5AKU5.1 Q12437.1 Q4WMR0.1 Q4WZP2.1 Q4WHN8.1
    Q5A0M4.1 Q5A7P3.1 Q9B8D6.1 Q59MN0.1 E9QYP0.1 Q4WYE5.1 Q4WVK2.1 Q4WJU8.1
    Q59PF9.1 Q5A6K8.1 Q9B8D0.1 Q59WH7.1 Q4WS76.1 Q4WZ01.1 Q4WUA0.1 Q4WBT4.1
    Q5AFP3.1 Q5AD13.1 Q5A2K0.1 Q96WL3.1 Q4WMJ7.1 Q4W930.1 A4DA84.1 Q4WZV6.1
    Q5AEK8.1 Q04782.1 Q5A1Q5.1 Q59ZX6.1 P28296.1 Q4WBR0.1 Q4WJX0.1 Q4WUV9.1
    Q5AFK0.1 Q5A0J9.1 Q5AEM5.1 Q59MU1.1 E9RAH5.1 Q4WHD1.1 Q4WP38.1 Q4WLV2.1
    Q5APD4.1 Q59ZZ6.1 Q5AK25.1 Q5A0J0.1 Q4WW81.1 Q4WTB3.1 Q4X1D7.1 Q4WFS2.1
    Q5ADQ9.1 Q5AH25.1 Q5AK10.1 Q59WK2.1 Q50EL0.1 Q4WRV9.1 Q4W9Z9.1 Q4WBM1.1
    P83779.1 Q59XM1.1 Q5AI15.1 P43073.1 Q4WY82.1 Q4X267.1 Q4WE62.1 Q4WAU7.1
    Q5AAH2.1 Q59NN8.1 Q5AEM8.1 P87220.1 Q4WSF6.1 Q4WVZ3.1 Q4WZL3.1 Q4WZS3.1
    O74254.1 Q5AP65.1 Q5A4J4.1 Q5ABD9.1 E9RCK4.1 Q4WR24.1 Q4WB37.1 Q4WPU9.1
    Q5AL49.1 Q5AFF7.1 Q59YK4.1 P83781.1 Q4WZA8.1 Q4WPM8.1 Q4W9Z4.1 Q4WVZ0.1
    P53697.1 Q59VR3.1 Q59WV0.1 Q5ANB1.1 Q4WAW7.1 Q4WE86.1 Q4WDD0.1 Q4WCX9.1
    Q5ACL7.1 Q5AFH3.1 Q5ABB1.1 Q5A0E2.1 Q92405.1 A4DA70.1 Q4WKB9.1 Q4WJ38.1
    Q5AEM6.1 P83780.1 Q5APK0.1 Q5AMG5.1 Q4WRY5.1 Q4WW45.1 Q4WU07.1 Q4WRC2.1
    Q8TG40.1 Q5A4G9.1 Q59PW0.1 Q5A6T8.1 Q7Z7W6.1 Q4WVG2.1 Q4WBL6.1 Q4WWW5.1
    Q59X38.1 Q59NQ9.1 O74711.1 Q59WG5.1 Q4WZ67.1 Q4WQG9.1 Q4WX13.1 Q4WC84.1
    Q59VQ3.1 A0A1D8PNP3.1 Q5ADN9.1 Q5AI80.1 Q4WZB3.1 Q4WQN1.1 Q4WV71.1 Q4WTW3.1
    Q5A7Q2.1 Q5A9Z1.1 Q5ACP5.1 Q5AB49.1 Q4WLN1.1 Q4WCF1.1 Q4X0C2.1 Q4WFV6.1
    Q5AJV5.1 A0A1D8PK89.1 Q5A1E1.1 Q59R32.1 Q4WR82.1 Q4WZC3.1 Q4WRU4.1 Q4WKD9.1
    Q5A3Z6.1 Q59WB3.1 Q59L86.1 Q5A061.1 O14434.1 Q4WYX7.1 Q4WGS4.1 Q4WP10.1
    Q5A201.1 Q59ZC8.1 Q5AD23.1 Q59P50.1 Q4WMK0.1 Q4X0A5.1 Q4WP13.1 C5JZM2.1
    O93827.1 Q5A1L6.1 Q5A5U6.1 Q59WC6.1 Q4WPX2.1 Q4WUD3.1 Q4WHG5.1 P0DJ06.1
    Q5AAI8.1 A0A1D8PN14.1 Q5ADQ7.1 Q5AI48.1 O43099.1 Q4WS49.1 Q4WPF7.1 P46598.1
    Q5A2J7.1 Q5A8X7.1 Q59WJ4.1 Q59ZU1.1 Q4WJ81.1 Q4WCX7.1 Q4WH83.1 P87020.1
    P22011.1 Q59X39.1 Q5AGV7.1 Q5AG56.1 P67875.1 Q4WXX5.1 Q4WXW1.1 P38110.1
    Q9HGT6.1 Q5ACW6.1 Q59NR8.1 Q59T36.1 Q4WZB4.1 Q4WNB5.1 Q8NJM2.1 C1GK29.1
    Q9UW26.1 P0CB54.1 Q5A5K7.1 Q9P840.1 E9QUT3.1 O42799.1 Q4WWD3.1
    Q59LX5.1 A0A1D8PN88.1 Q5A210.1 Q5ABB8.1 Q4WAZ9.1 Q4WHA3.1 Q4WPU8.1
    Q59PT0.1 A0A1D8PMB1.1 Q59N10.1 Q5AKU3.1 Q4WZ70.1 Q4W9M3.1 Q4WN99.1
    Q3MNT0.1 Q5ABR2.1 Q5A1B3.1 Q59ZW4.1 E9RBR0.1 Q4WVH5.1 P0C959.1
  • TABLE 6
    LIST OF ACCESSION NUMBERS FOR ALLERGENS FROM IEDB &
    ALLERGENONLINE
    P19594.1 P28335.1 P29000.1 M5ECN9.1 P38948.1 P00709.1 P79085.1
    P49148.1 Q6R4B4.1 P42037.1 Q9HDT3.1 P42058.1 P0C0Y4.1 P27759.1 Q2KN25.1
    P00304.1 Q2KN24.1 Q2KN27.1 P43174.1 P10414.1 Q8L5L5.1 Q8GZP6.1 Q8H2B8.1
    Q7Z1K3.1 A1IKL2.1 Q7M1X6.1 P49372.1 P00630.1 P43238.1 Q45W87.1 Q6PSU2.1
    O82580.1 Q647G9.1 Q9SQH1.1 C7E3T4.1 H6VGI3.1 Q84ZX5.1 A0PJ16.1 P67875.1
    P40292.1 P28296.1 P79017.1 Q96X30.1 Q4WWX5.1 O60024.1 Q92450.1 Q09072.1
    Q09097.1 P04403.1 P15494.1 P25816.1 P43187.1 Q39419.1 O65002.1 P05814.1
    P13916.1 Q9UAM5.1 P54958.1 D0VNY7.1 P54962.1 O18598.1 Q1A7B3.1 Q9NG56.1
    A0ERA8.1 Q8MUF6.1 A7IZE9.1 O96870.1 P02663.1 P02666.1 P02668.1 Q28133.1
    P00711.1 P02754.1 P02769.1 P02662.1 O18873.1 P49822.1 P09582.1 B5KVH4.1
    Q14790.1 E9R5X9.1 Q96385.1 Q7M1E7.1 P02229.1 Q7XCK6.1 P40108.1 P42039.1
    P42040.1 P42059.1 P0C0Y5.1 P02465.1 Q6IQX2.1 P20023.1 Q08407.1 Q8S4P9.1
    Q9ATH2.1 Q8W1C2.1 P18632.1 P43212.1 Q9SCG9.1 Q9M4S6.1 Q69CS2.1 Q96VP3.1
    O04701.1 O04725.1 P94092.1 P04800.1 Q7M1X8.1 Q41183.1 P93124.1 P82946.1
    O04298.1 Q58A71.1 Q23939.1 Q967Z0.1 Q1M2P5.1 Q94507.1 Q8MVU3.1 Q86R84.1
    Q00855.1 P49275.1 Q26456.1 P08176.1 Q8NON0.1 P49278.1 Q2L7C5.1 P39675.1
    Q9Y197.1 P14004.1 P49273.1 Q7Z163.1 Q9UL01.1 O15315.1 P11388.1 P30575.1
    Q95182.1 P41091.1 O15371.1 P25780.1 Q2PS07.1 P49327.1 P30438.1 Q5VFH6.1
    Q7XAV4.1 P04075.1 Q90YL0.1 P01005.1 P01012.1 P19121.1 P02230.1 P02224.1
    P02227.1 Q9NJQ6.1 O65809.1 P26987.1 P04776.1 P04347.1 P04405.1 P08238.1
    P12031.1 P15252.1 Q7Y1X1.1 P52407.1 O82803.1 Q39967.1 P02877.1 P62805.1
    P43216.1 O23972.1 P24337.1 Q7Y1C1.1 P93198.1 Q9SEW4.1 Q2TPW5.1 P81294.1
    P81295.1 O64943.1 P07498.1 Q84UI1.1 P80384.1 P31025.1 Q004B5.1 P14946.1
    Q7M1X5.1 P14947.1 P14948.1 Q5TIW3.1 Q40237.1 P14174.1 Q5H786.1 P30440.1
    P11589.1 P43211.1 P40967.1 Q01726.1 Q16655.1 Q07932.1 Q9ZNZ4.1 Q9H009.1
    P12036.1 Q15233.1 Q5RZZ3.1 Q8GZB0.1 Q8NFH4.1 P19963.1 Q94G86.1 P01014.1
    P22895.1 P43217.1 P55958.1 B8PYF3.1 O75475.1 O24554.1 Q0IX90.1 Q52PJ2.1
    K7VAC2.1 Q3Y8M6.1 Q9URR2.1 Q9P8G3.1 A1KYZ2.1 P23284.1 Q9TZR6.1 Q25641.1
    P00433.1 Q41260.1 P56164.1 Q40967.1 Q8H6L7.1 P35079.1 Q9XG86.1 P43214.1
    Q5ZQK5.1 Q40960.1 P43215.1 O82040.1 Q8L5D8.1 P82242.1 Q9HCM2.1 Q9ZP03.1
    Q9FPR0.1 B6T2Z8.1 Q9C5M8.1 P15722.1 P25788.1 P81651.1 O24248.1 P82534.1
    E3SH28.1 O65457.1 B6RQS1.1 P02761.1 P67876.1 Q9Y4W2.1 Q9ULX3.1 P83181.1
    Q8L5K9.1 C1KEU0.1 Q91482.1 Q9XHP1.1 P15322.1 Q15020.1 B9SA35.1 P01267.1
    O00267.1 D2T2K3.1 Q9T0P1.1 Q07283.1 Q7M3Y8.1 P25445.1 Q5NT95.1 P07101.1
    O15205.1 O00762.1 D2KFG9.1 H9AXB3.1 Q8W3V4.1 P49370.1 Q05110.1 Q9ULJ6.1
    Q2VST0.1 ABL09307.1 ABL09312.1 AGC39172.1 AGC39173.1 AGC39174.1 P00785.4 P85204.1
    AGC39168.1 CAM31908.1 ABB77213.1 P83958.1 AGC39176.1 CAA34486.1 AAA32629.1 A5HII1.1
    CAM31909.1 P85206.1 P86137.2 P85524.1 CAI38795.2 ABQ42566.1 AAR92223.1 P84527.1
    AGC39164.1 AGC39165.1 AGC39166.1 AGC39167.1 4X9U_B AGC39169.1 AGC39170.1 AGC39171.1
    AAC37218.1 P50635.2 XP_ P18153.2 AAB58417.1 ABF18122.1 XP_ XP_
    001657556.2 001653462.1 001654143. 1
    XP_ ABF18258.1 XP_ XP_ P13080.1 E37396 Q7M1X7 Q7M1X9
    001654291.1 001655948.1 001655954. 1
    AAB24432.1 CAA76831.1 AAB47552.1 AAM77471.1 AAS75297.1 3V0R_A 4AUD_B CAA55071.2
    P49148.1 Q6R4B4.1 P78983.2 Q00002.2 AAB48041.1 P42037.1 Q9HDT3.2 P42058.1
    OWY50380.1 AA091800.1 P0C0Y4.2 AGS80276.1 CAD38167.1 AB126088.1 ACP43298.1 AKV72168.1
    P27759.1 P27760.1 P27761.1 P28744.1 AAA32669.1 CBW30986.1 CBW30987.1 CBW30988.1
    CBW30989.1 CBW30990.1 CBW30991.1 CBW30992.1 CBW30993.1 CBW30994.1 CBW30995.1 AAX77686.1
    P27762.1 CBJ24286.1 CBK52317.1 CBK62693.1 CBK62694.1 CBK62695.1 CBK62697.1 CBK62698.1
    CBK62699.1 O04004.1 AAP15203.1 AAP15202.1 AAP15201.1 AAX77687.1 AAX77688.1 5EM1_A
    5EV0_B AAX77684.1 AAX77685.1 AHA56102.1 5EGW_B P00304.2 P02878.1 AAA20065.1
    AAA20067.1 AAA20064.1 AAA20066.1 AAA20068.1 P10414.2 AEK65120.1 AAM73729.1 AAM73730.2
    AAN76862.1 AAL91665.1 O23791.1 Q94JN2.1 CDZ09832.1 A0060026.1 AGC60027.1 AGC60028.1
    AGC60020.1 Q7Z1K3.1 AGC60035.1 AGC60036.1 ACZ95445.1 BAJ78220.1 BAJ78221.1 BAJ78222.1
    BAJ78223.1 AGC60029.1 AGC60030.1 AGC60031.1 BAT62430.1 AAF75225.1 Q9NJA9.1 Q9NAS5.1
    AEQ28167.1 P83885.1 CAK50389.1 BAF43534.1 ABL77410.1 BAF75681.1 BAF75704.1 BAF75705.1
    BAF75706.1 BAF75707.1 BAF75708.1 BAF75709.1 BAF75710.1 BAF75711.1 BAF75712.1 ABV55106.1
    CAB58171.1 G37396 Q7M1X6 Q7M1Y0 A59055 AAK09361.1 Q7M415.1 P01502.1
    P00630.3 ABF21077.1 ABF21078.1 Q08169.1 AC125605.1 Q5BLY5.1 CAA26038.1 MEHB2
    NP_001119715.1 NP_001035360.1 ABD51779.1 NP_001011564.1 AAY21180.1 CAD56944.1 AHM25038.1 AHM25037.1
    AHM25036.1 AHM25035.1 P49372.1 P92918.1 ACV04796.1 AAD29409.1 P81943.3 P86809.1
    AAB22817.1 P43237.1 P43238.1 AAT00595.1 AAT00594.1 AAT00596.1 ADQ53858.1 3SMH_A
    3S7E_A B3EWP3.1 C0HJZ1.1 B3EWP4.1 AAN77576.1 AAM78596.1 AAK96887.1 ACN62248.1
    AAC63045.1 AAD47382.1 AAM46958.1 AAM93157.1 AB117154.1 ACH91862.1 3C3V_A ADQ53859.1
    AAD55587.1 ADB96066.1 AGA84056.1 AAD56337.1 AAL37561.1 1W2Q_A Q647G9.1 AAD56719.1
    ABW17159.1 AAQ91847.1 ABP97433.1 ACA79908.1 ABG85155.1 ABX56711.1 ABX75045.1 AAU21499.2
    AAU21500.1 AAZ20276.1 Q45W86 CAG26895.1 2X45_A AHF71021.1 AHF71022.1 AHF71023.1
    AHF71024.1 AHF71025.1 AHF71026.1 AA024900.1 CAK50834.1 P00088.1 ACE07186.1 ACE07187.1
    ACE07188.1 ACE07189.1 CAD12861.1 CAD12862.1 5EM0_A AAX85388.1 AAX85389.1 CAD23611.1
    CAD23613.1 CAD23614.1 BAH09387.1 AAD13644.1 AAD13645.1 AAD13647.1 AAD13649.1 AAD13650.1
    AAD13651.1 AAD13652.1 AAB93837.1 AAB93839.1 AAD13646.1 ACN32322.1 AAB26195.1 Q06811.2
    2XV9_A P46436.3 Q9UVU3 CAA06305.1 AAF86369.1 P67875.1 CAA59419.1 CAB44442.1
    CAA73782.1 AAB07620.1 P79017.2 AAK49451.1 Q96X30.3 AAM43909.1 Q8NKF4.2 CAI78448.1
    CAI78449.1 CAI78450.1 AAB95638.1 CAM54066.1 CAA04959.1 O60024.2 CAA83015.1 P46075.3
    AAB60779.1 Q92450.3 O42799.2 CAB64688.1 Q9UUZ6.2 CAA11266.1 Q87519.1 EAL89830.1
    Q4WB37.1 KEY81716.1 KEY78748.1 AAA32702.1 CAB06417.1 AAD13106.1 P0C1B3.1 AAA32708.1
    P12547.2 ADE74975.1 P29600.1 P00780.1 AAG31026.1 BAA05540.1 BAF46896.1 AIV43661.1
    BAH10149.1 P04403.2 AA038859.1 A45786 CAA54696.1 CAA54695.1 CAA54694.1 CAA96546.1
    CAA96539.1 CAA96540.1 CAA96541.1 CAA96542.1 CAA96543.1 CAA96544.1 CAA96547.1 P43186.2
    CAB02155.1 CAB02156.1 CAB02157.1 CAB02158.1 CAB02159.1 CAB02160.1 CAB02161.1 CAA96545.1
    CAA05186.1 CAA05187.1 CAA05188.1 CAA05190.1 CAA07318.1 CAA07319.1 CAA07323.1 CAA07324.1
    CAA07325.1 CAA07326.1 CAA07327.1 CAA07329.1 CAA07330.1 CAA04823.1 CAA04826.1 CAA04827.1
    CAA04828.1 CAA04829.1 AAD26560.1 AAD26561.1 AAD26562.1 P43180.2 1QMR_A AAP37482.1
    1LLT_A AAB20452.1 CAA07328.1 CAA07320.1 CAA54488.1 1B6F_A 4BK7_A 4B9R_A
    4BKC_A 4BKD_A 4BK6_B CAA33887.1 CAA54482.1 CAA54483.1 CAA54484.1 CAA54487.1
    CAA54489.1 CAA54421.1 CAA54481.1 4BTZ_A 4Z3L_D B45786 1CQA_A AAA16522.1
    A4K9Z8.1 CAA55854.1 CAA60628.1 AAG22740.1 CAC84116.1 AHF71027.1 BAB21489.1 BAB21490.1
    BAB21491.1 AAB25850.1 AAB25851.1 AJ053282.1 AAB29344.1 AAB29345.1 ACM24358.1 ABC86902.1
    AAD13531.1 AAD13530.2 ABC68516.1 1YG9_A ABP35603.1 AAA86744.1 3LIZ_A ACY40650.1
    ACY40651.1 AAA87851.1 ABP04043.1 ACJ37389.1 ACF53836.1 ACF53837.1 ABP04044.1 AAB72147.1
    ABB89296.1 ABB89297.1 ABB89298.1 AAF72534.1 ABX57814.1 AAK58415.1 AAQ24541.1 ABU97466.1
    AAM83103.1 AAA78904.1 2MFK_A AAC80579.1 ABH06350.1 ABH06347.1 ABH06346.1 ABH06348.1
    AAX34047.1 AAM10779.1 AAQ24542.1 AAQ24543.1 AAD10850.1 ABH06352.1 ABH06359.1 2JMH_A
    APU87558.1 APU87557.1 APU87556.1 APU87554.1 AAQ24545.1 ASX95438.1 AAP35069.1 ACV04860.1
    Q7M4I6.1 Q7M4I3.1 P82971.1 P0CH88.1 ABB88514.1 XP_005902099. 2 AAA62707.1 AAA30429.1
    AAA30478.1 NP_851372.1 ABW98943.1 ABW98945.1 ABW98953.1 NP_776953.1 AAA30430.1 AAA30431.1
    AAB29137.1 AAA30433.1 NP_776719.1 Q28133.1 Q28050.1 CAA29664.1 AAA30615.1 CAA32835.1
    AAA30413.1 P02754.3 ACG59280.1 AAA51411.1 CAA76847.1 NP_776945.1 NP_851341.1 P80207.1
    P80208.1 S65144 S65145 AAN86249.1 XP_013623213.1 S65143 CAA46782.1 BAA09634.1
    P69199.1 P81729.1 CAA57342.1 AAN11300.1 P30575.1 AAC48794.1 CAD82911.1 CAD82912.1
    AAC48795.1 AAB30434.1 CAA76841.1 BAC10663.1 ACY38525.1 AHY24648.1 CAA68720.1 CCF72371.1
    CCK33472.1 CAC34055.2 CAD10376.1 AAB02650.1 CAA47357.1 CAB02206.1 CAB02207.1 CAB02208.1
    CAB02215.1 CAB02216.1 CAB02217.1 AAB20453.1 ABZ81044.1 ABZ81040.1 ABZ81043.1 ABZ81042.1
    ABZ81041.1 AAB34907.1 AAB34908.1 AAB34909.1 CAA47366.1 CAB02209.1 CAB02213.1 CAA47367.1
    AAO32314.1 ABW86978.1 ABW86979.1 ABV49590.1 5E1R_F ABM53030.1 CAD10374.1 ACJ23862.1
    ACJ23861.1 ACJ23863.1 CAA64868.1 ADN39439.1 2MC9_A P83507.1 CAX62129.1 CAX62130.1
    BAA08246.1 Q7M1E7.1 BAF32143.1 AAF35431.1 AAL07319.1 AAL92870.1 ACR77509.1 AAL92871.1
    A2V735.1 CAA09938.2 P02229.2 P02230.1 P02221.2 P84296.1 P02227.1 P12548.1
    P84298.1 P12549.1 P12550.1 P02226.2 P02222.2 P02223.2 P02224.2 P02231.1
    P02228.1 AAU43733.1 P84160.1 P84159.1 CAI23765.1 P84161.1 CAH03799.1 ADK47394.1
    ABQ59329.1 CAQ72970.1 CAQ72971.1 CAQ72972.1 AAK67491.1 AAK67492.1 ACF19589.1 ABC88428.1
    AGL34968.1 ADH10372.1 AGL34967.1 CAB39376.1 CAA50325.1 CAA50326.1 CAA50328.1 CAA96548.1
    CAA96549.1 AAD48405.1 AAG40329.1 AAG40330.1 AAG40331.1 CAA50327.1 AAL86739.1 AAO67349.2
    AAO65960.1 ACO56333.1 AAK01235.1 AAK01236.1 A4KA41.1 A4KA40.1 A4KA44.1 A4KA43.1
    A4KA45.1 A4KA39.1 AAK28533.1 AAL73404.1 AHA36627.1 ACR43473.1 ACR43474.1 ACR43475.1
    ACR43477.1 ACR43478.1 ACR43476.1 BAH10152.1 ARX70262.1 AAC61869.1 AAW81034.1 BAD77932.1
    BAA05543.1 BAA05542.1 BAA07020.1 P43212.1 BAC23082.1 BAC23083.1 BAC23084.1 BAF32105.1
    BAF32110.1 BAF32116.1 BAF32119.1 BAF32122.1 BAF32128.1 BAF32130.1 BAF32133.1 BAF32134.1
    BAA06172.1 BAF45320.1 AAK27264.1 BAI94503.1 BAJ04354.1 BAF51970.1 BAA06905.1 CAD92666.1
    AAW69549.1 P83834.1 ACB45874.1 AAP13533.2 CAB62551.1 CAC37790.2 ABK78766.1 ACY01951.1
    CAC05258.1 AAF72625.1 AAF72626.1 AAF72627.1 AAF72628.1 AAF72629.1 AAR21074.1 AAR21073.1
    AAB28566.1 AAB28567.1 AAB32317.1 AAF80379.2 AAK96255.1 AAL14077.1 AAL14078.1 AAL14079.1
    AAB50734.2 CAA69670.1 CAA01909.1 CAA01910.1 CAA62634.1 AAS02108.1 CAC83658.1 CAC83659.1
    CAD20406.1 AAP96759.1 2103117A CAA10345.1 AAB42200.1 P82946.1 AAK62278.1 CAD20405.1
    AEY79726.1 AAB01092.1 BAA13604.1 CAB03715.1 CAB03716.1 CAB06416.1 AAL76932.1 BAB88129.1
    ADL32660.1 ADL32661.1 ADL32662.1 ADL32663.1 ADL32664.1 ADL32665.1 ADL32666.1 AAL76933.1
    AEY79728.1 AEY79727.1 CAA55072.2 CAA55067.2 CAA55070.1 P42040.2 CAA55068.1 AAO91801.1
    AAX14379.1 P40918.1 CAD42710.1 ABA42918.1 CAD38166.1 ATI08931.1 L7UZ85.1 AAP35078.1
    AAD52672.1 AAM64112.1 AAP57094.1 ABU97470.1 AIO08850.1 AGI78542.1 AGC56216.1 AIO08860.1
    AAP35082.1 AIO08851.1 AGC56218.1 AIO08848.1 AAP35065.1 AGC56219.1 AIO08870.1 AIO08861.1
    BAX34757.1 BAE45865.1 AAP35068.1 ABO84970.1 ABO84971.1 ABO84972.1 ABO84973.1 P16311.2
    BAC53948.1 ABA39436.1 ABU49605.1 AAP35075.1 AFJ68066.1 ADM52184.1 ABL84749.1 ABL84750.1
    ABL84751.1 BAA04557.1 AAK39511.1 AIO08864.1 P39673.1 BAA04558.1 BAA01240.1 BAA01241.1
    AAL47677.1 CAI05850.1 CAI05849.1 CAI05848.1 ABA39438.1 BAD74060.2 AAP35073.1 AFJ68072.1
    BAA01239.1 ABN14313.1 AAA99805.1 ABY28115.1 ACK76291.1 ACK76292.1 BAA09920.1 AAB27594.1
    ACK76296.1 ACK76297.1 AAF28423.1 AAP35077.1 ACK76299.1 AIO08853.1 AAM19082.1 ABO84963.1
    ABO84964.1 ABO84966.1 ABO84967.1 ABO84968.1 ABO84969.1 AHC94806.1 BAV90601.1 AHX03180.1
    AIP86946.1 AIP86945.1 AIP86944.1 AIP86943.1 AIP86942.1 AIP86941.1 AIP86940.1 AIP86939.1
    AJF93907.1 AAP35080.1 AIO08867.1 AIO08866.1 P16312.1 ATI08932.1 AAY84565.1 AAY84564.2
    ACD50950.1 ALA65345.1 AAG02250.1 CAD38361.1 CAD38362.1 CAD38363.1 CAD38364.1 CAD38365.1
    CAD38366.1 CAD38367.1 CAD38368.1 CAD38369.1 CAD38370.1 CAD38371.1 AAX47076.1 2AS8_B
    ABV66255.1 3F5V_B ACG58378.1 CAQ68250.1 AAA28296.1 AAB60215.1 AFJ68065.1 ABA39435.1
    AAB69424.1 CAA75141.1 ABB52642.1 ACI32128.1 AAO73464.1 ADK92390.1 AAM21322.1 1KTJ_A
    CAD38372.1 CAD38373.1 CAD38374.1 CAD38375.1 CAD38376.1 CAD38377.1 CAD38378.1 CAD38379.1
    CAD38381.1 CAD38382.1 CAD38383.1 ABA39437.1 CAK22338.1 ABG76196.1 1A9V_A ABY53034.1
    AAF86462.1 CAQ68249.1 AFJ68070.1 AFJ68067.1 ABC73706.1 ACB46292.1 4ZCE_A ALA22869.1
    ALA22868.1 AAA19973.1 AAD38942.1 P49274.1 AAB32842.1 CAD69036.1 CAA35692.1 P49277.1
    AAA80264.1 CAC09234.1 AAB35977.1 AAB32224.1 AAX37326.1 AAY84563.1 ABC96702.1 AAA28303.1
    P53357.1 CAA47341.1 AAA68279.1 AAA28301.1 AAA28302.1 P83340.1 AAC48691.1 P81216.1
    P81217.1 CAA52194.1 AAM09530.3 BAF47268.1 BAF47269.1 AAO73305.1 ABO71783.1 BAF76431.1
    BAF76430.1 AAC82351.1 AAC82352.1 AAC82350.1 AAC82349.1 BAK09233.1 BAK09232.1 BAB79444.1
    BAO50872.1 BAO50870.1 AAX57578.1 ABC18306.1 O23878.1 O23880.1 Q9XFM4.1 ABQ10638.1
    BAT21117.1 ABO93594.1 ADW27428.1 ABI32184.1 ACJ23865.1 ACJ23864.1 ACJ23866.1 AAZ76743.1
    CAA44343.1 CAA44344.1 P30438.2 AAC37318.1 NP_001041618.1 CAA44345.1 AAC41616.1 CAA59279.1
    AAL49391.1 AAS77253.1 ADK56160.1 ADM15668.1 AAS98889.1 AAS98890.1 AGT20779.1 AEM89226.1
    ACD65080.1 ACD65081.1 CAJ85646.1 CAJ85644.1 CAJ85642.1 CAJ85641.1 ABD39049.1 ACX47057.1
    ACX47058.1 4C9C_B CAC86258.1 AAY83342.1 AAY83341.1 AAY83345.1 AHL24661.1 AHL24660.1
    AAQ83588.1 AAV74343.1 AAQ08947.1 BAH10153.1 AAN73248.1 AAL79930.1 AAL79931.1 AHY02994.1
    P02622.1 AAK63086.1 AAK63087.1 CAM56785.1 CAM56786.1 B3A0L6.1 P86980.1 NP_990450.1
    P01005.1 ACJ04729.1 CAA23681.1 P01012.2 CAA23682.1 1JTI_A 1UHG_D CAA26040.1
    P02789.2 P00698.1 AAA48944.1 CAA23711.1 CAA43098.1 BAA13973.1 P02604.3 CAX32963.1
    ADD18879.1 ADD19985.1 ADD19989.1 AAF82096.1 ACS49840.1 P24337.1 CAA11755.1 ABU97472.1
    CAA11756.1 CAA42646.1 CAA35691.1 AAA33947.1 BAA23360.2 AAB01374.1 BAB64303.1 BAA74452.2
    BAB64306.1 P25974.1 CAA26723.1 AAA33966.1 CAA26575.1 BAA00154.1 CAA33217.1 CAA37044.1
    CAA26478.1 BAA74953.1 AAA33964.1 AAA33965.1 BAB15802.1 AAD09630.1 NP_001238443.1 ACD36976.1
    ACD36975.1 ACD36974.1 ACD36978.1 BAB21619.2 P22895.1 AAB09252.1 BAA25899.1 P82947.1
    CAA45777.1 CAA45778.1 AAB23464.1 AAB23482.1 AAB23483.1 CAA56343.1 CAA60533.1 CAB59976.1
    CAB76459.1 AAQ54603.1 BAH10148.1 BAJ61596.1 AAG08987.1 APG42675.1 CAA75506.1 AAP47226.1
    P23110.1 CAB38044.1 CAA39880.1 AAA16792.1 CAB53458.1 CAC13961.1 CAC42881.1 AAL25839.1
    AAP37470.1 ADR82196.1 CCW27997.1 AAA87456.1 AAP87281.1 ABN03965.1 ABN03966.1 ABN09653.1
    ABN09654.1 ABN09655.1 ACY91851.1 ACZ74626.1 AEV41413.1 AFJ97275.1 AFJ97274.1 AAC82355.1
    AAR98518.1 AAC49447.1 CAA05978.1 1WKX_A ABW34946.1 AAC27724.1 CAA11041.1 CAA11042.1
    AAF25553.1 CAE85467.1 CAA75312.1 1G5U_A AAF34341.1 AAF34342.1 AAF34343.1 CAB51914.1
    CAB96215.1 CAC00532.1 Q9LEI9.1 CAD24068.1 CAA81610.1 CAA93121.1 CAA10140.1 Q7M262
    CAB10766.1 CAB10765.1 AAG42255.1 AAC48288.1 AAC48287.1 P32936.2 P80198.1 CAA51204.1
    CAA42832.1 AAA32970.1 CAA35188.1 CAA08836.1 CAA41956.1 CAA49555.1 CAA45085.1 CAA46705.1
    AAP94213.1 AAP15200.1 AAP15199.1 AAM54365.1 AAM54366.1 APR62629.1 AAB41308.1 AAF18269.1
    ACI47547.1 AAW29810.1 CAC05582.1 P81295.1 AAD03608.1 CAC48400.1 AAC15474.2 AAR21072.1
    AAR21071.1 Q9LD79.2 AAF80164.1 AAF80166.1 AAV97933.1 AAT45383.1 AAX35807.1 CAD87730.1
    CAD87731.1 AAQ55550.1 CAB71342.1 CAB62213.1 CAD32313.1 CAD32314.1 2118249E 2118249A
    AAQ73484.1 AAQ73486.1 AAQ73487.1 AAQ73488.1 AAQ73489.1 AAQ73490.1 AAQ73491.1 AAQ73492.1
    CAA57160.1 CAA58755.1 AAQ73493.1 AAQ73494.1 CAB62212.1 CAB65963.1 CAP17694.1 CAC84590.2
    CAC84593.2 CAA54818.1 CAA54819.1 AAZ91659.1 BAW03243.1 BAW03242.1 AAL07320.1 ABCO2750.1
    ACM89179.1 ACB38288.1 ABI98020.1 ACC76803.1 P14946.2 AAA63278.1 AAA63279.1 CAB63699.1
    Q7M1X5.1 P14947.1 CAA51775.1 P14948.1 CAH92637.1 AAD20386.1 CAB64344.1 AAA33405.1
    Q40240.2 CAI84850.2 Q53HY0.2 Q6EBC1.1 ABR21771.1 ABR21772.1 ACB05815.1 F5B8W5.1
    F5B8W4.1 F5B8W3.1 F5B8W2.1 F5B8W1.1 F5B8W0.1 F5B8V9.1 B3A0N2.1 ADC55380.1
    AHA85706.1 P86739.1 P86741.1 P86740.1 P86742.1 BAA32435.1 BAA32436.1 AAD25927.1
    CAA65341.1 CAD20981.3 CAD68071.1 CAI43283.4 CAA09883.1 CAA09884.1 CAA09885.1 CAA09886.2
    CAA09887.4 CCU97864.1 CCV00099.1 CCU98198.1 CCU99457.1 SHO79205.1 CCU99206.1 CAA96534.1
    CAA96535.1 CAA96536.1 CAA96537.1 AAD13683.1 AAD26546.1 AAD26547.1 AAD26548.1 AAD26552.1
    AAD26553.1 AAD26554.1 AAD26555.1 AAD26558.1 CAD32318.1 AAO25113.1 AAD29671.1 AAB01362.1
    CAA88833.1 CAA58646.1 AAK13029.1 AAK13030.1 AAK13027.1 AAB35897.1 AAX19848.1 AAX19851.1
    Q9FSG7.1 CAT99612.1 CAT99611.1 AFM77001.1 AAC36740.1 O29330.1 AAT80665.1 AAT80664.1
    AAT80662.1 AAT80659.1 AAT80649.1 AAR22488.1 Q9M5X7.1 CAD46559.1 CAD46561.1 CAD46560.1
    AAX19854.1 AAX19856.1 AAX19858.1 AAX19860.1 CAK93713.1 CAK93753.1 CAK93757.1 CAT99618.1
    CAT99619.1 CAT99617.1 AAD29412.1 AAD29413.1 AAD29414.1 AAM55492.1 AEE98392.1 B3EWS0.1
    B3EWE5.3 G5DC91.2 BAF47263.1 AGF86397.1 CAA73720.1 P86745.1 P86749.1 P86750.1
    P86752.1 P86753.1 P86754.1 P86757.1 P86761.1 P86760.1 P02620.1 P86765.1
    P86768.1 P86769.1 P86770.1 P86771.1 P86772.1 P86774.1 P86775.1 AAD55792.2
    Q99MG7.1 AAA60330.1 AAG08989.1 AHW81906.1 AAV33670.1 AAV33672.1 P85894.1 P02762.2
    CAA26953.1 A2BIM8.1 AAA39768.1 AAK54834.1 2CYG_A 1Z3Q_A CAC81811.1 AAB82772.2
    BAD36780.1 AAB50883.1 CAA49760.1 2206305A AAB36316.1 BAH10150.1 CAE17317.1 CAE17316.1
    BAE54433.1 P19963.2 I53806 E53806 F53806 C53806 A38968 G53806
    E53806 H53806 CAA73038.1 CAA73037.1 CAA73036.1 AAB32652.2 AAO22133.1 AA022132.1
    AAN18044.1 AAQ10281.1 AAQ10280.1 AAQ10279.1 AAQ10278.1 AAQ10277.1 AAQ10276.1 AAQ10274.1
    AAQ10271.1 AAQ10268.1 AAQ08190.1 ABP58632.1 ABP58633.1 ABP58635.1 ABP58636.1 ABP58637.1
    AAL92578.1 AAY88919.1 ACZ57582.1 E1U332.1 E3SU11.1 O24170.1 O24171.1 A4GFC0.1
    A4GFC3.1 CAA73035.1 AAD05375.1 AAO33897.1 P80740.2 CAD21706.2 ABP58627.1 ABX26131.1
    ABX26132.1 ABX26134.1 ABX26138.1 ABX26139.1 ABX26140.1 ABX26141.1 ABX26143.1 ABX26145.1
    ABX26147.1 ABX54842.1 ABX54844.1 ABX54849.1 ABX54855.1 ABX54859.1 ABX54862.1 ABX54864.1
    ABX54866.1 ABX54869.1 ABX54876.1 ABX54877.1 AAB66909.1 P81430.2 AAF31152.1 AAF31151.1
    AAK58515.1 2JON_A BAE54432.1 Q25632.1 BAJ07603.1 P86431.1 P86432.1 BAF95206.1
    AFV53352.1 AAG42806.1 AAG42802.1 Q948T6.2 AAA86533.1 AAF72991.1 BAB71741.1 Q40638.2
    BAD13150.1 BAC20657.1 BAA01998.1 BAA01996.1 BAA07772.1 BAA07773.1 BAA07774.1 BAA07710.1
    BAA07711.1 BAA07712.1 BAA07713.1 AAB99797.1 Q01882.2 Q01883.2 BAC19997.1 BAC20650.1
    ADK39021.1 ACA96507.1 CBY17558.1 AAC38996.1 BAF47265.1 BAF47266.1 2008179A CAA65123.1
    CAA54587.1 CAI94601.1 CAA59370.1 CAA65122.1 P55958.1 Q9T0M8.1 Q9XG85.1 CCP19647.1
    CAP05019.1 Q7M1E8 AAB36008.1 AAB36009.1 AAB36010.1 AAB36011.1 AAB36012.1 AAB46820.1
    AAB46819.1 AKF12278.1 CBM42667.1 CBM42666.1 CBM42665.1 CBM42664.1 CBM42663.1 CBM42662.1
    CBM42661.1 CBM42660.1 ACA23876.1 AAX37288.1 AAO15713.1 C7E3T4.1 ADV17342.1 ADV17343.1
    AAX11194.1 AAF71379.1 AAG44693.2 AAF23726.1 AAM33821.1 AAB34785.1 ADK27483.1 AAD25995.1
    AAG44480.1 Q92260.1 AAK51201.1 AAR17475.1 AAD42074.1 ABB89950.1 ABM60783.1 AAD25926.1
    AEX34122.1 AAG44478.1 AKH04310.1 AKH04311.1 AAX33729.1 AEV23867.1 AAD19606.1 CAB38086.1
    ACS14052.1 AAC34736.1 AAC34737.1 AAB82404.1 AAC34312.1 AAD13533.1 AAP13554.1 ADB92492.1
    AAX33734.1 AAX33727.1 ADR82198.1 AAB09632.1 AAB62731.1 AAB63595.1 Q25641.1 ADB92493.1
    ADD17628.1 AAX33728.1 3EBW_A ACJ37391.1 AAX33730.1 AAT77152.1 ACA00204.1 AAL86701.1
    AAG08988.1 CAB01591.1 AAB27445.1 Q41260.1 P56164.1 P56165.1 P56166.1 P56167.1
    ADC80502.1 ADC80503.1 CAA55390.1 CAA81613.1 1N10_A CAG24374.1 2118271A AAN32987.1
    CAA70609.1 ABG81289.1 ABG81290.1 ABG81291.1 ABG81292.1 ABG81293.1 ABG81294.1 ABG81295.1
    CAA70608.1 CAA54686.1 CAB42886.1 CAA53529.1 CAD54670.2 CAF32567.2 CAF32566.2 CAQ55938.1
    CAQ55939.1 CAQ55940.1 CAQ55941.1 3TSH_A CAD54671.2 CAA52753.1 S32101 S38584
    Q7M1L8 2023228A CAB05371.1 CAB05372.1 CAA50281.1 AAC16525.1 AAC16526.1 AAC16527.1
    AAC16528.1 AAC25994.1 AAC25995.1 AAC25997.1 AAC25998.1 AAK25823.1 CAD38384.1 CAD38385.1
    CAD38386.1 CAD38387.1 CAD38388.1 CAD38389.1 CAD38390.1 CAD38391.1 CAD38392.1 CAD38393.1
    CAD38394.1 CAD38395.1 CAD38396.1 CAD38397.1 1L3P_A CAD87529.1 CAA81609.1 CCD28287.1
    CAA76556.1 CAA76557.1 CAA76558.1 1NLX_N CAA76887.1 3FT1_A AGT28425.1 CAD10390.1
    AHC94918.1 CEJ95862.1 CTQ87571.1 ABU42022.1 ABG73109.1 ABG73110.1 ABG73108.1 AB036677.1
    ABR29644.1 CAF25233.1 CAF25232.1 CAB82855.1 AJG44053.1 A0A158V755.1 A0A158V976.1 2N81_A
    CAC41633.1 CAC41634.1 CAC41635.1 CAD80019.1 ABY21305.1 ABY21306.1 ALF39466.1 ALF00099.1
    CAD20556.1 CAE52833.1 CAC85911.1 CBW45298.1 A60372 F37396 CAA10520.1 AAG42254.1
    P22284.1 P22286.1 A60373 P22285.1 AAA29793.1 AAD52615.1 AAD52616.1 AAT95010.1
    AAS67044.1 AAS67043.1 AAS67042.1 AAS67041.1 AAP37412.1 AAT95009.1 P35780.1 P83377.1
    P83542.1 A2VBC4.1 ADT89774.1 ADL09135.1 P86687.1 ADD63684.1 P86686.1 Q7Z156.2
    P05946.1 AGE44125.1 ABL89183.1 ABS12234.1 AFA45339.1 ACN87223.1 AKV72167.1 AHY24177.1
    BAH59276.1 AAB97141.1 ADR66945.1 ADR66946.1 ADR66947.1 ADR66948.1 AACO2632.1 AAS47037.1
    AAS47036.1 AAS47035.1 1H2O_A AAF26449.1 ADR66943.1 ADR66944.1 AAD29411.1 AAB38064.1
    P82534.1 ACE80974.1 AAL91662.1 3EHK_A AGR27935.1 ADN39440.1 ADN39441.1 P82952.1
    ACE80939.1 ACE80956.1 ACE80958.1 ACE80957.1 ACE80959.1 ACE80955.1 ACE80972.1 P83332.1
    P83335.1 AEV57471.1 ABB78006.1 AJE61291.1 AJE61290.1 P81402.1 AAV40850.1 ADR66939.1
    AGW21344.1 CAD37201.1 CAD37202.1 P86888.1 BAH10154.1 C0HKC0.1 AHB19227.1 AHB19226.1
    AHB19225.1 AAF26451.1 AET05733.1 AET05732.1 AET05730.1 O65200.1 AAD29410.1 AAC24001.1
    ABZ81045.1 ABZ81047.1 ABZ81046.1 CAC83046.1 CAC95152.1 CAC83047.1 CAC95153.1 P02761.1
    Q63213 AAA41198.1 AIS82657.1 AAP30720.1 AAT37679.1 CAA38097.1 ABG54495.1 ABG54494.1
    Q91483.3 ACI68103.1 CAA66403.1 CBL79146.1 ACH70931.1 CBL79147.1 NP_001133181.1 AHL24657.1
    ARS33724.1 AAT99258.1 AAX11261.1 AAX11262.1 ACO34813.1 P83181.1 ACO34814.1 ACS34771.1
    AHL24658.1 ADK22841.1 ADK22842.1 CAX32966.1 CAX32967.1 SHD75397.1 AAO15613.1 AAS93669.1
    AAS93674.1 AAS93675.1 AAS93676.1 AAO15607.1 AAX37321.1 AGM48615.1 CAQ68366.1 BAH10151.1
    Q7M1Y1 C37396 D37396 AAP06493.1 AAC67308.1 XP_003030591.1 BAW32538.1 BAW32537.1
    BAW32536.1 BAW32535.1 BAC66618.1 CAX32965.1 AFA45340.1 AFJ80778.1 ABS12233.1 CAQ72968.1
    CAQ72969.1 AAB37403.1 AAB37406.1 AAB34365.1 CAH92630.1 CAH92627.1 Q7M263 CBG76811.1
    BAE54429.1 BAE54430.1 ACB55491.1 AAK15088.1 ACI41244.1 AAD42943.1 AAK15089.1 AAG23840.1
    ACH85188.1 AAD42942.1 AAD42944.1 AAK15087.1 CAA62909.1 CAA62910.1 CAA62911.1 CAA62912.1
    CAA62908.1 P15322.2 AAX77383.1 AAX77384.1 ABU95411.1 ABU95412.1 ABU53681.1 NP_001306883.1
    NP_001316123.1 CAD10377.1 AAL29690.1 AAL75449.1 AAL75450.1 CAJ19705.1 AAB42069.1 CAA75803.1
    AHC08074.1 AHC08073.1 ABA81885.1 ABB16985.1 CAA31575.1 CAA27571.1 CAA27588.1 AAA33819.1
    P15476.2 P16348.1 P20347.3 AAB63099.1 BAA04149.1 BAH10156.1 AAF65312.1 AAF65313.1
    AAC97370.1 AAC97369.1 AAB36117.1 AAB36119.1 AAB36120.1 AAB36121.1 AAT95008.1 P35775.1
    AAB65434.1 P35776.2 P35779.2 ADD74392.1 AIL01319.1 AIL01318.1 AIL01316.1 AIL01317.1
    AIL01320.1 AIL01321.1 ACT37324.1 1ESF_B CAJ43561.1 P34071.1 P20723.1 P06886.1
    AAT66567.1 ABS29033.1 AAT66566.1 AAD46493.1 AAS75831.1 P00791.3 AAA30988.1 NP_001005208. 1
    P58171.1 S43242 S43243 S43244 ADX78255.1 ADM18346.1 ADM18345.1 ADK47876.1
    P86360.1 CEE03319.1 CEE03318.1 AAK63089.1 AAK63088.1 CBL79145.1 P86978.1 CAX62602.1
    P86979.1 BAE54431.1 BAE46763.1 BAH10155.1 AAF07903.2 AAD52013.1 AAD52012.1 Q8J077.1
    CAD23374.1 P24296.2 CAA42453.1 ACG59281.1 AKJ77988.1 AKJ77986.1 AKJ77987.1 CAI64398.1
    AKJ77990.1 AKJ77985.1 CAA35238.1 CAA25593.1 CAA26383.1 CAA26384.1 CAA26385.1 AAA34275.1
    AAA34276.1 AAA34279.1 AAA34280.1 AAA34281.1 AAA34282.1 AAA34283.1 AAA34284.1 BAA12318.1
    P81496.1 ACE82289.1 BAE20328.1 CAR82265.1 CAR82266.1 CAR82267.1 BAN29067.1 CAI64397.1
    CAI64396.1 P08819.2 P27357.1 ACE82291.1 CAA61945.2 CAA61943.2 CAA61944.2 CAQ57979.1
    CBA13560.1 AAA34272.1 AAA34274.1 AAA34288.1 AAA34289.1 BAA11251.1 CAI78902.1 BAN29066.1
    CAY54134.1 CAB96931.1 CAA43331.1 CAA31396.1 CAA26847.1 CAA24934.1 CAA43361.1 AAB02788.1
    CAA27052.1 CAA24933.1 BAN29068.1 CAA31395.4 AAZ23584.1 BAC76688.1 CAI84642.1 CAA35598.1
    CAZ76052.1 CBA13559.1 CAA35597.1 CAC14917.1 ACE82290.1 Q6W8Q2.1 CAA72273.1 CAB52710.1
    CAZ76054.1 CAA31685.1 CAA30570.1 AAA34285.1 AAA34286.1 AAA34287.1 O22116 CAA59338.1
    CAA59339.1 CAA59340.1 O22108 CAI79052.1 AEH31546.1 BAN29069.1 CAA65313.1 ABS58503.1
    P82977.2 CCK33471.1 APY24042.1 CAA34709.1 CAA39099.1 CAA36063.1 CAA44473.1 AAA34290.1
    AAX34057.1 AAX34058.1 AAX34059.1 AOD75395.1 AOD75396.1 AOD75399.1 ABQ96644.1 ABU97479.1
    AAT40866.1 AAU11502.1 ABM53751.1 ABU97480.1 CAA73221.1 ACL36923.1 ABZ81991.1 AGG10560.1
    AAT66607.1 AAT66609.1 ACH42744.1 AAT66610.1 ACJ65836.1 AGC36415.1 ACH42743.1 ACI44002.1
    ABQ59259.1 ABQ59258.1 ABQ59255.1 ACJ54737.1 ACH42741.1 AGC36416.1 AKV72166.1 AIV43662.1
    BAH10157.1 P0DMB5.1 P0DMB4.1 P0CH87.1 P35781.1 P35782.1 CBY83816.1 CBY93636.1
    P81657.1 P35783.1 CAJ28931.1 P35784.1 CAJ28930.1 CAL59818.1 CAL59819.1 P51528.1
    P35760.1 ABC73068.1 P0CH89.1 P35785.1 P35786.1 P0CH86.1 P35787.1 AAB48072.1
    AAA30333.1 CAB42887.1 1QNX_A P49370.1 CAI77218.1 2ATM_A ACA00159.1 AAX19889.1
    ABG02262.1 ABW23574.1 BAA74451.1 CAA50008.1 P80273.2 P80274.1 P33556.1 CAR48256.1
    ABD79096.1 ABD79097.1 ABD79098.1 ACX37090.1 P29022.1 2209273A AAO45607.1 AAO45608.1
    AAK56124.1 2HCZ_X ABD79094.1 ABD79095.1 ABF81661.1 ABF81662.1 Q1ZYQ8.2 P0C1Y5.1
    AAB86960.1 ABG81312.1 ABG81313.1 ABG81314.1 ABG81315.1 ABG81316.1 ABG81317.1 ABG81318.1
    CAA51718.1 CAA51719.1 CAA51720.1 AAG35601.1 5FEF_A AAA33493.1 AAA33494.1 CAI64400.1
    AAX40948.1
  • TABLE 7
    LIST OF ACCESSION NUMBERS FOR AUTOMIMMUNE ANTIGENS FROM IEDB
    I7HKY1.1 Q9P0J1.1 P61604.1 Q9NUQ2.1 Q9P212.1 P16885.1 P09543.1
    P17980.1 Q99460.1 O00231.1 O00487.1 P48556.1 Q61733.1 P82909.1 P21953.1
    Q9CHK3.1 Q9BYD6.1 Q9BYC9.1 Q96A35.1 Q9P0J6.1 P04035.1 Q99714.1 B2RLH8.1
    P62277.1 P08708.1 P62269.1 P63220.1 P62851.1 P62273.1 P62861.1 P46781.1
    P08865.1 P17643.1 Q9H0D6.1 F5HCM1.1 E5RK45.1 A0A0B7JKK9.1 A1JIP3.1 B2RKS6.1
    P0A6F5.1 P0C0Z7.1 Q49375.1 Q9Z708.1 P0A521.1 P42384.1 P0A520.1 P9WPE7.1
    P10809.1 P10155.1 P05388.1 P05386.1 P05387.1 P27635.1 P62906.1 P40429.1
    P35268.1 A8MUS3.1 P62750.1 P61353.1 P46776.1 P46779.1 P47914.1 P39023.1
    P62888.1 Q02878.1 P18124.1 P62917.1 P32969.1 Q6SW59.1 P08253.1 P11021.1
    Q969T7.1 Q76LX8.1 C6AV76.1 Q2FWL5.1 B1RDC1.1 Q2G2D8.1 P42684.1 Q8IZT6.1
    Q9Y4K1.1 P02709.1 P02710.1 P02711.1 P04756.1 P02708.1 P02712.1 P11230.1
    Q07001.1 P02715.1 Q04844.1 P07510.1 P13536.1 F1N690.1 M9YGB9.1 O43427.1
    P68133.1 P62736.1 P60709.1 P63261.1 Q9NQW6.1 O15144.1 Q9H981.1 Q8N3C0.1
    Q6VMQ6.1 Q6JQN1.1 Q5T8D3.1 P82987.1 Q6ZMM2.1 Q9NZK5.1 Q8IUX7.1 Q9NP61.1
    Q9UJY4.1 O43488.1 P07897.1 P16112.1 Q73ZL3.1 Q92667.1 P49588.1 C9JKR2.1
    F8ELD9.1 P15121.1 F5HF49.1 P05186.1 P55008.1 Q5STX8.1 P02763.1 P01009.1
    P35368.1 P04217.1 P25100.1 P08697.1 P18825.1 P02765.1 P01023.1 P12814.1
    O43707.1 P35611.1 Q9UBT7.1 P61163.1 P02489.1 P02511.1 P06733.1 P06280.1
    Q16352.1 Q96Q83.1 P37840.1 Q9UJX4.1 P01019.1 Q9P2G1.1 Q9H8Y5.1 Q8N6D5.1
    H0YKS4.1 P04083.1 P50995.1 P07355.1 P08758.1 P08133.1 Q9NQ90.1 Q03518.1
    P01008.1 Q10567.1 Q9BXS5.1 Q96CW1.1 O00203.1 P02647.1 P02652.1 P06727.1
    P04114.1 P02655.1 C9JX71.1 P05090.1 P02649.1 Q9BZR8.1 P03182.1 Q9BRQ8.1
    Q9ATL6.1 P47863.1 P55087.1 P55064.1 P20292.1 Q15057.1 Q96P48.1 P35869.1
    Q5VUY2.1 P03928.1 P25705.1 P06576.1 P56385.1 Q9DB20.1 P18859.1 Q9BZC7.1
    Q8WWZ7.1 Q9NUT2.1 P61221.1 P53396.1 A1JNN2.1 P0A6G7.1 Q9H2U1.1 Q14562.1
    O84848.1 P78508.1 Q99712.1 P17342.1 Q99856.1 Q81VW6.1 Q96GD4.1 Q8WXX7.1
    O15392.1 P02730.1 P98160.1 F8W034.1 P20749.1 P41182.1 Q9NYF8.1 Q6W2J9.1
    Q8NFU0.1 P15291.1 P07550.1 P02749.1 P61769.1 Q13425.1 Q562R1.1 P42025.1
    P13929.1 F0K2P6.1 O43252.1 Q13057.1 Q81UF8.1 Q8NFC6.1 P18577.1 Q5VSJ8.1
    Q02161.1 P02663.1 P02769.1 Q9NWK9.1 O95415.1 Q7Z569.1 Q99728.1 Q9P287.1
    Q9NRL2.1 Q9U1F9.1 Q58F21.1 P25440.1 Q15059.1 O60885.1 P18892.1 Q8NCU7.1
    P04003.1 O75844.1 P12830.1 P33151.1 Q8NE86.1 P62158.1 P07384.1 P17655.1
    P20810.1 P27797.1 O94985.1 P10644.1 P31321.1 P13861.1 O70739.1 Q8QVL3.1
    Q8QVL6.1 Q8QVL9.1 Q91CY5.1 Q91CZ6.1 Q98Y63.1 Q99AQ9.1 Q9DTD4.1 Q9DUB7.1
    Q9DUC1.1 Q9JG76.1 Q9QU30.1 Q9QUB8.1 Q80AR5.1 Q80QT8.1 Q8UZK7.1 P14348.1
    Q9H2A9.1 P00918.1 P16870.1 O75339.1 O15519.1 Q14790.1 P04040.1 P35221.1
    P49913.1 P07858.1 P07339.1 P25774.1 Q03135.1 Q16663.1 Q9H9A5.1 Q9Y5K6.1
    P09326.1 P14209.1 Q99741.1 O00311.1 O75794.1 P04637.1 B2RD01.1 Q03188.1
    P49454.1 Q9HC77.1 Q02224.1 P00450.1 P08622.1 P35514.1 Q05980.1 P9WMJ9.1
    Q9H444.1 P36222.1 O00299.1 P05108.1 O15335.1 Q6UVK1.1 Q9P2D1.1 P10645.1
    O75390.1 O14503.1 Q00610.1 P09497.1 O75508.1 P56750.1 Q9P210.1 Q7Z460.1
    O75122.1 O75153.1 P10909.1 Q7Z401.1 P00451.1 P00488.1 P48444.1 P61923.1
    E9PP50.1 P23528.1 Q8WUD4.1 Q49A88.1 Q16204.1 P38432.1 P02452.1 P02458.1
    P05539.1 P02462.1 G1K238.1 Q7SIB2.1 P20908.1 Q02388.1 P27658.1 P12107.1
    Q99715.1 Q05707.1 P39059.1 Q9UMD9.1 P08123.1 P08572.1 Q7SIB3.1 P05997.1
    P12110.1 P13942.1 F1MZU6.1 Q01955.1 P12111.1 P02745.1 P02746.1 P09871.1
    P01024.1 P0C0L5.1 P01031.1 Q07021.1 P13671.1 P02748.1 P08603.1 Q03591.1
    Q6PUV4.1 W1Q7Z5.1 Q15021.1 Q15003.1 P42695.1 Q14746.1 Q9NZB2.1 Q12860.1
    Q02246.1 P78357.1 Q9UBW8.1 P36717.1 P02741.1 P12277.1 P06732.1 HOY8U5.1
    Q13618.1 Q86VP6.1 P25024.1 P16220.1 P06493.1 P11802.1 Q00534.1 P50750.1
    P41002.1 P04080.1 P50238.1 P52943.1 O14957.1 P20674.1 P10606.1 P14854.1
    P15954.1 P10176.1 Q16678.1 P10635.1 Q14008.1 Q9Y5Y2.1 Q96KP4.1 P14416.1
    Q5QP82.1 P07585.1 E5RFJ0.1 Q86SQ9.1 Q9Y394.1 P49366.1 Q5QJE6.1 P24855.1
    Q02413.1 P32926.1 P15924.1 Q16760.1 P19572.1 A9NHS5.1 Q9JZ09.1 P06959.1
    P08461.1 P10515.1 P20285.1 P0AFG6.1 Q5F875.1 P19262.1 P36957.1 Q16555.1
    P53634.1 Q14689.1 Q13443.1 Q12959.1 Q15398.1 Q16531.1 P40692.1 P43246.1
    P09884.1 P03198.1 P04293.1 Q9NRF9.1 Q9UGP5.1 P89471.1 Q13426.1 P49736.1
    P33992.1 P11387.1 Q02880.1 Q9UBZ4.1 P24928.1 O14802.1 Q9NW08.1 P31689.1
    P25686.1 O60216.1 O95793.1 P55265.1 Q6P0N6.1 Q13202.1 Q8IVF4.1 E9PEB9.1
    Q9UII4.1 P11161.1 Q14258.1 Q9ULT8.1 O95714.1 Q7Z6Z7.1 Q9Y4L5.1 O43567.1
    Q63HN8.1 Q969K3.1 Q81UQ4.1 P19474.1 Q6AZZ1.1 Q9C026.1 Q14669.1 Q5T4S7.1
    P18146.1 Q05BV3.1 Q6ZMW3.1 O95967.1 P15502.1 Q9BY07.1 P13804.1 Q6PJG2.1
    A6PW80.1 P68104.1 P13639.1 Q96RP9.1 Q9BW60.1 Q9U108.1 P17813.1 Q9NZ08.1
    P14625.1 Q14511.1 Q6P2E9.1 B2RLL7.1 O84591.1 Q9Z7A6.1 P03188.1 P04578.1
    P14075.1 Q6SW67.1 Q92817.1 P12724.1 Q12929.1 P61916.1 P07099.1 P03211.1
    P12978.1 P12977.1 P03203.1 P03204.1 Q99808.1 P27105.1 P03372.1 P32519.1
    Q15723.1 P60842.1 Q14240.1 P38919.1 P41567.1 Q14152.1 B5ME19.1 P60228.1
    O75821.1 Q13347.1 Q9Y262.1 F1TIN3.1 Q96KP1.1 Q96A65.1 O84646.1 Q01780.1
    P30822.1 O14980.1 P41180.1 P15311.1 Q08945.1 P52907.1 Q9BXW9.1 Q14296.1
    Q16658.1 Q7L8L6.1 Q7L5A8.1 P49327.1 Q81X29.1 Q8TB52.1 Q7Z6M2.1 Q7L513.1
    Q9BZ67.1 A1ZL39.1 P02792.1 P35555.1 P02671.1 P02675.1 P02679.1 Q06828.1
    P02751.1 Q4ZHG4.1 P20930.1 P21333.1 P30043.1 O75955.1 Q14254.1 P49771.1
    Q12841.1 Q13461.1 P32314.1 O95954.1 P04075.1 P09972.1 P07954.1 Q9H0Q3.1
    Q7Z6J4.1 P30279.1 P30281.1 O96020.1 O95067.1 P14078.1 P51570.1 Q08380.1
    O00214.1 Q3B8N2.1 P34903.1 P09104.1 A4D1B5.1 P17900.1 P06396.1 Q12789.1
    Q8WUA4.1 P03300.1 P08292.1 P27958.1 P03995.1 P14136.1 P47871.1 Q8TDQ7.1
    P35575.1 Q9NQR9.1 Q9Z186.1 P11413.1 P06744.1 P48318.1 Q99259.1 P48320.1
    Q05329.1 Q05683.1 P00367.1 Q05586.1 Q5VSF9.1 Q12879.1 S0G235.1 P15104.1
    Q06210.1 P35754.1 P18283.1 P09211.1 P04406.1 Q9NPB8.1 P11216.1 P06737.1
    P11217.1 Q31BS5.1 P04921.1 O43292.1 P30419.1 D6RB28.1 Q96S52.1 Q969N2.1
    Q86SQ4.1 Q9HC97.1 K7EQ05.1 P28799.1 P0A6P5.1 P44536.1 Q8WWP7.1 P62826.1
    P16520.1 P09471.1 Q9BVP2.1 Q9NVN8.1 P00738.1 Q9Y6N9.1 Q96CS2.1 P48723.1
    Q0VDF9.1 P08107.1 P34931.1 P11142.1 P04792.1 P07900.1 Q14568.1 P08238.1
    P54652.1 Q15477.1 P03452.1 P69905.1 P68871.1 P02042.1 P69892.1 P02790.1
    Q14CZ8.1 P09651.1 Q32P51.1 P14866.1 Q8WVV9.1 O43390.1 Q1KMD3.1 O88569.1
    P22626.1 Q9Y241.1 O95263.1 P12314.1 P09429.1 P26583.1 P25021.1 P49773.1
    Q9NQE9.1 P12081.1 Q9NVP2.1 Q8WU14.1 Q9H0E3.1 P07305.1 Q02539.1 P16403.1
    P16402.1 P10412.1 P16401.1 P0CE15.1 Q92522.1 P0C0S8.1 P0C0S9.1 Q93077.1
    Q9BTM1.1 Q71U19.1 P0C0S5.1 P16104.1 P62808.1 P33778.1 P62807.1 P10853.1
    P06899.1 O60814.1 Q99877.1 Q16778.1 Q5QNW6.1 P57053.1 P68431.1 P68432.1
    Q16695.1 Q71D13.1 P49450.1 P62803.1 P62805.1 P62806.1 Q99525.1 P02259.1
    Q9NR48.1 P01892.1 P04439.1 P16188.1 P10314.1 P01891.1 P10316.1 P13747.1
    P30464.1 P03989.1 P30685.1 P18463.1 Q95365.1 P30480.1 P30484.1 P30486.1
    P18464.1 P30490.1 P30495.1 P01889.1 Q31612.1 P30460.1 Q07000.1 Q29960.1
    F8W9Z8.1 Q29963.1 P10321.1 P28068.1 P20036.1 P04440.1 P01909.1 P01906.1
    E9PIB1.1 P01920.1 Q5Y7D6.1 P01903.1 P79483.1 P13762.1 Q30154.1 P04229.1
    P20039.1 Q951E3.1 Q5Y7A7.1 P01911.1 Q29974.1 P01912.1 P13760.1 Q9GZN2.1
    Q9H2X6.1 Q9H422.1 P51610.1 P50502.1 295441875.1 295413967.1 295413927.1 295413946.1
    295441907.1 295441886.1 295413949.1 312192955.1 295413970.1 295413952.1 295413922.1 295413835.1
    295413838.1 295413935.1 295413976.1 P01880.1 Q9Y6R7.1 Q9Y5U9.1 Q5VY09.1 O14498.1
    P78318.1 O00410.1 P11314.1 Q9BY32.1 P01317.1 A6XGL2.1 P01308.1 F8WCM5.1
    P01325.1 P01326.1 O15503.1 Q13429.1 P01344.1 Q9Y287.1 O60478.1 Q8N201.1
    P23229.1 Q13349.1 P08514.1 P05106.1 P16144.1 Q9H008.1 Q14624.1 Q9UMF0.1
    P01562.1 P01563.1 P01574.1 P38484.1 P14316.1 Q15306.1 Q13568.1 P20591.1
    P20592.1 Q9BYX4.1 O14879.1 Q12905.1 Q12906.1 P42701.1 Q5TF58.1 Q9NZM3.1
    P03956.1 Q9Y547.1 Q13099.1 O60306.1 O84606.1 Q9Y283.1 P10997.1 Q05084.1
    Q9P266.1 Q53G59.1 P13645.1 P02533.1 P08779.1 Q04695.1 P05783.1 P35527.1
    P04264.1 P35908.1 P12035.1 P48668.1 P08729.1 Q07666.1 Q96EK5.1 P52732.1
    Q96Q89.1 Q99661.1 P01042.1 Q6NY19.1 Q13601.1 Q04760.1 P42166.1 P19137.1
    P11047.1 O43813.1 P0CC04.1 P23700.1 P46379.1 Q6SW84.1 P13285.1 O75845.1
    P40126.1 Q99538.1 P29536.1 P02750.1 Q15345.1 Q8NHL6.1 Q8NHJ6.1 Q6GTX8.1
    Q9NPC1.1 Q14847.1 P61968.1 P11182.1 P18428.1 P50851.1 P06858.1 P0A5J0.1
    P9WK61.1 Q86W92.1 P05451.1 P23141.1 P07195.1 P31994.1 P31995.1 P01130.1
    Q7Z4F1.1 A4QPB2.1 P20132.1 P05455.1 P18627.1 Q13094.1 P01374.1 Q8NHM5.1
    O60341.1 P10253.1 O00754.1 P10619.1 Q13571.1 P11279.1 Q9UQV4.1 P22897.1
    P14174.1 P34810.1 Q8NDA8.1 P06491.1 P07199.1 F5HDQ6.1 P03227.1 Q14764.1
    P08392.1 P40925.1 P40926.1 Q8N5Y2.1 Q9ULC4.1 Q961J6.1 H3BT46.1 P11226.1
    Q8WXG6.1 Q92585.1 P43243.1 P50281.1 P51512.1 Q9NPA2.1 P03485.1 Q96RN5.1
    A6ZJ87.1 Q99705.1 P40967.1 Q01726.1 Q16655.1 P15529.1 190341000.1 F5HB52.1
    O00562.1 P16035.1 P56192.1 Q9UBB5.1 Q29983.1 Q16891.1 P55082.1 P55083.1
    P46821.1 P27816.1 Q9UPY8.1 Q9Y2H9.1 Q504T8.1 Q8N183.1 P03107.1 P26539.1
    P36745.1 P50799.1 Q81023.1 Q8TCT9.1 Q9H2D1.1 O60830.1 O94826.1 Q81WA4.1
    P28482.1 Q16584.1 O43318.1 O43683.1 Q9Y3D0.1 P08571.1 E7EWX8.1 Q99549.1
    Q04360.1 Q96T58.1 Q8WX17.1 Q9H8L6.1 P11229.1 P20309.1 Q5VZF2.1 O00499.1
    P01106.1 P02687.1 P25188.1 P25274.1 P81558.1 F7A0B0.1 P02686.1 P02689.1
    P25189.1 P60201.1 P60202.1 P20916.1 Q13875.1 E9PG44.1 Q16653.1 Q5SUK5.1
    P24158.1 P41218.1 Q969H8.1 Q8WXC6.1 P05164.1 Q9NPC7.1 Q9H1R3.1 P35749.1
    P35579.1 Q09013.1 O95248.1 O14745.1 O84639.1 P15586.1 P54450.1 Q8IXJ6.1
    O95167.1 O95298.1 P19404.1 O75251.1 Q6N069.1 Q73WP1.1 Q86VF7.1 Q9BT67.1
    O75113.1 Q15843.1 Q13564.1 Q8IXH7.1 P58400.1 P58401.1 Q09666.1 P12036.1
    P07196.1 P07197.1 Q8NEJ9.1 Q13491.1 P59665.1 P08246.1 Q9Y6K9.1 Q9NV10.1
    P43490.1 Q14112.1 Q5JPE7.1 P69849.1 O95897.1 Q13253.1 P05114.1 P05204.1
    P80272.1 Q15233.1 P29597.1 P23497.1 P08651.1 Q14938.1 Q16236.1 P19838.1
    Q6P4R8.1 O75694.1 P52948.1 P11654.1 Q8TEM1.1 Q9QY81.1 B4DW92.1 Q9Y6Q9.1
    Q9H1E3.1 P67809.1 Q9H8H0.1 P78316.1 O00567.1 Q9Y2X3.1 Q9NR30.1 P19338.1
    O75607.1 Q8NFH5.1 P03466.1 P00O25.1 Q99733.1 Q12830.1 Q96RS6.1 Q9H209.1
    A6NMS3.1 P23515.1 Q9HD40.1 295413917.1 295413964.1 295441897.1 Q9PWU2.1 P00675.1
    P11926.1 P54368.1 P10451.1 A2T3P5.1 A2T3T2.1 Q8TAD7.1 Q9BXB4.1 Q9UBL9.1
    P03262.1 Q96ST3.1 P50897.1 Q8IXS6.1 Q6ZV29.1 Q6ZW49.1 Q9UBV8.1 Q15154.1
    O60664.1 Q01453.1 O60437.1 P32119.1 O43808.1 Q13794.1 Q9H2J4.1 Q81Z21.1
    Q92903.1 O95674.1 Q9UKL6.1 P04180.1 P30086.1 O00329.1 P42356.1 O14986.1
    P57054.1 O95394.1 E4NG02.1 P00558.1 P18669.1 P15259.1 Q96FE7.1 Q9Y263.1
    Q13393.1 P26276.1 Q2FZ93.1 B2RID6.1 Q9Y617.1 P05155.1 P00747.1 O25249.1
    P13796.1 P07359.1 P16234.1 Q96CS7.1 Q9H7P9.1 Q15149.1 O43660.1 Q8IUK5.1
    Q6UX71.1 P09874.1 Q460N5.1 Q9UKK3.1 Q15365.1 Q15366.1 Q9BY77.1 A6Q6E9.1
    B2RGP7.1 295413956.1 I6XH73.1 Q96FM1.1 O43525.1 P19156.1 P18434.1 P0CG38.1
    Q16633.1 O84616.1 O75915.1 O84647.1 P68950.1 P02545.1 Q6P2Q9.1 O43143.1
    Q9HCS7.1 Q961Z0.1 P9WQ27.1 O84288.1 Q92841.1 Q15751.1 Q7Z333.1 O84419.1
    084818.1 B2RJ72.1 Q8N0Y7.1 O60312.1 Q9UHA3.1 P89479.1 Q9H3G5.1 Q02809.1
    P07737.1 Q8WUM4.1 Q53EL6.1 P49683.1 P12004.1 Q9UQ80.1 Q7Z6L0.1 Q07954.1
    P13674.1 C9JIZ6.1 Q9H7Z7.1 P40306.1 P49720.1 P28074.1 O60678.1 O14744.1
    P03189.1 P78543.1 O75629.1 O84583.1 O60888.1 P30101.1 Q14554.1 Q96JJ7.1
    P03129.1 Q9H8V3.1 Q96PZ2.1 Q8WU58.1 Q961P4.1 Q92636.1 Q96JP0.1 Q4ZG55.1
    Q9ULI3.1 Q96ST2.1 Q7Z3U7.1 P33215.1 Q8NHV4.1 Q9UFN0.1 O60502.1 Q6UWS5.1
    Q86U86.1 P23297.1 P60903.1 P06702.1 P04271.1 Q9UPN6.1 Q6P126.1 Q6ZMD2.1
    Q9BVV6.1 P14079.1 Q8WUY1.1 P50616.1 O15027.1 Q15436.1 Q15437.1 D4ACF2.1
    Q9QJ57.1 Q9QJ42.1 Q70J99.1 Q9GZT5.1 B1AQ67.1 Q9UM07.1 P21980.1 Q92954.1
    Q96JQ0.1 Q9JZQ0.1 A6NMY6.1 Q6FDV9.1 Q5VTE0.1 548558395.1 Q2VIR3.1 Q58FF8.1
    Q9HCE1.1 P13985.1 A2RGE9.1 Q8IXJ9.1 Q6P2P2.1 D3HT40.1 P42588.1 56160925.1
    Q53H96.1 P08559.1 HOYD97.1 O00330.1 P14618.1 Q9BXR0.1 Q9H974.1 Q9H2M9.1
    P35241.1 Q14699.1 P0DJD1.1 Q9BYM8.1 A6NK89.1 P61106.1 B2RHG7.1 P04626.1
    Q13546.1 Q92932.1 Q16849.1 P78509.1 P03209.1 P35249.1 P15927.1 P27694.1
    O75678.1 Q14257.1 Q9NQC3.1 Q9BZR6.1 P10276.1 P10826.1 P49788.1 Q8TC12.1
    P10745.1 P02753.1 P52566.1 Q7Z616.1 Q9BRR9.1 Q15052.1 Q81Y67.1 P11908.1
    Q15418.1 Q9UK32.1 O43159.1 Q9ULK6.1 Q7LOR7.1 Q9C0B0.1 Q9H0A0.1 O00472.1
    P18333.1 Q6PD62.1 Q9NTZ6.1 Q5T481.1 Q96EV2.1 Q9BQ04.1 P35637.1 Q9UKM9.1
    P22087.1 Q9Y230.1 P31153.1 Q9NSC2.1 O94885.1 Q93084.1 P08168.1 P10523.1
    Q9BQB4.1 O14828.1 Q13018.1 Q9UHJ6.1 Q9H4L4.1 Q9GZR1.1 Q15019.1 Q14141.1
    O15270.1 Q92743.1 O43464.1 P49842.1 Q9BZL6.1 O15075.1 Q96GX5.1 Q8TD19.1
    Q13153.1 F5GWT4.1 P63151.1 A6PVN5.1 Q06190.1 P53041.1 Q8N8A2.1 Q13315.1
    P49591.1 Q86SQ7.1 P02787.1 P36952.1 Q14140.1 B7WNR0.1 P02768.1 Q9BYB0.1
    Q5T123.1 Q9BZZ2.1 P67812.1 Q9BY50.1 P61009.1 P37108.1 P42224.1 Q92783.1
    Q96FS4.1 Q9UIB8.1 O75094.1 Q55732.1 O00193.1 Q7Z3B0.1 P62304.1 P62306.1
    P62308.1 P62314.1 P62316.1 P62318.1 P63162.1 P14678.1 P53814.1 Q13573.1
    Q63008.1 P05023.1 Q96K37.1 Q9NQZ2.1 Q96L92.1 Q14515.1 Q13813.1 Q01082.1
    P63208.1 P21453.1 P23246.1 M5JGM9.1 Q9NY15.1 Q7KZF4.1 Q9NQZ5.1 P16949.1
    P05093.1 P08686.1 P36956.1 Q12772.1 Q7Z7C7.1 Q96BY9.1 P38646.1 P08254.1
    Q14683.1 O95347.1 Q81Y18.1 P07566.1 P51649.1 P14410.1 O00391.1 O75897.1
    Q8NDZ2.1 P00441.1 O14512.1 Q81WZ8.1 Q6UWL2.1 Q8TAQ2.1 O15056.1 P60880.1
    Q9UQF0.1 O15400.1 Q9UNK0.1 B4DHN5.1 O00560.1 Q16635.1 Q9Y490.1 Q8N9U0.1
    O95271.1 D3YTG3.1 Q7Z7G0.1 Q9ULW0.1 P13686.1 Q86VP1.1 Q96F92.1 Q4KMP7.1
    Q9UL17.1 P01730.1 Q99832.1 F5H7V9.1 P24821.1 Q9UKZ4.1 Q5VYS8.1 Q92563.1
    Q8N6V9.1 Q9Y6M0.1 P04958.1 P05452.1 Q8NBS9.1 Q86V81.1 Q86YJ6.1 Q5VV42.1
    P40225.1 P07996.1 P35442.1 P04818.1 P63313.1 P62328.1 P01266.1 H7C1F5.1
    P07202.1 P16473.1 P21463.1 Q07157.1 Q9NR96.1 J3KNT7.1 Q9Y2L5.1 P03206.1
    P37837.1 P20062.1 P51532.1 Q14241.1 Q7KZ85.1 P05412.1 A0AVK6.1 Q14469.1
    P31629.1 P17275.1 Q8NHW3.1 Q9ULX9.1 P35716.1 Q06945.1 P57073.1 Q02447.1
    Q02446.1 O15164.1 Q9BWW7.1 Q04726.1 Q04727.1 P02786.1 Q9Y4A5.1 P01137.1
    Q15582.1 P61586.1 P37802.1 P29401.1 P69222.1 Q92616.1 P51571.1 Q14956.1
    Q96GE9.1 P57088.1 Q9BXS4.1 Q9C0B7.1 Q9Y5L0.1 P02766.1 Q13428.1 Q5T2D2.1
    Q07283.1 P22102.1 A2RCL1.1 Q8NDV7.1 Q6P9F5.1 Q6ZTA4.1 P04295.1 O14773.1
    Q97HE9.1 Q9Y3I0.1 P17752.1 Q8IWU9.1 Q0VAP8.1 P68363.1 Q9BQE3.1 P07437.1
    Q9H4B7.1 Q13885.1 Q13509.1 P04350.1 P68371.1 Q9BUF5.1 Q14679.1 O75347.1
    O14788.1 P48023.1 P43489.1 P25445.1 Q8N726.1 Q99816.1 Q15672.1 P14679.1
    P07101.1 P23458.1 Q9Y2R2.1 P29350.1 P78324.1 P08621.1 P17133.1 Q62376.1
    P09012.1 P09234.1 O75643.1 Q9UMX0.1 Q9UHD9.1 Q9Y4E8.1 Q9UPT9.1 Q8NFA0.1
    Q86T82.1 Q86UV5.1 O15205.1 P62979.1 H0Y5H6.1 Q14157.1 O00762.1 Q96LR5.1
    P62253.1 P22314.1 A0AVT1.1 Q15386.1 Q92575.1 I6ZLG2.1 O15294.1 Q9DUC0.1
    Q6ZRI6.1 Q9NSG2.1 Q9BWL3.1 Q9NZ63.1 P00727.1 Q9ZDE9.1 Q89882.1 P39999.1
