US20110082283A1 - Multimeric elp fusion constructs - Google Patents
Multimeric elp fusion constructs Download PDFInfo
- Publication number
- US20110082283A1 US20110082283A1 US12/712,615 US71261510A US2011082283A1 US 20110082283 A1 US20110082283 A1 US 20110082283A1 US 71261510 A US71261510 A US 71261510A US 2011082283 A1 US2011082283 A1 US 2011082283A1
- Authority
- US
- United States
- Prior art keywords
- seq
- protein
- pet17b
- ifna2bsd
- elp
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 230000004927 fusion Effects 0.000 title claims abstract description 20
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 140
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 140
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 99
- 108020001507 fusion proteins Proteins 0.000 claims abstract description 93
- 102000037865 fusion proteins Human genes 0.000 claims abstract description 92
- 241000239290 Araneae Species 0.000 claims abstract description 72
- 238000000034 method Methods 0.000 claims abstract description 19
- 230000002797 proteolythic effect Effects 0.000 claims abstract description 8
- 235000018102 proteins Nutrition 0.000 claims description 94
- 230000007704 transition Effects 0.000 claims description 82
- 230000007017 scission Effects 0.000 claims description 46
- 238000003776 cleavage reaction Methods 0.000 claims description 45
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 32
- 108060005714 orexin Proteins 0.000 claims description 19
- 102000002512 Orexin Human genes 0.000 claims description 18
- OHOWSYIKESXDMN-WMQZXSDYSA-N orexin-b Chemical group C([C@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](N)CCSC)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCN=C(N)N)C(N)=O)C1=CNC=N1 OHOWSYIKESXDMN-WMQZXSDYSA-N 0.000 claims description 18
- 125000006850 spacer group Chemical group 0.000 claims description 14
- 230000001747 exhibiting effect Effects 0.000 claims description 13
- 229920001184 polypeptide Polymers 0.000 claims description 12
- 108091033319 polynucleotide Proteins 0.000 claims description 10
- 239000002157 polynucleotide Substances 0.000 claims description 10
- 102000040430 polynucleotide Human genes 0.000 claims description 10
- 235000018417 cysteine Nutrition 0.000 claims description 7
- 239000000203 mixture Substances 0.000 claims description 7
- 239000003795 chemical substances by application Substances 0.000 claims description 4
- 230000002708 enhancing effect Effects 0.000 claims description 4
- 239000013604 expression vector Substances 0.000 claims description 4
- 239000002904 solvent Substances 0.000 claims description 4
- 238000007385 chemical modification Methods 0.000 claims description 3
- 239000002773 nucleotide Substances 0.000 claims description 3
- 125000003729 nucleotide group Chemical group 0.000 claims description 3
- 230000006337 proteolytic cleavage Effects 0.000 claims description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 claims description 2
- 239000013598 vector Substances 0.000 claims 1
- 238000000746 purification Methods 0.000 abstract description 14
- 238000004519 manufacturing process Methods 0.000 abstract description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 14
- 238000004458 analytical method Methods 0.000 description 12
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 12
- 102400000064 Neuropeptide Y Human genes 0.000 description 11
- 230000002441 reversible effect Effects 0.000 description 10
- 229940024606 amino acid Drugs 0.000 description 9
- 239000000872 buffer Substances 0.000 description 9
- 210000004027 cell Anatomy 0.000 description 9
- 235000001014 amino acid Nutrition 0.000 description 8
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 8
- 239000012634 fragment Substances 0.000 description 8
- 150000001413 amino acids Chemical class 0.000 description 7
- 230000017854 proteolysis Effects 0.000 description 7
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 210000004899 c-terminal region Anatomy 0.000 description 6
- 238000005119 centrifugation Methods 0.000 description 6
- 230000001965 increasing effect Effects 0.000 description 6
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 6
- 238000010276 construction Methods 0.000 description 5
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 4
- OABOXRPGTFRBFZ-IMJSIDKUSA-N Cys-Cys Chemical compound SC[C@H](N)C(=O)N[C@@H](CS)C(O)=O OABOXRPGTFRBFZ-IMJSIDKUSA-N 0.000 description 4
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 4
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical class NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 4
- 238000006664 bond formation reaction Methods 0.000 description 4
- 230000001351 cycling effect Effects 0.000 description 4
- 108010004073 cysteinylcysteine Proteins 0.000 description 4
- 238000010790 dilution Methods 0.000 description 4
- 239000012895 dilution Substances 0.000 description 4
- -1 erythropoietins Proteins 0.000 description 4
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 4
- 229940039781 leptin Drugs 0.000 description 4
- 239000008188 pellet Substances 0.000 description 4
- 238000000926 separation method Methods 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 3
- 239000004365 Protease Substances 0.000 description 3
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 3
- QWCKQJZIFLGMSD-UHFFFAOYSA-N alpha-aminobutyric acid Chemical compound CCC(N)C(O)=O QWCKQJZIFLGMSD-UHFFFAOYSA-N 0.000 description 3
- 235000014633 carbohydrates Nutrition 0.000 description 3
- 150000001720 carbohydrates Chemical class 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 210000000805 cytoplasm Anatomy 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 230000029087 digestion Effects 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 239000000178 monomer Substances 0.000 description 3
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 230000012743 protein tagging Effects 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- SLXKOJJOQWFEFD-UHFFFAOYSA-N 6-aminohexanoic acid Chemical class NCCCCCC(O)=O SLXKOJJOQWFEFD-UHFFFAOYSA-N 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 108010000241 Arthropod Proteins Proteins 0.000 description 2
- 102000016942 Elastin Human genes 0.000 description 2
- 108010014258 Elastin Proteins 0.000 description 2
- 102000004877 Insulin Human genes 0.000 description 2
- 108090001061 Insulin Proteins 0.000 description 2
- 102000014150 Interferons Human genes 0.000 description 2
- 108010050904 Interferons Proteins 0.000 description 2
- 102000016267 Leptin Human genes 0.000 description 2
- 108010092277 Leptin Proteins 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 2
- 108010076818 TEV protease Proteins 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 230000002776 aggregation Effects 0.000 description 2
- 238000004220 aggregation Methods 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 235000009697 arginine Nutrition 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 102000023732 binding proteins Human genes 0.000 description 2
- 108091008324 binding proteins Proteins 0.000 description 2
- 229960000074 biopharmaceutical Drugs 0.000 description 2
- 239000007853 buffer solution Substances 0.000 description 2
- 239000012141 concentrate Substances 0.000 description 2
- XVOYSCVBGLVSOL-UHFFFAOYSA-N cysteic acid Chemical class OC(=O)C(N)CS(O)(=O)=O XVOYSCVBGLVSOL-UHFFFAOYSA-N 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 108010035826 endozepine-like peptide ELP Proteins 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 229940125396 insulin Drugs 0.000 description 2
- NRYBAZVQPHGZNS-ZSOCWYAHSA-N leptin Chemical compound O=C([C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)CCSC)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CS)C(O)=O NRYBAZVQPHGZNS-ZSOCWYAHSA-N 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 239000006166 lysate Substances 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- FSYKKLYZXJSNPZ-UHFFFAOYSA-N sarcosine Chemical class C[NH2+]CC([O-])=O FSYKKLYZXJSNPZ-UHFFFAOYSA-N 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- 101150057627 trxB gene Proteins 0.000 description 2
- 102000003390 tumor necrosis factor Human genes 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- BVAUMRCGVHUWOZ-ZETCQYMHSA-N (2s)-2-(cyclohexylazaniumyl)propanoate Chemical class OC(=O)[C@H](C)NC1CCCCC1 BVAUMRCGVHUWOZ-ZETCQYMHSA-N 0.000 description 1
- MRTPISKDZDHEQI-YFKPBYRVSA-N (2s)-2-(tert-butylamino)propanoic acid Chemical class OC(=O)[C@H](C)NC(C)(C)C MRTPISKDZDHEQI-YFKPBYRVSA-N 0.000 description 1
- NPDBDJFLKKQMCM-SCSAIBSYSA-N (2s)-2-amino-3,3-dimethylbutanoic acid Chemical class CC(C)(C)[C@H](N)C(O)=O NPDBDJFLKKQMCM-SCSAIBSYSA-N 0.000 description 1
- OGNSCSPNOLGXSM-UHFFFAOYSA-N 2,4-diaminobutyric acid Chemical compound NCCC(N)C(O)=O OGNSCSPNOLGXSM-UHFFFAOYSA-N 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 102000055025 Adenosine deaminases Human genes 0.000 description 1
- 108700040115 Adenosine deaminases Proteins 0.000 description 1
- 241000024188 Andala Species 0.000 description 1
- 102000004452 Arginase Human genes 0.000 description 1
- 108700024123 Arginases Proteins 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 102000055006 Calcitonin Human genes 0.000 description 1
- 108060001064 Calcitonin Proteins 0.000 description 1
- 108010071942 Colony-Stimulating Factors Proteins 0.000 description 1
- 102000007644 Colony-Stimulating Factors Human genes 0.000 description 1
- 101800000414 Corticotropin Proteins 0.000 description 1
- 239000000055 Corticotropin-Releasing Hormone Substances 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 102000009025 Endorphins Human genes 0.000 description 1
- 108010049140 Endorphins Proteins 0.000 description 1
- 102400000321 Glucagon Human genes 0.000 description 1
- 108060003199 Glucagon Proteins 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102000002265 Human Growth Hormone Human genes 0.000 description 1
- 108010000521 Human Growth Hormone Proteins 0.000 description 1
- 239000000854 Human Growth Hormone Substances 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical class O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- SNDPXSYFESPGGJ-BYPYZUCNSA-N L-2-aminopentanoic acid Chemical class CCC[C@H](N)C(O)=O SNDPXSYFESPGGJ-BYPYZUCNSA-N 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical class NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ZGUNAGUHMKGQNY-ZETCQYMHSA-N L-alpha-phenylglycine zwitterion Chemical class OC(=O)[C@@H](N)C1=CC=CC=C1 ZGUNAGUHMKGQNY-ZETCQYMHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- RHGKLRLOHDJJDR-BYPYZUCNSA-N L-citrulline Chemical class NC(=O)NCCC[C@H]([NH3+])C([O-])=O RHGKLRLOHDJJDR-BYPYZUCNSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- XIGSAGMEBXLVJJ-YFKPBYRVSA-N L-homocitrulline Chemical class NC(=O)NCCCC[C@H]([NH3+])C([O-])=O XIGSAGMEBXLVJJ-YFKPBYRVSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- SNDPXSYFESPGGJ-UHFFFAOYSA-N L-norVal-OH Chemical class CCCC(N)C(O)=O SNDPXSYFESPGGJ-UHFFFAOYSA-N 0.000 description 1
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical class CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- RHGKLRLOHDJJDR-UHFFFAOYSA-N Ndelta-carbamoyl-DL-ornithine Chemical class OC(=O)C(N)CCCNC(N)=O RHGKLRLOHDJJDR-UHFFFAOYSA-N 0.000 description 1
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Chemical class NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 1
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Chemical class OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 102000003982 Parathyroid hormone Human genes 0.000 description 1
- 108090000445 Parathyroid hormone Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 102100027467 Pro-opiomelanocortin Human genes 0.000 description 1
- 102000003946 Prolactin Human genes 0.000 description 1
- 108010057464 Prolactin Proteins 0.000 description 1
- 101100519432 Rattus norvegicus Pdzd2 gene Proteins 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 108010077895 Sarcosine Chemical class 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 102000013275 Somatomedins Human genes 0.000 description 1
- 102000019197 Superoxide Dismutase Human genes 0.000 description 1
- 108010012715 Superoxide dismutase Proteins 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- GXBMIBRIOWHPDT-UHFFFAOYSA-N Vasopressin Natural products N1C(=O)C(CC=2C=C(O)C=CC=2)NC(=O)C(N)CSSCC(C(=O)N2C(CCC2)C(=O)NC(CCCN=C(N)N)C(=O)NCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(CCC(N)=O)NC(=O)C1CC1=CC=CC=C1 GXBMIBRIOWHPDT-UHFFFAOYSA-N 0.000 description 1
- 108010004977 Vasopressins Proteins 0.000 description 1
- 102000002852 Vasopressins Human genes 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 229960002684 aminocaproic acid Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- KBZOIRJILGZLEJ-LGYYRGKSSA-N argipressin Chemical compound C([C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CSSC[C@@H](C(N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N1)=O)N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(N)=O)C1=CC=CC=C1 KBZOIRJILGZLEJ-LGYYRGKSSA-N 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 229940000635 beta-alanine Drugs 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 229960000182 blood factors Drugs 0.000 description 1
- 238000010504 bond cleavage reaction Methods 0.000 description 1
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 1
- 229960004015 calcitonin Drugs 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 210000004081 cilia Anatomy 0.000 description 1
- 235000013477 citrulline Nutrition 0.000 description 1
- 229960002173 citrulline Drugs 0.000 description 1
- 229940047120 colony stimulating factors Drugs 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- IDLFZVILOHSSID-OVLDLUHVSA-N corticotropin Chemical compound C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)NC(=O)[C@@H](N)CO)C1=CC=C(O)C=C1 IDLFZVILOHSSID-OVLDLUHVSA-N 0.000 description 1
- 229960000258 corticotropin Drugs 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000003413 degradative effect Effects 0.000 description 1
- 230000000881 depressing effect Effects 0.000 description 1
- 238000004807 desolvation Methods 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 150000002019 disulfides Chemical class 0.000 description 1
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Chemical class OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 229960003692 gamma aminobutyric acid Drugs 0.000 description 1
- 229960004666 glucagon Drugs 0.000 description 1
- MASNOZXLGMXCHN-ZLPAWPGGSA-N glucagon Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 235000004554 glutamine Nutrition 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 239000000122 growth hormone Substances 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 239000002303 hypothalamus releasing factor Substances 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- 239000000199 parathyroid hormone Substances 0.000 description 1
- 229960001319 parathyroid hormone Drugs 0.000 description 1
- 238000005191 phase separation Methods 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 229940097325 prolactin Drugs 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 239000012460 protein solution Substances 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 238000009256 replacement therapy Methods 0.000 description 1
- 229940043230 sarcosine Drugs 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 239000002195 soluble material Substances 0.000 description 1
- 108010036625 somatosin Proteins 0.000 description 1
- 229960004532 somatropin Drugs 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229940021747 therapeutic vaccine Drugs 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Chemical class ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 229960003726 vasopressin Drugs 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
Definitions
- the present invention relates to fusion constructs comprising multimeric elastin-like peptides (ELPs) having utility, inter cilia, in biopharmaceutical applications, and to methods of making and using the same.