    Q12965.1 A2A306.1 A2RGM0.1 A6NG79.1 B8ZS71.1 B8ZUA4.1 E7EPZ9.1 F8W7G7.1
    H0Y335.1 J3KP29.1 M7PC26.1 M7PDR8.1 M7Q4Y3.1 Q5T8M8.1 Q7TWS5.1 S5U6K1.1
    S5UMF6.1 S5USV8.1 W5Z3U0.1 Q9BSU1.1 Q49AR2.1 P69996.1 P06132.1 Q709C8.1
    O75436.1 Q9UBQ0.1 Q96AX1.1 P32241.1 Q3ASL6.1 Q00341.1 P08670.1 P03180.1
    P02774.1 P04004.1 Q01668.1 O00555.1 P27884.1 O43497.1 P04275.1 Q9Y279.1
    Q16864.1 O75348.1 Q2M389.1 O75083.1 Q9UNX4.1 C9J016.1 Q8IWA0.1 Q6UXN9.1
    Q2TAY7.1 P13010.1 P12956.1 Q9Y2T7.1 A1JUA3.1 O95625.1 Q8NAP3.1 Q96K80.1
    Q9Y6R6.1 Q01954.1 Q9P243.1 Q96KR1.1 Q8IWU4.1 P25311.1
  • Predicting the Immunological Response of an Individual to a Polypeptide Antigen
  • Specific polypeptide antigens induce immune responses in only a fraction of human subjects. Currently, there is no diagnostic test that can predict whether a polypeptide antigen would likely induce an immune response in an individual. In particular, there is a need for a test that can predict whether a person is an immune responder to a vaccine or immunotherapy composition.
  • According to the present disclosure, the polypeptide antigen-specific T cell response of an individual is defined by the presence within the polypeptide of one or more fragments that may be presented by multiple HLA class I or multiple HLA class II molecules of the individual.
  • In some cases the disclosure involves a method of predicting whether a subject will have an immune response to administration of a polypeptide, wherein an immune response is predicted if the polypeptide is immunogenic according to any method described herein. A cytotoxic T cell response is predicted if the polypeptide comprises at least one amino acid sequence that is a T cell epitope capable of binding to at least two HLA class I molecules of the subject. A helper T cell response is predicted if the polypeptide comprises at least one amino acid sequence that is a T cell epitope capable of binding to at least two HLA class II molecules of the subject. No cytotoxic T cell response is predicted if the polypeptide does not comprise any amino acid sequence that is a T cell epitope capable of binding to at least two HLA class I molecules of the subject. No helper T cell response is predicted if the polypeptide does not comprise any amino acid sequence that is a T cell epitope capable of binding to at least two HLA class II molecules of the subject.
  • In some cases the polypeptide is an active component of a pharmaceutical composition, and the method comprises predicting the development or production of anti-drug antibodies (ADA) to the polypeptide. The pharmaceutical composition may be a drug selected from those listed in Table 8. According to the present disclosure, ADA development will occur if, or to the extent that, an active component polypeptide is recognised by multiple HLA class II molecules of the subject, resulting in a helper T cell response to support an antibody response to the active component. The presence of such epitopes (PEPIs) may predict the development of ADA in the subject. The method may further comprise selecting or recommending for treatment of the human subject administration to the subject of a pharmaceutical composition that is predicted to induce low or no ADA, and optionally further administering the composition to the subject. In other cases the method predicts that the pharmaceutical composition will induce unacceptable ADA and the method further comprises selecting or recommending or treating the subject with a different treatment or therapy. The polypeptide may be a checkpoint inhibitor. The method may comprise predicting whether the subject will respond to treatment with the checkpoint inhibitor.
  • TABLE 8
    Example drugs associated with ADA-related adverse events
    Drug ADA-related adverse event
    Abciximab anaphylaxis
    Adalimumab anti-drug antibodies and treatment failure
    Basiliximab anaphylaxis
    Cetuximab IgE, anaphlyaxis
    Epoetin Antibody-mediated pure red cell aplasia
    Erythropoietin pure red cell aplasia
    Etanercept no apparent effect on safety
    Factor-IX anaphylaxis
    Infliximab anaphylaxis
    OKT3 anaphylaxis
    Pegloticase anti-dug antibody, treatment failure
    rIFN-beta anaphylaxis
    recombinant factor VIII anaphylaxis
    Thrombopoietin thrombocitopenia
    Ustekinumab anti-ustekinumab antibodies, affected
    treatment efficacy
  • There is also currently no test that can predict the likelihood that a person will have a clinical response to, or derive clinical benefit from, a vaccine or immunotherapy composition. This is important because currently T cell responses measured in a cohort of individuals participating in vaccine or immunotherapy clinical trials poorly correlate with clinical responses. That is, the clinical responder subpopulation is substantially smaller than the immune responder subpopulation. Therefore, to enable the personalization of vaccines and immunotherapies it is important to predict not only the likelihood of an immune response in a specific subject, but also whether the immune response induced by the drug will be clinically effective (e.g. can kill cancer cells or pathogen infected cells or pathogens).
  • The presence in a vaccine or immunotherapy composition of at least two polypeptide fragments (epitopes) that can bind to at least three HLA class I of an individual (≥2 PEPI3+) is predictive for a clinical response. In other words, if ≥2 PEPI3+ can be identified within the active ingredient polypeptide(s) of a vaccine or immunotherapy composition, then an individual is a likely clinical responder. A “clinical response” or “clinical benefit” as used herein may be the prevention of or a delay in the onset of a disease or condition, the amelioration of one or more symptoms, the induction or prolonging of remission, or the delay of a relapse or recurrence or deterioration, or any other improvement or stabilisation in the disease status of a subject. Where appropriate, a “clinical response” may correlate to “disease control” or an “objective response” as defined by the Response Evaluation Criteria In Solid Tumors (RECIST) guidelines.
  • In some cases the disclosure involves a method of predicting whether the subject will have a clinical response to administration of a pharmaceutical composition such as a vaccine or immunotherapy composition comprising one or more polypeptides as active ingredients. The method may comprise determining whether the one or more polypeptides together comprise at least two different sequences each of which is a T cell epitope capable of binding to at least two, or in some cases at least three HLA class I molecules of the subject; and predicting that the subject will have a clinical response to administration of the pharmaceutical composition if the one or more polypeptides together comprise at least two different sequences each of which is a T cell epitope capable of binding to at least two, or in some cases at least three HLA class I molecules of the subject; or that the subject will not have a clinical response to administration of the pharmaceutical composition if the one or more polypeptides together comprise no more that one sequence that is a T cell epitope capable of binding to at least two, or in some cases at least three HLA class I molecules of the subject.
  • For the purposes of this method two T cell epitopes are “different” from each other if they have different sequences, and in some cases also if they have the same sequence that is repeated in a target polypeptide antigen. In some cases the different T cell epitopes in a target polypeptide antigen do not overlap with one another.
  • In some cases all of the fragments of one or more polypeptides or active ingredient polypeptides that are immunogenic for a human subject are identified using the methods described herein. The identification of at least one fragment of the polypeptide(s) that is a T cell epitope capable of binding to at least two, or at least three HLA class I molecules of the subject predicts that the polypeptide(s) will elicit or is likely to elicit a cytotoxic T cell response in the subject. The identification of at least one fragment of the polypeptide(s) that is a T cell epitope capable of binding to at least two, or at least three, or at least four HLA class II molecules of the subject predicts that the polypeptide(s) will elicit or is likely to elicit a helper T cell response in the subject. The identification of no fragments of the polypeptide(s) that are T cell epitopes capable of binding to at least two, or at least three HLA class I molecules of the subject predicts that the polypeptide(s) will not elicit or is not likely to elicit a cytotoxic T cell response in the subject. The identification of no fragments of the polypeptide(s) that are T cell epitopes capable of binding to at least two, or at least three, or at least four HLA class II molecules of the subject predicts that the polypeptide(s) will not elicit or is not likely to elicit a helper T cell response in the subject. The identification of at least two fragments of one or more active ingredient polypeptides of a vaccine or immunotherapy composition, wherein each fragment is a T cell epitope capable of binding to at least two, or at least three HLA class I molecules of the subject predicts that the subject is more likely to have, or will have a clinical response to the composition. The identification of less than two fragments of the one or more polypeptides that are T cell epitopes capable of binding to at least two, or at least three HLA class I molecules of the subject predicts that the subject is less likely to have, or will not have, a clinical response to the composition.
  • Without wishing to be bound by theory, one reason for the increased likelihood of deriving clinical benefit from a vaccine/immunotherapy comprising at least two multiple-HLA binding PEPIs, is that diseased cell populations, such as cancer or tumor cells or cells infected by viruses or pathogens such as HIV, are often heterogenous both within and between affected subjects. A specific cancer patient, for example, may or may not express or overexpress a particular cancer associated target polypeptide antigen of a vaccine, or their cancer may comprise heterogeneous cell populations, some of which (over-)express the antigen and some of which do not. In addition, the likelihood of developing resistance is decreased when more multiple HLA-binding PEPIs are included or targeted by a vaccine/immunotherapy because a patient is less likely to develop resistance to the composition through mutation of the target PEPI(s).
  • The likelihood that a subject will respond to treatment is therefore increased by (i) the presence of more multiple HLA-binding PEPIs in the active ingredient polypeptides; (ii) the presence of PEPIs in more target polypeptide antigens; and (iii) (over-)expression of the target polypeptide antigens in the subject or in diseased cells of the subject. In some cases expression of the target polypeptide antigens in the subject may be known, for example if target polypeptide antigens are in a sample obtained from the subject. In other cases, the probability that a specific subject, or diseased cells of a specific subject, (over-)express a specific or any combination of target polypeptide antigens may be determined using population expression frequency data. The population expression frequency data may relate to a subject- and/or disease-matched population or the intent-to-treat population. For example, the frequency or probability of expression of a particular cancer-associated antigen in a particular cancer or subject having a particular cancer, for example breast cancer, can be determined by detecting the antigen in tumor, e.g. breast cancer tumor samples. In some cases such expression frequencies may be determined from published figures and scientific publications. In some cases a method of the invention comprises a step of determining the expression frequency of a relevant target polypeptide antigen in a relevant population.
  • Disclosed is a range of pharmacodynamic biomarkers to predict the activity/effect of vaccines in individual human subjects as well as in populations of human subjects. The biomarkers have been developed specifically for cancer vaccines, but similar biomarkers could be used for other vaccines or immunotherapy compositions. These biomarkers expedite more effective vaccine development and also decrease the development cost and may be used to assess and compare different compositions. Exemplary biomarkers are as follows.
      • AG95—potency of a vaccine: The number of antigens in a cancer vaccine that a specific tumor type expresses with 95% probability. AG95 is an indicator of the vaccine's potency, and is independent of the immunogenicity of the vaccine antigens. AG95 is calculated from the tumor antigen expression rate data. Such data may be obtained from experiments published in peer reviewed scientific journals. Technically, AG95 is determined from the binomial distribution of antigens in the vaccine, and takes into account all possible variations and expression rates.
      • PEPI3+ count—immunogenicity of a vaccine in a subject: Vaccine-derived PEPI3+ are personal epitopes that bind to et least 3 HLAs of a subject and induce T cell responses. PEPI3+ can be determined using the PEPI3+ Test in subjects who's complete 4-digit HLA genotype is known.
      • AP count—antigenicity of a vaccine in a subject: Number of vaccine antigens with PEPI3+. Vaccines contain sequences from target polypeptide antigens expressed by diseased cells. AP count is the number of antigens in the vaccine that contain PEPI3+, and the AP count represents the number of antigens in the vaccine that can induce T cell responses in a subject. AP count characterizes the vaccine-antigen specific T cell responses of the subject since it depends only on the HLA genotype of the subject and is independent of the subject's disease, age, and medication. The correct value is between 0 (no PEPI presented by the antigen) and maximum number of antigens (all antigens present PEPIs).
      • AP50—antigenicity of a vaccine in a population: The mean number of vaccine antigens with a PEPI in a population. The AP50 is suitable for the characterization of vaccine-antigen specific T cell responses in a given population since it depends on the HLA genotype of subjects in a population.
      • AGP count—effectiveness of a vaccine in a subject: Number of vaccine antigens expressed in the tumor with PEPI. The AGP count indicates the number of tumor antigens that vaccine recognizes and induces a T cell response against (hit the target). The AGP count depends on the vaccine-antigen expression rate in the subject's tumor and the HLA genotype of the subject. The correct value is between 0 (no PEPI presented by expressed antigen) and maximum number of antigens (all antigens are expressed and present a PEPI).
      • AGP50—effectiveness of a cancer vaccine in a population: The mean number of vaccine antigens expressed in the indicated tumor with PEPI (i.e., AGP) in a population. The AGP50 indicates the mean number of tumor antigens that the T cell responses induced by the vaccine can recognize. AGP50 is dependent on the expression rate of the antigens in the indicated tumor type and the immunogenicity of the antigens in the target population. AGP50 can estimate a vaccine's effectiveness in different populations and can be used to compare different vaccines in the same population. The computation of AGP50 is similar to that used for AG50, except the expression is weighted by the occurrence of the PEPI3+ in the subject on the expressed vaccine antigens. In a theoretical population, where each subject has a PEPI from each vaccine antigen, the AGP50 will be equal to AG50. In another theoretical population, where no subject has a PEPI from any vaccine antigen, the AGP50 will be 0. In general, the following statement is valid: 0≤AGP50≤AG50.
      • mAGP—a candidate biomarker for the selection of likely responders: Likelihood that a cancer vaccine induces T cell responses against multiple antigens expressed in the indicated tumor. mAGP is calculated from the expression rates of vaccine-antigens in e.g. the tumor and the presence of vaccine derived PEPIs in the subject. Technically, based on the AGP distribution, the mAGP is the sum of probabilities of the multiple AGP (≥2 AGPs).
  • The results of a prediction as set out above may be used to inform a physician's decisions concerning treatment of the subject. Accordingly, in some cases the polypeptide is an active ingredient, for example of a vaccine or immunotherapy composition, the method of the disclosure predicts that the subject will have, is likely to have, or has above a threshold minimum likelihood of having an immune response and/or a clinical response to a treatment comprising administering the active ingredient polypeptide to the subject, and the method further comprises selecting the treatment for or selecting the vaccine or immunotherapy composition for treatment of the specific human subject. Also provided is a method of treatment with a subject-specific pharmaceutical composition, kit or panel of polypeptides comprising one or more polypeptides as active ingredients, wherein the pharmaceutical composition, kit or panel of polypeptides has been determined to have a threshold minimum likelihood of inducing a clinical response in the subject, wherein the likelihood of response has been determined using a method described herein. In some cases the minimum threshold is defined by one or more of the pharmacodynamic biomarkers described herein, for example a minimum PEPI3+ count (for example 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 or more PEPI3+), a minimum AGP count (for example AGP=at least 2 or at least 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 or more) and/or a minimum mAGP (for example AGP=at least 2 or at least 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 or more). For example, in some cases a subject is selected for treatment if their likelihood of a response targeted at a predefined number of target polypeptide antigens, optionally wherein the target polypeptide antigens are (predicted to be) expressed, is above a predetermined threshold (e.g. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 or more). Alternatively, the method may predict that the one or more polypeptide(s) of the composition will not elicit a T cell response and/or a clinical response in the subject and further comprise selecting a different treatment for the subject.
  • Predicting an Autoimmune or Toxic Immune Response to a Polypeptide Antigen
  • The differences among HLAs may influence the probability that a subject will experience immune-toxicity from a drug or polypeptide administered to the subject. There may be a toxic immune response if a polypeptide administered to the subject comprises a fragment that corresponds to a fragment of an antigen expressed in normal healthy cells of the subject and that comprises an amino acid that is a T cell epitope capable of binding to multiple HLA class I molecules of the subject. Therefore, some cases in accordance with the disclosure, involve identifying a toxic immunogenic region or fragment of a polypeptide or identifying subjects who are likely to experience immune-toxicity in response to administration of one or more polypeptides or a fragments thereof. The polypeptide may be an active ingredient of a vaccine or immunotherapy composition as described herein.
  • The method may comprise determining whether the polypeptide(s) comprises a sequence that is a T cell epitope capable of binding to at least two, or in other cases to at least three HLA class I molecules of the subject. In some cases the method comprises determining that the polypeptide comprises a sequence that is a T cell epitope capable of binding to at least four, or at least five HLA class I molecules of the subject; or an amino acid sequence that is a T cell epitope capable of binding to at least four, or at least five, or at least six or at least seven HLA class II of the subject. The method may further comprise identifying said sequence as toxic immunogenic for the subject or predicting a toxic immune response in the subject. In other cases no such amino acid sequence is identified and the method further comprises predicting no toxic immune response in the subject. The method may further comprise selecting or recommending for treatment of the subject administration of one or more polypeptides or a pharmaceutical composition that is predicted to induce no or low immune-toxicity, and optionally further treating the subject by administering the polypeptide. The disclosure also provides a method of treating a subject in need thereof by administrating to the subject such a polypeptide or composition.
  • In some cases a method described herein further comprises mutating a polypeptide that is predicted to be immunogenic for a subject, or that is predicted to be immunogenic in a proportion of subjects in a human population. Also provided is a method of reducing the immunogenicity of a polypeptide that has been identified as immunogenic in a subject or in a proportion of a human population as described herein. The polypeptide may be mutated to reduce the number of PEPIs in the polypeptide or to reduce the number of HLA class I or class II molecules of the subject or of said population that bind to the fragment of the polypeptide that is identified as immunogenic in the subject or in a proportion of said population. In some cases the mutation may reduce or prevent a toxic immune response or may increase the efficacy by preventing the ADA development in the subject or in a proportion of said population. The mutated polypeptide may be further selected or recommended for treatment of the subject or of a subject of said population. The subject may further be treated by administration of the mutated polypeptide. The disclosure also provides a method of treating a subject in need thereof by administrating to the subject such a mutated polypeptide.
  • Predicting the Immunological Response of a Human Population to a Polypeptide Antigen
  • The methods described herein may be used to predict the response or response rate of a wider human population to administration of one or more polypeptides or compositions comprising one or more polypeptides. In some cases a method of the disclosure may be repeated for a plurality of human subjects to predict the response or response rate in those subjects. In other cases the method of the disclosure may be repeated for each subject in a relevant sample or model population of subjects and the results used to predict or define the response or response rate in a broader human population represented by the sample or model population. The sample/model population may be relevant to the intent-to-treat population for a pharmaceutical composition. A relevant population is one that is representative or similar to the population for whom or amongst whom treatment with the pharmaceutical composition is intended. In some cases the sample/model population is representative for the whole human race. In other cases the sample/model population may be disease- or subject-matched to the broader population (subpopulation), for example by ethnicity, geographical location, gender, age, disease or cancer, disease or cancer type or stage, genotype, expression of one or more biomarkers, partially by HLA genotype (for example subjects have one or more particular HLA alleles). For example, the sample/model population may have HLA class I and/or class II genomes that are representative of those found in the world population, or in subjects having a particular disease or condition, or ethnic background, from a particular geographical location, or having a particular disease-associated biomarker (for example, women having the BRCA mutation for a breast cancer vaccine). In some cases the sample/model population is representative for at least 70%, or 75% or 80% or 84% or 85% or 86% or 90% or 95% of the broader population by HLA diversity and/or HLA frequency.
  • The method may comprise the step of selecting or defining a relevant sample or model population. Each subject in the sample/model population is minimally defined by their HLA class I or class II genotype, e.g. complete 4-digit HLA class I genotype. Data concerning the HLA genotype of the sample/model population may be stored or recorded in or retrieved from a database or be an in silico model human population.
  • In some cases the methods described herein may be used to conduct an in silico clinical trial that predicts the proportion of immune-responders or the proportion of clinical responders in a population for a given drug, such as a vaccine or immunotherapy composition. This is useful for pre-selecting drugs that are likely to have high rates of efficacy to undergo clinical testing.
  • A population of individuals or a subpopulation of individuals can comprise the study cohort of an in silico clinical trial conducted with a drug. Each individual in the study cohort is characterized by its HLA genotype. The proportion of individuals in the study cohort having ≥1 PEPI2+, or ≥1 PEPI3+, or ≥1 PEPI4+, or ≥1 PEPI5+, derived from the polypeptides of the drug may be calculated. For the purposes of this disclosure we have termed this the “PEPI Score”. Unless otherwise indicted, the “PEPI Score” refers specifically to the ≥1 PEPI3+ Score. This PEPI Score predicts the proportion of subjects with T cell responses in a clinical trial conducted with the same drug in a relevant cohort of subjects.
  • The disclosure provides a method of conducting an in silico trial for a vaccine or immunotherapy composition having one or more polypeptide active ingredients. The in silico trial may predict the cytotoxic T cell response rate of a human population. The method may comprise: (i) selecting or defining an in silico model human population comprising a plurality of subjects each defined by HLA class I genotype, wherein the in silico model human population may correspond to or be representative of, or relevant to the intend-to-treat, said human population in which the cytotoxic T cell response rate is to be predicted; (ii) determining for each subject in the in silico model human population whether the one or more active ingredient polypeptides comprise at least one sequence that is PEPI2+, PEPI3+, PEPI4+ or PEPI5+(depending the size, administration route and adjuvants of the polypeptide composition); and (iii) predicting the cytotoxic T cell response rate (of said human population), wherein a higher proportion of the in silico model human population that meet the requirements of step (ii) predicts a higher cytotoxic T cell response rate. The proportion of the in silico model human population that meet the requirements of step (ii) may correlate with or correspond to the predicted response rate in the intend-to-treat population.
  • Correlation between the presence of HLA-restricted epitopes and immune response rates and/or clinical response rates has not been demonstrated by clinical trials of the prior art. This raises the question about the mechanism of action of immunotherapies. The Examples provided herein show that activation of cytotoxic T lymphocytes (CTLs) against multiple targets may be required for a clinically meaningful response, for example against heterogeneous tumors. So far, CTL responses reported in clinical trials neither account for multiple targets nor for multiple HLAs. For example, a melanoma peptide vaccine targeting two antigens (Tyrosinase and gp100) elicited CTL responses in 52% of patients, but only 12% had clinical benefit. Using an in silico Model Population of 433 subjects we determined a ≥1 PEPI3+ Score of 42% (in 42% at least one vaccine-derived epitope could be identified that could be presented by at least three HLA class I of the subject) and a ≥2 PEPI3+ Score of 6% (in 6% at least two vaccine-derived epitopes could be identified that could be presented by at least three HLA class II of the subject). This explains why the clinical investigators did not find correlation between CTL response rate and clinical response rate in their trial: the peptides in the vaccine performed poorly in the trial because there were only a few patients in which two different vaccine peptides could both activate CTL responses. The discrepancy between the results of the clinical trial and our in silico trial is based on the different populations, since the populations of each had subjects with different HLA genotypes. However, the response rate results provided by the in silico trial on the Model Population are a good prediction for the response rate outcome in the clinical trial population.
  • Therefore disclosed herein is a method of conducting an in silico trial for a vaccine or immunotherapy composition having one or more active ingredient polypeptides. The in silico trial may predict the clinical response rate of a human population. The method may comprise (i) selecting or defining an in silico model human population comprising a plurality of subjects defined by HLA class I genotype, wherein the in silico model human population may correspond to or be representative of said human population (relevant to the intend-to-treat population) in which the clinical response rate is to be predicted; (ii) determining for each subject in the in silico model human population whether the one or more active ingredient polypeptides comprise at least two different sequences each of which is a T cell epitope capable of binding to at least three, or at least four, or at least five HLA class I of the subject; and (iii) predicting the clinical response rate (of said human population), wherein a higher proportion of the in silico model human population that meet the requirements of step (ii) predicts a higher clinical response rate. The proportion of the in silico model human population that meet the requirements of step (ii) may correlate with or correspond to the predicted response rate in the intend-to-treat population.
  • An equivalent method may be used to predict, for example, the immune toxicity rate, checkpoint inhibitor response rate, ADA development rate, or helper T cell response rate of a human population (or subpopulation) to administration of a polypeptide or pharmaceutical composition comprising one or more polypeptides as active ingredients.
  • In some cases the method may be repeated for one or more further polypeptides or fragments thereof or vaccine or pharmaceutical or immunotherapy compositions. The polypeptides, fragments or compositions may be ranked according to their predicted response rates in said human population. This method is useful for selecting the most effective or most safe polypeptide drugs for the intent-to-treat population.
  • Design and Preparation of Pharmaceutical Compositions
  • In some aspects the disclosure provides a method of designing or preparing a polypeptide, or a polynucleic acid that encodes a polypeptide, for inducing an immune response, a cytotoxic T cell response or a helper T cell response in a human subject (e.g. in a target or intent-to-treat population). The disclosure also provides an immunogenic composition, or pharmaceutical composition, kit or panel of peptides, methods of designing or preparing the same, compositions that may be obtained by those methods, and their use in a method of inducing an immune response, a cytotoxic T cell response, or a helper T cell response in the subject, or a method of treating, vaccinating or providing immunotherapy to a subject.
  • The methods involve identifying and/or selecting a T cell epitope that binds to multiple, e.g. at least three HLA class I molecules of individual subjects across the target population with a high frequency, and designing or/or preparing a polypeptide that comprises one or more such epitopes (PEPI3+s). Such high frequency population PEPI3+s may be referred to herein as “bestEPIs”. According to the present disclosure bestEPIs induce immune responses in a high proportion of human subjects in the specific or target human population. The polypeptide may be an active ingredient in a pharmaceutical composition or kit or panel of polypeptides for use in a method of treatment of a subject of the specific or target human population.
  • The composition/kit may optionally further comprise at least one pharmaceutically acceptable diluent, carrier, or preservative and/or additional polypeptides that do not comprise any bestEPIs. The polypeptides may be engineered or non-naturally occurring. The kit may comprise one or more separate containers each containing one or more of the active ingredient peptides. The composition/kit may be a personalised medicine to prevent, diagnose, alleviate, treat, or cure a disease of an individual, such as a cancer.
  • In some cases the bestEPI is capable of binding to multiple, for example to at least three HLA class I and/or to at least three HLA class II molecules of a high percentage of the subjects in a sample or model population, such as described herein. In some cases a “high” percentage may be at least or more than 1%, 2%, 5%, 10%, 12%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49% or 50% of the relevant population or subpopulation of human subjects. In some cases a “high” percentage is relative to the percentage of subjects in the population having other PEPI3+s. For example, the PEPI3+ may be the most frequent in the population, or more frequent than 50%, or 55% or 60% or 65% or 70% or 75% or 80% or 85% or 90% or 95% or 97% or 99% of all PEPI3+ and/or PEPI4+ and/or PEPI4+ in one or more reference target polypeptide antigens.
  • In some cases the probability that the target polypeptide antigen is expressed in a subject of the specific or target population is taken into account to determine the overall likelihood that the bestEPI will induce an immune response that targets a polypeptide antigen that is expressed by a subject of the specific or target human population. In some cases the bestEPI is predicted to express both the relevant target polypeptide antigen and multiple, for example at least three HLA class I or at least three HLA class II molecules capable of binding to the bestEPI in at least or more than 1%, 2%, 5%, 10%, 12%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49% or 50% of the relevant population of human subjects.
  • In some cases multiple T cell epitopes/PEPI3+s, optionally from one or more target polypeptide antigens may be ranked by the percentage of subjects in the model or intend-to-treat population having multiple, for example at least three HLA class I or at least three HLA class II molecules capable of binding to each fragment; or by the percentage of subjects in the model or intend-to-treat population that are predicted to express both the target polypeptide antigen comprising the fragment and multiple, for example at least three HLA class I or at least three HLA class II molecules capable of binding to the fragments. The peptide or composition may be designed to comprise one or more PEPI3+s that are selected based on their ranking.
  • Typically each bestEPI is a fragment of a target polypeptide antigen and polypeptides that comprise one or more of the bestEPIs are the target polypeptide antigens for the treatment, vaccination or immunotherapy. The method may comprise the step of identifying one or more suitable target polypeptide antigens. Typically each target polypeptide antigen will be associated with the same disease or condition, pathogenic organism or group of pathogenic organisms or virus, or type of cancer.
  • The composition, kit or panel may comprise, or the method may comprise selecting, for each bestEPI a sequence of up to 50, 45, 40, 35, 30, 25, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10 or 9 consecutive amino acids of the target polypeptide antigen, such as a polypeptide described herein, which consecutive amino acids comprise the amino acid sequence of the bestEPI.
  • In some cases the amino acid sequence is flanked at the N and/or C terminus by additional amino acids that are not part of the consecutive sequence of the target polypeptide antigen. In some cases the sequence is flanked by up to 41 or 35 or 30 or 25 or 20 or 15 or 10, or 9 or 8 or 7 or 6 or 5 or 4 or 3 or 2 or 1 additional amino acid at the N and/or C terminus or between target polypeptide fragments. In other cases each polypeptide either consists of a fragment of a target polypeptide antigen, or consists of two or more such fragments arranged end to end (arranged sequentially in the peptide end to end) or overlapping in a single peptide (where two or more of the fragments comprise partially overlapping sequences, for example where two bestEPIs in the same polypeptide are within 50 amino acids of each other).
  • When fragments of different polypeptides or from different regions of the same polypeptide are joined together in an engineered peptide there is the potential for neoepitopes to be generated around the join or junction. Such neoepitopes encompass at least one amino acid from each fragment on either side of the join or junction, and may be referred to herein as junctional amino acid sequences. The neoepitopes may induce undesired T cell responses against healthy cells (autoimmunity). The peptides may be designed, or the polypeptides may be screened, to avoid, eliminate or minimise neoepitopes that correspond to a fragment of a protein expressed in normal healthy human cells and/or neoepitopes that are capable of binding to at least two, or in some cases at least three, or at least four HLA class I molecules of the subject, or in some cases at least two, or at least three or four or five HLA class II molecules of the subject. In some cases the peptide is designed, or the polypeptide screened, to eliminate polypeptides having a junctional neoepitope that is capable of binding in more than a threshold percentage of human subjects in a specific, target or model population, to at least two HLA class I molecules expressed by individual subjects of the population. In some cases the threshold is 30%, or 20%, or 15%, or 10%, or 5%, or 2%, or 1%, or 0.5% of said population. The methods of the disclosure may be used to identify or screen for such neoepitopes as described herein. Alignment may be determined using known methods such as BLAST algorithms. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/).
  • The at least two bestEPIs of the composition polypeptides may both target a single antigen (e.g a polypeptide vaccine comprising two multiple HLA-binding PEPIs derived from a single antigen, for example a tumor associated antigen, targeted by the vaccine/immunotherapy) or may target different antigens (e.g. a polypeptide vaccine comprising one multiple HLA-binding PEPI derived from one antigen, e.g. a tumor associated antigen, and a second multiple HLA-binding PEPI derived from a different antigen, e.g. a different tumor associated antigen, both targeted by the vaccine/immunotherapy).
  • In some cases the active ingredient polypeptide(s) together comprise, or the method comprises selecting, a total of or at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 or more different bestEPIs. The bestEPIs may be fragments of one or more different target polypeptide antigens. By identifying the specific fragments of each target polypeptide antigen that are immunogenic for a high proportion of subjects in a target population it is possible to incorporate multiple such fragments, optionally from multiple different target polypeptide antigens, in a single active ingredient polypeptide or multiple active ingredient polypeptides intended for use in combination or to maximise the number of T cell clones that can be activated by one or more polypeptides of a certain length.
  • Currently most vaccines and immunotherapy compositions target only a single polypeptide antigen. However according to the present disclosure it is in some cases beneficial to provide a pharmaceutical composition or an active ingredient polypeptide that targets two or more different polypeptide antigens. For example, most cancers or tumors are heterogeneous, meaning that different cancer or tumor cells of a subject (over-)express different antigens. The tumour cells of different cancer patients also express different combinations of tumour-associated antigens. The anti-cancer immunogenic compositions that are most likely to be effective are those that target multiple antigens expressed by the tumor, and therefore more cancer or tumor cells, in an individual human subject or in a population.
  • The beneficial effect of combining multiple bestEPIs in a single treatment (administration of one or more pharmaceutical compositions that together comprise multiple PEPIs), can be illustrated by the personalised vaccine polypeptides described in Examples 15 and 16 below. Exemplary CTA expression probabilities in ovarian cancer are as follows: BAGE: 30%; MAGE A9: 37%; MAGE A4: 34%; MAGE A10: 52%. If patient XYZ were treated with a vaccine comprising PEPIs in only BAGE and MAGE A9, then the probability of having a mAGP (multiple expressed antigens with PEPI) would be 11%. If patent XYZ were treated with a vaccine comprising only PEPIs for the MAGE A4 and MAGE A10 CTAs, then the probability of having a multiAGP would be 19%. However if a vaccine contained all 4 of these CTAs (BAGE, MAGE A9, MAGE A4 and MAGE A10), then the probability of having a mAGP would be 50%. In other words the effect would be greater than the combined probabilities of mAGP for both two-PEPI treatments (probability mAGP for BAGE/MAGE+probability mAGP for MAGE A4 and MAGE A10). Patient XYZ's PIT vaccine described in Example 15 contains a further 9 PEPIs, and thus, the probability of having a mAGP is over 99.95%.
  • Likewise exemplary CTA expression probabilities in breast cancer are as follows: MAGE C2: 21%; MAGE A1: 37%; SPC1: 38%; MAGE A9: 44%. Treatment of patient ABC with a vaccine comprising PEPIs in only MAGE C2: 21% and MAGE A1 has a mAGP probability of 7%. Treatment of patient ABC with a vaccine comprising PEPIs in only SPC1: 38%; MAGE A9 has a mAGP probability of 11%. Treatment of patient ABC with a vaccine comprising PEPIs in MAGE C2: 21%; MAGE A1: 37%; SPC1: 38%; MAGE A9 has a mAGP probability of 44% (44>7+11). Patient ABC's PIT vaccine described in Example 16 contains a further 8 PEPIs, and thus, the probability of having a mAGP is over 99.93%.
  • Accordingly in some cases the bestEPIs of the active ingredient polypeptides are from two or more different target polypeptide antigens, for example different antigens associated with a specific disease or condition, for example different cancer- or tumor-associated antigens or antigens expressed by a target pathogen. In some cases the PEPIs are from a total of or at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 or more different target polypeptide antigens. The different target polypeptide antigens may be any different polypeptides that it is useful to target or that can be selectively targeted with different PEPI3+s. In some cases different target polypeptide antigens are non-homologues or non-paralogues or have less than 95%, or 90%, or 85% or 80% or 75% or 70% or 60% or 50% sequence identity across the full length of each polypeptide. In some cases different polypeptides are those that do not share any PEPI3+s. Alternatively, in some cases the PEPI3+s are from different target polypeptide antigens when they are not shared with other polypeptide antigens targeted by the active ingredient polypeptides.
  • In some cases one or more or each of the immunogenic polypeptide fragments is from a polypeptide that is present in a sample taken from a human subject (e.g., of the target population). This indicates that the polypeptide is expressed in the subject, for example a cancer- or tumor-associated antigen or a cancer testis antigen expressed by cancer cells of the subject. In some cases one or more or each of the polypeptides is a mutational neoantigen, or an expressional neoantigen of the subject. One or more or each fragment may comprise a neoantigen specific mutation.
  • In other cases one or more or each of the immunogenic polypeptide fragments is from a target polypeptide antigen that is not generally expressed or is minimally expressed in normal healthy cells or tissue, but is expressed in a high proportion of (with a high frequency in) subjects or in the diseased cells of a subject having a particular disease or condition, as described above. The method my comprise identifying or selecting such a target polypeptide antigen. In some cases two or more or each of the immunogenic polypeptide fragments/bestEPIs are from different cancer- or tumor-associated antigens that are each (over-)expressed with a high frequency in subjects having a type of cancer or a cancer derived from a particular cell type or tissue. In some cases the immunogenic polypeptide fragments are from a total of or at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 different cancer- or tumor-associated polypeptides. In some cases one or more or each or at least one, at least two, at least three, at least four, at least five or at least six or at least seven of the polypeptides are selected from the antigens listed in any one of Tables 2 to 7.
  • In some cases one or more or each of the target polypeptide antigens is a cancer testis antigen (CTA). In some cases the immunogenic polypeptide fragments/bestEPIs are from at least 1, or at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 CTAs, or from a total of 3 or more different target polypeptide antigens, optionally wherein 1, 2, or all three or at least three are CTAs, or from 4 or more different polypeptide antigens, optionally wherein 1, 2, 3 or all four or at least 1, 2, 3 or 4 are CTAs, or from 5 or more different polypeptide antigens, optionally wherein 1, 2, 3, 4 or all five or at least 1, 2, 3, 4, or 5 are CTAs, or from 6 or more different polypeptide antigens, optionally wherein 1, 2, 3, 4, 5 or all six or at least 1, 2, 3, 4, 5, or 6 are CTAs, or from 7 or more different polypeptide antigens, optionally wherein 1, 2, 3, 4, 5, 6 or all 7 or at least 1, 2, 3, 4, 5, 6 or 7 are CTAs, or from 8 or more different polypeptide antigens, optionally wherein 1, 2, 3, 4, 5, 6, 7 or all 8 or at least 1, 2, 3, 4, 5, 6, 7 or 8 are CTAs. In some cases one or more or each of the target polypeptide antigens is expressed by a bacteria, a virus, or a parasite.
  • In some cases one or more of the polypeptide fragments comprises an amino acid sequence that is a T cell epitope capable of binding to at least two, or at least three HLA class I of a high percentage of subjects in the population subject and one or more of the polypeptide fragments comprises an amino acid sequence that is a T cell epitope capable of binding to at least two, or at least three, or at least four HLA class II of the subject of a high percentage of subjects in the population, wherein the HLA class I and HLA class II binding fragments may optionally overlap. A composition prepared by such a method may elicit both a cytotoxic T cell response and a helper T cell response in the subject.
  • Immunogenic and Pharmaceutical Compositions, Methods of Treatment and Modes of Administration
  • In some aspects the disclosure relates to a pharmaceutical composition, kit, or panels of polypeptides as described above having one or more polypeptides as active ingredient(s). These may be for use in a method of inducing an immune response, treating, vaccinating or providing immunotherapy to a subject, and the pharmaceutical composition may be a vaccine or immunotherapy composition. Such a treatment comprises administering one or more polypeptides or pharmaceutical compositions that together comprise all of the active ingredient polypeptides of the treatment to the subject. Multiple polypeptides or pharmaceutical compositions may be administered together or sequentially, for example all of the pharmaceutical compositions or polypeptides may be administered to the subject within a period of 1 year, or 6 months, or 3 months, or 60 or 50 or 40 or 30 days.
  • The immunogenic or pharmaceutical compositions or kits described herein may comprise, in addition to one or more immunogenic peptides, a pharmaceutically acceptable excipient, carrier, diluent, buffer, stabiliser, preservative, adjuvant or other materials well known to those skilled in the art. Such materials are preferably non-toxic and preferably do not interfere with the pharmaceutical activity of the active ingredient(s). The pharmaceutical carrier or diluent may be, for example, water containing solutions. The precise nature of the carrier or other material may depend on the route of administration, e.g. oral, intravenous, cutaneous or subcutaneous, nasal, intramuscular, intradermal, and intraperitoneal routes.
  • The pharmaceutical compositions of the disclosure may comprise one or more “pharmaceutically acceptable carriers”. These are typically large, slowly metabolized macromolecules such as proteins, saccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, sucrose (Paoletti et al., 2001, Vaccine, 19:2118), trehalose (WO 00/56365), lactose and lipid aggregates (such as oil droplets or liposomes). Such carriers are well known to those of ordinary skill in the art. The pharmaceutical compositions may also contain diluents, such as water, saline, glycerol, etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present. Sterile pyrogen-free, phosphate buffered physiologic saline is a typical carrier (Gennaro, 2000, Remington: The Science and Practice of Pharmacy, 20th edition, ISBN:0683306472).
  • The pharmaceutical compositions of the disclosure may be lyophilized or in aqueous form, i.e. solutions or suspensions. Liquid formulations of this type allow the compositions to be administered direct from their packaged form, without the need for reconstitution in an aqueous medium, and are thus ideal for injection. The pharmaceutical compositions may be presented in vials, or they may be presented in ready filled syringes. The syringes may be supplied with or without needles. A syringe will include a single dose, whereas a vial may include a single dose or multiple doses.
  • Liquid formulations of the disclosure are also suitable for reconstituting other medicaments from a lyophilized form. Where a pharmaceutical composition is to be used for such extemporaneous reconstitution, the disclosure provides a kit, which may comprise two vials, or may comprise one ready-filled syringe and one vial, with the contents of the syringe being used to reconstitute the contents of the vial prior to injection.
  • The pharmaceutical compositions of the disclosure may include an antimicrobial, particularly when packaged in a multiple dose format. Antimicrobials may be used, such as 2-phenoxyethanol or parabens (methyl, ethyl, propyl parabens). Any preservative is preferably present at low levels. Preservative may be added exogenously and/or may be a component of the bulk antigens which are mixed to form the composition (e.g. present as a preservative in pertussis antigens).
  • The pharmaceutical compositions of the disclosure may comprise detergent e.g. Tween (polysorbate), DMSO (dimethyl sulfoxide), DMF (dimethylformamide). Detergents are generally present at low levels, e.g. <0.01%, but may also be used at higher levels, e.g. 0.01-50%.
  • The pharmaceutical compositions of the disclosure may include sodium salts (e.g. sodium chloride) and free phosphate ions in solution (e.g. by the use of a phosphate buffer).
  • In certain embodiments, the pharmaceutical composition may be encapsulated in a suitable vehicle either to deliver the peptides into antigen presenting cells or to increase the stability. As will be appreciated by a skilled artisan, a variety of vehicles are suitable for delivering a pharmaceutical composition of the disclosure. Non-limiting examples of suitable structured fluid delivery systems may include nanoparticles, liposomes, microemulsions, micelles, dendrimers and other phospholipid-containing systems. Methods of incorporating pharmaceutical compositions into delivery vehicles are known in the art.
  • In order to increase the immunogenicity of the composition, the pharmacological compositions may comprise one or more adjuvants and/or cytokines.
  • Suitable adjuvants include an aluminum salt such as aluminum hydroxide or aluminum phosphate, but may also be a salt of calcium, iron or zinc, or may be an insoluble suspension of acylated tyrosine, or acylated sugars, or may be cationically or anionically derivatised saccharides, polyphosphazenes, biodegradable microspheres, monophosphoryl lipid A (MPL), lipid A derivatives (e.g. of reduced toxicity), 3-O-deacylated MPL [3D-MPL], quil A, Saponin, QS21, Freund's Incomplete Adjuvant (Difco Laboratories, Detroit, Mich.), Merck Adjuvant 65 (Merck and Company, Inc., Rahway, N.J.), AS-2 (Smith-Kline Beecham, Philadelphia, Pa.), CpG oligonucleotides, bioadhesives and mucoadhesives, microparticles, liposomes, polyoxyethylene ether formulations, polyoxyethylene ester formulations, muramyl peptides or imidazoquinolone compounds (e.g. imiquamod and its homologues). Human immunomodulators suitable for use as adjuvants in the disclosure include cytokines such as interleukins (e.g. IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12, etc), macrophage colony stimulating factor (M-CSF), tumour necrosis factor (TNF), granulocyte, macrophage colony stimulating factor (GM-CSF) may also be used as adjuvants.
  • In some embodiments, the compositions comprise an adjuvant selected from the group consisting of Montanide ISA-51 (Seppic, Inc., Fairfield, N.J., United States of America), QS-21 (Aquila Biopharmaceuticals, Inc., Lexington, Mass., United States of America), GM-CSF, cyclophosamide, bacillus Calmette-Guerin (BCG), corynbacterium parvum, levamisole, azimezone, isoprinisone, dinitrochlorobenezene (DNCB), keyhole limpet hemocyanins (KLH), Freunds adjuvant (complete and incomplete), mineral gels, aluminum hydroxide (Alum), lysolecithin, pluronic polyols, polyanions, oil emulsions, dinitrophenol, diphtheria toxin (DT).
  • By way of example, the cytokine may be selected from the group consisting of a transforming growth factor (TGF) such as but not limited to TGF-α and TGF-β; insulin-like growth factor-I and/or insulin-like growth factor-II; erythropoietin (EPO); an osteoinductive factor; an interferon such as but not limited to interferon-.α, -β, and -γ; a colony stimulating factor (CSF) such as but not limited to macrophage-CSF (M-CSF); granulocyte-macrophage-CSF (GM-CSF); and granulocyte-CSF (G-CSF). In some embodiments, the cytokine is selected from the group consisting of nerve growth factors such as NGF-β; platelet-growth factor; a transforming growth factor (TGF) such as but not limited to TGF-α. and TGF-β; insulin-like growth factor-I and insulin-like growth factor-II; erythropoietin (EPO); an osteoinductive factor; an interferon (IFN) such as but not limited to IFN-α, IFN-β, and IFN-γ; a colony stimulating factor (CSF) such as macrophage-CSF (M-CSF); granulocyte-macrophage-CSF (GM-CSF); and granulocyte-CSF (G-CSF); an interleukin (II) such as but not limited to IL-1, IL-1.alpha., IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12; IL-13, IL-14, IL-15, IL-16, IL-17, IL-18; LIF; kit-ligand or FLT-3; angiostatin; thrombospondin; endostatin; a tumor necrosis factor (TNF); and LT.
  • It is expected that an adjuvant or cytokine can be added in an amount of about 0.01 mg to about 10 mg per dose, preferably in an amount of about 0.2 mg to about 5 mg per dose. Alternatively, the adjuvant or cytokine may be at a concentration of about 0.01 to 50%, preferably at a concentration of about 2% to 30%.
  • In certain aspects, the pharmaceutical compositions of the disclosure are prepared by physically mixing the adjuvant and/or cytokine with the PEPIs under appropriate sterile conditions in accordance with known techniques to produce the final product.
  • Examples of suitable compositions of polypeptide fragments and methods of administration are provided in Esseku and Adeyeye (2011) and Van den Mooter G. (2006). Vaccine and immunotherapy composition preparation is generally described in Vaccine Design (“The subunit and adjuvant approach” (eds Powell M. F. & Newman M. J. (1995) Plenum Press New York). Encapsulation within liposomes, which is also envisaged, is described by Fullerton, U.S. Pat. No. 4,235,877.
  • In some embodiments, the compositions disclosed herein are prepared as a nucleic acid vaccine. In some embodiments, the nucleic acid vaccine is a DNA vaccine. In some embodiments, DNA vaccines, or gene vaccines, comprise a plasmid with a promoter and appropriate transcription and translation control elements and a nucleic acid sequence encoding one or more polypeptides of the disclosure. In some embodiments, the plasmids also include sequences to enhance, for example, expression levels, intracellular targeting, or proteasomal processing. In some embodiments, DNA vaccines comprise a viral vector containing a nucleic acid sequence encoding one or more polypeptides of the disclosure. In additional aspects, the compositions disclosed herein comprise one or more nucleic acids encoding peptides determined to have immunoreactivity with a biological sample. For example, in some embodiments, the compositions comprise one or more nucleotide sequences encoding 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more peptides comprising a fragment that is a T cell epitope capable of binding to at least three HLA class I molecules and/or at least three HLA class II molecules of a patient. In some embodiments, the peptides are derived from an antigen that is expressed in cancer. In some embodiments the DNA or gene vaccine also encodes immunomodulatory molecules to manipulate the resulting immune responses, such as enhancing the potency of the vaccine, stimulating the immune system or reducing immunosuppression. Strategies for enhancing the immunogenicity of DNA or gene vaccines include encoding of xenogeneic versions of antigens, fusion of antigens to molecules that activate T cells or trigger associative recognition, priming with DNA vectors followed by boosting with viral vector, and utilization of immunomodulatory molecules. In some embodiments, the DNA vaccine is introduced by a needle, a gene gun, an aerosol injector, with patches, via microneedles, by abrasion, among other forms. In some forms the DNA vaccine is incorporated into liposomes or other forms of nanobodies. In some embodiments, the DNA vaccine includes a delivery system selected from the group consisting of a transfection agent; protamine; a protamine liposome; a polysaccharide particle; a cationic nanoemulsion; a cationic polymer; a cationic polymer liposome; a cationic nanoparticle; a cationic lipid and cholesterol nanoparticle; a cationic lipid, cholesterol, and PEG nanoparticle; a dendrimer nanoparticle. In some embodiments, the DNA vaccines is administered by inhalation or ingestion. In some embodiments, the DNA vaccine is introduced into the blood, the thymus, the pancreas, the skin, the muscle, a tumor, or other sites.
  • In some embodiments, the compositions disclosed herein are prepared as an RNA vaccine. In some embodiments, the RNA is non-replicating mRNA or virally derived, self-amplifying RNA. In some embodiments, the non-replicating mRNA encodes the peptides disclosed herein and contains 5′ and 3′ untranslated regions (UTRs). In some embodiments, the virally derived, self-amplifying RNA encodes not only the peptides disclosed herein but also the viral replication machinery that enables intracellular RNA amplification and abundant protein expression. In some embodiments, the RNA is directly introduced into the individual. In some embodiments, the RNA is chemically synthesized or transcribed in vitro. In some embodiments, the mRNA is produced from a linear DNA template using a T7, a T3, or an Sp6 phage RNA polymerase, and the resulting product contains an open reading frame that encodes the peptides disclosed herein, flanking UTRs, a 5′ cap, and a poly(A) tail. In some embodiments, various versions of 5′ caps are added during or after the transcription reaction using a vaccinia virus capping enzyme or by incorporating synthetic cap or anti-reverse cap analogues. In some embodiments, an optimal length of the poly(A) tail is added to mRNA either directly from the encoding DNA template or by using poly(A) polymerase. The RNA encodes one or more peptides comprising a fragment that is a T cell epitope capable of binding to at least three HLA class I and/or at least three HLA class II molecules of a patient. In some embodiments, the fragments are derived from an antigen that is expressed in cancer. In some embodiments, the RNA includes signals to enhance stability and translation. In some embodiments, the RNA also includes unnatural nucleotides to increase the half-life or modified nucleosides to change the immunostimulatory profile. In some embodiments, the RNAs is introduced by a needle, a gene gun, an aerosol injector, with patches, via microneedles, by abrasion, among other forms. In some forms the RNA vaccine is incorporated into liposomes or other forms of nanobodies that facilitate cellular uptake of RNA and protect it from degradation. In some embodiments, the RNA vaccine includes a delivery system selected from the group consisting of a transfection agent; protamine; a protamine liposome; a polysaccharide particle; a cationic nanoemulsion; a cationic polymer; a cationic polymer liposome; a cationic nanoparticle; a cationic lipid and cholesterol nanoparticle; a cationic lipid, cholesterol, and PEG nanoparticle; a dendrimer nanoparticle; and/or naked mRNA; naked mRNA with in vivo electroporation; protamine-complexed mRNA; mRNA associated with a positively charged oil-in-water cationic nanoemulsion; mRNA associated with a chemically modified dendrimer and complexed with polyethylene glycol (PEG)-lipid; protamine-complexed mRNA in a PEG-lipid nanoparticle; mRNA associated with a cationic polymer such as polyethylenimine (PEI); mRNA associated with a cationic polymer such as PEI and a lipid component; mRNA associated with a polysaccharide (for example, chitosan) particle or gel; nmRNA in a cationic lipid nanoparticle (for example, 1,2-dioleoyloxy-3-trimethylammoniumpropane (DOTAP) or dioleoylphosphatidylethanolamine (DOPE) lipids); niRNA complexed with cationic lipids and cholesterol, or mRNA complexed with cationic lipids, cholesterol and PEG-lipid. In some embodiments, the RNA vaccine is administered by inhalation or ingestion. In some embodiments, the RNA is introduced into the blood, the thymus, the pancreas, the skin, the muscle, a tumor, or other sites, and/or by an intradermal, intramuscular, subcutaneous, intranasal, intranodal, intravenous, intrasplenic, intratumoral or other delivery route.
  • Polynucleotide or oligonucleotide components may be naked nucleotide sequences or be in combination with cationic lipids, polymers or targeting systems. They may be delivered by any available technique. For example, the polynucleotide or oligonucleotide may be introduced by needle injection, preferably intradermally, subcutaneously or intramuscularly. Alternatively, the polynucleotide or oligonucleotide may be delivered directly across the skin using a delivery device such as particle-mediated gene delivery. The polynucleotide or oligonucleotide may be administered topically to the skin, or to mucosal surfaces for example by intranasal, oral, or intrarectal administration.
  • Uptake of polynucleotide or oligonucleotide constructs may be enhanced by several known transfection techniques, for example those including the use of transfection agents. Examples of these agents include cationic agents, for example, calcium phosphate and DEAE-Dextran and lipofectants, for example, lipofectam and transfectam. The dosage of the polynucleotide or oligonucleotide to be administered can be altered.
  • Administration is typically in a “prophylactically effective amount” or a “therapeutically effective amount” (as the case may be, although prophylaxis may be considered therapy), this being sufficient to result in a clinical response or to show clinical benefit to the individual, e.g. an effective amount to prevent or delay onset of the disease or condition, to ameliorate one or more symptoms, to induce or prolong remission, or to delay relapse or recurrence.
  • The dose may be determined according to various parameters, especially according to the substance used; the age, weight and condition of the individual to be treated; the route of administration; and the required regimen. The amount of antigen in each dose is selected as an amount which induces an immune response. A physician will be able to determine the required route of administration and dosage for any particular individual. The dose may be provided as a single dose or may be provided as multiple doses, for example taken at regular intervals, for example 2, 3 or 4 doses administered hourly. Typically peptides, polynucleotides or oligonucleotides are typically administered in the range of 1 pg to 1 mg, more typically 1 pg to 10 μg for particle mediated delivery and 1 μg to 1 mg, more typically 1-100 μg, more typically 5-50 μg for other routes. Generally, it is expected that each dose will comprise 0.01-3 mg of antigen. An optimal amount for a particular vaccine can be ascertained by studies involving observation of immune responses in subjects.
  • Examples of the techniques and protocols mentioned above can be found in Remington's Pharmaceutical Sciences, 20th Edition, 2000, pub. Lippincott, Williams & Wilkins.
  • In some cases in accordance with the disclosure, more than one peptide or composition of peptides is administered. Two or more pharmaceutical compositions may be administered together/simultaneously and/or at different times or sequentially. Thus, the disclosure includes sets of pharmaceutical compositions and uses thereof. The use of combination of different peptides, optionally targeting different antigens, is important to overcome the challenges of genetic heterogeneity of tumors and HLA heterogeneity of individuals. The use of peptides of the disclosure in combination expands the group of individuals who can experience clinical benefit from vaccination. Multiple pharmaceutical compositions of PEPIs, manufactured for use in one regimen, may define a drug product.
  • Routes of administration include but are not limited to intranasal, oral, subcutaneous, intradermal, and intramuscular. The subcutaneous administration is particularly preferred. Subcutaneous administration may for example be by injection into the abdomen, lateral and anterior aspects of upper arm or thigh, scapular area of back, or upper ventrodorsal gluteal area.
  • The compositions of the disclosure may also be administered in one, or more doses, as well as, by other routes of administration. For example, such other routes include, intracutaneously, intravenously, intravascularly, intraarterially, intraperitnoeally, intrathecally, intratracheally, intracardially, intralobally, intramedullarly, intrapulmonarily, and intravaginally. Depending on the desired duration of the treatment, the compositions according to the disclosure may be administered once or several times, also intermittently, for instance on a monthly basis for several months or years and in different dosages.
  • Solid dosage forms for oral administration include capsules, tablets, caplets, pills, powders, pellets, and granules. In such solid dosage forms, the active ingredient is ordinarily combined with one or more pharmaceutically acceptable excipients, examples of which are detailed above. Oral preparations may also be administered as aqueous suspensions, elixirs, or syrups. For these, the active ingredient may be combined with various sweetening or flavoring agents, coloring agents, and, if so desired, emulsifying and/or suspending agents, as well as diluents such as water, ethanol, glycerin, and combinations thereof.
  • One or more compositions of the disclosure may be administered, or the methods and uses for treatment according to the disclosure may be performed, alone or in combination with other pharmacological compositions or treatments, for example chemotherapy and/or immunotherapy and/or vaccine. The other therapeutic compositions or treatments may for example be one or more of those discussed herein, and may be administered either simultaneously or sequentially with (before or after) the composition or treatment of the disclosure.
  • In some cases the treatment may be administered in combination with checkpoint blockade therapy/checkpoint inhibitors, co-stimulatory antibodies, cytotoxic or non-cytotoxic chemotherapy and/or radiotherapy, targeted therapy or monoclonal antibody therapy. It has been demonstrated that chemotherapy sensitizes tumors to be killed by tumor specific cytotoxic T cells induced by vaccination (Ramakrishnan et al. J Clin Invest. 2010; 120(4):1111-1124). Examples of chemotherapy agents include alkylating agents including nitrogen mustards such as mechlorethamine (HN2), cyclophosphamide, ifosfamide, melphalan (L-sarcolysin) and chlorambucil; anthracyclines; epothilones; nitrosoureas such as carmustine (BCNU), lomustine (CCNU), semustine (methyl-CCNU) and streptozocin (streptozotocin); triazenes such as decarbazine (DTIC; dimethyltriazenoimidazole-carboxamide; ethylenimines/methylmelamines such as hexamethylmelamine, thiotepa; alkyl sulfonates such as busulfan; Antimetabolites including folic acid analogues such as methotrexate (amethopterin); alkylating agents, antimetabolites, pyrimidine analogs such as fluorouracil (5-fluorouracil; 5-FU), floxuridine (fluorodeoxyuridine; FUdR) and cytarabine (cytosine arabinoside); purine analogues and related inhibitors such as mercaptopurine (6-mercaptopurine; 6-MP), thioguanine (6-thioguanine; TG) and pentostatin (2′-deoxycoformycin); epipodophylotoxins; enzymes such as L-asparaginase; biological response modifiers such as IFNα, IL-2, G-CSF and GM-CSF; platinum coordination complexes such as cisplatin (cis-DDP), oxaliplatin and carboplatin; anthracenediones such as mitoxantrone and anthracycline; substituted urea such as hydroxyurea; methylhydrazine derivatives including procarbazine (N-methylhydrazine, MIH) and procarbazine; adrenocortical suppressants such as mitotane (o,p′-DDD) and aminoglutethimide; taxol and analogues/derivatives; hormones/hormonal therapy and agonists/antagonists including adrenocorticosteroid antagonists such as prednisone and equivalents, dexamethasone and aminoglutethimide, progestin such as hydroxyprogesterone caproate, medroxyprogesterone acetate and megestrol acetate, estrogen such as diethylstilbestrol and ethinyl estradiol equivalents, antiestrogen such as tamoxifen, androgens including testosterone propionate and fluoxymesterone/equivalents, antiandrogens such as flutamide, gonadotropin-releasing hormone analogs and leuprolide and non-steroidal antiandrogens such as flutamide; natural products including vinca alkaloids such as vinblastine (VLB) and vincristine, epipodophyllotoxins such as etoposide and teniposide, antibiotics such as dactinomycin (actinomycin D), daunorubicin (daunomycin; rubidomycin), doxorubicin, bleomycin, plicamycin (mithramycin) and mitomycin (mitomycin C), enzymes such as L-asparaginase, and biological response modifiers such as interferon alphenomes.
  • In some cases the method of treatment is a method of vaccination or a method of providing immunotherapy. As used herein, “immunotherapy” is the treatment of a disease or condition by inducing or enhancing an immune response in an individual. In certain embodiments, immunotherapy refers to a therapy that comprises the administration of one or more drugs to an individual to elicit T cell responses. In a specific embodiment, immunotherapy refers to a therapy that comprises the administration or expression of polypeptides that contain one or more PEPIs to an individual to elicit a T cell response to recognize and kill cells that display the one or more PEPIs on their cell surface in conjunction with a class I HLA. In another specific embodiment, immunotherapy comprises the administration of one or more PEPIs to an individual to elicit a cytotoxic T cell response against cells that display tumor associated antigens (TAAs) or cancer testis antigens (CTAs) comprising the one or more PEPIs on their cell surface. In another embodiment, immunotherapy refers to a therapy that comprises the administration or expression of polypeptides that contain one or more PEPIs presented by class II HLAs to an individual to elicit a T helper response to provide co-stimulation to cytotoxic T cells that recognize and kill diseased cells that display the one or more PEPIs on their cell surface in conjunction with a class I HLAs. In still another specific embodiment, immunotherapy refers to a therapy that comprises administration of one or more drugs to an individual that re-activate existing T cells to kill target cells. The theory is that the cytotoxic T cell response will eliminate the cells displaying the one or more PEPIs, thereby improving the clinical condition of the individual. In some instances, immunotherapy may be used to treat tumors. In other instances, immunotherapy may be used to treat intracellular pathogen-based diseases or disorders.
  • In some cases the disclosure relates to the treatment of cancer or the treatment of solid tumors. The treatment may be of cancers or malignant or benign tumors of any cell, tissue, or organ type. The cancer may or may not be metastatic. Exemplary cancers include carcinomas, sarcomas, lymphomas, leukemias, germ cell tumors, or blastomas. The cancer may or may not be a hormone related or dependent cancer (e.g., an estrogen or androgen related cancer).
  • In other cases the disclosure relates to the treatment of a viral, bacterial, fungal or parasitic infection, or any other disease or condition that may be treated by immunotherapy.
  • Systems
  • The disclosure provides a system comprising a storage module configured to store data comprising the class I and/or class II HLA genotypes of each subject of a model population of human subjects; and the amino acid sequence of one or more test polypeptides; wherein the model population is representative of a test target human population; and a computation module configured to identify and/or quantify the amino acid sequences in the one or more test polypeptides that are capable of binding to multiple class I HLA molecules of each subject in the model population and/or the amino acid sequences in the one or more test polypeptides that are capable of binding to multiple class II HLA molecules of each subject in the model population. The system may further comprise an output module configured to display any output prediction or treatment selection or recommendation described herein or the value of any pharmodynamic biomarker described herein.
  • Further Embodiments of the Disclosure
  • 1. A method of predicting the cytotoxic T cell response rate and/or the helper T cell response rate of a specific or target human population to administration of a polypeptide, or to administration of a pharmaceutical composition, kit or panel of polypeptides comprising one or more polypeptides as active ingredients, the method comprising
      • (i) selecting or defining a relevant model human population comprising a plurality of subjects each defined by HLA class I genotype and/or HLA class II genotype;
      • (ii) determining for each subject in the model human population whether the polypeptide or polypeptides together comprise
        • (a) at least one amino acid sequence that is a T cell epitope capable of binding to at least two HLA class I molecules of the subject; and/or
        • (b) at least one amino acid sequence that is a T cell epitope capable of binding to at least two HLA class II molecules of the subject; and
      • (iii) predicting
        • A. the cytotoxic T cell response rate of said human population, wherein a higher proportion of the model human population meeting the requirements of step (ii)(a) predicts a higher cytotoxic T cell response rate in said human population; and/or
        • B. the helper T cell response rate of said human population, wherein a higher proportion of the model human population meeting the requirements of step (ii)(b) predicts a higher helper T cell response rate in said human population.
  • 2. A method of predicting the clinical response rate of a specific or target human population to administration of a pharmaceutical composition, kit or panel of polypeptides comprising one or more polypeptides as active ingredients, the method comprising
      • (i) selecting or defining a relevant model human population comprising a plurality of subjects each defined by HLA class I genotype;
      • (ii) determining
        • (a) for each subject in the model human population whether the one or more active ingredient polypeptides together comprise at least two different amino acid sequences each of which is a T cell epitope capable of binding to at least two HLA class I molecules of the subject, optionally wherein the at least two different amino acid sequences are comprised in the amino acid sequence of two different polypeptide antigens targeted by the active ingredient polypeptide(s);
        • (b) in the model population the mean number of target polypeptide antigens that comprise at least one amino acid sequence that is
          • A. a T cell epitope capable of binding to at least three HLA class I molecules of the individual subjects of the model population; and
          • B. comprised in the amino acid sequence of the active ingredient polypeptide(s); and/or
        • (c) in the model population the mean number of expressed target polypeptide antigens that comprise at least one amino acid sequence that is
          • A. a T cell epitope capable of binding to at least three HLA class I molecules of the individual subjects of the model population; and
          • B. comprised in the amino acid sequence of the active ingredient polypeptide(s); and
      • (iii) predicting the clinical response rate of said human population, wherein a higher proportion of the model human population meeting the requirements of step (ii)(a), or a higher mean number of target polypeptides in step (ii)(b), or a higher mean number of expressed target polypeptides in step (ii)(c) predicts a higher clinical response rate in said human population.
  • 3. The method of item 1 or item 2 further comprising repeating the method for one or more further polypeptides, pharmaceutical compositions, kits or panels of polypeptides, and ranking the polypeptides, pharmaceutical compositions, kits or panels of polypeptides according to their predicted cytotoxic T cell, helper T cell and/or or clinical response rates in said specific or target human population.
  • 4. The method of any one of items 1 to 3 further comprising selecting or recommending treatment of a subject in need thereof by administration of one or more polypeptides or pharmaceutical compositions or the polypeptides of one or more kits or panels of polypeptides, based on their predicted response rate or response rate ranking.
  • 5. The method of item 4, wherein
      • (a) a polypeptide, pharmaceutical composition, kit or panel of polypeptides having a high predicted response rate or response rate ranking is selected or recommended for inducing a therapeutic immune response in the subject; or
      • (b) a polypeptide, pharmaceutical composition, kit or panel of polypeptides having a low predicted response rate or response rate ranking is selected or recommended for avoiding a toxic immune response.
  • 6. The method of item 4 or item 5 further comprising administering one or more of the selected or recommended polypeptides or pharmaceutical compositions or the polypeptides of one or more kits or panels of polypeptides to the subject.
  • 7. A method of treatment of a human subject in need thereof, the method comprising administering to the subject one or more polypeptides or pharmaceutical compositions that have been selected or recommended for treatment of the subject using a method according to item 4 or item 5.
  • 8. A method of designing or preparing a polypeptide, or a polynucleic acid that encodes a polypeptide, for use in a method of inducing an immune response in a subject of a specific or target human population, the method comprising
      • (i) selecting or defining
        • (a) a relevant model human population comprising a plurality of subjects each defined by HLA class I genotype and/or by HLA class II genotype; or
        • (b) one relevant model human population comprising a plurality of subjects each defined by HLA class I genotype and one relevant model human population comprising a plurality of subjects each defined by HLA class II genotype;
      • (ii) identifying a fragment of up to 50 consecutive amino acids of a target polypeptide antigen that comprises or consists of
        • A. a T cell epitope capable, in a high percentage of the subjects of a model population selected or defined in step (i) that is defined by HLA class I genotype, of binding to at least three HLA class I molecules of the individual subjects;
        • B. a T cell epitope capable, in a high percentage of the subjects of a model population selected or defined in step (i) that is defined by HLA class II genotype, of binding to at least three HLA class II molecules of the individual subjects; or
        • C. a T cell epitope capable, in a high percentage of the subjects of a model population selected or defined in step (i) that is defined by HLA class I genotype, of binding to at least three HLA class I molecules of the individual subjects and a T cell epitope capable, in a high percentage of the subjects of a model population selected or defined in step (i) that is defined by HLA class II genotype, of binding to at least three HLA class II molecules of the individual subjects;
      • (iii) if the polypeptide fragment selected in step (ii) is an HLA class I-binding epitope, optionally selecting a longer fragment of the target polypeptide antigen, which longer fragment comprises or consists of an amino acid sequence that
        • A. comprises the fragment selected in step (ii); and
        • B. is an HLA class II molecule-binding T cell epitope capable, in a high percentage of the subjects of a model population selected or defined in step (i) that is defined by HLA class II genotype, of binding to at least three, or the most possible HLA class II molecules of the individual subjects; and
      • (iv) designing or preparing a polypeptide, or a polynucleic acid that encodes a polypeptide that comprises one or more polypeptide fragments identified in step (ii) or step (iii), optionally wherein the polypeptide fragment is flanked at the N and/or C terminus by additional amino acids that are not part of the sequence of the target polypeptide antigen.
  • 9. The method of item 8, comprising identifying one or more further fragments of the same or one or more different target polypeptide antigens, wherein each polypeptide fragment is a T cell epitope capable of binding to at least three HLA class I molecules or at least three HLA class II molecules of at least one subject in the model population; and ranking the fragments by
      • (i) the percentage of subjects in the model population that express at least three HLA class I molecules capable of binding to the fragment;
      • (ii) the percentage of subjects in the model population that are predicted to express both the target polypeptide antigen comprising the fragment and at least three HLA class I molecules capable of binding to the fragment;
      • (iii) the percentage of subjects in the model population that express at least three HLA class II molecules capable of binding to the fragment;
      • (iv) the percentage of subjects in the model population that are predicted to express both the target polypeptide antigen comprising the fragment and at least three HLA class II molecules capable of binding to the fragment;
        • (v) the percentage of subjects in the model population that express at least three HLA class I molecules and at least three HLA class II molecules capable of binding to the fragment; or
      • (iv) the percentage of subjects in the model population that are predicted to express both the target polypeptide antigen comprising the fragment and at least three HLA class I molecules and at least three HLA class II molecules capable of binding to the fragment.
  • 10. The method of item 9, which comprises selecting one or more of the polypeptide fragments based on their ranking, and designing or preparing the polypeptide to comprise or the polynucleic acid to encode the one of more selected polypeptide fragments.
  • 11. The method of any one of items 8 to 10, further comprising designing or preparing a polypeptide, a panel of polypeptides, or a pharmaceutical composition or kit comprising one or more polypeptides as active ingredients for use in a method of inducing an immune response in a subject of the specific or target human population, wherein the polypeptide(s) or active ingredient polypeptides comprises at least two polypeptide fragments, optionally between 2 and 15 polypeptide fragments, selected according to the method of item 8 or item 10.
  • 12. The method of item 11, wherein the two or more or each of the fragments are from different target polypeptide antigens, optionally different target polypeptide antigens selected from the antigens listed in Tables 2 to 6 and/or different cancer associated antigens, optionally wherein one or more or each of the cancer associated antigens are CTAs.
  • 13. The method of item 11 or item 12, wherein two or more or each of the fragments are arranged in the polypeptide end to end.
  • 14. The method of item 13, further comprising screening all of the neoepitopes formed at the join between any two of the selected polypeptide fragments arranged end to end in a single polypeptide to eliminate peptides comprising a neoepitope amino acid sequence that