- ELPs multimeric elastin-like peptides
- Such fusion proteins comprise a biologically active molecule joined to one or more phase transition protein(s), where the one or more phase transition protein(s) comprise polymeric or oligomeric repeats of a polypeptide sequence.
- the fusion protein may also, optionally, contain a spacer sequence between the biologically active molecule and the one or more phase transition protein(s).
- the biologically active molecules in these constructs can be of widely varying types, including, for example, peptides, non-peptide proteins, lipids, oligonucleotides and carbohydrates, or alternatively a ligand-binding protein or an active fragment thereof having binding affinity to a biomolecule selected from the group consisting of small organic or inorganic molecules, proteins, peptides, single-stranded or double-stranded oligonucleotides, polynucleotides, lipids, and carbohydrates.
- phase transition can be mediated by one or more techniques such as changing temperature, changing pH, addition of solutes and/or solvents, side-chain ionization or chemical modification and/or changing pressure.
- the one or more one or more protein(s) exhibiting phase transition behavior can include polymeric or oligomeric repeats of the pentapeptide Ile-Pro-Gly-X-Gly or Leu-Pro-Gly-X-Gly, wherein X is any natural or non-natural amino acid residue, and wherein X optionally varies among polymeric or oligomeric repeats.
- the technology disclosed by the above-identified Chilkoti patent and application includes methods of purification of fusion proteins to yield a protein of interest, by forming a polynucleotide comprising a nucleotide sequence encoding a fusion protein exhibiting a phase transition, expressing the fusion protein in culture, and subjecting a fusion protein-containing material from the culture to processing involving centrifugation and inverse transition cycling to recover the protein of interest.
- the Chilkoti technology reflects an initial discovery that non-chromatographic, thermally-stimulated phase separation and purification of recombinant proteins can be easily achieved by forming fusion proteins that contain the target recombinant proteins with N- or C-terminal elastin-like polypeptide (ELP) tags.
- ELP elastin-like polypeptide
- ELPs are repeating peptide sequences that have been found to exist in the elastin protein. Among these repeating peptide sequences are polytetra-, polypenta-, polyhexa-, polyhepta-, polyocta, and polynonapeptides.
- ELPs undergo a reversible inverse temperature transition: they are structurally disordered and highly soluble in water below a transition temperature (T t ), but exhibit a sharp (2-3° C. range) disorder-to-order phase transition when the temperature is raised above T t , leading to desolvation and aggregation of the polypeptides.
- T t transition temperature
- the ELP aggregates when reaching sufficient size, can be readily removed and isolated from solution by centrifugation. More importantly, such phase transition is reversible, and the isolated ELP aggregates can be completely resolubilized in buffer solution when the temperature is returned below the T t of the ELPs.
- FP's fusion proteins
- N- or C-terminal ELP tags also undergo a thermo-dependent phase transition similar to that of free ELPs.
- Target proteins are readily expressed as soluble fusion proteins with N- or C-terminal ELP sequences in host organisms such as E. coli , wherein the fusion proteins exhibit a soluble-insoluble phase transition when the temperature is raised from below T t to above T t .
- This inverse phase transition is exploited for purifying the target proteins from other soluble proteins produced by the organism, by nonchromatographic “inverse transition cycling” (ITC) separation.
- ITC nonchromatographic “inverse transition cycling”
- the fundamental principle of ITC thus is remarkably simple. It involves forming an ELP fusion protein as described hereinabove, which contains the target protein with a N- or C-terminal ELP tag, rendering the ELP fusion protein insoluble in aqueous solution by triggering its inverse phase transition. This can be accomplished either by increasing the temperature above the T t or alternatively by depressing the T t below the solution temperature by the addition of NaCl or other salt or solute, organic or inorganic, to the solution. This results in aggregation of the ELP fusion protein, allowing it to be collected by centrifugation or other weight- and/or size-dependent mass separation techniques, e.g., membrane separation or filtration.
- the aggregated ELP fusion protein can then be resolubilized in fresh buffer solution at a temperature below the T t , thereby reversing the inverse phase transition, to yield soluble, functionally active, and purified fusion protein.
- ITC may also be used to concentrate and exchange buffers if desired as follows: the purified protein is aggregated by triggering the phase transition, and resolubilized in a smaller volume than before inducing the phase transition to concentrate the protein solution, and buffer exchange is achieved by simply resolubilizing the protein in a buffer of different composition than the starting buffer.
- Free target protein then can be obtained, for example, by carrying out protease digestion or other scission process at an engineered recognition site located between the target protein and the ELP tag, followed by a final round of ITC to remove the cleaved ELP tag and yield the purified free target protein.
- the advantage of the use of inverse phase transition cycling is that purification of the protein of interest is facilitated in a ready and efficient manner. Protein production and purification efficiency are of continuing interest in ongoing efforts to refine and develop this technology, involving the search for new constructs that are well-adapted to the inverse phase transition cycling process, to yield proteins of interest at high yields.
- the present invention provides such new constructs.
- the present invention is based on the discovery of new protein constructs that are easier to purify, enable production of peptide or protein products in higher amounts and are less susceptible to proteolysis, as compared to the single ELP-based constructs of the prior art. Such constructs are useful in inverse phase transition processes.
- the invention provides a fusion protein exhibiting a phase transition, including at least one target protein or peptide, one or more proteins comprising oligomeric repeats of a polypeptide sequence, wherein the one or more proteins exhibits a phase transition and are joined to the at least one target protein or peptide, at least two residues capable of forming a disulfide bond and optionally a spacer sequence separating any of the phase transition protein(s) front any of the target protein(s) or peptide(s).
- the invention also provides a polynucleotide encoding such a fusion protein, an expression vector comprising such a polynucleotide and a host cell that expresses the fusion protein.
- the invention provides ELP spider complex comprising two or more fusion proteins exhibiting a phase transition, including at least one target protein or peptide, one or more proteins comprising oligomeric repeats of a polypeptide sequence, wherein the one or more proteins exhibits a phase transition and are joined to the at least one target protein or peptide, at least two residues capable of forming a disulfide bond and optionally a spacer sequence separating any of the phase transition protein(s) from any of the target protein(s) or peptide(s), wherein the two or more fusion proteins exhibiting a phase transition are linked by at least one disulfide bond.
- the invention provides methods of providing a purified protein of interest and of enhancing proteolytic resistance of a protein or peptide moiety.
- the method of the invention providing a purified protein of interest comprises contacting a fusion protein comprising the protein of interest and an ELP tag, wherein the fusion protein contains at least one cleavage site that is cleavable to yield the protein of interest as a cleavage product with ELP-TEV1 that is effective to cleave the cleavage site, thereby yielding said protein of interest as a cleavage product in a cleavage product mixture comprising said ELP rag, any uncleaved fusion protein and said ELP-tagged cleavage agent; and separating the protein of interest from the cleavage produce mixture by inverse phase transition.
- the invention provides a method of enhancing proteolytic resistance of a protein or peptide moiety in an ELP-based fusion peptide, comprising provision of the ELP-based fusion peptide in an ELP spider complex.
- FIG. 1A is a schematic representation of an ELP fusion protein including a -Cys-Cys-moiety after the ELP and before the TEV site and the peptide.
- FIG. 1B is a schematic representation of a corresponding spider construct, for pET17b-SD34-ELP4-60-Orexin B (as set forth below in Example 1), and transformation into a BL21 trxB-strain, allowing disulfide bond formation between the fusion proteins to take place in the cytoplasm.
- FIG. 2 is an SDS-PAGE gel comparison for ELP4-60-Orexin B (Normal) and ELP4-60-S-S-Orexin B (Spider) (Lane 1: ELP4-60-Orexin B or ELP4-60-S-S-Orexin B; Lane 2: +ELP1-90-TEV; Lane 3: insolubles following T t (I); and Lane 4: solubles following T t (S)).
- FIG. 3 shows an LC-MS analysis of Orexin B derived from ELP4-60-Orexin B ( FIG. 3A ), in which the level of Orexin B was too low to detect by LC-MS, so that the theoretical location was estimated by location of Orexin B in (B) and ELP4-60-S-S-Orexin B ( FIG. 3B ), 85% pure, in which the major peak contains the correct molecular weight of Orexin B and the minor peak is a proteolytic fragment of Orexin B.
- FIG. 4 is a SDS-PAGE gel analysis, showing that the spider influences the amount of purification, the cleavage with ELP4-60-TEV and proteolysis, with all samples being reduced with DTT prior to loading on the SDS-gel.
- FIG. 5 is an SDS-PAGE gel analysis of ELP-spider constructs of three additional peptides (Lane 1: ELP4-60-S-S-peptide (reduced with DTT); Lane 2: +ELP1-90-TEV; Lane 3: insolubles following T t (1); and Lane 4: solubles following T t (S)).
- FIG. 6 shows LC-MS analysis for non-spider peptides, MMN from ELP4-60-S-S-MMN: 99.3% pure 13 mg/L ( FIG. 6A ) and NPY from ELP4-60-S-S-NPY: 98.1% pure 20 mg/L ( FIG. 6B ).
- FIG. 7 shows LC-MS analysis for pro-CT from ELP1-90-pro-CT: 98.0% pure ( FIG. 7A ) and Leptin from ELP1-90-Leptin: 85% pure ( FIG. 7B ).
- FIG. 8 shows the results of testing of spider constructs grown in Example 8, as compared to non-spider constructs containing IFNa2bSD, in order to determine which were most likely to produce soluble protein.
- FIG. 9 shows re-expression of selected constructs from FIG. 8 .
- the results of the re-expression show that spider constructs clearly express more target protein than non-spider constructs.
- FIG. 10 shows expression of purified target protein obtained after cleavage of each of the constructs. It is shown that the spider constructs express more soluble ELP fusion protein and more IFNa2bSD than non-spider constructs.
- the present invention relates to multimeric elastin-like peptide (ELP) constructs having utility for biopharmaceutical applications, and methods of making and using the same.
- ELP multimeric elastin-like peptide
- the present invention represents the discovery that multimeric ELP-peptide or ELP-protein constructs can be formed that in relation to single ELP-based peptide or protein constructs of the prior art: (i) can be more easily purified, (ii) enable production, e.g., in a suitable host such as F coli, of peptide or protein products in higher amounts, reflecting enhanced stability in relation to single ELP-based peptide or protein constructs, and (iii) are less susceptible to proteolysis.
- spider construct is used to refer to fusion proteins capable of forming multimeric or multi-legged spider complexes of the present invention. Spider constructs differ from single ELP-based constructs in that they are capable of forming covalent crosslinks in the form of disulfide bonds, linking them to other spider constructs and forming spider complexes. Such disulfide bonds are often formed between cysteine residues of the spider constructs. Cysteine residues present in a construct of the invention may be added to the construct on either side of the ELP or may be found within the ELP itself. Cysteines adjacent to the ELP in the construct may be on either the C-terminal or N-terminal end of the ELP, regardless of whether the ELP is oriented to the amino or carboxyl end of the protein or peptide.
- a “spider complex” of the invention contains at least two spider constructs linked by at least one disulfide bond, but is not limited by any maximum number of spider constructs or any maximum number of disulfide bonds.
- the fusion protein of the invention contains a target protein or peptide. More preferably, the target protein or peptide comprises a polypeptide protein, most preferably a biologically active polypeptide, e.g. a therapeutic peptide, protein or an enzyme useful in industrial biocatalysis.
- Suitable proteins include those of interest in medicine, agriculture and other scientific and industrial fields, particularly including therapeutic proteins such as erythropoietins, interferons, insulin, monoclonial antibodies, blood factors, colony stimulating factors, growth hormones, interleukins, growth factors, therapeutic vaccines, calcitonins, tumor necrosis factors (TNF), and enzymes.
- therapeutic proteins include, without limitation, enzymes utilized in replacement therapy; hormones for promoting growth in animals, or cell growth in cell culture; and active proteinaceous substances used in various applications, e.g., in biotechnology or in medical diagnostics.
- Specific examples include, but are not limited to: superoxide dismutase, interferon, asparaginease, glutamase, arginase, arginine deaminase, adenosine deaminase ribonuclease, trypsin, chromotrypsin, papin, insulin, calcitonin, ACTH, glucagon, somatosin, somatropin, somatomedin, parathyroid hormone, erthyropoietin, hypothalamic releasing factors, prolactin, thyroid stimulating hormones, endorphins, enkephatins, and vasopressin.
- the target protein or peptide may also comprise a ligand-binding protein or an active fragment thereof, such as an antibody or antibody fragment, which has specific affinity for a protein of interest.