      • (i) corresponds to a fragment of a human polypeptide expressed in healthy cells;
      • (ii) is a T cell epitope capable of binding, in more than a threshold percentage of human subjects, to at least two HLA class I molecules expressed by individual subjects;
      • (i) meets both requirements (i) and (ii).
  • 15. The method of any of items 8 to 14, wherein the one or more polypeptides have been screened to eliminate polypeptides comprising an amino acid sequence that
      • (i) corresponds to a fragment of a human polypeptide expressed in healthy cells; or
      • (ii) corresponds to a fragment of a human polypeptide expressed in healthy cells and is a T cell epitope capable of binding to at least two HLA class I molecules of the subject.
  • 16. A method of inducing an immune response in a subject of a specific or target human population, the method comprising designing or preparing a polypeptide, a panel of polypeptides, a polynucleic acid encoding a polypeptide, or a pharmaceutical composition or kit for use in said specific or target human population according to the method of any one of items 8 to 15 and administering the polypeptide(s), polynucleic acid, pharmaceutical composition or the active ingredient polypeptides of the kit to the subject.
  • 17. A polypeptide, panel of polypeptides, polynucleic acid, pharmaceutical composition or kit for use in a method of inducing an immune response in a subject of a specific or target human population, wherein the polypeptide, panel of polypeptides, polynucleic acid, pharmaceutical composition or kit is designed or prepared according to the method of any one of items 8 to 16 for use in said specific or target human population, and wherein the composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • 18. A pharmaceutical composition, panel of polypeptides or kit for use in a method of inducing an immune response in a subject of a specific or target human population, wherein the pharmaceutical composition, panel of polypeptides or kit comprises as active ingredients a first and a second and optionally one or more additional polypeptides, wherein each polypeptide comprises an amino acid sequence that is a T cell epitope capable of binding to at least three HLA class I molecules of at least 10% of subjects in the specific or target population, wherein the T cell epitope of the first, second and optionally any additional regions are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • 19. A pharmaceutical composition, panel of polypeptides or kit for use in a method of inducing an immune response in a human subject, wherein the pharmaceutical composition, panel of polypeptides or kit comprises an active ingredient polypeptide comprising a first region and a second region and optionally one or more additional regions, wherein each region comprises an amino acid sequence that is a T cell epitope capable of binding to at least three HLA class I molecules of at least 10% of subjects in the specific or target population, wherein the T cell epitope of the first, second and optionally any additional regions are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • 20. The pharmaceutical composition, panel of polypeptides or kit for use of item 18 or 19, wherein the amino acid sequence of one or more or each of the T cell epitopes is from a polypeptide selected from the antigens listed in Tables 2 to 6, or is a cancer associated antigen, optionally wherein one or more or each of the cancer associated antigens is a CTA.
  • 21. The pharmaceutical composition, panel of polypeptides or kit for use of items 18 to 20, wherein the amino acid sequence of two or more or each of the T cell epitopes is from a different polypeptide selected from the antigens listed in Tables 2 to 6, and/or different cancer associated antigens, optionally wherein one or more or each of the cancer associated antigens are CTAs.
  • 22. A pharmaceutical composition, panel of polypeptides or kit for use in a method treating a cancer in a subject in need thereof, wherein the pharmaceutical composition, panel of polypeptides or kit comprises as active ingredients a first and a second peptide and optionally one or more additional peptides, wherein each peptide comprises an amino acid sequence that is an HLA class I-binding T cell epitope wherein at least 10% of human subjects having cancer both
      • iii. express a tumor associated antigen selected from the antigens listed in Table 2 that comprises said T cell epitope; and
      • iv. have at least three HLA class I molecules capable of binding to said T cell epitope; wherein said T cell epitope of the first, second and optionally any additional peptides are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • 23. A pharmaceutical composition, panel of polypeptides or kit for use in a method treating a cancer in a subject in need thereof, wherein the pharmaceutical composition, panel of polypeptides or kit comprises an active ingredient polypeptide comprising a first and a second region and optionally one or more additional regions, wherein each region comprises an amino acid sequence that is an HLA class I-binding T cell epitope wherein at least 10% of human subjects having cancer both
      • (a) express a tumor associated antigen selected from the antigens listed in Table 2 that comprises said T cell epitope; and
      • (b) have at least three HLA class I molecules capable of binding to said T cell epitope; wherein said T cell epitope of the first, second and optionally any additional regions are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • 24. A pharmaceutical composition, panel of polypeptides or kit for use in a method treating a cancer selected from colorectal, breast, ovarian, melanoma, non-melanoma skin, lung, prostate, kidney, bladder, stomach, liver, cervix uteri, oesophagus, non-Hodgkin lymphoma, leukemia, pancreas, corpus uteri, lip, oral cavity, thyroid, brain, nervous system, gallbladder, larynx, pharynx, myeloma, nasopharynx, Hodgkin lymphoma, testis and Kaposi sarcoma in a subject in need thereof, wherein the pharmaceutical composition, panel of polypeptides or kit comprises as active ingredients a first and a second polypeptide and optionally one or more additional polypeptides, wherein each polypeptide comprises an amino acid sequence that is an HLA class I-binding T cell epitope wherein at least 10% of human subjects having said cancer both
      • (a) express a tumor associated antigen selected from the antigens listed in Table 2 that comprises said T cell epitope; and
      • (b) have at least three HLA class I molecules capable of binding to said T cell epitope; wherein said T cell epitope of the first, second and optionally any additional peptides are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • 25. A pharmaceutical composition, panel of polypeptides or kit for use in a method treating a cancer selected from colorectal, breast, ovarian, melanoma, non-melanoma skin, lung, prostate, kidney, bladder, stomach, liver, cervix uteri, oesophagus, non-Hodgkin lymphoma, leukemia, pancreas, corpus uteri, lip, oral cavity, thyroid, brain, nervous system, gallbladder, larynx, pharynx, myeloma, nasopharynx, Hodgkin lymphoma, testis and Kaposi sarcoma in a subject in need thereof, wherein the pharmaceutical composition, panel of polypeptides or kit comprises an active ingredient polypeptide comprising a first and a second region and optionally one or more additional regions, wherein each region comprises an amino acid sequence that is an HLA class I-binding T cell epitope wherein at least 10% of human subjects having said cancer both
      • (a) express a tumor associated antigen selected from the antigens listed in Table 2 that comprises said T cell epitope; and
      • (b) have at least three HLA class I molecules capable of binding to said T cell epitope; wherein said T cell epitope of the first, second and optionally any additional polypeptides are different from each other, and wherein the pharmaceutical composition or kit optionally comprises at least one pharmaceutically acceptable diluent, carrier, or preservative.
  • 26. A method of treatment of a human subject in need thereof, the method comprising administering to the subject a polypeptide, a panel of polypeptides, a pharmaceutical composition or the active ingredient polypeptides of a kit according to any one of items 17 to 25, wherein the subject has been determined to express at least three HLA class I molecules and/or at least three HLA class II molecules capable of binding to the polypeptide or to one or more of the active ingredient polypeptides of the pharmaceutical composition or kit.
  • 27. The method of item 26, wherein the subject has been determined to express at least three HLA class I and/or at least three HLA class II molecules capable of binding to a threshold minimal number of different T cell epitopes of the polypeptide, or the active ingredient polypeptides of the pharmaceutical composition or kit.
  • 28. The method of item 26 or item 27 wherein the active ingredient polypeptides of the pharmaceutical composition, kit or panel of polypeptides have been determined to together comprise at least two different sequences each of which is a T cell epitope capable of binding to at least three HLA class I molecules of the subject, optionally wherein the at least two different amino acid sequences are comprised in the amino acid sequence of two different polypeptide antigens targeted by the active ingredient polypeptide(s).
  • 29. The method of any one or items 26 to 28 wherein the pharmaceutical composition has been determined to have higher than a threshold minimum likelihood of inducing a clinical response in the subject, wherein one or more of the following factors corresponds to a higher likelihood of clinical response:
      • (a) presence in the active ingredient polypeptide(s) of a higher number of amino acid sequences and/or different amino acid sequences that are each a T cell epitope capable of binding to at least three HLA class I of the subject;
      • (b) a higher number of target polypeptide antigens, comprising at least one amino acid sequence that is both
        • A. comprised in an active ingredient polypeptide; and
        • B. a T cell epitope capable of binding to at least three HLA class I of the subject; optionally wherein the target polypeptide antigens are expressed in the subject, further optionally wherein the target polypeptides antigens are in one or more samples obtained from the subject;
      • (c) a higher probability that the subject expresses target polypeptide antigens, optionally a threshold number of the target polypeptide antigens and/or optionally target polypeptide antigens that have been determined to comprise at least one amino acid sequence that is both
        • A. comprised in an active ingredient polypeptide; and
        • B. a T cell epitope capable of binding to at least three HLA class I of the subject; and/or
      • (d) a higher number of target polypeptide antigens that the subject is predicted to express, optionally a higher number of target polypeptide antigens that the subject expresses with a threshold probability, and/or optionally the target polypeptide antigens that have been determined to comprise at least one amino acid sequence that is both
        • A. comprised in an active ingredient polypeptide; and
        • B. a T cell epitope capable of binding to at least three HLA class I of the subject.
  • 30. The method of item 29, wherein the likelihood of a clinical response has been determined by a method comprising
      • (i) identifying which polypeptide antigens targeted by the active ingredient polypeptide(s) comprise an amino acid sequence that is both
        • A. comprised in an active ingredient polypeptide; and
        • B. a T cell epitope capable of binding to at least three HLA class I of the subject; (ii) using population expression data for each antigen identified in step (i) to determine the probability that the subject expresses one or more of the antigens identified in step (i) that together comprise at least two different amino acid sequences of step (i); and
      • (iii) determining the likelihood that the subject will have a clinical response to administration of the administration of the pharmaceutical composition, kit or panel of polypeptides, wherein a higher probability determined in step (ii) corresponds to a more likely clinical response.
  • 31. A system comprising
      • (a) a storage module configured to store data comprising the class I and/or class II HLA genotypes of each subject of a model population of human subjects; and the amino acid sequence of one or more test polypeptides; wherein the model population is representative of a test target human population; and
      • (b) a computation module configured to identify and/or quantify the amino acid sequences in the one or more test polypeptides that are capable of binding to multiple class I HLA molecules of each subject in the model population and/or the amino acid sequences in the one or more test polypeptides that are capable of binding to multiple class II HLA molecules of each subject in the model population.
  • 32. The system of item 31 further comprising
      • (c) an output module configured to display
        • (i) a prediction of the cytotoxic T cell response rate and/or the helper T cell response rate of the test target human population to administration of the one or more polypeptides, or one or more pharmaceutical compositions comprising the one or more polypeptides as active ingredients; or
        • (ii) a prediction of the clinical response rate of the test target human population to a method of treatment comprising administration of one or more pharmaceutical compositions comprising the one or more polypeptides as active ingredients.
    Examples Example 1—HLA-Epitope Binding Prediction Process and Validation
  • Predicted binding between particular HLA and epitopes (9 mer peptides) was based on the Immune Epitope Database tool for epitope prediction (www.iedb.org).
  • The HLA I-epitope binding prediction process was validated by comparison with HLA I-epitope pairs determined by laboratory experiments. A dataset was compiled of HLA I-epitope pairs reported in peer reviewed publications or public immunological databases.
  • The rate of agreement with the experimentally determined dataset (Table 9) was determined. The binding HLA I-epitope pairs of the dataset were correctly predicted with a 93% probability. Coincidentally the non-binding HLA I-epitope pairs were also correctly predicted with a 93% probability.
  • TABLE 9
    Analytical specificity and sensitivity of
    the HLA-epitope binding prediction process.
    True epitopes False epitopes
    (n = 327) (n = 100)
    HLA-epitope pairs (Binder match) (Non-binder match)
    HIV 91% (32) 82% (14)
    Viral 100% (35)  100% (11) 
    Tumor  90% (172) 94% (32)
    Other (fungi, bacteria, etc.) 100% (65)  95% (36)
    All  93% (304) 93% (93)
  • The accuracy of the prediction of multiple HLA binding epitopes was determined. Based on the analytical specificity and sensitivity using the 93% probability for both true positive and true negative prediction and 7% (=100%-93%) probability for false positive and false negative prediction, the probability of the existence of a multiple HLA binding epitope in a person can be calculated. The probability of multiple HLA binding to an epitope shows the relationship between the number of HLAs binding an epitope and the expected minimum number of real binding. Per PEPI definition three is the expected minimum number of HLA to bind an epitope (bold).
  • TABLE 10
    Accuracy of multiple HLA binding epitopes predictions.
    Expected
    minimum
    number
    of real Predicted number of HLAs
    HLA binding to an epitope
    binding 0 1 2 3 4 5 6
    1 35% 95% 100% 100% 100% 100% 100%
    2  6% 29%  90%  99% 100% 100% 100%
    3  1%  4%  22%  84%  98% 100% 100%
    4  0%  0%   2%  16%  78%  96%  99%
    5  0%  0%   0%   1%  10%  71%  94%
    6  0%  0%   0%   0%  0%  5%  65%
  • The validated HLA-epitope binding prediction process was used to determine all HLA-epitope binding pairs described in the Examples below.
  • Example 2—Epitope Presentation by Multiple HLA Predicts Cytotoxic T Lymphocyte (CTL) Response
  • The presentation of one or more epitopes of a polypeptide antigen by one or more HLA I of an individual is predictive for a CTL response was determined.
  • The study was carried out by retrospective analysis of six clinical trials, conducted on 71 cancer and 9 HIV-infected patients (Table 11)1-7. Patients from these studies were treated with an HPV vaccine, three different NY-ESO-1 specific cancer vaccines, one HIV-1 vaccine and a CTLA-4 specific monoclonal antibody (Ipilimumab) that was shown to reactivate CTLs against NY-ESO-1 antigen in melanoma patients. All of these clinical trials measured antigen specific CD8+ CTL responses (immunogenicity) in the study subjects after vaccination. In some cases, correlation between CTL responses and clinical responses were reported.
  • No patient was excluded from the retroactive study for any reason other than data availability. The 157 patient datasets (Table 11) were randomized with a standard random number generator to create two independent cohorts for training and evaluation studies. In some cases the cohorts contained multiple datasets from the same patient, resulting in a training cohort of 76 datasets from 48 patients and a test/validation cohort of 81 datasets from 51 patients.
  • TABLE 11
    Summary of patient datasets
    Immuno-
    # Data assay
    sets performed
    (#antigen in the HLA
    Clinical Target # × clinical genotyping
    trial Immunotherapy Antigen Disease Patients* #patient) trials** method Ref
    1 VGX-3100 HPV16-E6 Cervical 17/18 5 × 17 IFN-γ High 1
    HPV16-E7 cancer ELISPOT Resolution
    HPV18-E6 SBT
    HPV18-E7
    HPV16/18
    2 HIVIS vaccine HIV-1 Gag AIDS  9/12 2 × 9  IFN-γ Low-Medium 2
    HIV-1 RT ELISPOT Resolution
    SSO
    3 rNY-ESO-1 NY-ESO-1 Breast-and 18/18 1 × 18 In vitro and High 3
    ovarian Ex vivo Resolution 4
    cancers, IFN-γ SBT
    melanoma ELISPOT
    and
    sarcoma
    4 Ipilimumab NY-ESO-1 Metastatic 19/20 1 × 19 ICS after T- Low to 5
    melanoma cell medium
    stimulation resolution
    typing,
    SSP of
    genomic
    DNA, high
    resolution
    sequencing
    5 NY-ESO-1f NY-ESO-1 Esophageal-, 10/10 1 × 10 ICS after T- SSO probing 6
    (91-110) non-small- cell and
    cell lung- stimulation SSP of
    and gastric genomic
    cancer DNA
    6 NY-ESO-1 NY-ESO-1 Esophageal-  7/9  1 × 7  ICS after T- SSO probing 7
    overlapping (79-173) and lung cell and
    peptides cancer, stimulation SSP of
    malignant genomic
    melanoma DNA
    Total 6 7 80 157 N/A
    *Number of patients used in the retrospective analysis from the original number of patient of the clinical trials.
    **Immunoassays are based on T cell stimulation with antigen-specific peptide pools and quantify the released cytokines by different techniques.
    CT: Clinical trial;
    SBT: Sequence Based Typing;
    SSO: Sequence-Specific Oligonucleotide;
    ICS: Intracellular cytokine staining;
    SSP: Sequence-specific priming
  • The reported CTL responses of the training dataset were compared with the HLA I restriction profile of epitopes (9 mers) of the vaccine antigens. The antigen sequences and the HLA I genotype of each patient were obtained from publicly available protein sequence databases or peer reviewed publications and the HLA I-epitope binding prediction process was blinded to patients' clinical CTL response data. The number of epitopes from each antigen predicted to bind to at least 1 (PEPI1+), or at least 2 (PEPI2+), or at least 3 (PEPI3+), or at least 4 (PEPI4+), or at least 5 (PEPI5+), or all 6 (PEPI6) HLA class I molecules of each patient was determined and the number of HLA bound were used as classifiers for the reported CTL responses. The true positive rate (sensitivity) and true negative rate (specificity) were determined from the training dataset for each classifier (number of HLA bound) separately.
  • ROC analysis was performed for each classifier. In a ROC curve, the true positive rate (Sensitivity) was plotted in function of the false positive rate (1-Specificity) for different cut-off points (FIG. 1). Each point on the ROC curve represents a sensitivity/specificity pair corresponding to a particular decision threshold (epitope (PEPI) count). The area under the ROC curve (AUC) is a measure of how well the classifier can distinguish between two diagnostic groups (CTL responder or non-responder).
  • The analysis unexpectedly revealed that predicted epitope presentation by multiple class I HLAs of a subject (PEPI2+, PEPI3+, PEPI4+, PEPI5+, or PEPI6), was in every case a better predictor of CTL response than epitope presentation by merely one or more HLA class I (PEPI1+, AUC=0.48, Table 12).
  • TABLE 12
    Determination of diagnostic value of
    the PEPI biomarker by ROC analysis
    Classifiers AUC
    PEPI1+ 0.48
    PEPI2+ 0.51
    PEPI3+ 0.65
    PEPI4+ 0.52
    PEPI5+ 0.5
    PEPI6+ 0.5
  • The CTL response of an individual was best predicted by considering the epitopes of an antigen that could be presented by at least 3 HLA class I of an individual (PEPI3+, AUC=0.65, Table 12). The threshold count of PEPI3+(number of antigen-specific epitopes presented by 3 or more HLA of an individual) that best predicted a positive CTL response was 1 (Table 13). In other words, at least one antigen-derived epitope is presented by at least 3 HLA class I of a subject (≥1 PEPI3+), then the antigen can trigger at least one CTL clone, and the subject is a likely CTL responder. Using the ≥1 PEPI3+ threshold to predict likely CTL responders (“≥1 PEPI3+ Test”) provided 76% diagnostic sensitivity (Table 13).
  • Example 3—Validation of the ≥1 PEPI3+ Test
  • The test cohort of 81 datasets from 51 patients was used to validate the ≥1 PEPI3+ threshold to predict an antigen-specific CTL response. For each dataset in the test cohort it was determined whether the ≥1 PEPI3+ threshold was met (at least one antigen-derived epitope presented by at least three class I HLA of the individual). This was compared with the experimentally determined CTL responses reported from the clinical trials (Table 14).
  • The clinical validation demonstrated that a PEPI3+ peptide induce CTL response in an individual with 84% probability. 84% is the same value that was determined in the analytical validation of the PEPI3+ prediction, epitopes that binds to at least 3 HLAs of an individual (Table 10). These data provide strong evidences that immune responses are induced by PEPIs in individuals.
  • TABLE 14
    Diagnostic performance characteristics of the ≥1 PEPI3+Test (n = 81).
    Performance characteristic Description Result
    Positive
    100%[A/(A + B)] The likelihood that an individual that 84%
    predictive meets the ≥1 PEPI3+ threshold has
    value (PPV) antigen-specific CTL responses after
    treatment with immunotherapy.
    Sensitivity 100%[A/(A + C)] The proportion of subjects with antigen- 75%
    specific CTL responses after treatment
    with immunotherapy who meet
    the ≥1 PEPI3+ threshold.
    Specificity 100%[D/(B + D)] The proportion of subjects without antigen- 55%
    specific CTL responses after treatment
    with immunotherapy who do not meet
    the ≥1 PEPI3+ threshold.
    Negative 100%[D/(C + D)] The likelihood that an individual who does 42%
    predictive not meet the ≥1 PEPI3+ threshold does not
    value (NPV) have antigen-specific CTL responses after
    treatment with immunotherapy.
    Overall 100%[(A + D)/N] The percentage of predictions based on 70%
    percent the ≥1 PEPI3+ threshold that match
    agreement the experimentally determined result,
    (OPA) whether positive or negative.
    Fisher's exact (p) 0.01
  • ROC analysis determined the diagnostic accuracy, using the PEPI3+ count as cut-off values (FIG. 2). The AUC value=0.73. For ROC analysis an AUC of 0.7 to 0.8 is generally considered as fair diagnostic.
  • A PEPI3+ count of at least 1 (≥1 PEPI3+) best predicted a CTL response in the test dataset (Table 15). This result confirmed the threshold determined during the training (Table 12).
  • Example 4—the ≥1 PEPI3+ Test Predicts CD8+ CTL Reactivities
  • The ≥1 PEPI3+ Test was compared with a previously reported method for predicting a specific human subject's CTL response to peptide antigens.
  • The HLA genotypes of 28 cervical cancer and VIN-3 patients that received the HPV-16 synthetic long peptide vaccine (LPV) in two different clinical trials were determined from DNA samples8 9 10. The LPV consists of long peptides covering the HPV-16 viral oncoproteins E6 and E7. The amino acid sequence of the LPV was obtained from these publications. The publications also report the T cell responses of each vaccinated patient to pools of overlapping peptides of the vaccine.
  • For each patient epitopes (9 mers) of the LPV that are presented by at least three patient class I HLA (PEPI3+s) were identified and determined their distribution among the peptide pools was determined. Peptides that comprised at least one PEPI3+(≥1 PEPI3+) were predicted to induce a CTL response. Peptides that comprised no PEPI3+ were predicted not to induce a CTL response.
  • The ≥1 PEPI3+ Test correctly predicted 489 out of 512 negative CTL responses and 8 out of 40 positive CTL responses measured after vaccination (FIG. 3A). Overall, the agreement between the ≥1 PEPI3+ Test and experimentally determined CD8+ T cell reactivity was 90% (p<0.001).
  • For each patient the distribution among the peptide pools of epitopes that are presented by at least one patient class I HLA (≥1 PEPI1+, HLA restricted epitope prediction, prior art method) was also determined. ≥1 PEPI1+ correctly predicted 116 out of 512 negative CTL responses and 37 out of 40 positive CTL responses measured after vaccination (FIG. 3B). Overall, the agreement between the HLA restricted epitope prediction (≥1 PEPI1+) and CD8+ T cell reactivity was 28% (not significant).
  • Example 5—Prediction of HLA Class II Restricted CD4+ Helper T Cell Epitopes
  • The 28 cervical cancer and VIN-3 patients that received the HPV-16 synthetic long peptide vaccine (LPV) in two different clinical trials (as detailed in Example 4) were investigated for CD4+T helper responses following LPV vaccination (FIG. 4A-B). The sensitivity of the prediction of HLA class II restricted epitopes was 78%, since the State of Art tool predicted 84 positive responses (positive CD4+ T cell reactivity to a peptide pool for a person's DP alleles) out of 107 (sensitivity=78%). The specificity was 22% since it could rule out 7 negative responses out of 31. Overall, the agreement between HLA-restricted class II epitope prediction and CD4+ T cell reactivity was 66%, which was statistically not significant.
  • Example 6—the ≥1 PEPI3+ Test Predicts T Cell Responses to Full Length LPV Polypeptides
  • Using the same reported studies as Examples 4 and 5, the ≥1 PEPI3+ Test was used to predict patient CD8+ and CD4+ T cell responses to the full length E6 and E7 polypeptide antigens of the LPV vaccine. Results were compared to the experimentally determined responses were reported. The Test correctly predicted the CD8+ T cell reactivity (PEPI3+) of 11 out of 15 VIN-3 patients with positive CD8+ T cell reactivity test results (sensitivity 73%, PPV 85%) and of 2 out of 5 cervical cancer patients (sensitivity 40%, PPV 100%). The CD4+ T cell reactivities (PEPI4+) were correctly predicted 100% both of VIN-3 and cervical cancer patients (FIGS. 5A-D).
  • Class I and class II HLA restricted PEPI3+ count was also observed to correlate with the reported clinical benefit to LPV vaccinated patients. Patients with higher PEPI3+ counts had either complete or partial response already after 3 months.
  • Example 7—Case Study
  • pGX3001 is an HPV16 based DNA vaccine containing full length E6 and E7 antigens with a linker in between. pGX3002 is an HPV18 based DNA vaccine containing full length E6 and E7 antigens with a linker in between. A Phase II clinical trial investigated the T cell responses of 17 HPV-infected patients with cervical cancer who were vaccinated with both pGX3001 and pGX3002 (VGX-3100 vaccination)1.
  • FIGS. 5A-D and FIG. 6 shows for two illustrative patients (patient 12-11 and patient 14-5) the position of each epitope (9 mer) presented by at least 1 (PEPI1+), at least 2 (PEPI2+), at least 3 (PEPI3+), at least 4 (PEPI4+), at least 5 (PEPI5+), or all 6 (PEPI6) class I HLA of these patients within the full length sequence of the two HPV-16 and two HPV-18 antigens.
  • Patient 12-11 had an overall PEPI1+ count of 54 for the combined vaccines (54 epitopes presented by one or more class I HLA). Patient 14-5 had a PEPI1+ count of 91. Therefore patient 14-5 has a higher PEPI1+ count than patient 12-11 with respect to the four HPV antigens. The PEPI1+s represent the distinct vaccine antigen specific HLA restricted epitope sets of patients 12-11 and 14-5. Only 27 PEPI1+s were common between these two patients.
  • For the PEPI3+ counts (number of epitopes presented by three or more patient class I HLA), the results for patients 12-11 and 14-5 were reversed. Patient 12-11 had a PEPI3+ count of 8, including at least one PEPI3+ in each of the four HPV16/18 antigens. Patient 14-5 had a PEPI3+ count of 0.
  • The reported immune responses of these two patients matched the PEPI3+ counts, not the PEPI1+ counts. Patient 12-11 developed immune responses to each of the four antigens post-vaccination as measured by ELISpot, whilst patient 14-5 did not develop immune responses to any of the four antigens of the vaccines. A similar pattern was observed when the PEPI1+ and PEPI3+ sets of all 17 patients in the trial were compared. There was no correlation between the PEPI1+ count and the experimentally determined T cell responses reported from the clinical trial. However, we correlation between the T cell immunity predicted by the ≥1 PEPI3+ Test and the reported T cell immunity was observed. The ≥1 PEPI3+ Test predicted the immune responders to HPV DNA vaccine.
  • Moreover, the diversity of the patient's PEPI3+ set resembled the diversity of T cell responses generally found in cancer vaccine trials. Patients 12-3 and 12-6, similar to patient 14-5, did not have PEPI3+s predicting that the HPV vaccine could not trigger T cell immunity. All other patients had at least one PEPI3 predicting the likelihood that the HPV vaccine can trigger T cell immunity. 11 patients had multiple PEPI3+ predicting that the HPV vaccine likely triggers polyclonal T cell responses. Patients 15-2 and 15-3 could mount high magnitude T cell immunity to E6 of both HPV, but poor immunity to E7. Other patients 15-1 and 12-11 had the same magnitude response to E7 of HPV18 and HPV16, respectively.
  • Example 8—Design of a Model Population for Conducting in Silico Trials and Identifying Candidate Precision Vaccine Targets for Large Population
  • An in silico human trial cohort of 433 subjects with complete 4-digit HLA class I genotype (2×HLA-A*xx:xx; 2×HLA-B*xx:xx; 2×HLA-C*xx:xx) and demographic information was compiled. This Model Population has subjects with mixed ethnicity having a total of 152 different HLA alleles that are representative for ≥85% of presently known allele G-groups.
  • A database of a “Big Population” containing 7,189 subjects characterized with 4-digit HLA genotype and demographic information was also established. The Big Population has 328 different HLA class I alleles. The HLA allele distribution of the Model Population significantly correlated with the Big Population (Table 16) (Pearson p<0.001). Therefore the 433 patient Model Population is representative for a 16 times larger population.
  • The Model Population is representative for 85% of the human race as given by HLA diversity as well as HLA frequency.
  • TABLE 16
    Statistical analysis of HLA distributions in “Model
    Population” vs. “Big Population”
    Pearson
    Group name
    1 Group name 2 R value Correlation P Value
    433 Model 7,189 Big 0.89 Strong P < 0.001
    Population Population
  • Example 9—in Silico Trials Based on the Identification of Multiple HLA Binding Epitopes Predict the Reported T Cell Response Rates of Clinical Trials
  • The objective of this study was to determine whether a model population, such as the one described in Example 8, may be used to predict CTL reactivity rates of vaccines, i.e. used in an in silico efficacy trials.
  • Twelve peptide vaccines derived from cancer antigens that induced T cell responses in a subpopulation of subjects were identified from peer reviewed publications. These peptides have been investigated in clinical trials enrolling a total of 172 patients (4 ethnicities). T cell responses induced by the vaccine peptides have been determined from blood specimens and reported. The immune response rate as the percentage of study subjects with positive T cell responses measured in the clinical trials was determined (FIG. 7).
  • TABLE 17
    Clinical trials conducted with peptide vaccines.
    Source Peptide Pop.
    Peptide vaccines antigen length T cell assay (n) Ethnicity Ref.
    MMNLMQPKTQQTYTYD JUP 16 mer Multimer 18 Canadian 12
    staining
    GRGSTTTNYLLDRDDYRNTSD ADA17
    21 mer Multimer 18 Canadian 12
    staining
    LKKGAADGGKLDGNAKLNRSLK BAP31
    22 mer Multimer 18 Canadian 12
    staining
    FPPKDDHTLKFLYDDNQRPYPP TOP2A 22 mer Multimer 18 Canadian 12
    staining
    RYRKPDYTLDDGHGLLRFKST Ab1-2 21 mer Multimer 18 Canadian 12
    staining
    QRPPFSQLHRFLADALNT DDR1
    18 mer Multimer 18 Canadian 12
    staining
    ALDQCKTSCALMQQHYDQTSCFSSP ITGB8
    25 mer Multimer 18 Canadian 12
    STAPPAHGVTSAPDTRPAPGSTAPP MUC-1 25 mer Proliferation 80 Canadian 13
    YLEPGPVTA gp100  9 mer Tetramer 18 US 14
    MTPGTQSPFFLIILLTVLTVV MUC-1 21 mer Cytotoxicity 10 Israeli 15
    SSKALQRPV Bcr-Abl  9 mer ELISPOT  4 US 16
    RMFPNAPYL WT-1  9 mer Multimer 24 US 17
    staining
    RMFPNAPYL (HLA-A*0201) WT-1  9 mer Cytokine 18 CEU 18
    staining
  • The 12 peptides were investigated with the ≥1 PEPI3+ Test in each of the 433 subjects of the Model Population described in Example 8. The “≥1 PEPI3+ Score” for each peptide was calculated as the proportion of subjects in the Model Population having at least one vaccine derived epitope that could bind to at least three subject-specific HLA class I (≥1 PEPI3+). If the corresponding clinical trial stratified patients for HLA allele selected population, the Model Population was also filtered for subjects with the respective allele(s) (Example: WT1, HLA-A*0201).
  • The experimentally determined response rates reported from the trials were compared with the ≥1 PEPI3+ Scores. The Overall Percentage of Agreements (OPA) were calculated on the paired data (Table 18). A linear correlation between ≥1 PEPI3+ Score and response rate (R2=0.77) was observed (FIG. 7). This result shows that the identification of peptides predicted to bind to multiple HLAs of an individual is useful to predict in silico the outcome of clinical trials.
  • TABLE 19
    Comparison of ≥1 PEPI3+ Scores and CTL response rates of 12 peptide
    vaccines.
    Response ≥ PEPI3+
    rate Score*
    Source (Clinical (Model
    Peptide vaccine antigen Trials) Population) OPA
    MMNLMQPKTQQTYTYD JUP
     0% 22% NA
    GRGSTTTNYLLDRDDYRNTSD ADA17
    11% 18%  61%
    LKKGAADGGKLDGNAKLNRSLK BAP31
    11%  7%  64%
    FPPKDDHTLKFLYDDNQRPYPP TOP2A
    11% 39%  28%
    RYRKPDYTLDDGHGLLRFKST Abl-2 17% 12%  71%
    QRPPFSQLHRFLADALNT DDR1
    17%  5%  29%
    ALDQCKTSCALMQQHYDQTSCFSSP ITGB
     8 28% 31%  90%
    STAPPAHGVTSAPDTRPAPGSTAPP MUC-1 20%  2%  10%
    YLEPGPVTA gp100 28%  4%  14%
    MTPGTQSPFFLLLLLTVLTVV MUC-1 90% 95%  95%
    SSKALQRPV Bcr-Abl  0%  0% 100%
    RMFPNAPYL WT-1 100% 78%  78%
    RMFPNAPYL (HLA-A*0201) WT-1 81% 61%  75%
    *% subjects in the Model Population with ≥1 vaccine derived PEPI3+
  • Example 10. In Silico Trials Based on the Identification of Multiple HLA Binding Epitopes Predict the Reported T Cell Response Rates of Clinical Trials II
  • Nineteen clinical trials with published immune response rates (IRR) conducted with peptide or DNA based vaccines were identified (Table 19). These trials involved 604 patients (9 ethnicities) and covered 38 vaccines derived from tumor and viral antigens. Vaccine antigen specific CTL responses were measured in each study patient and the response rate in the clinical study populations was calculated and reported.
  • Each vaccine peptide of the 19 clinical trials was investigated with the ≥1 PEPI3+ Test in each subject of the Model Population. The ≥1 PEPI3+ Score for each peptide was calculated as the proportion of subjects in the Model Population having at least one vaccine derived PEPI3+. The experimentally determined response rates reported from the trials were compared with the PEPI Scores, as in Example 9 (Table 20). A linear correlation between the response rate and ≥1 PEPI3+Score (R2=0.70) was observed (FIG. 8). This result confirms that the identification of peptides predicted to bind to multiple HLAs of an individual can predict T cell responses of subjects, and in silico trials can predict the outcome of clinical trials.
  • TABLE 20
    Response rates published in clinical trials.
    Pop. Race/
    Immunotherapy Type CTL assay (n) Ethnicity Ref.
    StimuVax peptide Proliferation 80 Canadian 13
    gp100 vaccine DNA Tetramer 18 US 14
    IMA901 phase I peptide ELISPOT 64 CEU
    IMA901 phase II peptide Multimer 27 CEU 19
    staining
    ICT107 peptide ICC 15 US 20
    ProstVac DNA ELISPOT 32 CEU87%, 21
    Afr.
    Am. 12%,
    Hisp. 1%
    Synchrotope DNA Tetramer 26 US 22
    TA2M
    MELITAC 12.1 peptide ELISPOT 167 US 23
    WT1 vaccine peptide Tetramer 22 Japanese 24
    Ipilimumab Check-point ICC 19 US 5
    (NY-ESO-1) inhibitor
    **
    VGX-3100 DNA ELISPOT 17 US 1
    HIVIS-1 DNA ELISPOT 12 CEU98%,
    Asian1%, 2
    Hisp. 1%
    ImMucin peptide Cytotoxicity 10 Israeli 15
    NY-ESO-1 OLP peptide IFN-gamma 7 Japanese 7
    GVX301 peptide Proliferation 14 CEU 25
    WT1 vaccine peptide ELISPOT 12 US 26
    WT1 vaccine peptide ICC 18 CEU 18
    DPX-0907* peptide Multimer 18 Canadian 12
    staining
    Melanoma peptide ELISPOT 26 White 27
    peptide
    vaccine
  • TABLE 21
    Linear correlation between PEPI Score and response rate (R2 = 0.7).
    Clinical Trial ≥1 PEPI3+
    Immunotherapy Response Rate Score* OPA
    StimuVax (failed to show 20%  2% 10%
    efficacy in Phase III)
    gp100 vaccine 28%  4% 14%
    IMA901 phase I 74% 48% 65%
    IMA901 phase II 64% 48% 75%
    ICT107 33% 52% 63%
    ProstVac 45% 56% 80%
    Synchrotope TA2M 46% 24% 52%
    MELITAC 12.1 49% 47% 96%
    WT1 vaccine
    59% 78% 76%
    Ipilimumab (NY-ESO-1*) 72% 84% 86%
    VGX-3100 78% 87% 90%
    HIVIS-1 80% 93% 86%
    ImMucin 90% 95% 95%
    NY-ESO-1 OLP 100%  84% 84%
    GVX301 64% 65% 98%
    WT1 vaccine 83% 80% 96%
    WT1 vaccine 81% 61% 75%
    DPX-0907 61% 58% 95%
    Melanoma peptide vaccine 52% 42% 81%
    *% subjects in the Model Population with ≥1 vaccine derived PEPI3+
  • Example 11—in Silico Trial Based on the Identification of Multiple HLA Binding Epitopes in a Multi-Peptide Vaccine Predict the Reported Clinical Trial Immune Response Rate
  • IMA901 is a therapeutic vaccine for renal cell cancer (RCC) comprising 9 peptides derived from tumor-associated peptides (TUMAPs) that are naturally presented in human cancer tissue. A total of 96 HLA-A*02+ subjects with advanced RCC were treated with IMA901 in two independent clinical studies (phase I and phase II). Each of the 9 peptides of IMA901 have been identified in the prior art as HLA-A2-restricted epitopes. Based on currently accepted standards, they are all strong candidate peptides to boost T cell responses against renal cancer in the trial subjects, because their presence has been detected in renal cancer patients, and because the trial patients were specifically selected to have at least one HLA molecule capable of presenting each of the peptides.
  • For each subject in the Model population how many of the nine peptides of the IMA901 vaccine were capable of binding to three or more HLA was determined. Since each peptide in the IMA901 vaccine is a 9 mer this corresponds to the PEPI3+ count. The results were compared with the immune response rates reported for the Phase I and Phase II clinical trials (Table 22).
  • TABLE 22
    Immune Response Rates in the Model Population
    and in two clinical trials to IMA901
    Immune Model Population
    responses to (HLA-A2+) Phase I Phase II
    TUMAPs (n = 180) (n = 27)* (n = 64)*
    No peptide 39% 25% 36%
      1 peptide 34% 44% 38%
    27%
    ≥2 peptides (MultiPEPI Score) 29% 26%
    ≥3 peptides  3% ND  3%
    *No of patients evaluated for immune responses
  • The phase I and phase II study results show the variability of the immune responses to the same vaccine in different trial cohorts. Overall, however, there was a good agreement between response rates predicted by the ≥2 PEPI3+ Test and the reported clinical response rates.
  • In a retrospective analysis, the clinical investigators of the trials discussed above found that subjects who responded to multiple peptides of the IMA901 vaccine were significantly (p=0.019) more likely to experience disease control (stable disease, partial response) than subjects who responded only to one peptide or had no response. 6 of 8 subjects (75%) who responded to multiple peptides experienced clinical benefit in the trial, in contrast to 14% and 33% of 0 and 1 peptide responders, respectively. The randomized phase II trial confirmed that immune responses to multiple TUMAPs were associated with a longer overall survival.
  • Since the presence of PEPIs accurately predicted responders to TUMAPs, clinical responders to IMA901 are likely patients who can present 22 PEPIs from TUMAPs. This subpopulation is only 27% of HLA-A*02 selected patients, and according to the clinical trial result, 75% of this subpopulation is expected to experience clinical benefit. The same clinical results suggest that 100% of patients would experience clinical benefit if patient selection is based on 23 PEPIs from TUMAPs, albeit this population would represent only 3% of the HLA-A*02 selected patient population. These results suggest that the disease control rate (stable disease or partial response) is between 3% and 27% in the patient population which was investigated in the IMA901 clinical trials. In the absence of complete response, only a portion of these patients can experience survival benefit.
  • These findings explain the absence of improved survival in the Phase III IMA901 clinical trial. These results also demonstrated that HLA-A*02 enrichment of the study population was not sufficient to reach the primary overall survival endpoint in the Phase III IMA901 trial. As the IMA901 trial investigators noted, there is a need for the development of a companion diagnostic (CDx) to select likely responders to peptide vaccines. These findings also suggest that selection of patients with ≥2 TUMAP specific PEPIs may provide sufficient enrichment to demonstrate significant clinical benefit of IMA901.