- the fusion protein Upon binding to the protein of interest, the fusion protein preferably retains some or all of its phase transition character, so that the protein of interest bound to such fusion protein may be isolated by inverse phase transition.
- the target protein or peptide may be selected from the group consisting of proteins, lipids, carbohydrates, and single- or double-stranded oligonucleotides.
- the target protein or peptide may be, but is not limited to, IFNa2b, Orexin-B, MMN, NPY, Gh or active fragments thereof.
- a fusion protein of the invention also includes one or more ELPs exhibiting a phase transition. These ELPs may be of any suitable type.
- ELPs are repeating peptide sequences that exist in the elastin protein. Among these repeating peptide sequences are polytetra-, polypenta-, polyhexa-, polyhepta-, polyocta, and polynonapeptides.
- the ELPs may comprise polymeric or oligomeric repeats of various tetra-, penta-, hexa-, hepta-, octa-, and nonapeptides, including but not limited to VPGG (SEQ ID NO: 1), IPGG (SEQ ID NO: 2), XGVPG (SEQ ID NO: 3), VGVPG (SEQ ID NO: 4), VPAVG (SEQ ID NO: 5), GVGIP (SEQ ID NO: 6), VGLPG (SEQ ID NO: 7), VPGXG (SEQ ID NO: 8).
- AVGVP SEQ ID NO: 9
- IPGVG SEQ ID NO: 10
- ELPs need not consist of only polymeric or oligomeric sequences as listed hereinabove, in order to exhibit the desired phase transition, and that other polymeric or oligomeric sequences of varying size and constitution that exhibit phase transition behavior are also usefully employed in the broad practice of the present invention.
- the ELPs are polymeric or oligomeric repeats selected from one of the above listed polypentapeptides.
- X may be any amino acid that does not eliminate the phase transition characteristics of the ELP.
- X may be a naturally occurring or non-naturally occurring amino acid.
- X may be selected from the group consisting of: alanine, arginine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine and valine.
- ELP is VPGXG (SEQ ID NO: 8)
- X is not proline.
- X may be a non-classical amino acid.
- non-classical amino acids include: D-isomers of the common amino acids, 2,4-diaminobutyric acid, ⁇ -amino isobutyric acid, 4-aminobutyric acid, Abu, 2-amino butyric acid, ⁇ -Abu, ⁇ -Ahx, 6-amino hexanoic acid, Aib, 2-amino isobutyric acid, 3-amino propionic acid, ornithine, norleucine, norvaline, hydroxyproline, sarcosine, citrulline, homocitrulline, cysteic acid, t-butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, ⁇ -alanine, fluoro-amino acids, designer amino acids such as ⁇ -methyl amino acids, C ⁇ -methyl amino acids, N ⁇ -methyl amino acids, and amino
- the ELP is a “Series I” pentapeptide of repeating oligomer XGVPG (SEQ ID NO: 3) where X is independently selected from Val, Gly and Ala, in a ratio of 5V:3G:2A, selected from ELP1-90 and ELP1-180.
- the ELP is a “Series II” pentapeptide of repeating oligomer XGVPG (SEQ ID NO: 3) where X is independently selected from Lys, Val and Phe, in a ratio of 1K:2V:1F, selected from ELP2-64 and ELP2-128.
- the ELP is a “Series III” pentapeptide of repeating oligomer XGVPG (SEQ ID NO: 3) where X is independently selected from Lys, Val and Phe, in a ratio of 1K:7V:1F, selected from ELP3-72 and ELP3-144.
- the ELP is a “Series IV” pentapeptide of repeating oligomer VGVPG (SEQ ID NO: 4), selected from ELP4-60 and ELP4-120.
- the ELP is a “Series V” pentapeptide of repeating oligomer VPAVG (SEQ ID NO: 5), selected from ELP5-15, ELP5-30 and ELP5-60.
- the ELP is a “Series VI” pentapeptide of repeating oligomer GVGIP (SEQ ID NO: 6), selected from ELP6-15. ELP6-30 and ELP6-60.
- the ELP is a “Series VII” pentapeptide of repeating oligomer VGLPG (SEQ ID NO: 7), selected from ELP7-15, ELP7-30 and ELP7-60.
- ELPs can be polymeric or oligomeric repeats of the pentapeptide IPGXG (SEQ ID NO: 11) or LPGXG (SEQ ID NO: 13), where X is as defined hereinabove.
- the fusion protein contains a phase transition protein selected front the group consisting of: SEQ ID NO: 1-17.
- the fusion protein contains a phase transition protein selected from the group consisting of: SEQ ID NOs: 1, 2, 8, 9, 10, 11, 12, 13, 14, 15, 16, and 17.
- the fusion protein contains a phase transition protein selected from the group consisting of: SEQ ID NOs: 1, 2, 9, 10, 11, 12, 13, 14, 15, 16, and 17.
- a further embodiment of the invention relates to a fusion protein containing a phase transition protein, wherein the phase transition protein is selected from the group consisting of: ELP1-90.
- phase transition protein is joined to the at least one target protein or peptide. Such joining may be on either end of the target protein or peptide, forming either an N- or C-terminal ELP tag.
- the fusion protein of the invention contains at least two residues capable of forming a disulfide bond. In one aspect this comprises the presence of two cysteine residues within the ELP monomer sequence. In another aspect the cysteines are located elsewhere in the fusion protein, either adjacent to the ELP, or separated from the ELP. The cysteines may be located on either side of the ELP within the fusion protein.
- ELPx-y An example of an ELP containing two cysteines within the monomer sequence is set forth below.
- the ELP is of a general form “ELPx-y”, where x is an indicator of the ELP series and y is the number of oligomeric repeats.
- the ratio of G:V:C:A is 2:5:2:2.
- ELP containing two cysteines within the monomer sequence is set forth below, where the ratio of G:V:C:A is 1:5:2:2.
- G V G V P G V G V P G C G V P (SEQ ID NO: 20) GGCGTGGGTGTTCCGGGCGTGGGTGTTCCGGGTTGCGGGGTGCC (SEQ ID NO: 21) G A G V P G V G V P G V G V P GGGCGCAGGTGTTCCTGGTGTAGGTGTGCCGGGTGTTGGTGTGCCGGGTGTTGGTGTACC G C G V P G A G V P G G G V P G AGGTTGCGGTGTTCCGGGTGCAGGCGTTCCGGGTGGCGGTGTGCCGGGC . . .
- the phase transition of the fusion protein is preferably mediated by one or more mechanisms selected from, but not limited to, changing temperature, changing pH, addition of (organic or inorganic) solutes and/or solvents, side-chain ionization or chemical modification, irradiation with electromagnetic waves (rf, ultrasound, and light) and changing pressure.
- the preferred mechanisms for mediating the phase transition are raising temperature and adding solutes and/or solvents.
- the fusion protein may contain a spacer sequence separating the phase transition protein from the target protein or peptide.
- the spacer sequence when present, preferably comprises a cleavage site, e.g., a proteolytic cleavage site, a chemical cleavage site, a photolytic cleavage site, a thermolytic cleavage site, or a cleavage site susceptible to cleavage in the presence of a shear force, pH change, enzymatic agent, ultrasonic or other predetermined frequency field providing energy effective for cleavage.
- the cleavage modality may be of any of widely varying types, it being necessary only that the cleaving step yield at least one biological molecule (as a cleavage product) that retains functional utility for its intended purpose.
- the fusion peptides of the present invention may also optionally comprise signal peptides for directing secretion of the fusion peptides from the cell, so that the fusion peptides may readily be isolated from the medium of an active culture of recombinant cells genetically modified to produce the fusion peptides.
- signal peptides are preferably cleavable from the fusion protein by enzymatic cleavage.
- the invention provides a fusion protein comprising a spacer sequence.
- the invention provides a fusion protein with a spacer sequence that is a proteolytic cleavage site.
- the invention provides a fusion protein selected front pET17b-SD33-ELP1-90-IFNA2bSD (SEQ ID NO: 22), pET17b-SD33-ELP4-60-IFNA2bSD (SEQ ID NO: 23), pET17b-SD34-ELP1-90-IFNA2bSD (SEQ ID NO: 24), pET17b-SD34-ELP4-60-IFNA2bSD (SEQ ID NO: 25), pET17b-SD22-ELP1-90-IFNA2bSD (SEQ ID NO: 26), pET17b-SD22-ELP4-60-IFNA2bSD (SEQ ID NO: 27), pET17b-SD35-IFNA2bSD-ELP1-90 (SEQ ID NO: 28), pET17b-SD35-IFNA2bSD-ELP4-60 (SEQ ID NO: 29), pET17b-SD37-IFNA2bSD-ELP1-90 (SEQ ID NO: 22
- the invention provides a fusion protein selected from ELP4-60-S-S-Orexin B, ELP4-60-S-S-MMN, ELP4-60-S-S-NPY and ELP4-60-S-S-Gh.
- Yet another embodiment of the invention relates to a polynucleotide comprising a nucleotide sequence encoding a fusion protein exhibiting a phase transition, comprising:
- the invention in a further aspect relates to a polynucleotide selected from pET17b-SD33-ELP1-90-IFNA2bSD (SEQ ID NO; 34), pET17b-SD33-ELP4-60-IFNA2bSD (SEQ ID NO: 35), pET17b-SD34-ELP1-90-IFNA2bSD (SEQ ID NO: 36), pET17b-SD34-ELP4-60-IFNA2bSD (SEQ ID NO: 37), pET17b-SD22-ELP1-90-IFNA2bSD (SEQ ID NO: 38), pET17b-SD22-ELP4-60-IFNA2bSD (SEQ ID NO: 39), pET17b-SD35-IFNA2bSD-ELP1-90 (SEQ ID NO: 40), pET17b-SD35-IFNA2bSD-ELP4-60 (SEQ ID NO: 41), pET17b-SD37-IFNA2bSD-EL
- the invention provides an expression vector comprising a polynucleotide encoding a fusion protein of the invention.
- the invention provides a host cell transformed by such an expression vector, where the host cell expresses the fusion protein.
- the invention provides an ELP spider complex comprising two or more fusion proteins of the invention, covalently linked by at least one disulfide bond.
- the invention also provides a spider complex which includes two or more fusion proteins exhibiting a phase transition comprising:
- the invention also provides methods of utilizing the fusion proteins and spider complexes as discussed herein.
- the invention relates to a method of providing a purified protein of interest, comprising contacting a fusion protein comprising the protein of interest and an ELP tag, wherein the fusion protein contains at least one cleavage site that is cleavable to yield the protein of interest as a cleavage product with ELP-TEV1 that is effective to cleave said cleavage site, thereby yielding said protein of interest as a cleavage product in a cleavage product mixture comprising said ELP tag, any uncleaved fusion protein and said ELP-tagged cleavage agent and separating the protein of interest from the cleavage produce mixture by inverse phase transition.
- the invention provides a method of enhancing proteolytic resistance of a protein or peptide moiety in an ELP-based fusion peptide, comprising provision of the ELP-based fusion peptide in an ELP spider complex form.
- spider complexes discussed herein include Orexin B/ELP and IFNa2bSD/ELP spider constructs, but are broadly applicable to a wide spectrum of other proteins and peptides, and have particular utility for proteins or peptides that are susceptible to proteolytic degradation.
- Methods of protection of target proteins or peptides by the spider construct may involve, but are not limited to: (i) slowing or stopping degradative action of proteases, (ii) decreasing or eliminating non-specific associated proteins that may make the target protein or peptide insoluble or prevent the target protein or peptide from properly folding, (iii) increasing the amount of total spider construct concentration in the cell, and/or (iv) exposure of a region of the target protein or peptide subject to proteolysis by the ELP fused to TEV protease when produced in the absence of disulfide bonds. Disulfides formed between ELP and TEV site have been tested.
- Spacing may be desirably adjusted for such bonding, e.g., with intra-disulfide bonds being separated by at least 2 amino acid residues, such as for example by a -Cys-Cys-moiety.
- Other techniques for increasing inter- and decreasing intra-disulfide bond formation can be employed.
- FIG. 1A is a schematic representation of an ELP fusion protein including a -Cys-Cys-moiety after the ELP and before the TEV site and the peptide.
- FIG. 1B is a schematic representation of a corresponding spider construct, for pET17b-SD34-ELP4-60-Orexin B (as set forth below in Example 1), and transformation into a BL21 trxB-strain, allowing disulfide bond formation between the fusion proteins to take place in the cytoplasm.
- FIG. 2 is an SDS-PAGE gel comparison of the two fusion protein constructs. (Lane 1: ELP4-60-Orexin B or ELP4-60-S-S-Orexin B; Lane 2: +ELP1-90-TEV; Lane 3: insolubles following T t (I); and Lane 4: solubles following T t (S)).
- FIG. 3 shows an LC-MS analysis of Orexin B derived from ELP4-60-Orexin B ( FIG. 3A ), in which the level of Orexin B was too low to detect by LC-MS, so that the theoretical location was estimated by location of Orexin B in (B) and ELP4-60-S-S-Orexin B ( FIG. 3B ), 85% pure, in which the major peak contains the correct molecular weight of Orexin B and the minor peak is a proteolytic fragment of Orexin B.
- ELP4-60-Orexin B appeared to purify well, however a substantial amount was difficult to resuspend and purify away from insoluble contaminates. Only a portion of Orexin B was cleaved following 18 hr digestion with ELP1-90-TEV. Once cleaved 50% was insoluble following final transition to eliminate uncleaved ELP4-60-Orexin D, ELP1-90-TEV and ELP4-60. The level of Orexin B was too low to analyze by LC-MS. Loading the gel with 10 ⁇ more cleaved ELP4-60-Orexin B indicated proteolysis had occurred prior to or during cleavage.