  • Example 12—in Silico Trial Based on the Identification of Vaccine-Derived Multiple HLA Binding Epitopes Predict Reported Experimental Clinical Response Rates
  • A correlation between the ≥2 PEPI3+ Score of immunotherapy vaccines determined in the Model Population described in Example 8 and the reported Disease Control Rate (DCR, proportion of patients with complete responses and partial responses and stable disease) determined in clinical trials was determined.
  • Seventeen clinical trials, conducted with peptide- and DNA-based cancer immunotherapy vaccines that have published Disease Control Rates (DCRs) or objective response rate (ORR) were identified from peer reviewed scientific journals (Table 23). These trials involved 594 patients (5 ethnicities) and covered 29 tumor and viral antigens. DCRs were determined according to the Response Evaluation Criteria in Solid Tumors (RECIST), which is the current standard for clinical trials, in which clinical responses are based on changes in maximum cross-sectional dimensions42, 43, 44. In case there was no available DCR data, objective response rate (ORR) data was used, which is also defined according to the RECIST guidelines.
  • Table 24 compares the ≥2 PEPI3+ Score for each vaccine in the Model Population and the published DCR or ORR. A correlation between the predicted and measured DCR was observed providing further evidence that not only the immunogenicity but also the potency of cancer vaccines depends on the multiple HLA sequences of individuals (R2=0.76) (FIG. 9).
  • TABLE 23
    Clinical trials selected for Disease Control Rate (DCR) prediction.
    Immuno- Pop. Study pop./ HLA Adm. Dose Dosing Assessment
    therapy Antigen Sponsor Disease (n) Ethnicity restriction form (mg) schedule time (weeks) Ref.
    IMA901 9 TAAs Immatics Renal 28 CEU A02 i.d. 0.4 8 × in 10 wks 12 19
    phase I cell
    cancer
    IMA901 9 TAAs Immatics Renal 68 CEU A02 i.d. 0.4 7 × in 5 wks 24 19
    phase II cell then 10 × 3
    cancer wks
    Ipilimumab NY-ESO1 MSKCC Melanoma 19 US no i.v. 0.3 4 × every 3 24 5
    3 wks
    10
    HPV-SLP* HPV-16 E6, Leiden VIN 20 CEU no s.c. 0.3 3 × every 3 12 9
    E7 University wks
    HPV-SLP* Leiden HPV- 5 CEU no s.c. 0.3 3 × every 3 12 (OR) 10
    University related wks
    cervical
    cancer
    gp100-2 gp100 BMS Melanoma 136 US A*0201 s.c. 1 4 × every 3 12 28
    peptides wks
    Immucin Muc-1 VaxilBio Myeloma 15 Israeli no s.c. 0.1 6 × every 2 12** 29
    wks
    StimuVax Muc-1 Merck NSCLC 80 Canadian no s.c. 1 8 × wkly then 12 13, 30
    every 6 wks
    VGX-3100 HPV-16&18 Inovio HPV- 125 US no i.m. 6 0, 4, 12 wks 36 31
    related
    cervical
    cancer
    TSPP Thymidylate Siena CRC, 21 CEU no s.c. 0.1 3 × 3 wks 12 12
    peptide synthase University NSCLC, 0.2
    vaccine Gallbladder 0.3
    carc.,
    Breast-,
    Gastric
    cancer
    KIF20A-66 KIF20A Chiba Metasttatic 29 Japanese A*2402 s.c. 1 2 cycles 1, 12 (OR) 33
    peptide Tokushukai pancreatic 3 8, 15, 22
    vaccine* Hospital cancer days then
    every 2
    wks
    Peptide 3 TAAs Kumamoto HNSCC 37 Janpanese A*2402 s.c. 1 8 × wkly then 12 34
    vaccine* University every 4 wks
    7-peptide 7 TAAs Kinki Metastatic 30 Janpanese A*2402 s.c. 1 Cycles: 5 × 10 (OR) 35
    cocktail University colorectal wkly then 1
    vaccine* cancer wk rest
    GVX301* hTERT University Prostate 14 Janpanese A02 i.d. 0.5 1, 3, 5, 7, 14, 12 25
    Genoa and renal 21, 35, 63
    cancer days
    MAGE-A3 MAGE-A3 Abramson Multiple 26 US no s.c. 0.3 14, 42, 90, 24 36
    Trojan* Cancer myeloma 120, 150 days
    Center
    PepCan HPV-16E6 University CIN2/3 23 US no i.m. 0.05 4 × 3 wks 24 37
    of 0.1
    Arkansas 0.25
    0.5
    Melanoma Tyrosinase, University Melanoma 26 US A1, A2 or s.c. 0.1 6 cycles: 0, 6 27
    peptide gp100 of A3 7, 14, 28, 35,
    vaccine* Virginia 42 days
    *Montanide ISA51 VG as adjuvant
    **Disease response was assessed according to the International Myeloma Working Group response criteria45
  • TABLE 24
    The Disease Control Rates (DCRs) and MultiPEPI Scores
    (predicted DCR) in 17 clinical trials.
    MultiPEPI Score Overall Percentage
    Immunotherapy DCR (Predicted DCR) of Agreement
    IMA901 phase I 43% 27% 61%
    IMA901 phase II 22% 27% 81%
    Ipilimumab
    60% 65% 92%
    HPV-SLP 60% 70% 86%
    HPV-SLP 62% 70% 89%
    gp100-2 peptides 15% 11% 73%
    Immucin 73% 59% 81%
    StimuVax
     0%  0% 100% 
    VGX-3100 50% 56% 89%
    TSPP peptide vaccine 48% 31% 65%
    KIF20A-66 peptide 26%  7% 27%
    vaccine
    Peptide vaccine
    27% 10% 37%
    7-peptide cocktail 10%  9% 90%
    vaccine
    GVX301 29%  7% 24%
    MAGE-A3 Trojan 35% 10% 29%
    PepCan 52% 26% 50%
    Melanoma peptide
    12%  6% 50%
    vaccine
  • Example 13 in Silico Trials Based on the Identification of Multiple HLA Binding Epitopes Predict the Reported Cellular Immune Response Rates to a Vaccine Targeting a Mutational Antigen
  • The epidermal growth factor receptor variant III (EGFRvIII) is a tumor-specific mutation broadly expressed in glioblastoma multiforme (GBM) and other neoplasms. The mutation comprises an in-frame deletion of 801 bp from the extracellular domain of the EGFR that splits a codon and yields a novel glycine at the fusion junction.1, 2 This mutation encodes a constitutively active tyrosine kinase that increases tumor formation and tumor cell migration and enhances resistance against radiation and chemotherapy.3, 4, 5, 6, 7, 8, 9 This insertion results in a tumor-specific epitope which is not found in normal adult tissues making EGFRvIII a suitable target candidate for antitumor immunotherapy.10 Rindopepimut is a 13-amino-acid peptide vaccine (LEEKKGNYVVTDHC) spanning the EGFRvIII mutation with an additional C-terminal cysteine residue.11
  • In a phase II clinical study, the peptide conjugated to keyhole limpet hemocyanin (KLH) was administered to newly diagnosed EGFRvIII-expressing GBM patients. The first three vaccinations were given biweekly, starting 4 weeks after the completion of radiation. Subsequent vaccines were given monthly until radiographic evidence of tumor progression or death. All vaccines were given intradermally in the inguinal region. Immunologic evaluation showed only 3 out of 18 patients developing cellular immune response assessed by DTH reaction test.
  • An in silico trial with the Model Population of 433 subjects with Rindopepimut sequence was conducted. 4 out of 433 subjects had PEPI3+, confirming the low immunogenicity found in the phase II study (Table 25).
  • TABLE 25
    Results of clinical trial and in silico study
    Responders Response rate
    Clinical trial (Phase II) 3/18  16.6%
    In silico study (PEPI3+ Test) 4/433   1%
  • An HLA map of the Rindopepimut on the HLA alleles of the subjects in the Model Population (FIG. 10) illustrates that very few HLA-A and HLA-C alleles can bind the vaccine epitopes which explains the lack of PEPI3+ in the in silico cohort.
  • In a recent phase III clinical study the ineffectiveness was further demonstrated when 745 patients were enrolled and randomly assigned to Rindopepimut and temozolomide (n=371) or control and temozolomide (n=374) arms.12 The trial was terminated for ineffectiveness after the interim analysis. The analysis showed no significant difference in overall survival: median overall survival was 20.1 months (95% CI 18.5-22.1) in the Rindopepimut group versus 20.0 months (18.1-21.9) in the control group (HR 1.01, 95% CI 0.79-1.30; p=0.93).
  • REFERENCES FOR EXAMPLE 13
    • 1 Bigner et al. Characterization of the epidermal growth factor receptor in human glioma cell lines and xenografts. Cancer Res 1990; 50: 8017-22.
    • 2 Libermann et al. Amplification, enhanced expression and possible rearrangement of EGF receptor gene in primary human brain tumours of glial origin. Nature 1985; 313: 144-7.
    • 3 Chu et al. Receptor dimerization is not a factor in the signalling activity of a transforming variant epidermal growth factor receptor (EGFRvIII). Biochem J 1997; 324: 855-61.
    • 4 Batra et al. Epidermal growth factor ligand-independent, unregulated, cell-transforming potential of a naturally occurring human mutant EGFRvIII gene. Cell Growth Differ 1995; 6: 1251-9.
    • 5 Nishikawa et al. A mutant epidermal growth factor receptor common in human glioma confers enhanced tumorigenicity. PNAS 1994; 91: 7727-31.
    • 6 Lammering et al. Inhibition of the type III epidermal growth factor receptor variant mutant receptor by dominant-negative EGFR-CD533 enhances malignant glioma cell radiosensitivity. Clin Cancer Res 2004; 10: 6732-43.
    • 7 Nagane et al. A common mutant epidermal growth factor receptor confers enhanced tumorigenicity on human glioblastoma cells by increasing proliferation and reducing apoptosis. Cancer Res 1996; 56: 5079-86.
    • 8 Lammering et al. Radiation-induced activation of a common variant of EGFR confers enhanced radioresistance. Radiother Oncol 2004; 72: 267-73.
    • 9 Montgomery et al. Expression of oncogenic epidermal growth factor receptor family kinases induces paclitaxel resistance and alters β-tubulin isotype expression. J Biol Chem 2000; 275: 17358-63.
    • 10 Humphrey et al. Anti-synthetic peptide antibody reacting at the fusion junction of deletion-mutant epidermal growth factor receptors in human glioblastoma. PNAS 1990; 87: 4207-11.
    • 11 Sampson et al. Immunologic Escape After Prolonged Progression-Free Survival With Epidermal Growth Factor Receptor Variant III Peptide Vaccination in Patients With Newly Diagnosed Glioblastoma. J Clin Oncol 28:4722-4729.
    • 12 Weller at al. Rindopepimut with temozolomide for patients with newly diagnosed, EGFRvIII-expressing glioblastoma (ACT IV): a randomised, double-blind, international phase 3 trial. Lancet Oncol 2017; 18(10): 1373-1385.
    Example 14. Multiple HLA Binding Peptides of Individuals can Predict Immune-Toxicity
  • Thrombopoietin (TPO) is a highly immunogenic protein drug causing toxicity in many patients. EpiVax/Genentech used State of Art technology to identify class II HLA restricted epitopes and found that the most immunogenic region of the TPO is located in the C-terminal end of TPO (US20040209324 A1).
  • According to the present disclosure we defined the multiple class II HLA binding epitopes (PEPI3+s) from TPO in 400 HLA class II genotyped US subjects were determined. Most of the PEPI3+ peptides of these individuals located within the N terminal region of the TPO between 1-165 amino acids. PEPI3+ were sporadically identified in some subjects also in the C terminal region. However, our results were different from the State of Art.
  • The published literature confirmed the disclosed results, demonstrating experimental proof for the immunotoxic region being located at the N-terminal end of TP040, 41. Most individuals treated with TPO drug made anti-drug antibodies (ADA) ADA against this region of the drug. These antibodies not only abolished therapeutic effect of the drug but also caused systemic adverse events, i.e. immune-toxicity, like antibody-dependent cytotoxicity (ADCC) and complement-dependent cytotoxicity associated with thrombocytopenia, neutropenia and anemia. These data demonstrate that the identification of multiple HLA binding peptides of individuals predicts the immune-toxicity of TPO. Therefore, the disclosure is useful to identify the toxic immunogenic region of drugs, to identify subjects who likely experience immune-toxicity from drugs, to identify regions of a polypeptide drug that may be targeted by ADAs, and to identify subjects who likely experience ADA.
  • Example 15 Personalised Immunotherapy Composition for Treatment of Ovarian Cancer
  • This example describes the treatment of an ovarian cancer patient with a personalised immunotherapy composition, wherein the composition was specifically designed for the patient based on her HLA genotype based on the disclosure described herein. This Example and Example 16 below provide clinical data to support the principals regarding binding of epitopes by multiple HLA of a subject to induce a cytotoxic T cell response on which the present disclosure is based.
  • The HLA class I and class II genotype of metastatic ovarian adenocarcinoma cancer patient XYZ was determined from a saliva sample.
  • To make a personalized pharmaceutical composition for patient XYZ thirteen peptides were selected, each of which met the following two criteria: (i) derived from an antigen that is expressed in ovarian cancers, as reported in peer reviewed scientific publications; and (ii) comprises a fragment that is a T cell epitope capable of binding to at least three HLA class I of patient XYZ (Table 26). In addition, each peptide is optimized to bind the maximum number of HLA class II of the patient.
  • TABLE 26
    XYZ ovarian cancer patient's personalized vaccine
    MAX MAX
    XYZ's Target Antigen HLA HLA
    vaccine Antigen Expression 20 mer peptides classI classII
    POC01_P1 AKAP4 89% NSLQKQLQAVLQWIAASQFN 3 5
    POC01_P2 BORIS 82% SGDERSDEIVLTVSNSNVEE 4 2
    POC01_P3 SPAG9 76% VQKEDGRVQAFGWSLPQKYK 3 3
    POC01_P4 OY-TES-1 75% EVESTPMIMENIQELIRSAQ 3 4
    POC01_P5 SP17 69% AYFESLLEKREKTNFDPAEW 3 1
    POC01_P6 WT1 63% PSQASSGQARMFPNAPYLPS 4 1
    POC01_P7 HIWI 63% RRSIAGFVASINEGMTRWFS 3 4
    POC01_P8 PRAME 60% MQDIKMILKMVQLDSIEDLE 3 4
    POC01_P9 AKAP-3 58% ANSVVSDMMVSIMKTLKIQV 3 4
    POC01_P10 MAGE-A4 37% REALSNKVDELAHFLLRKYR 3 2
    POC01_P11 MAGE-A9 37% ETSYEKVINYLVMLNAREPI 3 4
    POC01_P12a MAGE-A10 52% DVKEVDPTGHSFVLVTSLGL 3 4
    POC01_P12b BAGE 30% SAQLLQARLMKEESPVVSWR 3 2
  • Eleven PEPI3 peptides in this immunotherapy composition can induce T cell responses in XYZ with 84% probability and the two PEPI4 peptides (POC01-P2 and POC01-P5) with 98% probability, according to the validation of the PEPI Test shown in Table 10. T cell responses target 13 antigens expressed in ovarian cancers. Expression of these cancer antigens in patient XYZ was not tested. Instead the probability of successful killing of cancer cells was determined based on the probability of antigen expression in the patient's cancer cells and the positive predictive value of the ≥1 PEPI3+ Test (AGP count). AGP count predicts the effectiveness of a vaccine in a subject: Number of vaccine antigens expressed in the patient's tumor (ovarian adenocarcinoma) with PEPI. The AGP count indicates the number of tumor antigens that vaccine recognizes and induces a T cell response against the patient's tumor (hit the target). The AGP count depends on the vaccine-antigen expression rate in the subject's tumor and the HLA genotype of the subject. The correct value must be between 0 (no PEPI presented by expressed antigen) and maximum number of antigens (all antigens are expressed and present a PEPI).
  • The probability that patient XYZ will express one or more of the 12 antigens is shown in FIGS. 11A-B. AGP95=5, AGP50=7.9, mAGP=100%, AP=13.
  • A pharmaceutical composition for patient XYZ may be comprised of at least 2 from the 13 peptides (Table 26), because the presence in a vaccine or immunotherapy composition of at least two polypeptide fragments (epitopes) that can bind to at least three HLA of an individual (≥2 PEPI3+) was determined to be predictive for a clinical response. The peptides are synthetized, solved in a pharmaceutically acceptable solvent and mixed with an adjuvant prior to injection. It is desirable for the patient to receive personalized immunotherapy with at least two peptide vaccines, but preferable more to increase the probability of killing cancer cells and decrease the chance of relapse.
  • For treatment of patient XYZ the 12 peptides were formulated as 4×¾ peptide (POC01/1, POC01/2, POC01/3, POC01/4). One treatment cycle is defined as administration of all 13 peptides within 30 days.
  • Patient History:
  • Diagnosis: Metastatic ovarian adenocarcinoma
  • Age: 51
  • Family anamnesis: colon and ovary cancer (mother) breast cancer (grandmother)
    Tumor pathology:
  • BRCA1-185delAG, BRAF-D594Y, MAP2K1-P293S, NOTCH1-S2450N
      • 2011: first diagnosis of ovarian adenocarcinoma; Wertheim operation and chemotherapy; lymph node removal
      • 2015: metastasis in pericardial adipose tissue, excised
      • 2016: hepatic metastases
      • 2017: retroperitoneal and mesenteric lymph nodes have progressed; incipient peritoneal carcinosis with small accompanying ascites
    Prior Therapy:
      • 2012: Paclitaxel-carboplatin (6×)
      • 2014: Caelyx-carboplatin (1×)
      • 2016-2017 (9 months): Lymparza (Olaparib) 2×400 mg/day, oral
      • 2017: Hycamtin inf. 5×2.5 mg (3× one seria/month)
      • PIT vaccine treatment began on 21 Apr. 2017.
  • TABLE 27
    Patient XYZ peptide treatment schedule
    Vaccinations
    Lot #
    1st cycle 2nd cycle 3rd cycle 4th cycle
    POC01/1 N1727 21 Apr. 2017 16 Jun. 2017 30 Aug. 2017 19 Oct. 2017
    POC01/2 N1728 28 Apr. 2017 31 May 2017
    POC01/3 N1732 16 Jun. 2017 02 Aug. 2017 20 Sep. 2017
    POC01/4 N1736 15 May 2017 06 Jul. 2017
  • Patient' tumor MRI findings (Baseline Apr. 15, 2016)
      • Disease was confined primarily to liver and lymph nodes. The use of MRI limits detection of lung (pulmonary) metastasis
      • May 2016-January 2017: Olaparib treatment
      • Dec. 25, 2016 (before PIT vaccine treatment) There was dramatic reduction in tumor burden with confirmation of response obtained at FU2
      • January-March 2017—TOPO protocol (topoisomerase)
      • Apr. 6, 2017 FU3 demonstrated regrowth of existing lesions and appearance of new lesions leading to disease progression
      • Apr. 21, 2017 START PIT
      • Jul. 21, 2017 (after the 2nd Cycle of PIT) FU4 demonstrated continued growth in lesions and general enlargement of pancreas and abnormal para pancreatic signal along with increased ascites
      • Jul. 26, 2017—CBP+Gem+Avastin
      • Sep. 20, 2017 (after 3 Cycles of PIT) FU5 demonstrated reversal of lesion growth and improved pancreatic/parapancreatic signal. The findings suggest pseudo progression
      • Nov. 28, 2017 (after 4 Cycles of PIT) FU6 demonstrated best response with resolution of non target lesions
        MRI data for patient XYZ is shown in Table 28 and FIG. 12.
  • TABLE 28
    Summary Table of Lesions Responses
    FU2 FU3 FU4 FU5
    Lesion/ Baseline FU1 (% Δ (% Δ (% Δ (% Δ FU6 Best PD
    Time (% Δ from (% Δ from from from from from (% Δ from Response Time
    Point BL) BL) BL) BL) BL) BL) BL) Cycle Point
    TL1 NA −56.1 −44.4 −44.8 +109.3 −47.8 −67.3 FU6 FU4
    TL2 NA −100.0 −100.0 −47.1 −13.1 −100.0 −100.0 FU1 FU3
    TL3 NA −59.4 −62.3 −62.0 −30.9 −66.7 −75.9 FU6 FU4
    TL4 NA −65.8 −100.0 −100.0 −100.0 −100.0 −100.0 FU2 NA
    SUM NA −66.3 −76.0 −68.9 −23.5 −78.2 −85.2 FU6 FU4
  • Example 16 Design of Personalised Immunotherapy Composition for Treatment of Breast Cancer
  • The HLA class I and class II genotype of metastatic breast cancer patient ABC was determined from a saliva sample. To make a personalized pharmaceutical composition for patient ABC twelve peptides were selected, each of which met the following two criteria: (i) derived from an antigen that is expressed in breast cancers, as reported in peer reviewed scientific publications; and (ii) comprises a fragment that is a T cell epitope capable of binding to at least three HLA class I of patient ABC (Table 29). In addition, each peptide is optimized to bind the maximum number of HLA class II of the patient. The twelve peptides target twelve breast cancer antigens. The probability that patient ABC will express one or more of the 12 antigens is shown in FIG. 13.
  • TABLE 29
    12 peptides for ABC breast cancer patient
    BRC09 vaccine Target Antigen MAXHLA MAXHLA
    peptides Antigen Expression 20 mer peptide Class I Class II
    PBRC01_cP1 FSIP1
    49% ISDTKDYFMSKTLGIGRLKR 3 6
    PBRC01_cP2 SPAG9 88% FDRNTESLFEELSSAGSGLI 3 2
    PBRC01_cP3 AKAP4 85% SQKMDMSNIVLMLIQKLLNE 3 6
    PBRC01_cP4 BORIS 71% SAVFHERYALIQHQKTHKNE 3 6
    PBRC01_cP5 MAGE-A11 59% DVKEVDPTSHSYVLVTSLNL 3 4
    PBRC01_cP6 NY-SAR-35 49% ENAHGQSLEEDSALEALLNF 3 2
    PBRC01_cP7 HOM-TES-85 47% MASFRKLTLSEKVPPNHPSR 3 5
    PBRC01_cP8 NY-BR-1 47% KRASQYSGQLKVLIAENTML 3 6
    PBRC01_cP9 MAGE-A9 44% VDPAQLEFMFQEALKLKVAE 3 8
    PBRC01_cP10 SCP-1 38% EYEREETRQVYMDLNNNIEK 3 3
    PBRC01_cP11 MAGE-A1 37% PEIFGKASESLQLVFGIDVK 3 3
    PBRC01_cP12 MAGE-C2 21% DSESSFTYTLDEKVAELVEF 4 2
  • Predicted Efficacy:
  • AGP95=4; 95% likelihood that the PIT Vaccine induces CTL responses against 4 CTAs expressed in the breast cancer cells of BRC09. Additional efficacy parameters: AGP50=6.3, mAGP=100%, AP=12.
  • Detected Efficacy after the 1st Vaccination with all 12 Peptides:
  • 83% reduction of tumor metabolic activity (PET CT data).
  • For treatment of patient ABC the 12 peptides were formulated as 4×3 peptide (PBR01/1, PBR01/2, PBR01/3, PBR01/4). One treatment cycle is defined as administration of all 12 different peptide vaccines within 30 days.
  • Patient History
  • Diagnosis: bilateral metastatic breast carcinoma: Right breast is ER positive, PR negative, Her2 negative; Left Breast is ER, PR and Her2 negative.
    First diagnosis: 2013 (4 years before PIT vaccine treatment)
    2016: extensive metastatic disease with nodal involvement both above and below the diaphragm. Multiple liver and pulmonar metastases.
    2016-2017 treatment: Etrozole, Ibrance (Palbociclib) and Zoladex
  • Results
  • Mar. 7, 2017: Prior PIT Vaccine treatment
    Hepatic multi-metastatic disease with truly extrinsic compression of the origin of the choledochal duct and massive dilatation of the entire intrahepatic biliary tract. Celiac, hepatic hilar and retroperitoneal adenopathy
    May 26, 2017: After 1 cycle of PIT
    Detected efficacy: 83% reduction of tumor metabolic activity (PET CT) liver, lung lymphnodes and other metastases. Detected safety: Skin reactions
    Local inflammation at the site of the injections within 48 hours following vaccine administrations
  • Follow up:
  • BRC-09 was treated with 5 cycles of PIT vaccine. She was feeling very well and she refused a PET CT examination in September 2017. In November she had symptoms, PET CT scan showed progressive disease, but she refused all treatments. In addition, her oncologist found out that she did not take Palbocyclib since spring/summer. Patient ABC passed away in January 2018.
  • The combination of pablocyclib and the personalised vaccine was likely to have been responsible for the remarkable early response observed following administration of the vaccine. Palbocyclib has been shown to improve the activity of immunotherapies by increases CTA presentation by HLAs and decreasing the proliferation of Tregs: (Goel et al. Nature. 2017:471-475). The PIT vaccine may be used as add-on to the state-of-art therapy to obtain maximal efficacy.
  • Example 17. Breast Cancer Vaccine Design for Large Population and Composition
  • We used the PEPI3+ Test described above to design peptides for use in breast cancer vaccines that are effective in a large percentage of patients, taking into account the heterogeneities of both tumour antigens and patients' HLAs.
  • Breast cancer CTAs were identified and ranked based on the overall expression frequencies of antigens found in breast cancer tumor samples as reported in peer reviewed publications (Chen et al. Multiple Cancer/Testis Antigens Are Preferentially Expressed in Hormone-Receptor Negative and High-Grade Breast Cancers. Plos One 2011; 6(3): e17876; Kanojia et al. Sperm-Associated Antigen 9, a Novel Biomarker for Early Detection of Breast Cancer. Cancer Epidemiol Biomarkers Prev 2009; 18(2):630-639; Saini et al. A Novel Cancer Testis Antigen, A-Kinase Anchor Protein 4 (AKAP4) Is a Potential Biomarker for Breast Cancer. Plos One 2013; 8(2): e57095).
  • For select CTAs we used the PEPI3+ Test and the Model Population described in Example 8 to identify the 9 mer epitopes (PEPI3+s) that are most frequently presented by at least 3HLAs of the individuals in the Model Population. We refer to these epitopes herein as “bestEPIs”. An illustrative example of the “PEPI3+ hotspot” analysis and bestEPI identification is shown in FIG. 14 for the PRAME antigen.
  • We multiplied the reported expression frequency for each CTA (N %) by the frequency of the PEPI3+ hotspots in the Model Population (B %) to identify the T cell epitopes (9 mers) that will induce an immune response against breast cancer antigens in the highest proportion of individuals (Table 30). We then selected 15 mers encompassing each of the selected 9 mers (Table 30). The 15 mers were selected to bind to most HLA class II alleles of most subjects, using the process described in Example 22 below. These 15 mers can induce both CTL and T helper responses in the highest proportion of subjects.
  • TABLE 30
    BestEPI list for selecting breast cancer peptide vaccine composition. Ntotal:
    number of samples analyzed for the expression of the certain antigen; N+:
    number of individuals expressing the certain antigen; N%: expression
    frequency of the certain antigen; B%: bestEPI frequency, ie. the percentage
    of individuals having the bestEPI within the model population;
    N%*B%: expression frequency multiplied by the bestEPI frequency.
    Antigen Information BestEPIs
    Gene length Ntotal N+ N% SEQ Position B% N%*B%
    AKAP-4 854 91  77 85% YLMNRPQNL 167 52% 44%
    AKAP-4 854 91  77 85% MMAYSDTTM 1 49% 41%
    BORIS 663 58  41 71% FTSSRMSSF 264 57% 40%
    AKAP-4 854 91  77 85% YALGFQHAL 121 46% 39%
    SPAG9 1321 100  88 88% KMSSLLPTM 964 43% 38%
    SPAG9 1321 100  88 88% FTVCNSHVL 785 36% 31%
    BORIS 663 58  41 71% MAFVTSGEL 320 44% 31%
    PRAME 509 100  55 55% YLHARLREL 462 52% 28%
    SPAG9 1321 100  88 88% VMSERVSGL 19 28% 25%
    BORIS 663 58  41 71% FTQSGTMKI 407 35% 25%
    NY-SAR-35 255 29  14 48% FSSSGTTSF 163 45% 22%
    MAGE-A9 315 142  63 44% FMFQEALKL 102 49% 22%
    NY-SAR-35 255 29  14 48% FVLANGHIL 97 42% 21%
    PRAME 509 100  55 55% KAMVQAWPF 70 37% 20%
    NY-BR-1 1341 131  61 47% YSCDSRSLF 424 39% 18%
    Survivin 142 167 118 71% RAIEQLAAM 133 26% 18%
    MAGE-A11 429 135  79 59% AMDAIFGSL 184 23% 14%
    HOM-TES-85 313 100  47 47% MASFRKLTL 1 29% 13%
    MAGE-A9 315 142  63 44% SSISVYYTL 67 30% 13%
    NY-BR-1 1341 131  61 47% SAFEPATEM 584 27% 12%
  • Then we designed 31 30 mer peptides. Each consists of two optimized 15 mer fragments, generally from different frequent CTAs, arranged end to end, each fragment comprising one of the 9 mers (BestEPIs) from Table 30. Nine of these 30 mer peptides were selected for a panel of peptides, referred to as PolyPEPI915 (Table 31). Expression frequencies for the 10 CTAs targeted by PolyPEPI915, singly and in combination, are shown in FIG. 15.
  • TABLE 31
    Selected Breast Cancer Vaccine peptides for PolyPEPI915 panel/composition
    HLAI* HLAII**
    TREOSID Source Antigen Peptide (30 mer) (CD8) (CD4)
    BCV900-4-1 SPAG9/AKAP4 GNILDSFTVCNSHVLLQKYALGFQHALSPS 53%  75%
    BCV900-4-2 BORIS/NY-SAR-35 NMAFVTSGELVRHRRFSSSGTTSFKCFAPF 65%  46%
    BCV900-3-3 NY-BR-1/SURVIVIN YSODSRSLFESSAKITAKKVRRAIEQLAAM 55%  11%
    BCV900-3-4 AKAP-4/BORIS MMAYSDTTMMSDDIDHTRFTQSGTMKIHIL 72%  45%
    BCV900-4-5 SPAG9/BORIS AQKMSSLLPTMWLGAMFTSSRMSSFNRHMK 72%  50%
    BCV900-5-6 HomTes85/MageA11 MASFRKLTLSEKVPPSPTAMDAIFGSLSDE 45%  16%
    BCV900-5-7 AKAP4/PRAME DQVNIDYLMNRPQNLRHSQTLKAMVQAWPF 64%  33%
    BCV900-5-8 NYSAR/SPAG9 CSGSSYFVLANGHILSGAVMSERVSGLAGS 46%  48%
    BCV900-3-9 PRAME/MAGE-A9 LERLAYLHARLRELLQLEFMFQEALKLKVA 73% 100%
    PolyPEPI915 (9 peptide together) 96% 100%
    *Percentage of individuals having CD8+ T cell specific PEPI3+ within the Model Population (n = 433).
    **Percentage of individuals having CD4+ T cell specific PEPI4+ within the Model Population (n = 433).
  • Characterization of PolyPEPI915
  • Tumor heterogeneity can be addressed by including peptide sequences that target multiple CTAs in a vaccine or immunotherapy regime. The PolyPEPI915 composition targets 10 different CTAs. Based on the antigen expression rates for these 10 CTAs, we modelled the predicted average number of expressed antigens (AG50) and the minimum number of expressed antigens with 95% likelihood (AG95) in the cancer cells. 95% of individuals expressed minimum 4 of the 10 target antigens (AG95=4) as shown by the antigen expression curve in FIGS. 16A-B.
  • The AG values described above characterize a vaccine independently from the target patient population. They can be used to predict the likelihood that a specific cancer (e.g. breast cancer) expresses antigens targeted by a specific vaccine or immunotherapy composition. AG values are based on known tumor heterogeneity, but do not take HLA heterogeneity into account.
  • HLA heterogeneity of a certain population can be characterised from the viewpoint of an immunotherapy or vaccine composition by the number of antigens representing PEPI3+. These are the vaccine-specific CTA antigens for which ≥1 PEPI3+ is predicted, referred to herein as the “AP”. The average number of antigens with PEPI3+(AP50) shows how the vaccine can induce immune response against the antigens targeted by the composition (breast cancer vaccine specific immune response). The PolyPEPI915 composition can induce immune response against an average of 5.3 vaccine antigens (AP50=5.30) and 95% of the Model Population can induce immune response against at least one vaccine antigen (AP95=1)(FIGS. 17A-B).
  • Vaccines can be further characterized by AGP values that refers to antigens with PEPIs”. This parameter is the combination of the previous two parameters: (1) AG is depending on the antigen expression frequencies in the specific tumor type but not on the HLA genotype of individuals in the population, and (2) AP is depending on the HLA genotype of individuals in a population without taking account the expression frequencies of the antigen. The AGP is depending on both, the expression frequencies of vaccine antigens in the disease and the HLA genotype of individuals in a population.
  • Combining the data of AG of breast cancer and AP in the Model Population we determined the AGP value of PolyPEPI915 that represents the probability distribution of vaccine antigens that are induce immune responses against antigens expressed in breast tumors. For PolyPEPI915, the AGP50 value in the Model Population is 3.37. The AGP92=1, means that 92% of the subjects in the Model Population induce immune responses against at least one expressed vaccine antigen (FIGS. 18A-B).
  • Example 18—Likely Responder Patient Selection Using Companion Diagnostic Tests for Vaccines
  • The likelihood that a specific patient will have an immune response or a clinical response to treatment with one or more cancer vaccine peptides, for example as described above, can be determined based on (i) the identification of PEPI3+ within the vaccine peptide(s) (9 mer epitopes capable of binding at least three HLA of the patient); and/or (ii) a determination of target antigen expression in cancer cells of the patient, for example as measured in a tumour biopsy. In some cases both parameters are ideally determined and the optimal combination of vaccine peptides is selected for use in treatment of the patient. However, PEPI3+ analysis alone may be used if a determination of the expressed tumour antigens, for example by biopsy, is not possible, not advised, or unreliable due to biopsy error (i.e. biopsy tissue samples taken from a small portion of the tumor or metastasised tumors do not represent the complete repertoire of CTAs expressed in the patient).
  • Example 19—Comparison of PolyPEPI915 with Competing Breast Cancer Vaccines
  • We used the in silico clinical trial model described in above to predict the immune response rates of competing breast cancer vaccines that have been investigated in clinical trials (Table 32). The immune response rate of these products were between 3% and 91%.
  • The single peptide vaccines were immunogenic in 3%-23% of individuals. In comparison, the 30 mer peptides described in Example 18 above (Table 29) were each immunogenic in from 44% to 73% of individuals in the same cohorts. This result represents substantial improvement in immunogenicity of each peptide in PolyPEPI915.
  • Competing combination peptide products immune response rates were between 10-62%. The invented PolyPEPI915 combination product were 96% in the Model Population and 93% in a breast cancer patient population, representing improvement in immunogenicity.
  • TABLE 32
    Predicted immune response rates of competing breast cancer vaccines
    Predicted immune
    response rates*
    433 90
    normal patients
    donors with
    Breast Cancer Target (Model breast
    Vaccines Sponsors antigens Population) cancer
    DPX0907 Immuno Vaccine 7 58% 62%
    Multipeptide Tech.
    Multipeptide vaccine University of 5 22% 31%
    Virginia
    Ad-sig-hMUC-1/ Singapore CRI 1 91% 80%
    ecdCD40L
    NY-ESO-1 IDC-G305 Immune Design 1 84% 84%
    Corp.
    6 HER2 peptide University 1 29% 36%
    pulsed DC Pennsylvania
    HER-2 B Cell peptide Ohio State 1 18% 23%
    University
    HER-2/neu ID protein University 1 10% 11%
    Washington
    NeuVax peptide Galena Biopharma 1  6%  3%
    StimuVax ®(L-BLP25) EMD Serono 1  6%  8%
    peptide
    PolyPEPI915 Treos Bio 10 96% 93%
    *Proportion of subjects with ≥1 PEPI3+
  • Another improvement of using the PolyPEPI915 vaccine is the lower chance of tumor escape. Each 30 mer peptide in PolyPEPI915 targets 2 tumor antigens. CTLs against more tumor antigens are more effective against heterologous tumor cells that CTLs against a single tumor antigen.
  • Another improvement is that PolyPEPI915 vaccine is that individuals who likely respond to vaccination can be identified based on their HLA genotypes (sequence) and optionally antigen expression in their tumor using the methods described here. Pharmaceutical compositions with PolyPEPI vaccines will not be administered to individuals whose HLA cannot present any PEPI3 from the vaccines. During clinical trials correlation will be made between the mAGP or number of AGP in the PolyPEPI915 regimen and the duration of individual's responses. A vaccine combination with ≥1 AGP is most likely required to destroy heterologous tumor cells.
  • Example 20 Colorectal Cancer Vaccine Design and Composition
  • We show another example for colorectal vaccine composition using the same design method demonstrated above. We used the PEPI3+ Test described above to design peptides for use in colorectal cancer vaccines that are effective in a large percentage of patients, taking into account the heterogeneities of both tumour antigens and patient HLAs.
  • Colorectal cancer CTAs were identified and ranked based on the overall expression frequencies of antigens found in colorectal cancer tumor samples as reported in peer reviewed publications (FIG. 19) (Choi J, Chang H. The expression of MAGE and SSX, and correlation of COX2, VEGF, and survivin in colorectal cancer. Anticancer Res 2012. 32(2):559-564; Goossens-Beumer I J, Zeestraten E C, Benard A, Christen T, Reimers M S, Keijzer R, Sier C F, Liefers G J, Morreau H, Putter H, Vahrmeijer A L, van de Velde C J, Kuppen P J. Clinical prognostic value of combined analysis of Aldhl, Survivin, and EpCAM expression in colorectal cancer. Br J Cancer 2014. 110(12):2935-2944; Li M, Yuan Y H, Han Y, Liu Y X, Yan L, Wang Y, Gu J. Expression profile of cancer-testis genes in 121 human colorectal cancer tissue and adjacent normal tissue. Clinical Cancer Res 2005. 11(5):1809-1814).
  • For the selection of the most frequently expressed colorectal cancer CTAs we used the PEPI3+ Test and the Model Population described in Example 8 to identify the “bestEPIs”.
  • We multiplied the reported expression frequency for each CTA (N %) by the frequency of the PEPI3+ hotspots in the Model Population (B %) to identify the T cell epitopes (9 mers) that will induce an immune response against colorectal cancer antigens in the highest proportion of individuals (Table 33). We then selected 15 mers encompassing each of the selected 9 mers (Table 33). The 15 mers were selected to bind to most HLA class II alleles of most subjects, using the process described in Example 22 below. These 15 mers can induce both CTL and T helper responses in the highest proportion of subjects.
  • TABLE 33
    BestEPI list for selecting colorectal cancer peptide vaccine
    composition. Ntotal: number of biopsy samples (tumor specific antigen
    expression in human colorectal cancer tissues) analyzed for the
    expression of the certain antigen; N+: number of individuals
    expressing the certain antigen; N%: expression frequency of the
    certain antigen; B%: bestEPI frequency, ie. the percentage of
    induviduals having the bestEPI within the model population; N%*B%:
    expression frequency multiplied by the bestEPI frequency.
    Antigen Information BestEPIs
    Gene LEN Ntotal N+ N% SEQ POS B% N%*B%
    TSP50 385 95 85 89% FSYEQDPTL 106 51% 45.7%
    EpCAM 314 309 273 88% RTYWIIIEL 140 51% 45.1%
    TSP50 385 95 85 89% TTMETQFPV 85 36% 32.6%
    Spag9 1321 78 58 74% FSFVRITAL 1143 44% 32.6%
    Spag9 1321 78 58 74% KMSSLLPTM 964 43% 32.1%
    CAGE1 777 47 35 74% KMHSLLALM 616 42% 31.5%
    FBXO39 442 57 22 39% FMNPYNAVL 96 78% 30.1%
    CAGE1 777 47 35 74% KSMTMMPAL 760 37% 27.3%
    EpCAM 314 309 273 88% YVDEKAPEF 251 28% 24.7%
    FBXO39 442 57 22 39% KTMSTFHNL 218 58% 22.2%
    Survivin 142 309 267 86% RAIEQLAAM 133 26% 22.2%
    Spag9 1321 78 58 74% VMSERVSGL 19 28% 21.0%
    TSP50 385 95 85 89% YRAQRFWSW 192 20% 17.8%
    FBXO39 442 57 22 39% FFFERIMKY 287 46% 17.6%
    Survivin 142 309 267 86% STFKNWPFL 20 15% 13.0%
    Mage-A8 318 80 35 44% AIWEALSVM 223 20%  8.7%
    Mage-A8 318 80 35 44% KVAELVRFL 115 18%  7.7%
    Mage-A6 314 250 69 28% FVQENYLEY 250 27%  7.5%
    Mage-A8 318 80 35 44% RALAETSYV 279 16%  7.1%
    Mage-A6 314 250 69 28% YIFATCLGL 176 25%  6.9%
  • Then we designed 31 30 mer peptides. Each consist of two optimized 15 mer fragments, generally from different frequent CTAs, where the 15 mer fragments are arranged end to end, each fragment comprising one of the 9 mers (BestEPIs) described above. Nine of these 30 mer peptides were selected for a panel of peptide vaccines, referred to as PolyPEPI1015 (Table 34). Expression frequencies for the 8 CTAs targeted by PolyPEPI1015, singly and in combination, are shown in FIG. 19.
  • TABLE 34
    Selected Colorectal Cancer Vaccine peptides for PolyPEPI1015 composition
    HLAI* HLAII**
    TREOSID Source Antigen Peptide (30 mer) (CD8) (CD4)
    CCV1000-5-1 TSP50 PSTTMETQFPVSEGKSRYRAQRFWSWVGQA  53% 53%
    CCV1000-2-2 EpCAM/Survivin VRTYWIIIELKHKARTAKKVRRAIEQLAAM  57% 98%
    CCV1000-5-3 pCAM/Mage-A8 YVDEKAPEFSMQGLKDEKVAELVRFLLRKY  43% 72%
    CCV1000-5-4 TSP50/Spag9 RSCGFSYEQDPTLRDGTGKLGFSFVRITAL  67% 82%
    CCV1000-5-5 Mage-A8/Mage-A6 SRAPEEAIWEALSVMQYFVQENYLEYRQVP  45% 76%
    CCV1000-2-6 CAGE1/Survivin LASKMHSLLALMVGLKDHRISTFKNWPFLE  58% 95%
    CCV1000-5-7 CAGE1/Spag9 PKSMTMMPALFKENRSGAVMSERVSGLAGS  57% 57%
    CCV1000-2-8 FBXO39 KFMNPYNAVLTKKFQKVNFFFERIMKYERL  90% 98%
    CCV1000-2-9 Spag9/FBXO39 AQKMSSLLPTMWLGAFKKTMSTFHNLVSLN  67% 66%
    PolyPEPI1015 (9 peptide together) 100% 99%
    *Percentage of individuals having CD8+ T cell specific PEPI3+ within the Model Population (n = 433).
    **Percentage of individuals having CD4+ T cell specific PEPI4+ within the Model Population (n = 433).
  • Characterization of PolyPEPI1015 Colorectal Cancer Vaccine
  • Tumor heterogeneity: The PolyPEPI1015 composition targets 8 different CTAs (FIG. 19). Based on the antigen expression rates for these 8 CTAs, AG50=5.22 and AG95=3 (FIGS. 20A-B). Patient heterogeneity: the AP50=4.73 and AP95=2 (AP95=2) (FIGS. 21A-B). Both tumor and patient heterogeneity: AGP50=3.16 and AGP95=1 (Model Population) (FIGS. 22A-B).
  • Example 21—Comparison of Colorectal Cancer Vaccine Peptides with Competing Colorectal Cancer Vaccines
  • We used the in silico clinical trial model described above to determine T cell responder rate of state of art and currently developed CRC peptide vaccines and compared to that of polyPEPI1015 (Table 34). Our PEPI3+ test demonstrates that competing vaccines can induce immune responses against one tumor antigen in a fraction of subjects (2%-77%). However, the multi-antigen (multi-PEPI) response determination for the 2 competitor multi-antigen vaccines resulted in no or 2% responders. *% of responders are the ratio of subjects from the Model population with 1≥PEPI3+ for HLAI (CD8+ T cell responses) in case of 1, or for 2, 3, 4 or 5 antigens of the vaccine compositions. Since multi-PEPI responses correlate with clinical responses induced by tumor vaccines, it is unlikely that any of the competing vaccines will demonstrate clinical benefit in 98% of patients. In contrast, we predicted multi-PEPI responses in 95% of subjects suggesting the likelihood for clinical benefit in the majority of patients.
  • TABLE 35
    Predicted immune response rates of polyPEPI1015 and competing colorectal
    cancer vaccines
    % of CD8+ T cell responders in 433 subjects*
    Colorectal Cancer Vaccine % responders against multiple Ags
    Vaccines Sponsor antigens (Ags) 1 Ag 2 Ags 3 Ags 4 Ags 5 Ags
    Stimuvax ® (L-BLP25) Johannes Gutenberg 1   6%
    Peptide Vaccine University Mainz
    WT1 Multipeptide Shinshu University, 1  79%
    Vaccine Japan
    Multiepitope Peptide Kinki University 7   5%  2%  0%  0%  0%
    Cocktail Vaccine
    p53 Synthetic Long Leiden University 1  77%
    Peptide Vaccine Medical Center
    HER-2 B Cell Ohio State University 1  18%
    Peptide Vaccine Comprehensive
    Cancer Center
    NY-ESO-1 peptide Jonsson 1   0%
    pulsed dendritic cell ComprehensiveCancer   
    vaccine Center   
    OCV-C02 Otsuka 2   2% 0%
    Pharmaceutical Co.,
    Ltd.
    TroVax vaccine Oxford BioMedica 1  94%
    (OXB-301)
    ImMucin Vaxil Bio Theapeutics 1  95%
    PolyPEPI 1015 Treos Bio 8 100% 95% 87% 70% 54%
  • Example 22. Efficacy by Design Procedure Exemplified for PolyPEPI1018 Colorectal Cancer Vaccine
  • The PolyPEPI1018 Colorectal Cancer (CRC) Vaccine (PolyPEPI1018) composition is a peptide vaccine intended to be used as an add-on immunotherapy to standard-of-care CRC treatment options in patients identified as likely responders using a companion in vitro diagnostic test (CDx). Clinical trials are ongoing in the US and Italy to evaluate PolyPEPI1018 in metastatic colorectal cancer patients. The product contains 6 peptides (6 of the 30 mer peptides PolyPEPI1015 described in examples 18 to 20 mixed with the adjuvant Montanide. The 6 peptides were selected to induce T cell responses against 12 epitopes from 7 cancer testis antigens (CTAs) that are most frequently expressed in CRC. The 6 peptides were optimized to induce long lasting CRC specific T cell responses. Likely responder patients with T cell responses against multiple CTAs expressed in the tumor can be selected with a companion diagnostic (CDx). This example sets out the precision process used to design PolyPEPI1018. This process can be applied to design vaccines against other cancers and diseases.
  • A. Selection of Multiple Antigen Targets
  • The selection of tumor antigens is essential for the safety and efficacy of cancer vaccines. The feature of a good antigen is to have restricted expression in normal tissues so that autoimmunity is prevented. Several categories of antigen meet this requirement, including uniquely mutated antigens (e.g. p53), viral antigens (e.g. human papillomavirus antigens in cervical cancer), and differentiation antigens (e.g. CD20 in B-cell lymphoma).
  • The inventors selected multiple cancer testis antigens (CTAs) as target antigens since they are expressed in various types of tumor cells and testis cells, but not expressed in any other normal somatic tissues or cells. CTAs are desirable targets for vaccines for at least the following reasons:
      • tumors of higher histological grade and later clinical stage often show higher frequency of CTA expression
      • only a subpopulation of tumor cells express a certain CTA
      • different cancer types are significantly different in their frequency of CTA expression
      • tumors that are positive for a CTA often show simultaneous expression of more than one CTA
      • None of the CTAs appear to be cell surface antigens, therefore these are unique targets for cancer vaccines (they are not suitable targets for antibody based immunotherapies)
  • To identify the target CTAs for PolyPEPI1018, the inventors built a CTA expression knowledgebase. This knowledgebase contains CTAs that are expressed in CRC ranked in order by expression rate. Correlation studies conducted by the inventors (see Example 11) suggest that vaccines which induce CTL responses against multiple antigens that are expressed in tumor cells can benefit patients. Therefore, seven CTAs with high expression rates in CRC were selected for inclusion in PolyPEPI1018 development. Details are set out in Table 36.
  • TABLE 36
    Target CTAs in PolyPEPI1018 CRC vaccine
    Ex-
    CTA pression
    Name Rate Characterization
    TSP50 89.47% Testis-Specific Protease-Like Protein 50 is an oncogene which induces cell
    proliferation, cell invasion, and tumor growth. It is frequently expressed
    in gastric-, breast-, cervical- and colorectal cancer samples; and rarely
    expressed in normal human tissues, except in spermatocytes of testes.
    EpCAM 88.35% Epithelial Cell Adhesion Molecule is a tumor associated antigen, which is
    expressed in colon cancers and over-expressed in various human carcinomas.
    The high expression of EpCAM in cancer-initiating stem cells makes it a
    valuable target for cancer vaccines. EpCAM is also expressed in at low or
    negligible levels in normal epithelial cells, with the exception of
    squamous epithelium, hepatocytes and keratinocytes.
    Survivin 87.28% Survivin (Baculoviral IAP repeat-containing protein 5) is a multi-tasking
    protein that promotes cell proliferation and inhibits apoptosis. Though
    it is strongly expressed in fetal tissues and necessary for normal
    development, it is not expressed in most adult tissues. Survivin
    is expressed in various cancers including carcinomas. Normal
    tissues that express low level survivin include thymus,
    CD34+ bone-marrow-derived stem cells, and basal colonic epithelium.
    Dramatic over-expression of survivin compared with normal tissues
    us observed in tumors in the lung, breast, colon, stomach, esophagus,
    pancreas, bladder, uterus, ovaries, large-cell non-Hodgkin's lymphoma,
    leukemias, neuroblastoma, melanoma and non-melanoma skin cancers.
    CAGE1 74.47% Cancer-associated gene 1 protein is a typical CTA, which might play
    a role in cell proliferation and tumorigenesis. CAGE1 is
    highly expressed in colorectal cancer tissues and weakly expressed
    in adjacent normal colorectal mucosa. In addition, CAGE1 is expressed
    in melanoma, hepatoma, and breast tumors. No CAGE1 protein
    expression is detected in healthy human tissues, other than testes.
    SPAG9 74.36% Sperm-associated antigen 9 is involved in c-Jun N-terminal kinase-signaling
    and functions as a scaffold protein, thus playing an important role in cell
    survival, proliferation, apoptosis and tumor development. SPAG9 expression
    was detected in epithelial ovarian cancer (90%), breast cancer (88%),
    cervical cancer (82%), renal cell cancer (88%) and colorectal cancer
    (74%) patients. None of the adjacent noncancerous tissues showed
    antigen expression. SPAG9 expression is restricted to testis.
    FBXO39 38.60% FBXO39 (BCP-20) is a testis specific protein and is an important part of the
    E3 ubiquitin ligase complex. It participates in ubiquitination and has a role
    in regulating the cell cycle, immune responses, signaling, and proteasomal
    degradation of proteins. FBXO39 is expressed in colon and breast
    cancers. FBXO39 expression has also been detected in ovary, placenta,
    and lung. FBXO39 expression is 100-fold higher in testis and 1,000-
    fold higher in colorectal cancers compared with normal tissue.
    MAGEA8 43.75% Melanoma-associated antigen 8 function is not known, though it may
    play a role in embryonal development and tumor transformation
    or aspects of tumor progression. MAGE-A8 gene is expressed
    in CRC and hepatocellular carcinoma. MAGE-A8 expression in
    normal tissues is restricted to the testis and the placenta.
  • B. Precise Targeting is Achieved by PEPI3+ Biomarker Based Vaccine Design
  • As described above the PEPI3+ biomarker predicts a subject's vaccine induced T cell responses. The inventors developed and validated a test to accurately identify the PEPIs from antigen sequences and HLA genotypes (Examples 1, 2, 3). The PEPI Test algorithm was used to identify the dominant PEPIs (besEPIs) from the 7 target CTAs to be included in PolyPEPI1018 CRC vaccine.
  • The dominant PEPIs identified with the process described here can induce CTL responses in the highest proportion of subjects:
      • i. Identification of all HLA class I binding PEPIs from the 7 CTA targets in each of the 433 subjects in the Model Population
      • ii. Identification of the dominant PEPIs (BestEPIs) that are PEPIs present in the largest subpopulation.
  • The 12 dominant PEPIs that are derived from the 7 CTAs in PolyPEPI1018 are presented in the following table. The PEPI % in Model Population indicates the proportion of 433 subjects with the indicated PEPI, i.e. the proportion of subjects where the indicated PEPI can induce CTL responses. There is very high variability (18%-78%) in the dominant PEPIs to induce CTL responses despite the optimization steps used in the identification process.
  • TABLE 37
    CRC specific HLA class I binding dominant PEPIs in PolyPEPI1018
    Dominant PEPI3+ for each of the 7 CTAs in PolyPEPI1018 in CRC patients
    Peptides in PEPI3+ % in
    PolyPEPI1018 CRC Antigens Dominant PEPI3+ Model Population
    CRC-P1 TSP50 TTMETQFPV 36%
    YRAQRFWSW 20%
    CRC-P2 EpCAM RTYWIIIEL 51%
    Survivin RAIEQLAAM
    26%
    CRC-P3 EpCAM YVDEKAPEF 28%
    MAGE-A8 KVAELVRFL 18%
    CRC-P6 CAGE1 KMHSLLALM 42%
    Survivin STFKNWPFL
    15%
    CRC-P7 CAGE1 KSMTMMPAL 37%
    SPAG9 VMSERVSGL
    28%
    CRC-P8 FBXO39 FMNPYNAVL 78%
    FFFERIMKY 46%
  • The inventors optimized each dominant PEPI to bind to most HLA class II alleles of most subjects. This should enhance efficacy, because it will induce CD4+T helper cells that can augment CD8+ CTL responses and contribute to long lasting T cell responses. The example presented in FIG. 4 demonstrates that PEPIs that bind to 23 HLA class II alleles most likely activate T helper cells.
  • The 15-mer peptides selected with the process described here contain both HLA class I and class II binding dominant PEPIs. Therefore, these peptides can induce both CTL and T helper responses in the highest proportion of subjects.
  • Process:
      • 1. Identification the HLA class II genotype of 400 normal donors*
      • 2. Extension of each 9-mer dominant PEPI (Table 33) on both sides with amino acids that match the source antigen
      • 3. Prediction of HLA class II PEPIs of 400 normal donors using an IEDB algorithm
      • 4. Selection the 15-mer peptide with the highest proportion of subject have HLA Class II binding PEPIs
      • 5. Ensure the presence of one dominant HLA class II PEPI in each vaccine peptide when joining two 15-mer peptides
  • The 12 optimized 15-mer peptides derived from the 7 CTAs in PolyPEPI1018 are presented in the Table 38. These peptides have different HLA class II binding characteristics. There is a high variability (0%-100%) in PEPI generation capacity (≥3 HLA binding) among these peptides despite such an optimized personalized vaccine design.
  • TABLE 38
    Antigen specific HLA class II binding PEPIs in PolyPEPI1018.
    Average HLA % subjects % subjects % subjects % subjects
    class II with ≥1 HLA with ≥2 HLA with ≥3 HLA with ≥4 HLA
    binding class II class II class II class II
    Nr. CRC antigens alleles binding binding binding binding
    CRC-P1 TSP50 (83-97) 0  0%  0%  0%  0%
    TSP50 (190-204) 4 100%  99%  88%  53%
    CRC-P2 EPCAM(139-153) 5 100% 100% 100%  98%
    SURVIVIN(127- 2  84%  58%  26%  11%
    141)
    CRC-P3 EPCAM(251-265) 0  0%  0%  0%  0%
    MAGE-A8(113- 4 100% 100%  95%  72%
    127)
    CRC-P6 CAGE(613-627) 5 100% 100%  99%  35%
    SURVIVIN(15-29) 3 100%  97%  83%  45%
    CRC-P7 CAGE(759-773) 3 100%  98%  87%  56%
    SPAG9(16-30) 1  66%  35%   9%   2%
    CRC-P8 FBXO39(95-109) 3 100%  94%  43%  13%
    FBXO39(284-298) 5 100% 100% 100%  98%
  • The 30-mer vaccine peptides have the following advantages compared to shorter peptides:
      • (i) Multiple precisely selected tumor specific immunogens: each 30 mer contains two precisely selected cancer specific immunogenic peptides that are capable to induce CTL and T helper responses in the majority of the relevant population (similar to the model population).
      • (ii) Ensure natural antigen presentation. 30-mer long polypeptides can be viewed as pro-drugs: They are not biologically active by themselves, but are processed to smaller peptides (9 to 15 amino acid long) to be loaded into the HLA molecules of professional antigen presenting cells. The antigen presentation resulting from long peptide vaccination reflects physiological pathways for presentation in both HLA class I and class II molecules. In addition, long peptide processing in the cells is much more efficient than that of large intact proteins.
      • (iii) Exclude induction of tolerizing T cell responses. 9-mer peptides do not require processing by professional antigen-presenting cells and therefore bind exogenously to the HLA class I molecules. Thus, injected short peptides will bind in large numbers to HLA class I molecules of all nucleated cells that have surface HLA class I. In contrast, ≥20-mers long peptides are processed by antigen presenting cells before binding to HLA class I. Therefore, vaccination with long peptides is less likely to lead to tolerance and will promote the desired antitumor activity.
      • (iv) Induce long lasting T cell responses because it can stimulate T helper responses by binding to multiple HLA class II molecules
      • (v) Utility. GMP manufacturing, formulation, quality control and administration of a smaller number of peptides (each with all of the above characteristics) is more feasible than a larger number of peptides supplying different characteristics.
  • Each 30-mer peptide in PolyPEPI1018 consists of 2 HLA class I binding dominant PEPIs and at least one strong HLA class II binding PEPI. Strong binding PEPIs bind to 4 HLA class II alleles in ≥50% of individuals. Therefore, the vaccine peptides are tailored to both HLA class I and class II alleles of individual subjects in a general population (which is a relevant population for CRC vaccine design).
  • As demonstrated above the high HLA genotype variability in subjects results in high variability of T cell responses induced by PolyPEPI1018. This justifies the co-development of a CDx that determines likely responders. The PEPI3+ and ≥2PEPI3+ biomarkers could predict the immune response and clinical responses, respectively, of subjects vaccinated with PolyPEP11018 as detailed in Examples 11 and 12. These biomarkers will be used to co-develop a CDx which predicts likely responders to PolyPEPI1018 CRC vaccine.
  • Example 23—Analysis of the Composition and Immunogenicity of PolyPEPI1018 CRC Vaccine
  • Selected peptides for the PolyPEPI1018 composition are as shown in Table 39.
  • TABLE 39
    Selected Colorectal Cancer Vaccine peptides for PolyPEPI1018 composition
    HLAI* HLAII**
    SEQID TREOSID Source Antigen Peptide (30 mer) (CD8) (CD4)
    130 CCV1000-5-1 TSP50 PSTTMETQFPVSEGKSRYRAQRFWSWVGQA 53%  88%
    121 CCV1000-2-2 EpCAM/Survivin VRTYWIIIELKHKARTAKKVRRAIEQLAAM 57% 100%
    131 CCV1000-5-3 EpCAM/Mage-A8 YVDEKAPEFSMQGLKDEKVAELVRFLLRKY 43%  95%
    124 CCV1000-2-6 Cage/Survivin LASKMHSLLALMVGLKDHRISTFKNWPFLE 58%  99%
    134 CCV1000-5-7 Cage/Spag9 PKSMTMMPALFKENRSGAVMSERVSGLAGS 57%  87%
    126 CCV1000-2-8 FBX039 KFMNPYNAVLTKKFQKVNFFFERIMKYERL 90% 100%
    PolyPEPI1018 (6 peptide together) 98% 100%
    *Percentage of individuals having CD8+ T cell specific PEPI3+ within the Model Population (n = 433).
    **Percentage of individuals having CD4+ T cell specific PEPI4+ within normal donors (n = 400).
  • Characterization of Immunogenicity
  • The inventors used the PEPI3+ Test to characterized the immunogenicity of PolyPEPI1018 in a cohort of 37 CRC patients with complete HLA genotype data. T cell responses were predicted in each patient against the same 9 mer peptides that will be used in clinical trials. These peptides represent the 12 dominant PEPI3+ within the PolyPEP11018 peptides. The 9 mers are shown in Table 39.
  • The specificity and sensitivity of PEPI3+ prediction depends on the actual number of HLAs predicted to bind a particular epitope. Specifically, the inventors have determined that the probability that one HLA-restricted epitope induces a T cell response in a subject is typically 4%, which explains the poor sensitivity of the state-of-art prediction methods based on HLA restricted epitope prediction. Applying the PEPI3+ methodology, the inventors determined the probability that T cell response to each of the dominant PEPI3+-specific would be induced by PolyPEPI1018 in the 37 CRC patients. The results from this analysis are summarized in the Table 40.
  • Overall, these results show that the most immunogenic peptide in PolyPEP11018 is CRC-P8, which it is predicted to bind to >3 HLAs in most patients. The least immunogenic peptide, CRC-P3, binds to >1 HLA in many patients and has a 22% chance of inducing T cell responses. Since bioassays used to detect T cell responses are less accurate than PEPI3+, this calculation may be the most accurate characterization of the T cell responses in CRC patients. Though MAGE-A8 and SPAG9 were immunogenic in the Model Population used for vaccine design, MAGE-A8-specific PEPI3+ were absent in the 37 CRC patients, and only one patient (3%) had SPAG9 specific PEPI3+.
  • Characterization of Toxicity—ImmunoBLAST
  • A method was developed that can be performed on any antigen to determine its potential to induce toxic immune reaction, like autoimmunity. The method is referred to herein as immunoBLAST. PolyPEPI1018 contains six 30-mer polypeptides. Each polypeptide consists of two 15-mer peptide fragments derived from antigens expressed in CRC. Neoepitopes might be generated in the joint region of the two 15-mer peptides and could induce undesired T cell responses against healthy cells (autoimmunity). This was assesses using the inventors applied the immunoBLAST methodology.
  • A 16-mer peptide for each of the 30-mer components of PolyPEP1018 was designed. Each 16-mer contains 8 amino acids from the end of the first 15 residues of the 30-mer and 8 amino acids from the beginning of the second 15 residues of the 30-mer—thus precisely spanning the joint region of the two 15-mers. These 16-mers are then analysed to identify cross-reactive regions of local similarity with human sequences using BLAST (https://blast.ncbi.nlm.nih.gov/Blast.cgi), which compares protein sequences to sequence databases and calculates the statistical significance of matches. 8-mers within the 16-mers were selected as the examination length since that length represents the minimum length needed for a peptide to form an epitope, and is the distance between the anchor points during HLA binding.
  • As shown in FIG. 23, the positions of amino acids in a polypeptide are numbered. The start positions of potential 9-mer peptides that can bind to HLAs and form neoepitopes are the 8 amino acids in positions 8-15. The start positions of tumor antigen derived peptides harbored by the 15-mers that can form the pharmaceutically active epitopes are 7+7=14 amino acids at position 1-7 and 16-22. The ratio of possible neoepitope generating peptides is 36.4% (8/22).
  • The PEPI3+ Test was used to identify neoepitopes and neoPEPI among the 9-mer epitopes in the joint region. The risk of PolyPEPI1018 inducing unwanted T cell responses was assessed in the 433 subjects in the Model Population by determining the proportion of subjects with PEPI3+ among the 9-mers in the joint region. The result of neoepitope/neoPEPI analysis is summarized in table 41. In the 433 subjects of the Model Population, the average predicted epitope number that could be generated by intracellular processing was 40.12. Neoepitopes were frequently generated; 11.61 out of 40.12 (28.9%) epitopes are neoepitopes. Most of the peptides were able to be identified as a neoepitope, but the number of subjects that present neoepitopes varied.
  • Epitopes harbored by PolyPEPI1018 create an average of 5.21 PEPI3+. These PEPIs can activate T cells in a subject. The amount of potential neoPEPIs was much lower than neoepitopes (3.7%). There is a marginal possibility that these neoPEPIs compete on T cell activation with PEPIs in some subjects. Importantly, the activated neoPEPI specific T cells had no targets on healthy tissue.
  • TABLE 41
    Identification of Potential Neoepitopes of PolyPEPI1018
    Epitope & PEPI3+ binding in 433 Subjects of the Model Population
    Poly- Epitope Binding (1 x HLA) PEPI3+ binding (3 x HLA)
    PEPI1018 Neo- Neo-
    Peptide Potential EPI EPI
    ID: Neoepitope Sub# Sub% NeoEPI count Sub# Sub% NeoEPI count
    CRC-P1 QFPVSEGKS   0  0.0% 7  0 0.0% 3
    FPVSEGKSR 160 37.0% X  1 0.2% X
    PVSEGKSRY 150 34.6% X  0 0.0%
    VSEGKSRYR 194 44.8% X  1 0.2% X
    SEGKSRYRA 113 26.1% X  0 0.0%
    EGKSRYRAQ  77 17.8% X  0 0.0%
    GKSRYRAQR  37  8.5% X  0 0.0%
    KSRYRAQRF 337 77.8% X 33 7.6% X
    CRC-P2 IELKHKART  32  7.4% X 7  0 0.0% 1
    ELKHKARTA  63 14.5% X  0 0.0%
    LKHKARTAK  59 13.6% X  0 0.0%
    KHKARTAKK 166 38.3% X  1 0.2% X
    HKARTAKKV   0  0.0%  0 0.0%
    KARTAKKVR  70 16.2% X  0 0.0%
    ARTAKKVRR 134 30.9% X  0 0.0%
    RTAKKVRRA  41  9.5% X  0 0.0%
    CRC-P3 EFSMQGLKD   0  0.0% 5  0 0.0% 1
    FSMQGLKDE 188 43.4% X  0 0.0%
    SMQGLKDEK 138 31.9% X  0 0.0%
    MQGLKDEKV  16  3.7% X  0 0.0%
    QGLKDEKVA   0  0.0%  0 0.0%
    GLKDEKVAE   0  0.0%  0 0.0%
    LKDEKVAEL 186 43.0% X  3 0.7% X
    KDEKVAELV  51 11.8% X  0 0.0%
    CRC-P6 LLALMVGLK 252 58.2% X 7  0 0.0% 1
    LALMVGLKD  86 19.9% X  0 0.0%
    ALMVGLKDH  65 15.0% X  0 0.0%
    LMVGLKDHR  97 22.4% X  0 0.0%
    MVGLKDHRI  67 15.5% X  0 0.0%
    VGLKDHRIS   0  0.0%  0 0.0%
    GLKDHRIST   4  0.9% X  0 0.0%
    LKDHRISTF 195 45.0% X  5 1.2% X
    CRC-P7 PALFKENRS   0  0.0% 5  0 0.0% 1
    ALFKENRSG   0  0.0%  0 0.0%
    LFKENRSGA  41  9.5% X  0 0.0%
    FKENRSGAV 114 26.3% X  0 0.0%
    KENRSGAVM 261 60.3% X  0 0.0%
    ENRSGAVMS   0  0.0%  0 0.0%
    NRSGAVMSE 227 52.4% X  0 0.0%
    RSGAVMSER 197 45.5% X  2 0.5% X
    CRC-P8 AVLTKKFQK 181 41.8% X 7  0 0.0% 3
    VLTKKFQKV 208 48.0% X  2 0.5% X
    LTKKFQKVN   0  0.0%  0 0.0%
    TKKFQKVNF  25  5.8% X  0 0.0%
    KKFQKVNFF 250 57.7% X 12 2.8% X
    KFQKVNFFF 273 63.0% X 23 5.3% X
    FQKVNFFFE 163 37.6% X  0 0.0%
    QKVNFFFER 110 25.4% X  0 0.0%
    Abbreviations: CRC = colorectal cancer; HLA = human leukocytic antigen; PEPI = personal epitope
  • Each of the 30-mer peptides in PolyPEPI1018 were released for clinical development since none of the 8-mers in the joint regions matched any human protein, except the target CTAs.
  • Characterisation of Activity/Efficacy
  • The inventors have developed pharmacodynamic biomarkers to predict the activity/effect of vaccines in individual human subjects as well as in populations of human subjects. These biomarkers expedite more effective vaccine development and also decrease the development cost. The inventors have the following tools:
  • Antigen expression knowledgebase: The inventors have collected data from experiments published in peer reviewed scientific journals regarding the tumor antigens expressed by tumor cells and organized by tumor type to create a database of CTA expression levels—CTA database (CTADB). As of April 2017, the CTADB contained data from 145 CTAs from 41,132 tumor specimens, and was organized by the CTA expression frequencies in different types of cancer.
    In silico trial populations: The inventors have also collected data on the HLA genotypes of several different model populations. Each individual in the populations has complete 4-digit HLA genotype and ethnicity data. The populations are summarized in Table 42.
  • TABLE 42
    In silico trial populations
    Number of
    Population Subjects Inclusion criteria
    Model Population
    433 Complete HLA class I genotype
    Diverse ethnicity
    CRC patients 37 Complete HLA class I genotype
    CRC diagnosis, unknown ethnicity
    “Big” Population 7,189 Complete HLA class I genotype
    Diverse ethnicity
    Chinese 234 Complete HLA class I genotype
    Population Chinese ethnicity
    Complete HLA class I genotype
    Irish Population 999 Irish ethnicity
    Abbreviations:
    CRC = colorectal cancer;
    HLA = human leukocyte antigen
  • Using these tools (or potentially equivalent databases or model populations), the following markers can be assessed:
      • AG95—potency of a vaccine: The number of antigens in a cancer vaccine that a specific tumor type expresses with 95% probability. AG95 is an indicator of the vaccine's potency, and is independent of the immunogenicity of the vaccine antigens. AG95 is calculated from the tumor antigen expression rate data, which is collected in the CTADB. Technically, AG95 is determined from the binomial distribution of CTAs, and takes into account all possible variations and expression rates. In this study, AG95 was calculated by cumulating the probabilities of a certain number of expressed antigens, by the widest range of antigens where the sum of probabilities was less than or equal to 95%. The correct value is between 0 (no expression expected with 95% probability) and maximum number of antigens (all antigens expressed with 95% probability).
      • PEPI3+ count—immunogenicity of a vaccine in a subject: Vaccine-derived PEPI3+ are personal epitopes that induce T cell responses in a subject. PEPI3+ can be determined using the PEPI3+ Test in subjects who's complete 4-digit HLA genotype is known.
      • AP count—antigenicity of a vaccine in a subject: Number of vaccine antigens with PEPI3+. Vaccines like PolyPEPI1018 contain sequences from antigens expressed in tumor cells. AP count is the number of antigens in the vaccine that contain PEPI3+, and the AP count represents the number of antigens in the vaccine that can induce T cell responses in a subject. AP count characterizes the vaccine-antigen specific T cell responses of the subject since it depends only on the HLA genotype of the subject and is independent of the subject's disease, age, and medication. The correct value is between 0 (no PEPI presented by the antigen) and maximum number of antigens (all antigens present PEPIs).
      • AP50—antigenicity of a vaccine in a population: The mean number of vaccine antigens with a PEPI in a population. The AP50 is suitable for the characterization of vaccine-antigen specific T cell responses in a given population since it depends on the HLA genotype of subjects in a population. Technically, the AP count was calculated in the Model Population and the binomial distribution of the result was used to calculate the AP50.
      • AGP count—effectiveness of a vaccine in a subject: Number of vaccine antigens expressed in the tumor with PEPI. The AGP count indicates the number of tumor antigens that vaccine recognizes and induces a T cell response against (hit the target). The AGP count depends on the vaccine-antigen expression rate in the subject's tumor and the HLA genotype of the subject. The correct value is between 0 (no PEPI presented by expressed antigen) and maximum number of antigens (all antigens are expressed and present a PEPI).
      • AGP50—effectiveness of a cancer vaccine in a population: The mean number of vaccine antigens expressed in the indicated tumor with PEPI (i.e., AGP) in a population. The AGP50 indicates the mean number of tumor antigens that the T cell responses induced by the vaccine can recognize. AGP50 is dependent on the expression rate of the antigens in the indicated tumor type and the immunogenicity of the antigens in the target population. AGP50 can estimate a vaccine's effectiveness in different populations and can be used to compare different vaccines in the same population. The computation of AGP50 is similar to that used for AG50, except the expression is weighted by the occurrence of the PEPI3+ in the subject on the expressed vaccine antigens. In a theoretical population, where each subject has a PEPI from each vaccine antigen, the AGP50 will be equal to AG50. In another theoretical population, where no subject has a PEPI from any vaccine antigen, the AGP50 will be 0. In general, the following statement is valid: 0≤AGP50≤AG50.
      • mAGP—a candidate biomarker for the selection of likely responders: Likelihood that a cancer vaccine induces T cell responses against multiple antigens expressed in the indicated tumor. mAGP is calculated from the expression rates of vaccine-antigens in CRC and the presence of vaccine derived PEPIs in the subject. Technically, based on the AGP distribution, the mAGP is the sum of probabilities of the multiple AGP (≥2 AGPs).
        Application of these Markers to Assess Antigenicity and Effectiveness PolyPEPI1018 in Individual Patients with CRC
  • Table 43 shows the antigenicity and effectiveness of PolyPEPI1018 in 37 CRC patients using AP and AGP50, respectively. As expected from the high variability of PolyPEPI1018 specific T cell responses (see Table 41), the AP and AGP50 have high variability. The most immunogenic antigen in PolyPEPI1018 was FOX039; each patient had a PEPI3+. However, FOX039 is expressed only 39% of CRC tumors, suggesting that 61% of patients will have FOX039 specific T cell responses that do not recognize the tumor. The least immunogenic antigen was MAGE-A8; none of the 37 CRC patients had a PEPI3+ despite the antigen being expressed in 44% of CRC tumors. These results illustrate that both expression and immunogenicity of antigens can be taken into account when determining a cancer vaccine's effectiveness.
  • AGP50 indicates the mean number of expressed antigens in CRC tumor with PEPIs. Patients with higher AGP50 values are more likely to respond to PolyPEPI1018 since higher AGP50 values indicate that the vaccine can induce T cell responses against more antigens expressed in CRC cells.
  • The last column in the Table 43 shows the probability of mAGP (multiple AGP; i.e., at least 2 AGPs) in each of the 37 CRC patients. The average mAGP in patients with CRC is 66%, suggesting that there is a 66% likelihood that a CRC patient will induce T cell responses against multiple antigens expressed in the tumor.
  • These biomarkers have immediate utility in vaccine development and in the routine clinical practice because they do not require invasive biopsies. Antigen expression data can be obtained from achieved tumor specimen and organized in databases. 4-digit HLA genotyping can be done from a saliva specimen. It is a validated test performed by certified laboratories worldwide for transplantation and paternity testing. These assessments will allow drug developers and physicians to gain deeper insights into the immunogenicity and activity of tumor response and the possible emergence of resistance.
  • Application of these Markers to Asses Antigenicity and Effectiveness PolyPEPI1018 in Populations
  • Antigenicity of PolyPEPI1018 CRC Vaccine in a General Population
  • The antigenicity of PolyPEPI1018 in a subject is determined by the AP count, which indicates the number of vaccine antigens that induce T cell responses in a subject. The AP count of PolyPEPI1018 was determined in each of the 433 subjects in the Model Population using the PEPI Test, and the AP50 count was then calculated for the Model Population.
  • As shown in FIG. 24 the AP50 of PolyPEPI1018 in the Model Population is 3.62. Therefore, the mean number of immunogenic antigens (i.e., antigens with ≥1 PEPI) in PolyPEPI1018 in a general population is 3.62.
  • Effectiveness of PolyPEPI1018 CRC Vaccine in a General Population
  • Vaccine induced T cells can recognize and kill tumor cells if a PEPI in the vaccine is presented by the tumor cell. The number of AGPs (expressed antigens with PEPI) is an indicator of vaccine effectiveness in an individual, and is dependent on both the potency and antigenicity of PolyPEPI1018. As shown in FIG. 25, the mean number of immunogenic CTAs (i.e., AP [expressed antigens with ≥1 PEPI]) in PolyPEPI1018 is 2.54 in the Model Population.
  • The likelihood that PolyPEPI1018 induces T cell responses against multiple antigens in a subject (i.e., mAGP) in the Model Population is 77%.
  • Comparison of the PolyPEPI1018 CRC Vaccine Activities in Different Populations
  • Table 44 shows the comparison of the immunogenicity, antigenicity, and effectiveness of PolyPEPI1018 in different populations.
  • TABLE 44
    Comparison of Immunogenicity, Antigenicity, and Effectiveness of
    PolyPEPI1018 in Different Sub-populations
    Number Number of Number Number of
    of PEPI3+ of AP AGP50
    Populations subject Average SD Average SD Average SD
    CRC 37 5.16 1.98 3.19 1.31 2.21 1.13
    Model 433 5.02 2.62 3.62 1.67 2.54 1.25
    Big 7,189 5.20 2.82 3.75 1.74 2.66 1.30
    Chinese 324 5.97 3.16 4.28 1.78 3.11 1.30
    Irish 999 3.72 1.92 2.86 1.46 1.94 1.10
    Abbreviations: CRC = colorectal cancer;
    PEPI = personal epitope;
    SD = standard deviation;
    AP = expressed antigens with ≥1 PEPI
  • The average number of PEPI3+ and AP results demonstrate that PolyPEPI1018 is highly immunogenic and antigenic in all populations; PolyPEPI1018 can induce an average of 3.7-6.0 CRC specific T cell clones against 2.9-3.7 CRC antigens. PolyPEPI1018 immunogenicity was similar in patients with CRC and the average population (p>0.05), this similarity may have been due to the small sample size of the CRC population. Additional analyses suggest that PolyPEPI1018 is significantly more immunogenic in a Chinese population compared to an Irish or a general population (p<0.0001). The differences in immunogenicity are also reflected in the effectiveness of the vaccine as characterized by AGP50; PolyPEPI1018 is most effective in a Chinese population and less effective in an Irish population. Since a CDx will be used to select likely responders to PolyPEPI1018, ethnic differences will only be reflected in the higher percentage of Chinese individuals that might be eligible for treatment compared with Irish individuals.
  • Example 24—Personalised Immunotherapy Composition for Treatment of Patient with Late Stage Metastatic Breast Cancer
  • Patient BRC05 was diagnosed with inflammatory breast cancer on the right with extensive lymphangiosis carcinomatose. Inflammatory breast cancer (IBC) is a rare, but aggressive form of locally advanced breast cancer. It's called inflammatory breast cancer because its main symptoms are swelling and redness (the breast often looks inflamed). Most inflammatory breast cancers are invasive ductal carcinomas (begin in the milk ducts). This type of breast cancer is associated with the expression of oncoproteins of high risk Human Papilloma Virus. Indeed, HPV16 DNA was diagnosed in the tumor of this patient.
  • Patient's stage in 2011 (6 years prior to PIT vaccine treatment)
  • T4: Tumor of any size with direct extension to the chest wall and/or to the skin (ulceration or skin nodules)
    pN3a: Metastases in ≥10 axillary lymph nodes (at least 1 tumor deposit ≥2.0 mm); or metastases to the infraclavicular (level III axillary lymph) nodes.
  • 14 vaccine peptides were designed and prepared for patient BRCO5 (Table 45). Peptides PBRC05-P01-P10 were made for this patient based on population expression data. The last 3 peptides in the Table 45 (SSX-2, MORC, MAGE-B1) were designed from antigens that expression was measured directly in the tumor of the patient.
  • TABLE 45
    Vaccine peptides for patient BRCO5
    BRCO5 vaccine Target Antigen MAXHLA MAXHLA
    peptides Antigen Expression 20 mer peptide Class I Class II
    PBRC05_P1 SPAG9
    88% XXXXXXXXXXXXXXXXXXXX 3 4
    PBRC05_P2 AKAP4 85% XXXXXXXXXXXXXXXXXXXX 3 4
    PBRC05_P3 MAGE-A11 59% XXXXXXXXXXXXXXXXXXXX 3 3
    PBRC05_P4 NY-SAR-35 49% XXXXXXXXXXXXXXXXXXXX 3 3
    PBRC05_P5 FSIP1 49% XXXXXXXXXXXXXXXXXXXX 3 3
    PBRC05_P6 NY-BR-1 47% XXXXXXXXXXXXXXXXXXXX 3 4
    PBRC05_P7 MAGE-A9 44% XXXXXXXXXXXXXXXXXXXX 3 3
    PBRC05_P8 SCP-1 38% XXXXXXXXXXXXXXXXXXXX 3 6
    PBRC05_P9 MAGE-A1 37% XXXXXXXXXXXXXXXXXXXX 3 3
    PBRC05_P10 MAGE-C2 21% XXXXXXXXXXXXXXXXXXXX 3 3
    PBRC05_P11 MAGE-A12 13% XXXXXXXXXXXXXXXXXXXX 3 4
    PBRC05_P12 SSX-2  6% XXXXXXXXXXXXXXXXXXXX 3 1
    PBRC05_P13 MORC ND XXXXXXXXXXXXXXXXXXXX 3 4
    PBRC05_P14 MAGE-B1 ND XXXXXXXXXXXXXXXXXXXX 3 3
    Note:
    Bold red means CD8 PEPI, Underline means best binding CD4 allele.
  • T cell responses were measured cells in peripheral mononuclear cells 2 weeks after the 1st vaccination with the mix of peptides PBRC05_P1, PBRC05_P2, PBRC05_P3, PBRC05_P4, PBRC05_P5, PBRC05_P6, PBRC05_P7.
  • TABLE 46
    Antigen specific T cell responses:
    Number of spots/300,000 PBMC
    Antigen Stimulant Exp1 Exp2 Average
    SPAG9 PBRC05_P1
    2 1 1.5
    AKAP4 PBRC05_P2 11 4 7.5
    MAGE-A11 PBRC05_P3 26 32 29
    NY-SAR-35 PBRC05_P4 472 497 484.5
    FSIP1 PBRC05_P5 317 321 319
    NY-BR-1 PBRC05_P6 8 12 10
    MAGE-A9 PBRC05_P7 23 27 25
    None Negative Control (DMSO) 0 3 1.5
  • The results show that a single immunization with 7 peptides induced potent T cell responses against 3 out of the 7 peptides demonstrating potent MAGE-A11, NY-SAR-35, FSIP1 and MAGE-A9 specific T cell responses. There were weak responses against AKAP4 and NY-BR-1 and no response against SPAG9.
  • REFERENCES
    • 1 Bagarazzi et al. Immunotherapy against HPV16/18 generates potent TH1 and cytotoxic cellular immune responses. Science Translational Medicine. 2012; 4(155):155ra138.
    • 2 Gudmundsdotter et al. Amplified antigen-specific immune responses in HIV-1 infected individuals in a double blind DNA immunization and therapy interruption trial. Vaccine. 2011; 29(33):5558-66.
    • 3 Bioley et al. HLA class I—associated immunodominance affects CTL responsiveness to an ESO recombinant protein tumor antigen vaccine. Clin Cancer Res. 2009; 15(1):299-306.
    • 4 Valmori et al. Vaccination with NY-ESO-1 protein and CpG in Montanide induces integrated antibody/Th1 responses and CD8 T cells through cross-priming. Proceedings of the National Academy of Sciences of the United States of America. 2007; 104(21):8947-52.
    • 5 Yuan et al. Integrated NY-ESO-1 antibody and CD8+ T-cell responses correlate with clinical benefit in advanced melanoma patients treated with ipilimumab. Proc Natl Acad Sci USA. 2011; 108(40):16723-16728.
    • 6 Kakimi et al. A phase I study of vaccination with NY-ESO-if peptide mixed with Picibanil OK-432 and Montanide ISA-51 in patients with cancers expressing the NY-ESO-1 antigen. Int J Cancer. 2011; 129(12):2836-46.
    • 7 Wada et al. Vaccination with NY-ESO-1 overlapping peptides mixed with Picibanil OK-432 and montanide ISA-51 in patients with cancers expressing the NY-ESO-1 antigen. J Immunother. 2014; 37(2):84-92.
    • 8 Welters et al. Induction of tumor-specific CD4+ and CD8+ T-cell immunity in cervical cancer patients by a human papillomavirus type 16 E6 and E7 long peptides vaccine. Clin. Cancer Res. 2008; 14(1):178-87.
    • 9 Kenter et al. Vaccination against HPV-16 oncoproteins for vulvar intraepithelial neoplasia. N Engl J Med. 2009; 361(19):1838-47.
    • 10 Welters et al. Success or failure of vaccination for HPV16-positive vulvar lesions correlates with kinetics and phenotype of induced T-cell responses. PNAS. 2010; 107(26):11895-9.
    • 11 http://www.ncbi.nlm.nih.gov/projects/gv/mhc/main.fcgi?cmd=initThe MHC database, NCBI (Accessed Mar. 7, 2016).
    • 12 Karkada et al. Therapeutic vaccines and cancer: focus on DPX-0907. Biologics. 2014; 8:27-38.
    • 13 Butts et al. Randomized phase IIB trial of BLP25 liposome vaccine in stage IIIB and IV non-small-cell lung cancer. J Clin Oncol. 2005; 23(27):6674-81.
    • 14 Yuan et al. Safety and immunogenicity of a human and mouse gp100 DNA vaccine in a phase I trial of patients with melanoma. Cancer Immun. 2009; 9:5.
    • 15 Kovjazin et al. ImMucin: a novel therapeutic vaccine with promiscuous MHC binding for the treatment of MUC1-expressing tumors. Vaccine. 2011; 29(29-30):4676-86.
    • 16 Cathcart et al. Amultivalent bcr-abl fusion peptide vaccination trial in patients with chronic myeloid leukemia. Blood. 2004; 103:1037-1042.
    • 17 Chapuis et al. Transferred WT1-reactive CD8+ T cells can mediate antileukemic activity and persist in post-transplant patients. Sci Transl Med. 2013; 5(174): 174ra27.
    • 18 Keilholz et al. A clinical and immunologic phase 2 trial of Wilms tumor gene product 1 (WT1) peptide vaccination in patients with AML and MDS. Blood; 2009; 113(26):6541-8.
    • 19 Walter et al. Multipeptide immune response to cancer vaccine IMA901 after single-dose cyclophosphamide associates with longer patient survival. Nat Med. 2012; 18(8):1254-61.
    • 20 Phuphanich et al. Phase I trial of a multi-epitope-pulsed dendritic cell vaccine for patients with newly diagnosed glioblastoma. Cancer Immunol Immunother. 2013; 62(1):125-35.
    • 21 Kantoff et al. Overall survival analysis of a phase II randomized controlled trial of a Poxviral-based PSA-targeted immunotherapy in metastatic castration-resistant prostate cancer. J Clin Oncol. 2010; 28(7):1099-105.
    • 22 Tagawa et al. Phase I study of intranodal delivery of a plasmid DNA vaccine for patients with Stage IV melanoma. Cancer. 2003; 98(1):144-54.
    • 23 Slingluff et al. Randomized multicenter trial of the effects of melanoma-associated helper peptides and cyclophosphamide on the immunogenicity of a multipeptide melanoma vaccine. J Clin Oncol. 2011; 29(21):2924-32.
    • 24 Kaida et al. Phase 1 trial of Wilms tumor 1 (WT1) peptide vaccine and gemcitabine combination therapy in patients with advanced pancreatic or biliary tract cancer. J Immunother. 2011; 34(1):92-9.
    • 25 Fenoglio et al. A multi-peptide, dual-adjuvant telomerase vaccine (GX301) is highly immunogenic in patients with prostate and renal cancer. Cancer Immunol Immunother; 2013; 62:1041-1052.
    • 26 Krug et al. WT1 peptide vaccinations induce CD4 and CD8 T cell immune responses in patients with mesothelioma and non-small cell lung cancer. Cancer Immunol Immunother; 2010; 59(10):1467-79.
    • 27 Slingluff et al. Clinical and immunologic results of a randomized phase II trial of vaccination using four melanoma peptides either administered in granulocyte-macrophage colony-stimulating factor in adjuvant or pulsed on dendritic cells. J Clin Oncol; 2003; 21(21):4016-26.
    • 28 Hodi et al. Improved survival with ipilimumab in patients with metastatic melanoma. N Engl J Med; 2010; 363(8):711-23.
    • 29 Carmon et al. Phase I/II study exploring ImMucin, a pan-major histocompatibility complex, anti-MUC1 signal peptide vaccine, in multiple myeloma patients. Br J Hematol. 2014; 169(1):44-56.
    • 30 http://www.merckgroup.com/en/media/extNewsDetail.html?newsId=EB4A46A2AC4A52E7C1257AD9001F3186&newsType=1 (Accessed Mar. 28, 2016)
    • 31 Trimble et al. Safety, efficacy, and immunogenicity of VGX-3100, a therapeutic synthetic DNA vaccine targeting human papillomavirus 16 and 18 E6 and E7 proteins for cervical intraepithelial neoplasia 2/3: a randomised, double-blind, placebo-controlled phase 2b trial. Lancet. 2015; 386(10008):2078-88.
    • 32 Cusi et al. Phase I trial of thymidylate synthase poly epitope peptide (TSPP) vaccine in advanced cancer patients. Cancer Immunol Immunother; 2015; 64:1159-1173.
    • 33 Asahara et al. Phase I/II clinical trial using HLA-A24-restricted peptide vaccine derived from KIF20A for patients with advanced pancreatic cancer. J Transl Med; 2013; 11:291.
    • 34 Yoshitake et al. Phase II clinical trial of multiple peptide vaccination for advanced head and neck cancer patients revealed induction of immune responses and improved OS. Clin Cancer Res; 2014; 21(2):312-21.
    • 35 Okuno et al. Clinical Trial of a 7-Peptide Cocktail Vaccine with Oral Chemotherapy for Patients with Metastatic Colorectal Cancer. Anticancer Res; 2014; 34: 3045-305.
    • 36 Rapoport et al. Combination Immunotherapy after ASCT for Multiple Myeloma Using MAGE-A3/Poly-ICLC Immunizations Followed by Adoptive Transfer of Vaccine-Primed and Costimulated Autologous T Cells. Clin Cancer Res; 2014; 20(5): 1355-1365.
    • 37 Greenfield et al. A phase I dose-escalation clinical trial of a peptide based human papillomavirus therapeutic vaccine with Candida skin test reagent as a novel vaccine adjuvant for treating women with biopsy-proven cervical intraepithelial neoplasia 2/3. Oncoimmunol; 2015; 4:10, e1031439.
    • 38 Snyder et al. Genetic basis for clinical response to CTLA-4 blockade in melanoma. N Engl J Med. 2014; 371(23):2189-99.
    • 39 Van Allen et al. Genomic correlates of response to CTLA-4 blockade in metastatic melanoma. Science; 2015; 350:6257.
    • 40 Li et al. Thrombocytopenia caused by the development of antibodies to thrombopoietin. Blood; 2001; 98:3241-3248
    • 41 Takedatsu et al. Determination of Thrombopoietin-Derived Peptides Recognized by Both Cellular and Humoral Immunities in Healthy Donors and Patients with Thrombocytopenia. 2005; 23(7): 975-982
    • 42 Eisenhauer et al. New response evaluation criteria in solid tumors: revised RECIST guideline (version 1.1). Eur J Cancer; 2009; 45(2):228-47.
    • 43 Therasse et al. New guidelines to evaluate the response to treatment in solid tumors: European Organization for Research and Treatment of Cancer, National Cancer Institute of the United States, National Cancer Institute of Canada. J Natl Cancer Inst; 2000; 92:205-216.
    • 44 Tsuchida & Therasse. Response evaluation criteria in solid tumors (RECIST): New guidelines. Med Pediatr Oncol. 2001; 37:1-3.
    • 45 Durie et al. International uniform response criteria for multiple myeloma. Leukemia; 2006; 20:1467-1473.