- ELP4-60-S-S-Orexin B was much easier to purify away from contaminates. Complete cleavage occurred following 18 hr digestion with ELP1-90-TEV. A minor amount of Orexin B remained insoluble following the final transition to eliminate uncleaved ELP4-60-Orexin B, ELP1-90-TEV, and ELP4-60. LC-MS analysis indicated the largest peak contained the correct molecular weight Orexin B peptide and was 85% of total peaks. The minor peak was a proteolytic fragment of Orexin B.
- FIG. 4 is an SDS-PAGE gel analysis, showing that use of a spider construct influences the amount of purification, the cleavage with ELP4-60-TEV and proteolysis. All samples in the comparison were reduced with DTT prior to loading on the SDS-gel.
- FIG. 5 is an SDS-PAGE gel analysis of ELP-spider constructs of three peptides: MMN, NPY and Gh.
- the lanes are as follows: Lane 1: ELP4-60-S-S-peptide (reduced with DTT): Lane 2: +ELP1-90-TEV; Lane 3: insolubles following T, (I); and Lane 4: solubles following T t (S)).
- ELP4-60-MMN (58 mg/liter) was not difficult to purify and resulted in 6 mg/liter MMN.
- ELP4-60-S-S-MMN 180 mg/liter was not difficult to purify and resulted in 13 mg/liter MMN. It can be seen that use of spider constructs increased the amount of MMN purified.
- NPY peptide ELP4-60-NPY (62 mg/liter) was not difficult to purify and resulted in 7 mg/liter NPY. ELP4-60-S-S-NPY (222 mg/liter) was not difficult to purify and resulted in 20 mg/liter NPY. It can be seen that use of spider constructs increased the amount of NPY purified, it being noted that NPY does not stain well.
- ELP4-60-GH was difficult to purify and resulted in 0 mg/liter Gh.
- ELP4-60-S-S-GH was not as difficult to purify and resulted in approx 2 mg/liter Gh.
- a spider construct only partially eliminated Gh degradation. The amount of non-degraded Gh was too low for LC-MS determination.
- spider constructs may also act to buffer the possible toxic effect of the peptide and allow more ELP-peptide to be produced per cell, in addition to decreasing protcolysis.
- FIG. 6 shows LC-MS analysis for non-spider peptides.
- MMN from ELP4-60-S-S-MMN 99.3% pure 13 mg/L
- NPY from ELP4-60-S-S-NPY 98.1% pure 20 mg/L
- FIG. 7 shows LC-MS analysis for pro-CT from ELP1-90-pro-CT: 98.0% pure ( FIG. 7A ) and Leptin from ELP1-90-Leptin: 85% pure ( FIG. 7B ).
- SD35 forward oligo (SEQ ID NO: 46) TCGAGAACCTGTATTTCCAGGGCGGGTGCTGCGGC SD35 reverse oligo: (SEQ ID NO: 47) CTTGGCCGCAGCAGCCGCCCTGGAAATACAGGTTC Annealed oligos: (SEQ ID NO: 48) L E N L Y F Q G G C C G Q G cTCGAG AACCTGTATTT CCAGGG CGGGTGCTGCGG Ccaagg (SEQ ID NO: 49) gagctCTTGGACATAAAGGTCCCGCCCACGACGCCGGTTCc XhoI StyI
- the annealed SD35 oligos were ligated into pUC19-SD31-ELP, digested with XhoI and StyI and 5′ dephosphorylated with CIP to create pUC19-SD35-ELP.
- the pUC19-SD35-ELP XbaI-EcoRI fragment containing SD35-ELP was subcloned into pET17b, digested with XbaI and EcoRI and 5′ dephosphorylated with CIP.
- the Cys-Cys is placed following the TEV cleavage site at the amino terminus of the ELP to create a protein/peptide-ELP orientation.
- SD37 forward oligo TGGCCTTGCTGCTGATAAG
- SD37 reverse oligo CTAGCTTATCAGCAGCAAGGCCAGCC
- Annealed oligos P G W P C C * * A S (SEQ ID NO: 54) gccgggcTGGCCTTGCTGCTGATAAGctagc cggcCCGACCGGAACGACGACTATTCGATCg (SEQ ID NO: 55) BglI NheI
- the annealed SD37 oligos were ligated into pET17b-SD31-ELP, digested with BglI and NheI and 5′ dephosphorylated with CIP to create pET17b-SD37-ELP.
- the Cys-Cys is placed at the carboxyl terminus of the ELP to create a protein/peptide-ELP orientation.
- SD33 forward and reverse oligos were annealed to form XbaI and NcoI overhangs: SD33 forward oligo:
- SD33 forward oligo CTAGAAATAATTTTGTTTAACTTTAAGAAGGAGATATACCATGTGCTGCCC
- SD33 reverse oligo CATGGGGCAGCACATGGTATATCTCCTTCTTAAAGTTAAACAAAATTATTT
- Annealed oligos M C C P M G
- tCTAGAAATAATTTTGTTTAACTTTAAGAAGGAGATATACCATGTGCTGCCCcatgg agatcTTTATTAAAACAAATTGAAATTCTTCCTCTATATGGTACACGACGGGGTACc SEQ ID NO: 61
- the annealed SD33 oligos were ligated into pET17b-SD22-ELP digested with XbaI and NcoI and 5′ dephosphorylated with CIP to create pET17b-SD33-ELP.
- the Cys-Cys is placed at the amino terminus of the ELP to create an ELP-protein/peptide orientation.
- SD34 forward oligo TGCCCGTGCTGCAGCAGCGGTGAT (SEQ ID NO: 64)
- SD34 reverse oligo ATCACCGCTGCTGCAGCACGGCCAGCC (SEQ ID NO: 65)
- the annealed SD34 oligos were ligated into pET17b-SD22-ELP digested with BglI and EcoRV and 3′ dephosphorylated to create pET17b-SD34-ELP.
- the Cys-Cys is placed at the carboxyl terminus of the ELP to create an ELP-protein/peptide orientation.
- PCR amplification was used to generate the following DNA fragments from a Human cDNA library containing IFNA2b:
- IFNA2bSD with stop codon was ligated into pET17b-SD33-ELP, pET17b-SD34-ELP and pET17b-SD22-ELP digested with NdeI and partially digested with XhoI and 5′ dephosphorylated with CIP to create pET17b-SD33-ELP-IFNA2bSD, pET17b-SD34-ELP-IFNA2bSD and pET17b-SD22-ELP-IFNA2bSD respectively.
- IFNA2bSD without stop codon was ligated into pET17b-SD35-ELP, pET17b-SD37-ELP and pET17b-SD31-ELP digested with NdeI and partially digested with XhoI and 5′ dephosphorylated with CIP to create pET17b-SD35-IFNA2bSD-ELP, pET17b-SD37-IFNA2bSD-ELP and pET17b-SD31-IFNA2bSD-ELP respectively.
- Resulting spider constructs created included pET17b-SD33-ELP1-90-IFNA2bSD (SEQ ID NO: 34), pET17b-SD33-ELP4-60-IFNA2bSD (SEQ ID NO: 35), pET17b-SD34-ELP1-90-IFNA2bSD (SEQ ID NO: 36), pET17b-SD34-ELP4-60-IFNA2bSD (SEQ ID NO: 37), pET17b-SD22-ELP1-90-IFNA2bSD (SEQ ID NO: 38), pET17b-SD22-ELP4-60-IFNA2bSD (SEQ ID NO: 39), pET17b-SD35-IFNA2bSD-ELP1-90 (SEQ ID NO: 40), pET17b-SD35-IFNA2bSD-ELP4-60 (SEQ ID NO: 41), pET17b-SD37-IFNA2bSD-ELP1-90 (SEQ ID NO: 42),
- the pellet was resuspended in the original volume ice-cold ml buffer, centrifuged at 20,000 g, 4° C. for 15 minutes to remove non-specific insoluble proteins (T,1).
- the temperature transition cycle was repeated at one additional time to increase the purity of the ELP/protein fusions and reduce the final volume (T,2).
- ELP-TEV1 ELP TEV protease
- T,2+ELP1-90-TEV1 ELP TEV protease
- Cleavage was allowed to proceed for 15 hrs at 4° C.
- Free protein was separated front free ELP and uncleaved ELP/protein fusions by adding 1M NaCl at 25° C., followed by centrifugation at 25° C.
- Salt transitioned material ELP and ELP fusions
- ELP and ELP fusions were resuspended in cold buffer (Insoluble). Salt soluble protein was transferred to a new tube (Soluble). Results can be seen in FIG. 10 .
- TEV cleavage was incomplete when performed at 4° C. rather then 25° C., the spider construct not only expressed more soluble ELP fusion protein but also produced 3-4 times more soluble IFNa2bSD following cleavage with ELP1-90-TEV1 and a final transition to separate IFNa2bSD from free ELP, ELP fusions and ELP1-90-TEV1.
Landscapes
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Organic Chemistry (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Peptides Or Proteins (AREA)
Abstract
ELP fusion proteins, multimeric ELP spider complexes formed of ELP fusion proteins, and methods of using the same. The construct may be in the form of an ELP spider structure complex including multi-leg moieties comprising ELP fusion proteins capable of forming covalent disulfide bonds. The multimeric fusion constructs may be employed in peptide production and purification and/or to enhance proteolytic resistance of a protein or peptide moiety in a fusion construct, by provision of the fusion protein in an ELP spider complex.
Description
- The benefit of priority of U.S.
Provisional Patent Application 60/756,269 filed Jan. 4, 2006 in the name of Suzanne Dagher is hereby claimed under the provisions of 35 USC 119(e). The disclosure of suchProvisional Patent Application 60/756,269 is hereby incorporated herein by reference, in its entirety. - The present invention relates to fusion constructs comprising multimeric elastin-like peptides (ELPs) having utility, inter cilia, in biopharmaceutical applications, and to methods of making and using the same.
- U.S. Pat. No. 6,852,834 issued Feb. 8, 2005 in the name of Ashutosh Chilkoti for “FUSION PEPTIDES ISOLATABLE BY PHASE TRANSITION” and U.S. patent application Ser. No. 11/053,100 filed Feb. 8, 2005 for “FUSION PEPTIDES ISOLATABLE BY PHASE TRANSITION,” in the name of Ashutosh Chilkoti (published Nov. 17, 2005 as U.S. Patent Publication No. 2005/0255554) disclose fusion proteins exhibiting a phase transition. Such fusion proteins comprise a biologically active molecule joined to one or more phase transition protein(s), where the one or more phase transition protein(s) comprise polymeric or oligomeric repeats of a polypeptide sequence. The fusion protein may also, optionally, contain a spacer sequence between the biologically active molecule and the one or more phase transition protein(s).
- The biologically active molecules in these constructs can be of widely varying types, including, for example, peptides, non-peptide proteins, lipids, oligonucleotides and carbohydrates, or alternatively a ligand-binding protein or an active fragment thereof having binding affinity to a biomolecule selected from the group consisting of small organic or inorganic molecules, proteins, peptides, single-stranded or double-stranded oligonucleotides, polynucleotides, lipids, and carbohydrates.
- The phase transition can be mediated by one or more techniques such as changing temperature, changing pH, addition of solutes and/or solvents, side-chain ionization or chemical modification and/or changing pressure.
- The one or more one or more protein(s) exhibiting phase transition behavior can include polymeric or oligomeric repeats of the pentapeptide Ile-Pro-Gly-X-Gly or Leu-Pro-Gly-X-Gly, wherein X is any natural or non-natural amino acid residue, and wherein X optionally varies among polymeric or oligomeric repeats.
- The technology disclosed by the above-identified Chilkoti patent and application includes methods of purification of fusion proteins to yield a protein of interest, by forming a polynucleotide comprising a nucleotide sequence encoding a fusion protein exhibiting a phase transition, expressing the fusion protein in culture, and subjecting a fusion protein-containing material from the culture to processing involving centrifugation and inverse transition cycling to recover the protein of interest.
- The Chilkoti technology reflects an initial discovery that non-chromatographic, thermally-stimulated phase separation and purification of recombinant proteins can be easily achieved by forming fusion proteins that contain the target recombinant proteins with N- or C-terminal elastin-like polypeptide (ELP) tags.
- ELPs are repeating peptide sequences that have been found to exist in the elastin protein. Among these repeating peptide sequences are polytetra-, polypenta-, polyhexa-, polyhepta-, polyocta, and polynonapeptides.
- ELPs undergo a reversible inverse temperature transition: they are structurally disordered and highly soluble in water below a transition temperature (Tt), but exhibit a sharp (2-3° C. range) disorder-to-order phase transition when the temperature is raised above Tt, leading to desolvation and aggregation of the polypeptides. The ELP aggregates, when reaching sufficient size, can be readily removed and isolated from solution by centrifugation. More importantly, such phase transition is reversible, and the isolated ELP aggregates can be completely resolubilized in buffer solution when the temperature is returned below the Tt of the ELPs.
- It was a surprising and unexpected discovery that fusion proteins (“FP's”) containing target recombinant proteins with N- or C-terminal ELP tags also undergo a thermo-dependent phase transition similar to that of free ELPs.
- This discovery has been particularly useful for non-chromatographic, thermally-stimulated separation and purification of recombinant proteins. By fusing a thermally responsive ELP tag to a target protein of interest, environmentally sensitive solubility can be imparted to such target protein. Target proteins are readily expressed as soluble fusion proteins with N- or C-terminal ELP sequences in host organisms such as E. coli, wherein the fusion proteins exhibit a soluble-insoluble phase transition when the temperature is raised from below Tt to above Tt. This inverse phase transition is exploited for purifying the target proteins from other soluble proteins produced by the organism, by nonchromatographic “inverse transition cycling” (ITC) separation.
- The fundamental principle of ITC thus is remarkably simple. It involves forming an ELP fusion protein as described hereinabove, which contains the target protein with a N- or C-terminal ELP tag, rendering the ELP fusion protein insoluble in aqueous solution by triggering its inverse phase transition. This can be accomplished either by increasing the temperature above the Tt or alternatively by depressing the Tt below the solution temperature by the addition of NaCl or other salt or solute, organic or inorganic, to the solution. This results in aggregation of the ELP fusion protein, allowing it to be collected by centrifugation or other weight- and/or size-dependent mass separation techniques, e.g., membrane separation or filtration.
- The aggregated ELP fusion protein can then be resolubilized in fresh buffer solution at a temperature below the Tt, thereby reversing the inverse phase transition, to yield soluble, functionally active, and purified fusion protein.
- Successive purification steps may also be carried out using ITC to achieve a highly pure, e.g. ultrapure, fusion protein product. Furthermore. ITC may also be used to concentrate and exchange buffers if desired as follows: the purified protein is aggregated by triggering the phase transition, and resolubilized in a smaller volume than before inducing the phase transition to concentrate the protein solution, and buffer exchange is achieved by simply resolubilizing the protein in a buffer of different composition than the starting buffer.
- Free target protein then can be obtained, for example, by carrying out protease digestion or other scission process at an engineered recognition site located between the target protein and the ELP tag, followed by a final round of ITC to remove the cleaved ELP tag and yield the purified free target protein.
- The advantage of the use of inverse phase transition cycling is that purification of the protein of interest is facilitated in a ready and efficient manner. Protein production and purification efficiency are of continuing interest in ongoing efforts to refine and develop this technology, involving the search for new constructs that are well-adapted to the inverse phase transition cycling process, to yield proteins of interest at high yields. The present invention provides such new constructs.
- The present invention is based on the discovery of new protein constructs that are easier to purify, enable production of peptide or protein products in higher amounts and are less susceptible to proteolysis, as compared to the single ELP-based constructs of the prior art. Such constructs are useful in inverse phase transition processes.
- Thus in one embodiment, the invention provides a fusion protein exhibiting a phase transition, including at least one target protein or peptide, one or more proteins comprising oligomeric repeats of a polypeptide sequence, wherein the one or more proteins exhibits a phase transition and are joined to the at least one target protein or peptide, at least two residues capable of forming a disulfide bond and optionally a spacer sequence separating any of the phase transition protein(s) front any of the target protein(s) or peptide(s). The invention also provides a polynucleotide encoding such a fusion protein, an expression vector comprising such a polynucleotide and a host cell that expresses the fusion protein.
- In another embodiment the invention provides ELP spider complex comprising two or more fusion proteins exhibiting a phase transition, including at least one target protein or peptide, one or more proteins comprising oligomeric repeats of a polypeptide sequence, wherein the one or more proteins exhibits a phase transition and are joined to the at least one target protein or peptide, at least two residues capable of forming a disulfide bond and optionally a spacer sequence separating any of the phase transition protein(s) from any of the target protein(s) or peptide(s), wherein the two or more fusion proteins exhibiting a phase transition are linked by at least one disulfide bond.
- In still another embodiment the invention provides methods of providing a purified protein of interest and of enhancing proteolytic resistance of a protein or peptide moiety.
- The method of the invention providing a purified protein of interest comprises contacting a fusion protein comprising the protein of interest and an ELP tag, wherein the fusion protein contains at least one cleavage site that is cleavable to yield the protein of interest as a cleavage product with ELP-TEV1 that is effective to cleave the cleavage site, thereby yielding said protein of interest as a cleavage product in a cleavage product mixture comprising said ELP rag, any uncleaved fusion protein and said ELP-tagged cleavage agent; and separating the protein of interest from the cleavage produce mixture by inverse phase transition.
- In another aspect the invention provides a method of enhancing proteolytic resistance of a protein or peptide moiety in an ELP-based fusion peptide, comprising provision of the ELP-based fusion peptide in an ELP spider complex.
-
FIG. 1A is a schematic representation of an ELP fusion protein including a -Cys-Cys-moiety after the ELP and before the TEV site and the peptide.FIG. 1B is a schematic representation of a corresponding spider construct, for pET17b-SD34-ELP4-60-Orexin B (as set forth below in Example 1), and transformation into a BL21 trxB-strain, allowing disulfide bond formation between the fusion proteins to take place in the cytoplasm. -
FIG. 2 is an SDS-PAGE gel comparison for ELP4-60-Orexin B (Normal) and ELP4-60-S-S-Orexin B (Spider) (Lane 1: ELP4-60-Orexin B or ELP4-60-S-S-Orexin B; Lane 2: +ELP1-90-TEV; Lane 3: insolubles following Tt (I); and Lane 4: solubles following Tt (S)). -
FIG. 3 shows an LC-MS analysis of Orexin B derived from ELP4-60-Orexin B (FIG. 3A ), in which the level of Orexin B was too low to detect by LC-MS, so that the theoretical location was estimated by location of Orexin B in (B) and ELP4-60-S-S-Orexin B (FIG. 3B ), 85% pure, in which the major peak contains the correct molecular weight of Orexin B and the minor peak is a proteolytic fragment of Orexin B. -
FIG. 4 is a SDS-PAGE gel analysis, showing that the spider influences the amount of purification, the cleavage with ELP4-60-TEV and proteolysis, with all samples being reduced with DTT prior to loading on the SDS-gel. -
FIG. 5 is an SDS-PAGE gel analysis of ELP-spider constructs of three additional peptides (Lane 1: ELP4-60-S-S-peptide (reduced with DTT); Lane 2: +ELP1-90-TEV; Lane 3: insolubles following Tt (1); and Lane 4: solubles following Tt (S)). -
FIG. 6 shows LC-MS analysis for non-spider peptides, MMN from ELP4-60-S-S-MMN: 99.3% pure 13 mg/L (FIG. 6A ) and NPY from ELP4-60-S-S-NPY: 98.1% pure 20 mg/L (FIG. 6B ). -
FIG. 7 shows LC-MS analysis for pro-CT from ELP1-90-pro-CT: 98.0% pure (FIG. 7A ) and Leptin from ELP1-90-Leptin: 85% pure (FIG. 7B ). -
FIG. 8 shows the results of testing of spider constructs grown in Example 8, as compared to non-spider constructs containing IFNa2bSD, in order to determine which were most likely to produce soluble protein. -
FIG. 9 shows re-expression of selected constructs fromFIG. 8 . The results of the re-expression show that spider constructs clearly express more target protein than non-spider constructs. -
FIG. 10 shows expression of purified target protein obtained after cleavage of each of the constructs. It is shown that the spider constructs express more soluble ELP fusion protein and more IFNa2bSD than non-spider constructs. - The present invention relates to multimeric elastin-like peptide (ELP) constructs having utility for biopharmaceutical applications, and methods of making and using the same.
- The disclosures of the following U.S. patent and U.S. patent application are hereby incorporated herein by reference in their respective entireties: U.S. Pat. No. 6,352,834 issued Feb. 8, 2005 in the name of Ashutosh Chilkoti for “FUSION PEPTIDES ISOLATABLE BY PHASE TRANSITION” and U.S. patent application Ser. No. 11/053,100 filed Feb. 8, 2005 for “FUSION PEPTIDES ISOLATABLE BY PHASE TRANSITION,” in the name of Ashutosh Chilkoti (published Nov. 17, 2005 as U.S. Patent Publication No. 2005/0255554).
- The present invention represents the discovery that multimeric ELP-peptide or ELP-protein constructs can be formed that in relation to single ELP-based peptide or protein constructs of the prior art: (i) can be more easily purified, (ii) enable production, e.g., in a suitable host such as F coli, of peptide or protein products in higher amounts, reflecting enhanced stability in relation to single ELP-based peptide or protein constructs, and (iii) are less susceptible to proteolysis.
- As used herein, the term “spider construct” is used to refer to fusion proteins capable of forming multimeric or multi-legged spider complexes of the present invention. Spider constructs differ from single ELP-based constructs in that they are capable of forming covalent crosslinks in the form of disulfide bonds, linking them to other spider constructs and forming spider complexes. Such disulfide bonds are often formed between cysteine residues of the spider constructs. Cysteine residues present in a construct of the invention may be added to the construct on either side of the ELP or may be found within the ELP itself. Cysteines adjacent to the ELP in the construct may be on either the C-terminal or N-terminal end of the ELP, regardless of whether the ELP is oriented to the amino or carboxyl end of the protein or peptide.
- A “spider complex” of the invention contains at least two spider constructs linked by at least one disulfide bond, but is not limited by any maximum number of spider constructs or any maximum number of disulfide bonds.
- Therefore in one embodiment the invention provides a fusion protein of spider construct comprising
-
- a) at least one target protein or peptide;
- b) one or more proteins comprising oligomeric repeats of a polypeptide sequence, such as those hereinafter described, wherein the one or more proteins exhibit a phase transition and are joined to the at least one target protein or peptide of a);
- c) at least two residues capable of forming a disulfide bond; and
- d) optionally, a spacer sequence separating any of the phase transition protein(s) of b) from any of the target protein(s) or peptide(s) of a).
- The fusion protein of the invention contains a target protein or peptide. More preferably, the target protein or peptide comprises a polypeptide protein, most preferably a biologically active polypeptide, e.g. a therapeutic peptide, protein or an enzyme useful in industrial biocatalysis. Suitable proteins include those of interest in medicine, agriculture and other scientific and industrial fields, particularly including therapeutic proteins such as erythropoietins, interferons, insulin, monoclonial antibodies, blood factors, colony stimulating factors, growth hormones, interleukins, growth factors, therapeutic vaccines, calcitonins, tumor necrosis factors (TNF), and enzymes. Specific examples of such therapeutic proteins include, without limitation, enzymes utilized in replacement therapy; hormones for promoting growth in animals, or cell growth in cell culture; and active proteinaceous substances used in various applications, e.g., in biotechnology or in medical diagnostics. Specific examples include, but are not limited to: superoxide dismutase, interferon, asparaginease, glutamase, arginase, arginine deaminase, adenosine deaminase ribonuclease, trypsin, chromotrypsin, papin, insulin, calcitonin, ACTH, glucagon, somatosin, somatropin, somatomedin, parathyroid hormone, erthyropoietin, hypothalamic releasing factors, prolactin, thyroid stimulating hormones, endorphins, enkephatins, and vasopressin.
- The target protein or peptide may also comprise a ligand-binding protein or an active fragment thereof, such as an antibody or antibody fragment, which has specific affinity for a protein of interest. Upon binding to the protein of interest, the fusion protein preferably retains some or all of its phase transition character, so that the protein of interest bound to such fusion protein may be isolated by inverse phase transition. In another embodiment the target protein or peptide may be selected from the group consisting of proteins, lipids, carbohydrates, and single- or double-stranded oligonucleotides.
- In various embodiments of the invention, the target protein or peptide may be, but is not limited to, IFNa2b, Orexin-B, MMN, NPY, Gh or active fragments thereof.
- In addition to the target protein or peptide component, a fusion protein of the invention also includes one or more ELPs exhibiting a phase transition. These ELPs may be of any suitable type.
- As used herein, ELPs are repeating peptide sequences that exist in the elastin protein. Among these repeating peptide sequences are polytetra-, polypenta-, polyhexa-, polyhepta-, polyocta, and polynonapeptides.
- The ELPs may comprise polymeric or oligomeric repeats of various tetra-, penta-, hexa-, hepta-, octa-, and nonapeptides, including but not limited to VPGG (SEQ ID NO: 1), IPGG (SEQ ID NO: 2), XGVPG (SEQ ID NO: 3), VGVPG (SEQ ID NO: 4), VPAVG (SEQ ID NO: 5), GVGIP (SEQ ID NO: 6), VGLPG (SEQ ID NO: 7), VPGXG (SEQ ID NO: 8). AVGVP (SEQ ID NO: 9), IPGVG (SEQ ID NO: 10). IPGXG (SEQ ID NO: 11), LPGVG (SEQ ID NO: 12), LPGXG (SEQ ID NO: 13). VAPGVG (SEQ ID NO: 14). GVGVPGVG (SEQ ID NO: 15), VPGFGVGAG (SEQ ID NO: 16), and VPGVGVPGG (SEQ ID NO: 17). It will be appreciated by those of skill in the art that the ELPs need not consist of only polymeric or oligomeric sequences as listed hereinabove, in order to exhibit the desired phase transition, and that other polymeric or oligomeric sequences of varying size and constitution that exhibit phase transition behavior are also usefully employed in the broad practice of the present invention.
- In one embodiment, the ELPs are polymeric or oligomeric repeats selected from one of the above listed polypentapeptides. Where the above polypentapeptides contain a guest residue X, X may be any amino acid that does not eliminate the phase transition characteristics of the ELP. X may be a naturally occurring or non-naturally occurring amino acid. For example, X may be selected from the group consisting of: alanine, arginine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine and valine. In one aspect of the invention, where the ELP is VPGXG (SEQ ID NO: 8), X is not proline.