Claims (28)

1. A pharmaceutical composition for treatment of a disease or disorder in a subject of a target human population, comprising one or more polypeptides, each polypeptide comprising:
(a) a first region of 10-50 amino acids in length comprising a first T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and
(b) a second region of 10-50 amino acids in length comprising a second T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population;
wherein the first T cell epitope and the second T cell epitope comprise different amino acid sequences.
2. The pharmaceutical composition of claim 1, comprising at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, or at least 12 different polypeptides.
3. The pharmaceutical composition of claim 1, comprising 2-40 different polypeptides.
4. The pharmaceutical composition of claim 1, wherein the first T cell epitope and/or the second T cell epitope comprises 7 to 17 amino acids.
5. The pharmaceutical composition of claim 1, wherein the first T cell epitope is from a first antigen; and the second T cell epitope is from the first antigen or a second antigen.
6. The pharmaceutical composition of claim 1, wherein the first T cell epitope and the second T cell epitope are from a single antigen.
7. The pharmaceutical composition of claim 1, wherein the first T cell epitope is from a first antigen and the second T cell epitope is from a second different antigen.
8. The pharmaceutical composition of claim 5, wherein the first and/or the second antigen is a cancer-associated antigen, a tumor-associated antigen, an antigen expressed by a target pathogenic organism, an antigen expressed by a virus, an antigen expressed by a bacterium, an antigen expressed by a fungus, an antigen associated with an autoimmune disorder, or is an allergen.
9. The pharmaceutical composition of claim 6, wherein the single antigen is selected from the antigens listed in Tables 2 to 7.
10. The pharmaceutical composition of claim 7, wherein the first and second antigens are selected from the antigens listed in Tables 2 to 7.
11. The pharmaceutical composition of claim 5, wherein the first and/or second antigen is a cancer testis antigen (CTA).
12. The pharmaceutical composition of claim 5, wherein the first region and the second region each further comprise up to 10 amino acids flanking the T cell epitope that are not part of a consecutive sequence flanking the epitope in the corresponding antigen.
13. The pharmaceutical composition of claim 1, wherein the one or more polypeptides substantially do not comprise neoepitopes that span a junction between the first region and second region and that
(i) corresponds to a fragment of a human polypeptide expressed in healthy cells;
(ii) is a T cell epitope capable of binding to at least three HLA class I molecules of at least 10% of subjects in the target population; or
(iii) meets both requirements (i) and (ii).
14. The pharmaceutical composition of claim 1, wherein the target population is cancer patients and wherein each of the first region and second region comprises an amino acid sequence that is an HLA class I-binding T cell epitope, and wherein for each T cell epitope,
(i) at least 10% of subjects in the target population express a tumor associated antigen selected from the antigens listed in Table 2 that comprises the T cell epitope; and
(ii) at least 10% of subjects in the target population have at least three HLA class I molecules capable of binding to the T cell epitope;
wherein the first T cell epitope and the second T cell epitope are different from each other.
15. The pharmaceutical composition of claim 1, further comprising a pharmaceutically acceptable adjuvant, diluent, carrier, preservative, or combination thereof.
16. The pharmaceutical composition of claim 15, wherein the adjuvant is selected from the group consisting of Montanide ISA-51, QS-21, GM-CSF, cyclophosamide, bacillus Calmette-Guerin (BCG), corynbacterium parvum, levamisole, azimezone, isoprinisone, dinitrochlorobenezene (DNCB), keyhole limpet hemocyanins (KLH), Freunds adjuvant (complete), Freunds adjuvant (incomplete), mineral gels, aluminum hydroxide (Alum), lysolecithin, pluronic polyols, polyanions, oil emulsions, dinitrophenol, diphtheria toxin (DT), and combinations thereof.
17. (canceled)
18. (canceled)
19. A pharmaceutical composition comprising: one or more nucleic acid molecules expressing one or more polypeptides, each polypeptide comprising:
(a) a first region of 10-50 amino acids in length comprising a first T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and
(b) a second region of 10-50 amino acids in length comprising a second T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population;
wherein the first T cell epitope and the second T cell epitope comprise different amino acid sequences.
20. (canceled)
21. (canceled)
22. (canceled)
23. A method of inducing an immune response in a subject of a target human population, the method comprising,
administering to the subject a pharmaceutical composition comprising one or more polypeptides, each polypeptide comprising,
(a) a first region of 10-50 amino acids in length comprising a first T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population; and
(b) a second region of 10-50 amino acids in length comprising a second T cell epitope that binds at least three HLA class I molecules of at least 10% of subjects in the target population and/or at least three HLA class II molecules of at least 10% of subjects in the target population;
wherein the first T cell epitope and the second T cell epitope comprise different amino acid sequences.
24. The method of claim 23, further comprising prior to the administering step, determining if the subject is likely to have an have a clinical response to administration of the pharmaceutical composition by:
(i) assaying a biological sample of the subject to determine HLA genotype of the subject;
(ii) determining that the pharmaceutical composition comprises two or more sequences that are a T cell epitope capable of binding to at least three HLA class I molecules of the subject; and
(iii) determining the probability that a tumor of the subject expresses one or more antigen corresponding to the T cell epitopes identified in step (ii) using population expression data for each antigen, to identify the likelihood of the subject to have a clinical response to administration of the pharmaceutical composition.
25. (canceled)
26. (canceled)
27. The method of claim 24, wherein the antigen is a cancer-associated antigen, a tumor-associated antigen, or an antigen expressed by a target pathogenic organism, an antigen expressed by a virus, an antigen expressed by a bacterium, an antigen expressed by a fungus, an antigen associated with an autoimmune disorder, or is an allergen.
28.-81. (canceled)
US15/910,965 2017-03-03 2018-03-02 Population-based immunogenic peptide identification platform Abandoned US20180264095A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US17/454,225 US20220072114A1 (en) 2017-03-03 2021-11-09 Population-based immunogenic peptide identification platform