- X may be a non-classical amino acid. Examples of non-classical amino acids include: D-isomers of the common amino acids, 2,4-diaminobutyric acid, α-amino isobutyric acid, 4-aminobutyric acid, Abu, 2-amino butyric acid, γ-Abu, ε-Ahx, 6-amino hexanoic acid, Aib, 2-amino isobutyric acid, 3-amino propionic acid, ornithine, norleucine, norvaline, hydroxyproline, sarcosine, citrulline, homocitrulline, cysteic acid, t-butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, β-alanine, fluoro-amino acids, designer amino acids such as β-methyl amino acids, C α-methyl amino acids, N α-methyl amino acids, and amino acid analogs in general.
- In one embodiment, the ELP is a “Series I” pentapeptide of repeating oligomer XGVPG (SEQ ID NO: 3) where X is independently selected from Val, Gly and Ala, in a ratio of 5V:3G:2A, selected from ELP1-90 and ELP1-180.
- In another embodiment, the ELP is a “Series II” pentapeptide of repeating oligomer XGVPG (SEQ ID NO: 3) where X is independently selected from Lys, Val and Phe, in a ratio of 1K:2V:1F, selected from ELP2-64 and ELP2-128.
- In still another embodiment of the invention, the ELP is a “Series III” pentapeptide of repeating oligomer XGVPG (SEQ ID NO: 3) where X is independently selected from Lys, Val and Phe, in a ratio of 1K:7V:1F, selected from ELP3-72 and ELP3-144.
- In a further embodiment, the ELP is a “Series IV” pentapeptide of repeating oligomer VGVPG (SEQ ID NO: 4), selected from ELP4-60 and ELP4-120.
- In a further embodiment, the ELP is a “Series V” pentapeptide of repeating oligomer VPAVG (SEQ ID NO: 5), selected from ELP5-15, ELP5-30 and ELP5-60.
- In a further embodiment, the ELP is a “Series VI” pentapeptide of repeating oligomer GVGIP (SEQ ID NO: 6), selected from ELP6-15. ELP6-30 and ELP6-60.
- In a further embodiment, the ELP is a “Series VII” pentapeptide of repeating oligomer VGLPG (SEQ ID NO: 7), selected from ELP7-15, ELP7-30 and ELP7-60.
- Alternatively, such ELPs can be polymeric or oligomeric repeats of the pentapeptide IPGXG (SEQ ID NO: 11) or LPGXG (SEQ ID NO: 13), where X is as defined hereinabove.
- Therefore in one embodiment of the invention, the fusion protein contains a phase transition protein selected front the group consisting of: SEQ ID NO: 1-17.
- In another embodiment of the invention, the fusion protein contains a phase transition protein selected from the group consisting of: SEQ ID NOs: 1, 2, 8, 9, 10, 11, 12, 13, 14, 15, 16, and 17.
- In still another embodiment, the fusion protein contains a phase transition protein selected from the group consisting of: SEQ ID NOs: 1, 2, 9, 10, 11, 12, 13, 14, 15, 16, and 17.
- A further embodiment of the invention relates to a fusion protein containing a phase transition protein, wherein the phase transition protein is selected from the group consisting of: ELP1-90. ELP1-180, ELP2-64, ELP2-128, ELP3-72, ELP3-144, ELP4-60, ELP4-120, ELP5-15, ELP5-30, ELP5-60, ELP6-15, ELP6-30, ELP6-60, ELP7-15, ELP7-30 and ELP7-60.
- In the fusion protein the phase transition protein is joined to the at least one target protein or peptide. Such joining may be on either end of the target protein or peptide, forming either an N- or C-terminal ELP tag.
- The fusion protein of the invention contains at least two residues capable of forming a disulfide bond. In one aspect this comprises the presence of two cysteine residues within the ELP monomer sequence. In another aspect the cysteines are located elsewhere in the fusion protein, either adjacent to the ELP, or separated from the ELP. The cysteines may be located on either side of the ELP within the fusion protein.
- An example of an ELP containing two cysteines within the monomer sequence is set forth below. In the example, the ELP is of a general form “ELPx-y”, where x is an indicator of the ELP series and y is the number of oligomeric repeats. In the following exemplified sequence, the ratio of G:V:C:A is 2:5:2:2.
-
G V G V P G V G V P G C C V P (SEQ ID NO: 18) GGCGTGGGTGTTCCGGGCGTGGGTGTTCCGGGTTGCTGCGTGCC (SEQ ID NO: 19) G A G V P G V G V P G V G V P G V G V P GGGCGCAGGTGTTCCTGGTGTAGGTGTGCCGGGTGTTGGTGTGCCGGGTGTTGGTGTACC G G G V P G A G V P G G G V P G AGGTGGCGGTGTTCCGGGTGCAGGCGTTCCGGGTGGCGGTGTGCCGGGC . . . - Another example of an ELP containing two cysteines within the monomer sequence is set forth below, where the ratio of G:V:C:A is 1:5:2:2.
-
G V G V P G V G V P G C G V P (SEQ ID NO: 20) GGCGTGGGTGTTCCGGGCGTGGGTGTTCCGGGTTGCGGGGTGCC (SEQ ID NO: 21) G A G V P G V G V P G V G V P G V G V P GGGCGCAGGTGTTCCTGGTGTAGGTGTGCCGGGTGTTGGTGTGCCGGGTGTTGGTGTACC G C G V P G A G V P G G G V P G AGGTTGCGGTGTTCCGGGTGCAGGCGTTCCGGGTGGCGGTGTGCCGGGC . . . - The phase transition of the fusion protein is preferably mediated by one or more mechanisms selected from, but not limited to, changing temperature, changing pH, addition of (organic or inorganic) solutes and/or solvents, side-chain ionization or chemical modification, irradiation with electromagnetic waves (rf, ultrasound, and light) and changing pressure. The preferred mechanisms for mediating the phase transition are raising temperature and adding solutes and/or solvents.
- Optionally, the fusion protein may contain a spacer sequence separating the phase transition protein from the target protein or peptide. The spacer sequence, when present, preferably comprises a cleavage site, e.g., a proteolytic cleavage site, a chemical cleavage site, a photolytic cleavage site, a thermolytic cleavage site, or a cleavage site susceptible to cleavage in the presence of a shear force, pH change, enzymatic agent, ultrasonic or other predetermined frequency field providing energy effective for cleavage. The cleavage modality may be of any of widely varying types, it being necessary only that the cleaving step yield at least one biological molecule (as a cleavage product) that retains functional utility for its intended purpose.
- The fusion peptides of the present invention may also optionally comprise signal peptides for directing secretion of the fusion peptides from the cell, so that the fusion peptides may readily be isolated from the medium of an active culture of recombinant cells genetically modified to produce the fusion peptides. Such signal peptides are preferably cleavable from the fusion protein by enzymatic cleavage.
- Therefore in one embodiment the invention provides a fusion protein comprising a spacer sequence. In another embodiment the invention provides a fusion protein with a spacer sequence that is a proteolytic cleavage site.
- In one embodiment, the invention provides a fusion protein selected front pET17b-SD33-ELP1-90-IFNA2bSD (SEQ ID NO: 22), pET17b-SD33-ELP4-60-IFNA2bSD (SEQ ID NO: 23), pET17b-SD34-ELP1-90-IFNA2bSD (SEQ ID NO: 24), pET17b-SD34-ELP4-60-IFNA2bSD (SEQ ID NO: 25), pET17b-SD22-ELP1-90-IFNA2bSD (SEQ ID NO: 26), pET17b-SD22-ELP4-60-IFNA2bSD (SEQ ID NO: 27), pET17b-SD35-IFNA2bSD-ELP1-90 (SEQ ID NO: 28), pET17b-SD35-IFNA2bSD-ELP4-60 (SEQ ID NO: 29), pET17b-SD37-IFNA2bSD-ELP1-90 (SEQ ID NO: 30), pET17b-SD37-IFNA2bSD-ELP4-60 (SEQ ID NO: 31), pET17b-SD31-IFNA2bSD-ELP1-90 (SEQ ID NO: 32) and pET17b-SD31-IFNA2bSD-ELP4-60 (SEQ ID NO: 33).
- In another embodiment the invention provides a fusion protein selected from ELP4-60-S-S-Orexin B, ELP4-60-S-S-MMN, ELP4-60-S-S-NPY and ELP4-60-S-S-Gh.
- Yet another embodiment of the invention relates to a polynucleotide comprising a nucleotide sequence encoding a fusion protein exhibiting a phase transition, comprising:
-
- a) at least one target protein or peptide;
- b) one or more proteins comprising oligomeric repeats of a polypeptide sequence selected from SEQ ID NOs: 1-17, wherein the one or more proteins exhibits a phase transition and are joined to the at least one target protein or peptide of a);
- c) at least two residues capable of forming a disulfide bond; and
- d) optionally, a spacer sequence separating any of the phase transition protein(s) of b) from any of the target protein(s) or peptide(s) of a).
- The invention in a further aspect relates to a polynucleotide selected from pET17b-SD33-ELP1-90-IFNA2bSD (SEQ ID NO; 34), pET17b-SD33-ELP4-60-IFNA2bSD (SEQ ID NO: 35), pET17b-SD34-ELP1-90-IFNA2bSD (SEQ ID NO: 36), pET17b-SD34-ELP4-60-IFNA2bSD (SEQ ID NO: 37), pET17b-SD22-ELP1-90-IFNA2bSD (SEQ ID NO: 38), pET17b-SD22-ELP4-60-IFNA2bSD (SEQ ID NO: 39), pET17b-SD35-IFNA2bSD-ELP1-90 (SEQ ID NO: 40), pET17b-SD35-IFNA2bSD-ELP4-60 (SEQ ID NO: 41), pET17b-SD37-IFNA2bSD-ELP1-90 (SEQ ID NO: 42), pET17b-SD37-IFNA2bSD-ELP4-60 (SEQ ID NO: 43), pET17b-SD31-IFNA2bSD-ELP1-90 (SEQ ID NO: 44) and pET17b-SD31-IFNA2bSD-ELP4-60 (SEQ ID NO: 45).
- In still another embodiment the invention provides an expression vector comprising a polynucleotide encoding a fusion protein of the invention. In yet another embodiment the invention provides a host cell transformed by such an expression vector, where the host cell expresses the fusion protein.
- In a still further embodiment, the invention provides an ELP spider complex comprising two or more fusion proteins of the invention, covalently linked by at least one disulfide bond.
- The invention also provides a spider complex which includes two or more fusion proteins exhibiting a phase transition comprising:
-
- a) at least one target protein or peptide;
- b) one or more proteins comprising oligomeric repeals of a polypeptide sequence selected from SEQ ID NOs: 1-17, wherein the one or more proteins exhibits a phase transition and are joined to the at least one target protein or peptide of a);
- c) at least two residues capable of forming a disulfide bond; and
- d) optionally, a spacer sequence separating any of the phase transition protein(s) of b) from any of the target protein(s) or peptide(s) of a).
- wherein the two or more fusion proteins exhibiting a phase transition are covalently linked by at least one disulfide bond.
- The invention also provides methods of utilizing the fusion proteins and spider complexes as discussed herein.
- In one aspect the invention relates to a method of providing a purified protein of interest, comprising contacting a fusion protein comprising the protein of interest and an ELP tag, wherein the fusion protein contains at least one cleavage site that is cleavable to yield the protein of interest as a cleavage product with ELP-TEV1 that is effective to cleave said cleavage site, thereby yielding said protein of interest as a cleavage product in a cleavage product mixture comprising said ELP tag, any uncleaved fusion protein and said ELP-tagged cleavage agent and separating the protein of interest from the cleavage produce mixture by inverse phase transition.
- In another aspect the invention provides a method of enhancing proteolytic resistance of a protein or peptide moiety in an ELP-based fusion peptide, comprising provision of the ELP-based fusion peptide in an ELP spider complex form.
- Examples of spider complexes discussed herein include Orexin B/ELP and IFNa2bSD/ELP spider constructs, but are broadly applicable to a wide spectrum of other proteins and peptides, and have particular utility for proteins or peptides that are susceptible to proteolytic degradation.
- Methods of protection of target proteins or peptides by the spider construct may involve, but are not limited to: (i) slowing or stopping degradative action of proteases, (ii) decreasing or eliminating non-specific associated proteins that may make the target protein or peptide insoluble or prevent the target protein or peptide from properly folding, (iii) increasing the amount of total spider construct concentration in the cell, and/or (iv) exposure of a region of the target protein or peptide subject to proteolysis by the ELP fused to TEV protease when produced in the absence of disulfide bonds. Disulfides formed between ELP and TEV site have been tested. Spacing may be desirably adjusted for such bonding, e.g., with intra-disulfide bonds being separated by at least 2 amino acid residues, such as for example by a -Cys-Cys-moiety. Other techniques for increasing inter- and decreasing intra-disulfide bond formation can be employed.
-
FIG. 1A is a schematic representation of an ELP fusion protein including a -Cys-Cys-moiety after the ELP and before the TEV site and the peptide.FIG. 1B is a schematic representation of a corresponding spider construct, for pET17b-SD34-ELP4-60-Orexin B (as set forth below in Example 1), and transformation into a BL21 trxB-strain, allowing disulfide bond formation between the fusion proteins to take place in the cytoplasm. - The following examples are intended to illustrate, but not limit the invention.
- Fusion protein constructs of ELP4-60-Orexin B (Normal) and ELP4-60-S-S-Orexin B (Spider) were generated.
-
FIG. 2 is an SDS-PAGE gel comparison of the two fusion protein constructs. (Lane 1: ELP4-60-Orexin B or ELP4-60-S-S-Orexin B; Lane 2: +ELP1-90-TEV; Lane 3: insolubles following Tt (I); and Lane 4: solubles following Tt (S)). -
FIG. 3 shows an LC-MS analysis of Orexin B derived from ELP4-60-Orexin B (FIG. 3A ), in which the level of Orexin B was too low to detect by LC-MS, so that the theoretical location was estimated by location of Orexin B in (B) and ELP4-60-S-S-Orexin B (FIG. 3B ), 85% pure, in which the major peak contains the correct molecular weight of Orexin B and the minor peak is a proteolytic fragment of Orexin B. - The original ELP4-60-Orexin B appeared to purify well, however a substantial amount was difficult to resuspend and purify away from insoluble contaminates. Only a portion of Orexin B was cleaved following 18 hr digestion with ELP1-90-TEV. Once cleaved 50% was insoluble following final transition to eliminate uncleaved ELP4-60-Orexin D, ELP1-90-TEV and ELP4-60. The level of Orexin B was too low to analyze by LC-MS. Loading the gel with 10× more cleaved ELP4-60-Orexin B indicated proteolysis had occurred prior to or during cleavage.
- ELP4-60-S-S-Orexin B was much easier to purify away from contaminates. Complete cleavage occurred following 18 hr digestion with ELP1-90-TEV. A minor amount of Orexin B remained insoluble following the final transition to eliminate uncleaved ELP4-60-Orexin B, ELP1-90-TEV, and ELP4-60. LC-MS analysis indicated the largest peak contained the correct molecular weight Orexin B peptide and was 85% of total peaks. The minor peak was a proteolytic fragment of Orexin B.
- The fusion protein constructs of ELP4-60-Orexin B (Normal) and ELP4-60-S-S-Orexin B (Spider) were expressed in E. coli strains BL21 and trxB. The results are summarized in
FIG. 4 .FIG. 4 is an SDS-PAGE gel analysis, showing that use of a spider construct influences the amount of purification, the cleavage with ELP4-60-TEV and proteolysis. All samples in the comparison were reduced with DTT prior to loading on the SDS-gel. - It can be seen in
FIG. 4 that in both BL21 and trxB, more spider constructs (lanes lanes lanes 6, 8) did not influence the amount of spider construct purified in the absence of DTT (lanes 2,4). Cleavage with ELP1-90-TEV was not complete when spider constructs were produced in BL21* and purified in the absence of DTT (lane 2). Spider constructs were degraded when produced in BL21* and exposed to OTT during purification (lane 6). The presence of disulfide bonds during expression produced more cleaved Orexin B (lanes 4,8). -
FIG. 5 is an SDS-PAGE gel analysis of ELP-spider constructs of three peptides: MMN, NPY and Gh. For each peptide, the lanes are as follows: Lane 1: ELP4-60-S-S-peptide (reduced with DTT): Lane 2: +ELP1-90-TEV; Lane 3: insolubles following T, (I); and Lane 4: solubles following Tt (S)). - Comparison of spider constructs and normal constructs were as follows:
- MMN peptide: ELP4-60-MMN (58 mg/liter) was not difficult to purify and resulted in 6 mg/liter MMN. ELP4-60-S-S-MMN (180 mg/liter) was not difficult to purify and resulted in 13 mg/liter MMN. It can be seen that use of spider constructs increased the amount of MMN purified.
- NPY peptide: ELP4-60-NPY (62 mg/liter) was not difficult to purify and resulted in 7 mg/liter NPY. ELP4-60-S-S-NPY (222 mg/liter) was not difficult to purify and resulted in 20 mg/liter NPY. It can be seen that use of spider constructs increased the amount of NPY purified, it being noted that NPY does not stain well.
- Gh peptide: ELP4-60-GH was difficult to purify and resulted in 0 mg/liter Gh. ELP4-60-S-S-GH was not as difficult to purify and resulted in
approx 2 mg/liter Gh. A spider construct only partially eliminated Gh degradation. The amount of non-degraded Gh was too low for LC-MS determination. These factors were exacerbated by ELP4-60-Gh transitioning at room temperature (RT): -
- a. ELP4-60-GH had to be diluted 10 fold compared to MMN and NPY to prevent transitioning at RT during cleavage with ELP1-90-TEV.
- b. The 10-fold dilution made the final concentration of GH too low for LC-MS analysis.
- c. Incomplete cleavage with ELP1-90-TEV may be due to a fraction of ELP4-60-GH that continued to transition at RT even after a 10 fold dilution.
- d. The low transition temperature of ELP4-60-GH may also be due to contaminants that could not be eliminated through 3 temperature transitions.
- It can be seen that use of spider constructs increased the amount of Gh purified.
- With all three peptides (MMN, NPY and Gh), use of spider constructs may also act to buffer the possible toxic effect of the peptide and allow more ELP-peptide to be produced per cell, in addition to decreasing protcolysis.
-
FIG. 6 shows LC-MS analysis for non-spider peptides. MMN from ELP4-60-S-S-MMN: 99.3% pure 13 mg/L (FIG. 6A ) and NPY from ELP4-60-S-S-NPY: 98.1% pure 20 mg/L (FIG. 6B ). -
FIG. 7 shows LC-MS analysis for pro-CT from ELP1-90-pro-CT: 98.0% pure (FIG. 7A ) and Leptin from ELP1-90-Leptin: 85% pure (FIG. 7B ). - SD 35 forward and reverse oligos were annealed, forming 5′ XhoI and 3′ StyI overhangs:
-
SD35 forward oligo: (SEQ ID NO: 46) TCGAGAACCTGTATTTCCAGGGCGGGTGCTGCGGC SD35 reverse oligo: (SEQ ID NO: 47) CTTGGCCGCAGCAGCCGCCCTGGAAATACAGGTTC Annealed oligos: (SEQ ID NO: 48) L E N L Y F Q G G C C G Q G cTCGAGAACCTGTATTTCCAGGGCGGGTGCTGCGGCcaagg (SEQ ID NO: 49) gagctCTTGGACATAAAGGTCCCGCCCACGACGCCGGTTCc XhoI StyI - The annealed SD35 oligos were ligated into pUC19-SD31-ELP, digested with XhoI and StyI and 5′ dephosphorylated with CIP to create pUC19-SD35-ELP. The pUC19-SD35-ELP XbaI-EcoRI fragment containing SD35-ELP was subcloned into pET17b, digested with XbaI and EcoRI and 5′ dephosphorylated with CIP.
- In this spider construct, the Cys-Cys is placed following the TEV cleavage site at the amino terminus of the ELP to create a protein/peptide-ELP orientation.
- Individual spider constructs pET17b-SD35-ELP1-90 (SEQ ID NO: 50) and pET17b-SD35-ELP4-60 (SEQ ID NO: 51) were created.
- SD37 forward and reverse oligos were annealed, forming BglI and NheI overhangs:
-
SD37 forward oligo: TGGCCTTGCTGCTGATAAG (SEQ ID NO: 52) SD37 reverse oligo: CTAGCTTATCAGCAGCAAGGCCAGCC (SEQ ID NO: 53) Annealed oligos: P G W P C C * * A S (SEQ ID NO: 54) gccgggcTGGCCTTGCTGCTGATAAGctagc cggcCCGACCGGAACGACGACTATTCGATCg (SEQ ID NO: 55) BglI NheI - The annealed SD37 oligos were ligated into pET17b-SD31-ELP, digested with BglI and NheI and 5′ dephosphorylated with CIP to create pET17b-SD37-ELP.
- In this spider construct, the Cys-Cys is placed at the carboxyl terminus of the ELP to create a protein/peptide-ELP orientation.
- Individual spider constructs pET17b-SD37-ELP1-90 (SEQ ID NO: 56) and pET17b-SD37-ELP4-60 (SEQ ID NO: 57) were created.
- SD33 forward and reverse oligos were annealed to form XbaI and NcoI overhangs: SD33 forward oligo:
-
SD33 forward oligo: CTAGAAATAATTTTGTTTAACTTTAAGAAGGAGATATACCATGTGCTGCCC (SEQ ID NO: 58) SD33 reverse oligo CATGGGGCAGCACATGGTATATCTCCTTCTTAAAGTTAAACAAAATTATTT (SEQ ID NO: 59) Annealed oligos: M C C P M G (SEQ ID NO: 60) tCTAGAAATAATTTTGTTTAACTTTAAGAAGGAGATATACCATGTGCTGCCCcatgg agatcTTTATTAAAACAAATTGAAATTCTTCCTCTATATGGTACACGACGGGGTACc (SEQ ID NO: 61) XbaI NcoI - The annealed SD33 oligos were ligated into pET17b-SD22-ELP digested with XbaI and NcoI and 5′ dephosphorylated with CIP to create pET17b-SD33-ELP.
- In this spider construct, the Cys-Cys is placed at the amino terminus of the ELP to create an ELP-protein/peptide orientation.
- Individual spider constructs pET17b-SD33-ELP1-90 (SEQ ID NO: 62) and pET176-SD33-ELP4-60 (SEQ ID NO: 63) were created.
- SD34 forward and reverse oligos were annealed to form BglI and EcoRV overhangs:
-
SD34 forward oligo: TGCCCGTGCTGCAGCAGCGGTGAT (SEQ ID NO: 64) SD34 reverse oligo: ATCACCGCTGCTGCAGCACGGCCAGCC (SEQ ID NO: 65) - The annealed SD34 oligos were ligated into pET17b-SD22-ELP digested with BglI and EcoRV and 3′ dephosphorylated to create pET17b-SD34-ELP.
- In this spider construct, the Cys-Cys is placed at the carboxyl terminus of the ELP to create an ELP-protein/peptide orientation.
- Individual spider constructs pET17b-SD34-ELP1-90 (SEQ ID NO: 68) and pET17b-SD34-ELP4-60 (SEQ ID NO: 69) were created.
- PCR amplification was used to generate the following DNA fragments from a Human cDNA library containing IFNA2b:
- IFNa2bSD NdeI-XhoI containing STOP codon:
-
(SEQ ID NO: 70) CATAT 5150 GTGTGATCTGCCTCAAACCCACAGCCTGGGTAGCAGGAGGACCTTGATGC 5200 TCCTGGCACAGATGAGGAGAATCTCTCTTTTCTCCTGCTTGAAGGACAGA 5250 CATGACTTTGGATTTCCCCAGGAGGAGTTTGGCAACCAGTTCCAAAAGGC 5300 TGAAACCATCCCTGTCCTCCATGAGATGATCCAGCAGATCTTCAATCTCT 5350 TCAGCACAAAGGACTCATCTGCTGCTTGGGATGAGACCCTCCTAGACAAA 5400 TTCTACACTGAACTCTACCAGCAGCTGAATGACCTGGAAGCCTGTGTGAT 5450 ACAGGGGGTGGGGGTGACAGAGACTCCCCTGATGAAGGAGGACTCCATTC 5500 TGGCTGTGAGGAAATACTTCCAAAGAATCACTCTCTATCTGAAAGAGAAG 5550 AAATACAGCCCTTGTGCCTGGGAGGTTGTCAGAGCAGAAATCATGAGATC 5000 TTTTTCTTTGTCAACAAACTTGCAAGAAAGTTTAAGAAGTAAGGAATAACTCGAG - IFNa2bSD NdeI-XhoI, not containing STOP codon:
-
(SEQ ID NO: 71) CATAT 5150 GTGTGATCTGCCTCAAACCCACAGCCTGGGTAGCAGGAGGACCTTGATGC 5200 TCCTGGCACAGATGAGGAGAATCTCTCTTTTCTCCTGCTTGAAGGACAGA 5250 CATGACTTTGGATTTCCCCAGGAGGAGTTTGGCAACCAGTTCCAAAAGGC 5300 TGAAACCATCCCTGTCCTCCATGAGATGATCCAGCAGATCTTCAATCTCT 5350 TCAGCACAAAGGACTCATCTGCTGCTTGGGATGAGACCCTCCTAGACAAA 5400 TTCTACACTGAACTCTACCAGCAGCTGAATGACCTGGAAGCCTGTGTGAT 5450 ACAGGGGGTGGGGGTGACAGAGACTCCCCTGATGAAGGAGGACTCCATTC 5500 TGGCTGTGAGGAAATACTTCCAAAGAATCACTCTCTATCTGAAAGAGAAG 5550 AAATACAGCCCTTGTGCCTGGGAGGTTGTCAGAGCAGAAATCATGAGATC 5600 TTTTTCTTTGTCAACAAACTTGCAAGAAAGTTTAAGAAGTAAGGAACTCGAG - IFNA2bSD with stop codon was ligated into pET17b-SD33-ELP, pET17b-SD34-ELP and pET17b-SD22-ELP digested with NdeI and partially digested with XhoI and 5′ dephosphorylated with CIP to create pET17b-SD33-ELP-IFNA2bSD, pET17b-SD34-ELP-IFNA2bSD and pET17b-SD22-ELP-IFNA2bSD respectively.
- IFNA2bSD without stop codon was ligated into pET17b-SD35-ELP, pET17b-SD37-ELP and pET17b-SD31-ELP digested with NdeI and partially digested with XhoI and 5′ dephosphorylated with CIP to create pET17b-SD35-IFNA2bSD-ELP, pET17b-SD37-IFNA2bSD-ELP and pET17b-SD31-IFNA2bSD-ELP respectively.
- Resulting spider constructs created included pET17b-SD33-ELP1-90-IFNA2bSD (SEQ ID NO: 34), pET17b-SD33-ELP4-60-IFNA2bSD (SEQ ID NO: 35), pET17b-SD34-ELP1-90-IFNA2bSD (SEQ ID NO: 36), pET17b-SD34-ELP4-60-IFNA2bSD (SEQ ID NO: 37), pET17b-SD22-ELP1-90-IFNA2bSD (SEQ ID NO: 38), pET17b-SD22-ELP4-60-IFNA2bSD (SEQ ID NO: 39), pET17b-SD35-IFNA2bSD-ELP1-90 (SEQ ID NO: 40), pET17b-SD35-IFNA2bSD-ELP4-60 (SEQ ID NO: 41), pET17b-SD37-IFNA2bSD-ELP1-90 (SEQ ID NO: 42), pET17b-SD37-IFNA2bSD-ELP4-60 (SEQ ID NO: 43), pET17b-SD31-IFNA2bSD-ELP1-90 (SEQ ID NO: 44) and pET17b-SD31-IFNA2bSD-ELP4-60 (SEQ ID NO: 45). Protein translations of these spider constructs are SEQ ID NOs: 22-33.
- E. coli strain BL21trxB-(DE3) F-ompT hsdSB(rB-mB-) gal dcm trxB15::kan (DE3) (Novagen) containing the ELP/protein construct was inoculated into 5 ml TB supplemented with 100 mM proline, 4% glycerol, phosphate buffer and ampicillin. Cultures were grown for 5 hrs at 37° C. before being transferred at 1:100 dilutions into the same media and grown for 43 hrs at 25° C. unless otherwise noted. The cultures were harvested and resuspended in 10 ml/gram wet weight in the following buffer: 50 mM Tris pH7.0, 1 mM EDTA. Cells were lysed by ultrasonic disruption on ice for 3 minutes, consisting of 15 second bursts at 60 W separated by 15 second cooling down intervals (Sonicate). Cell debris was removed by centrifugation at 20,000 g at 4° C. for 30 minutes. The insoluble pellet was resuspended in the original buffer and volume (Pellet). Soluble material comprised lysate. Inverse temperature transition was induced by adding NaCl to a final concentration of 1.0-2.0 M to the lysate at 25° C., followed by centrifugation at 20,000 g for 15 minutes at 25° C. The resulting pellet contained ELP/protein fusions. The pellet was resuspended in the original volume ice-cold ml buffer, centrifuged at 20,000 g, 4° C. for 15 minutes to remove non-specific insoluble proteins (T,1). The temperature transition cycle was repeated at one additional time to increase the purity of the ELP/protein fusions and reduce the final volume (T,2).
- The above purification was performed for spider constructs created in Example 8.
- Initially the spider constructs were tested after growth for 15 hours at 25° C. and compared to non-spider protein constructs containing IFNa2bSD to determine which were most likely to produce soluble protein. Results are shown in
FIG. 8 . - Selected constructs from
FIG. 8 were re-expressed for 48 hours at 25° C. and purified using two inverse phase transitions as set forth above. The results of the re-expression are shown inFIG. 9 . It can be seen that spider constructs clearly express more initial fusion protein than their non-spider counterparts. - In order to purify cleaved protein from ELP, uncleaved protein and protease, the present invention provides an optimized purification of ELP TEV protease (ELP-TEV1) for inverse phase transition removal once cleavage has been completed. ELP1-90-TEV1 was added at a 1:100 dilution of the protein concentration in T,2 and supplemented with 1 mM DTT (T,2+ELP1-90-TEV1). Cleavage was allowed to proceed for 15 hrs at 4° C. Free protein was separated front free ELP and uncleaved ELP/protein fusions by adding 1M NaCl at 25° C., followed by centrifugation at 25° C. Salt transitioned material (ELP and ELP fusions) were resuspended in cold buffer (Insoluble). Salt soluble protein was transferred to a new tube (Soluble). Results can be seen in
FIG. 10 . Although TEV cleavage was incomplete when performed at 4° C. rather then 25° C., the spider construct not only expressed more soluble ELP fusion protein but also produced 3-4 times more soluble IFNa2bSD following cleavage with ELP1-90-TEV1 and a final transition to separate IFNa2bSD from free ELP, ELP fusions and ELP1-90-TEV1. - Resulting cleaved proteins were as follows:
-
(SEQ ID NO: 72) pET17b-SD33-IFINA2bSD-ELP1-90, cleaved with TEV: GAHMCDLPQTHSLGSRRILMLLAQMRRISLFSCLKDRHDFGFPQEEFG NQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQL NDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAW EVVRAEIMRSFSLSTNLQESLRSKE pET17b-SD33-IFNA2bSD-ELP4-60, cleaved with TEV: (SEQ ID NO: 73) GAHMCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFG NQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQL NDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAW EVVRAEIMRSFSLSTNLQESLRSKE pET17b-SD34-IFNA2bSD-ELP1-90, cleaved with TEV: (SEQ ID NO: 74) GAHMCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFG NQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQL NDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAW EVVRAEIMRSFSLSTNLQESLRSKE pET17b-SD34-IFNA2bSD-ELP4-60, cleaved with TEV: (SEQ ID NO: 75) GAHMCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFG NQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQL NDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAW EVVRAEIMRSFSLSTNLQESLRSKE pET17b-SD22-ELP1-90-IFNA2bSD, cleaved with TEV: (SEQ ID NO: 76) GAHMCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFG NQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQL NDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAW EVVRAEIMRSFSLSTNLQESLRSKE pET17b-SD22-ELP4-60-IFNA2bSD, cleaved with TEV: (SEQ ID NO: 77) GAHMCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFG NQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQL NDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAW EVVRAEIMRSFSLSTNLQESLRSKE pET17b-SD35-IFNA2bSD-ELP1-90, cleaved with TEV: (SEQ ID NO: 78) MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDPGFPQEEFGNQF QKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDL EACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVV RAEIMRSFSLSTNLQESLRSKELENLYFQ pET17b-SD35-IFNA2bSD-ELP4-60, cleaved with TEV: (SEQ ID NO: 79) MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQF QKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDL EACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVV RAEIMRSFSLSTNLQESLRSKELENLYFQ pET17b-SD37-IFNA2bSD-ELP1-90, cleaved with TEV: (SEQ ID NO: 80) MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQF QKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDL EACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVV RAEIMRSFSLSTNLQESLRSKELENLYFQ pET17b-SD37-IFNA2bSD-ELP4-60 cleaved with TEV: (SEQ ID NO: 81) MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQF QKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDL EACVIQCVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVV RAEIMRSFSLSTNLQESLRSKELENLYFQ pET17b-SD31-IFNA2bSD-ELP4-60, cleaved with TEV: (SEQ ID NO: 82) MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQF QKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDL EACVIQGVCVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVV RAEIMRSFSLSTNLQESLRSKELENLYFQ pET17b-SD31-IFNA2bSD-ELP4-60, cleaved with TEV: (SEQ ID NO: 83) MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQF QKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDL EACVIQGVCVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVV RAEIMRSFSLSTNLQESLRSKELENLYFQ - While the invention has been has been described herein in reference to specific aspects, features and illustrative embodiments of the invention, it will be appreciated that the utility of the invention is not thus limited, but rather extends to and encompasses numerous other variations, modifications and alternative embodiments, as will suggest themselves to those of ordinary skill in the field of the present invention, based on the disclosure herein. Correspondingly, the invention as hereinafter claimed is intended to be broadly construed and interpreted, as including all such variations, modifications and alternative embodiments, within its spirit and scope.
Claims (22)
1. A fusion protein exhibiting a phase transition, comprising:
a) at least one target protein or peptide;
b) one or more proteins comprising oligomeric repeats of a polypeptide sequence selected front SEQ ID NOs: 1-17, wherein the one or more proteins exhibits a phase transition and are joined to the at least one target protein or peptide of a);
c) at least two residues capable of forming a disulfide bond; and
d) optionally, a spacer sequence separating any of the phase transition protein(s) of b) from any of the target protein(s) or peptide(s) of a).
2. The fusion protein of claim 1 , wherein the target protein is IFNa2b.
3. The fusion protein of claim 1 , wherein the target peptide is Orexin-B, MMN, NPY or Gh.
4. The fusion protein of claim 1 , wherein the phase transition protein is selected from the group consisting of: SEQ ID NOs: 1, 2, 8, 9, 10, 11, 12, 13, 14, 15, 16, and 17.
5. The fusion protein of claim 1 , wherein the phase transition protein is selected from the group consisting of: SEQ ID NOs: 1, 2, 9, 10, 11, 12, 13, 14, 15, 16, and 17.
6. The fusion protein of claim 1 , wherein the phase transition protein is selected from the group consisting of: ELP1-90, ELP1-180, ELP2-64, ELP2-128, ELP3-72, ELP3-144, ELP4-60, ELP4-120, ELP5-15, ELP5.30, ELP5-60, ELP6-15, ELP6-30, ELP6-60, ELP7-13, ELP7-30 and ELP7-60.
7. The fusion protein of claim 1 , wherein the phase transition is mediatable by an agency comprising one or more of: changing temperature; changing pH; addition of solutes and/or solvents; side chain ionization or chemical modification; and changing pressure.
8. The fusion protein of claim 1 , wherein the at least two residues capable of forming a disulfide bond comprise cysteine.
9. The fusion protein of claim 1 , comprising said spacer sequence.
10. The fusion protein of claim 9 , wherein said spacer sequence comprises a proteolytic cleavage site.
11. The fusion protein of claim 1 , selected from pET17b-SD33-ELP1-90-IFNA2bSD (SEQ ID NO: 22), pET17b-SD33-ELP4-60-IFNA2bSD (SEQ ID NO: 23), pET17b-SD34-ELP1-90-IFNA2bSD (SEQ ID NO: 24), pET17b-SD34-ELP4-60-IFNA2bSD (SEQ ID NO: 25), pET17b-SD22-ELP1-90-IFNA2bSD (SEQ ID NO: 26), pET17b-SD22-ELP4-60-IFNA2bSD (SEQ ID NO: 27), pET17b-SD35-IFNA2bSD-ELP1-90 (SEQ ID NO: 28), pET17b-SD35-IFNA2bSD-ELP4-60 (SEQ ID NO: 29), pET17b-SD37-IFNA2bSD-ELP1-90 (SEQ ID NO: 30), pET17b-SD37-IFNA2bSD-ELP4-60 (SEQ ID NO: 31), pET17b-SD31-IFNA2bSD-ELP1-90 (SEQ ID NO: 32) and pET17b-SD31-IFNA2bSD-ELP4-60 (SEQ ID NO: 33).
12. The fusion protein of claim 1 , selected from ELP4-60-S-S-Orexin B, ELP4-60-S-S-MMN, ELP4-60-S-S-NPY or ELP4-60-S-S-Gh.
13. A polynucleotide comprising a nucleotide sequence encoding the fusion protein of claim 1 .
14. The polynucleotide of claim 13 , selected from pET17b-SD33-ELP1-90-IFNA2bSD (SEQ ID NO: 34), pET17b-SD33-ELP4-60-IFNA2bSD (SEQ ID NO: 35), pET17b-SD34-ELP1-90-IFNA2bSD (SEQ ID NO: 36), pET17b-SD34-ELP4-60-IFNA2bSD (SEQ ID NO: 37), pET17b-SD22-ELP1-90-IFNA2bSD (SEQ ID NO: 38), pET17b-SD22-ELP4-60-IFNA2bSD (SEQ ID NO: 39), pET17b-SD35-IFNA2bSD-ELP1-90 (SEQ ID NO: 40), pET17b-SD35-IFNA2bSD-ELP4-60 (SEQ ID NO: 41), pET17b-SD37-IFNA2bSD-ELP1-90 (SEQ ID NO: 42), pET17b-SD37-IFNA2bSD-ELP4-60 (SEQ ID NO: 43), pET17b-SD31-IFNA2bSD-ELP1-90 (SEQ ID NO: 44) and pET17b-SD31-IFNA2bSD-ELP4-60 (SEQ ID NO: 45).
15. An expression vector comprising the polynucleotide of claim 13 .
16. A host cell transformed by the vector of claim 15 , wherein said host cell expresses the fusion protein.
17. An ELP spider complex comprising two or more fusion proteins of claim 1 , linked by at least one disulfide bond.
18. An ELP spider complex comprising two or more fusion proteins exhibiting a phase transition, comprising:
a) at least one target protein or peptide;
b) one or more proteins comprising oligomeric repeats of a polypeptide sequence selected from SEQ ID NOs: 1-17, wherein the one or more proteins exhibits a phase transition and are joined to the at least one target protein or peptide of a);
c) at least two residues capable of forming a disulfide bond; and
d) optionally, a spacer sequence separating any of the phase transition protein(s) of h) from any of the target protein(s) or peptide(s) of a).
wherein the two or more fusion proteins exhibiting a phase transition are linked by at least one disulfide bond.
19. A method of providing a purified protein of interest, comprising:
contacting a fusion protein comprising the protein of interest and an ELP tag, wherein the fusion protein contains at least one cleavage site that is cleavable to yield the protein of interest as a cleavage product with ELP-TEV1 that is effective to cleave said cleavage site, thereby yielding said protein of interest as a cleavage product in a cleavage product mixture comprising said ELP tag, any uncleaved fusion protein and said ELP-tagged cleavage agent; and
separating the protein of interest from the cleavage product mixture by inverse phase transition.
20. The method of claim 19 , wherein the fusion protein comprises a spider construct.
21. A method of enhancing proteolytic resistance of a protein or peptide moiety in an ELP-based fusion peptide, comprising provision of the ELP-based fusion peptide in an ELP spider complex.
22. An ELP fusion protein spider complex.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US12/712,615 US20110082283A1 (en) | 2006-01-04 | 2010-02-25 | Multimeric elp fusion constructs |
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US75626906P | 2006-01-04 | 2006-01-04 | |
US11/620,034 US7709227B2 (en) | 2006-01-04 | 2007-01-04 