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
EP17159243.9 2017-03-03
EP17159242.1 2017-03-03
EP17159242.1A EP3369431A1 (en) 2017-03-03 2017-03-03 Vaccine
EP17159243.9A EP3370065A1 (en) 2017-03-03 2017-03-03 Immunogenic peptides
GBGB1703809.2A GB201703809D0 (en) 2017-03-09 2017-03-09 Vaccine
GB1703809.2 2017-03-09

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/454,225 Continuation US20220072114A1 (en) 2017-03-03 2021-11-09 Population-based immunogenic peptide identification platform

Publications (1)

Publication Number Publication Date
US20180264095A1 true US20180264095A1 (en) 2018-09-20

Family

ID=61386864

Family Applications (9)

Application Number Title Priority Date Filing Date
US15/910,988 Active US10213497B2 (en) 2017-03-03 2018-03-02 Vaccine
US15/910,930 Abandoned US20180264094A1 (en) 2017-03-03 2018-03-02 Personalised immunogenic peptide identification platform
US15/910,965 Abandoned US20180264095A1 (en) 2017-03-03 2018-03-02 Population-based immunogenic peptide identification platform
US16/244,497 Active 2039-05-03 US11213578B2 (en) 2017-03-03 2019-01-10 Vaccine
US17/448,020 Pending US20220031823A1 (en) 2017-03-03 2021-09-17 Personalised immunogenic peptide identification platform
US17/454,225 Pending US20220072114A1 (en) 2017-03-03 2021-11-09 Population-based immunogenic peptide identification platform
US17/645,741 Active US11628211B2 (en) 2017-03-03 2021-12-22 Vaccine
US17/645,737 Active US11426452B2 (en) 2017-03-03 2021-12-22 Vaccine
US18/166,420 Pending US20230405100A1 (en) 2017-03-03 2023-02-08 Vaccine

Family Applications Before (2)

Application Number Title Priority Date Filing Date
US15/910,988 Active US10213497B2 (en) 2017-03-03 2018-03-02 Vaccine
US15/910,930 Abandoned US20180264094A1 (en) 2017-03-03 2018-03-02 Personalised immunogenic peptide identification platform

Family Applications After (6)

Application Number Title Priority Date Filing Date
US16/244,497 Active 2039-05-03 US11213578B2 (en) 2017-03-03 2019-01-10 Vaccine
US17/448,020 Pending US20220031823A1 (en) 2017-03-03 2021-09-17 Personalised immunogenic peptide identification platform
US17/454,225 Pending US20220072114A1 (en) 2017-03-03 2021-11-09 Population-based immunogenic peptide identification platform
US17/645,741 Active US11628211B2 (en) 2017-03-03 2021-12-22 Vaccine
US17/645,737 Active US11426452B2 (en) 2017-03-03 2021-12-22 Vaccine
US18/166,420 Pending US20230405100A1 (en) 2017-03-03 2023-02-08 Vaccine

Country Status (16)

Country Link
US (9) US10213497B2 (en)
EP (3) EP3589951A1 (en)
JP (4) JP2020514413A (en)
KR (3) KR20190133177A (en)
CN (3) CN110651189A (en)
AU (3) AU2018228785A1 (en)
BR (3) BR112019018307A2 (en)
CA (3) CA3054861A1 (en)
CL (4) CL2019002533A1 (en)
CO (3) CO2019010524A2 (en)
IL (3) IL268919B2 (en)
MA (3) MA47683A (en)
MX (3) MX2019010461A (en)
SG (3) SG11201907524UA (en)
WO (3) WO2018158457A1 (en)
ZA (2) ZA201904725B (en)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10973909B1 (en) * 2020-04-03 2021-04-13 Peptc Vaccines Limited Coronavirus vaccine
WO2021194057A1 (en) * 2020-03-24 2021-09-30 주식회사 테라젠바이오 Method and computer program for predicting neoantigen by using peptide sequence and hla allele sequence
US11213578B2 (en) 2017-03-03 2022-01-04 Treos Bio Limited Vaccine
US11666644B2 (en) 2018-09-04 2023-06-06 Treos Bio Limited Peptide vaccines

Families Citing this family (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BR112017020058A2 (en) * 2015-03-20 2018-06-05 Childrens Nat Medical Ct process for producing a specific t-cell, composition, specific t-cell bank, method of treatment, and, bank or cell storage facility.
GB201814362D0 (en) 2018-09-04 2018-10-17 Treos Bio Zrt Composition and process for preparing vaccine
GB201814361D0 (en) 2018-09-04 2018-10-17 Treos Bio Zrt Immunogenetic cancer screening test
US11945850B2 (en) * 2018-09-17 2024-04-02 Immatics Biotechnologies Gmbh B*44 restricted peptides for use in immunotherapy against cancers and related methods
TW202039535A (en) * 2018-12-18 2020-11-01 德商英麥提克生物技術股份有限公司 Immunotherapy with b*08 restricted peptides and combination of peptides against cancers and related methods
US20230158137A1 (en) 2020-04-03 2023-05-25 Peptc Vaccines Limited Coronavirus vaccine
KR20220123276A (en) * 2020-04-20 2022-09-06 엔이씨 래보러토리즈 유럽 게엠바하 Methods and systems for optimal vaccine design
CN112048001B (en) * 2020-09-08 2022-04-05 南方科技大学 Tumor neogenesis antigen polypeptide and application thereof
KR102278727B1 (en) * 2020-09-16 2021-07-19 주식회사 테라젠바이오 Method for predicting neoantigen using a peptide sequence and hla class ii allele sequence and computer program
WO2023017768A1 (en) 2021-08-10 2023-02-16 日本電気株式会社 Information processing system and information processing method
TW202322137A (en) 2021-10-04 2023-06-01 日商日本電氣股份有限公司 Management method, management system, and electronic health record system
WO2023059606A1 (en) * 2021-10-06 2023-04-13 Cancervax, Inc. Methods and compositions for cancer treatment
WO2023211024A1 (en) * 2022-04-27 2023-11-02 포항공과대학교 산학협력단 Method for constructing hotspot-derived peptide-nucleic acid hybrid molecules on basis of in vitro selection
CN115785203B (en) * 2022-06-10 2024-03-12 河北博海生物工程开发有限公司 Lung cancer specific molecular target 10 and application thereof
GB202216453D0 (en) 2022-11-04 2022-12-21 Lisziewicz Julianna Identification of antigens which induce t-cell responses

Family Cites Families (59)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4235877A (en) 1979-06-27 1980-11-25 Merck & Co., Inc. Liposome particle containing viral or bacterial antigenic subunit
WO1997033602A1 (en) 1996-03-11 1997-09-18 Cytel Corporation Peptides with increased binding affinity for hla molecules
US6617434B1 (en) * 1996-05-31 2003-09-09 North Shore Long Island Jewish Research Institute Identificiaton of differentially methylated and mutated nucleic acids
US20030148463A1 (en) 1997-04-14 2003-08-07 Micromet Ag Novel method for the production of anti-human antigen receptors and uses thereof
CA2286879C (en) * 1997-04-14 2003-12-16 Peter Kufer Novel method for the production of anti-human antigen receptors and uses thereof
FR2791895B1 (en) 1999-03-23 2001-06-15 Pasteur Merieux Serums Vacc USE OF TREHALOSE TO STABILIZE A LIQUID VACCINE
AUPQ776100A0 (en) 2000-05-26 2000-06-15 Australian National University, The Synthetic molecules and uses therefor
US6673580B2 (en) 2000-10-27 2004-01-06 Genentech, Inc. Identification and modification of immunodominant epitopes in polypeptides
US7892559B2 (en) 2002-01-30 2011-02-22 Survac Aps Survivin-derived peptides and use thereof
JP2005537800A (en) 2002-09-06 2005-12-15 マンカインド コーポレイション Epitope sequence
GB0228900D0 (en) * 2002-12-11 2003-01-15 Ml Lab Plc Cancer Immunotherapy
NZ543467A (en) 2003-04-10 2008-07-31 Novartis Vaccines & Diagnostic The severe acute respiratory syndrome coronavirus
US20050100883A1 (en) 2003-11-12 2005-05-12 Wang Chang Y. Peptide-based diagnostic reagents for SARS
US7619058B2 (en) 2004-01-20 2009-11-17 Aichi Prefecture Epitope/peptide recognized by HLA-A2402-restricted Ep-CAM-specific CTL and use of the same
JP2008509654A (en) 2004-06-01 2008-04-03 イノジェネティックス・ナムローゼ・フェンノートシャップ Peptides for inducing CTL and / or HTL responses against hepatitis C virus
US8487076B1 (en) 2005-01-25 2013-07-16 Nec Corporation HLA-binding peptide, and DNA fragment and recombinant vector coding for said HLA-binding peptide
WO2006081826A2 (en) 2005-02-04 2006-08-10 Survac Aps Survivin peptide vaccine
CN100402554C (en) * 2005-02-25 2008-07-16 李玉新 Preparation and use of testes specificity protein 50 human source antibody
FR2891462B1 (en) 2005-09-30 2009-10-16 Commissariat Energie Atomique CD4 + EPITOPES OF SURVIVIN AND THEIR APPLICATIONS
GB0520067D0 (en) 2005-10-01 2005-11-09 Cancer Rec Tech Ltd Treatment of cancer
WO2008035350A1 (en) 2006-09-21 2008-03-27 Vaxil Biotherapeutics Ltd. Antigen specific multi epitope vaccines
WO2008039874A2 (en) 2006-09-26 2008-04-03 Cedars-Sinai Medical Center Cancer stem cell antigen vaccines and methods
WO2008116468A2 (en) 2007-03-26 2008-10-02 Dako Denmark A/S Mhc peptide complexes and uses thereof in infectious diseases
EP2042600A1 (en) * 2007-09-28 2009-04-01 Commissariat A L'energie Atomique A public and immunogenic CD4+ T Cell epitope of the hiv tat protein and its applications
CN105330733A (en) 2008-03-31 2016-02-17 株式会社生物免疫平衡 Partial peptide of Survivin presented on MHC class II molecule and use thereof
PL2119726T5 (en) 2008-05-14 2018-04-30 Immatics Biotechnologies Gmbh Novel and powerful MHC-class II peptides derived from survivin and neurocan
TW201008574A (en) 2008-08-19 2010-03-01 Oncotherapy Science Inc INHBB epitope peptides and vaccines containing the same
WO2010037395A2 (en) 2008-10-01 2010-04-08 Dako Denmark A/S Mhc multimers in cancer vaccines and immune monitoring
GB0818065D0 (en) * 2008-10-02 2008-11-05 Cancer Rec Tech Ltd Immunogenic peptides and uses thereof
US20120244145A1 (en) * 2009-11-16 2012-09-27 Duke University Enhanced immunological responses
GB201004575D0 (en) * 2010-03-19 2010-05-05 Immatics Biotechnologies Gmbh Composition of tumor associated peptides and related anti cancer vaccine for the treatment of gastric cancer and other cancers
US20170039314A1 (en) * 2010-03-23 2017-02-09 Iogenetics, Llc Bioinformatic processes for determination of peptide binding
WO2012051282A2 (en) * 2010-10-14 2012-04-19 The Ohio State University Research Foundation Piwil2-like (pl2l) proteins-targeted cancer diagnosis and therapy
EP2745845A1 (en) * 2012-12-19 2014-06-25 Centre Hospitalier Universitaire de Bordeaux A method for preventing or treating an HIV infection
WO2014180490A1 (en) * 2013-05-10 2014-11-13 Biontech Ag Predicting immunogenicity of t cell epitopes
GB201315946D0 (en) 2013-09-06 2013-10-23 Immune Targeting Systems Its Ltd Oncology vaccine
CN105828834A (en) * 2013-11-05 2016-08-03 同源生物服务股份有限公司 Combinations of checkpoint inhibitors and therapeutics to treat cancer
WO2015143335A1 (en) 2014-03-20 2015-09-24 The University Of North Carolina At Chapel Hill Methods and compositions for chimeric coronavirus spike proteins
WO2015164798A1 (en) 2014-04-25 2015-10-29 Tria Bioscience Corp. Synthetic hapten carrier compositions and methods
AU2015314776A1 (en) * 2014-09-14 2017-04-06 Washington University Personalized cancer vaccines and methods therefor
EP3227679A1 (en) * 2014-12-03 2017-10-11 Verik Bio, Inc. Identification, selection and use of high curative potential t cell epitopes
JP7236216B2 (en) 2015-04-23 2023-03-09 ナントミクス,エルエルシー Cancer neoepitopes
US11090332B2 (en) 2015-05-21 2021-08-17 Regen BioPharma, Inc. Antigen specific mRNA cellular cancer vaccines
EP3362930A4 (en) * 2015-10-12 2019-06-19 Nantomics, LLC Systems, compositions, and methods for discovery of msi and neoepitopes that predict sensitivity to checkpoint inhibitors
GB201604755D0 (en) 2016-03-21 2016-05-04 Vaxeal Res Sas Immunogenic compositions
SG11201903008YA (en) 2016-10-07 2019-05-30 Univ Texas Hla-restricted vgll1 peptides and use thereof
TWI796314B (en) 2017-01-27 2023-03-21 德商英麥提克生物技術股份有限公司 Novel peptides and combination of peptides for use in immunotherapy against ovarian cancer and other cancers
CA3054861A1 (en) 2017-03-03 2018-09-07 Treos Bio Zrt Peptide vaccines
EP3369431A1 (en) 2017-03-03 2018-09-05 Treos Bio Kft Vaccine
EP3370065A1 (en) 2017-03-03 2018-09-05 Treos Bio Kft Immunogenic peptides
CA3086923A1 (en) 2017-12-28 2019-07-04 Gritstone Oncology, Inc. Antigen-binding proteins targeting shared antigens
US20210213066A1 (en) 2018-05-18 2021-07-15 Children's National Medical Center Improved cell therapy compositions for hematopoietic stem cell transplant patients
EP3796923A4 (en) 2018-05-18 2022-03-09 Children's National Medical Center Improved targeted t-cell therapy
WO2020048990A1 (en) 2018-09-04 2020-03-12 Treos Bio Zrt Peptide vaccines
GB201814362D0 (en) 2018-09-04 2018-10-17 Treos Bio Zrt Composition and process for preparing vaccine
GB201814361D0 (en) 2018-09-04 2018-10-17 Treos Bio Zrt Immunogenetic cancer screening test
EP3908293A4 (en) 2019-01-07 2023-01-11 Children's National Medical Center Ex vivo activated t-lymphocytic compositions and methods of using the same
CA3126064A1 (en) 2019-01-07 2020-07-16 Children's National Medical Center Improved targeted t-cell therapy for treatment of multiple myeloma
GB202004974D0 (en) 2020-04-03 2020-05-20 Treos Bio Ltd Coronavirus vaccine

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11213578B2 (en) 2017-03-03 2022-01-04 Treos Bio Limited Vaccine
US11426452B2 (en) 2017-03-03 2022-08-30 Treos Bio Limited Vaccine
US11628211B2 (en) 2017-03-03 2023-04-18 Treos Bio Limited Vaccine
US11666644B2 (en) 2018-09-04 2023-06-06 Treos Bio Limited Peptide vaccines
WO2021194057A1 (en) * 2020-03-24 2021-09-30 주식회사 테라젠바이오 Method and computer program for predicting neoantigen by using peptide sequence and hla allele sequence
US10973909B1 (en) * 2020-04-03 2021-04-13 Peptc Vaccines Limited Coronavirus vaccine

Also Published As

Publication number Publication date
JP7437939B2 (en) 2024-02-26
CO2019010503A2 (en) 2020-01-17
CL2022002836A1 (en) 2023-06-16
JP2023051941A (en) 2023-04-11
US11426452B2 (en) 2022-08-30
US20220111024A1 (en) 2022-04-14
CN110621334A (en) 2019-12-27
US11628211B2 (en) 2023-04-18
ZA201904725B (en) 2024-01-31
CA3054866A1 (en) 2018-09-07
MA47683A (en) 2020-01-08
CN110651188B (en) 2024-02-02
KR20190133010A (en) 2019-11-29
JP2020514413A (en) 2020-05-21
KR102549625B1 (en) 2023-06-28
EP3589951A1 (en) 2020-01-08
AU2018228785A1 (en) 2019-08-01
IL268919A (en) 2019-10-31
IL268919B1 (en) 2023-06-01
BR112019018307A2 (en) 2020-03-31
BR112019018313A2 (en) 2020-05-19
WO2018158456A1 (en) 2018-09-07
CA3054871A1 (en) 2018-09-07
MA47678A (en) 2021-05-26
MA47677A (en) 2020-01-08
US11213578B2 (en) 2022-01-04
US20230405100A1 (en) 2023-12-21
CL2019002532A1 (en) 2020-02-07
SG11201907524UA (en) 2019-09-27
US20220111025A1 (en) 2022-04-14
KR20190133177A (en) 2019-12-02
US20180250399A1 (en) 2018-09-06
JP2020510698A (en) 2020-04-09
KR20190134636A (en) 2019-12-04
IL268919B2 (en) 2023-10-01
JP2020511672A (en) 2020-04-16
US10213497B2 (en) 2019-02-26
AU2018228786A1 (en) 2019-08-01
IL268917B2 (en) 2023-04-01
AU2018226566A1 (en) 2019-08-01
EP3589954A1 (en) 2020-01-08
EP3589310A1 (en) 2020-01-08
BR112019018312A2 (en) 2020-03-31
MX2019010459A (en) 2020-01-09
CL2019002534A1 (en) 2020-02-07
KR102591136B1 (en) 2023-10-17
MX2019010461A (en) 2020-01-09
MX2019010460A (en) 2020-01-09
WO2018158455A1 (en) 2018-09-07
WO2018158457A1 (en) 2018-09-07
US20190240302A1 (en) 2019-08-08
ZA201904723B (en) 2024-01-31
CA3054861A1 (en) 2018-09-07
CN110651188A (en) 2020-01-03
SG11201906765UA (en) 2019-08-27
US20220031823A1 (en) 2022-02-03
IL268917B (en) 2022-12-01
CL2019002533A1 (en) 2020-02-07
SG11201907402SA (en) 2019-09-27
CO2019010524A2 (en) 2020-01-17
CN110651189A (en) 2020-01-03
IL268920A (en) 2019-10-31
US20180264094A1 (en) 2018-09-20
CO2019010698A2 (en) 2020-01-17
IL268917A (en) 2019-10-31
US20220072114A1 (en) 2022-03-10

Similar Documents

Publication Publication Date Title
US20220072114A1 (en) Population-based immunogenic peptide identification platform
US20220160854A1 (en) Composition and process for preparing vaccine
US20240000911A1 (en) Peptide vaccines
KR20210086611A (en) Immunogenetic Cancer Screening Test
EA045702B1 (en) PLATFORM FOR IDENTIFICATION OF IMMUNOGENIC PEPTIDES AT THE POPULATION LEVEL
EA045699B1 (en) PERSONALIZED PLATFORM FOR IMMUNOGENIC PEPTIDE IDENTIFICATION

Legal Events

Date Code Title Description
AS Assignment

Owner name: TREOS BIO ZRT., HUNGARY

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:LISZIEWICZ, JULIANNA, DR.;MOLNAR, LEVENTE;TOKE, ENIKO R., DR.;AND OTHERS;REEL/FRAME:045428/0797

Effective date: 20180314

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

AS Assignment

Owner name: TREOS BIO LIMITED, UNITED KINGDOM

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:TREOS BIO ZRT.;REEL/FRAME:054268/0378

Effective date: 20200713

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION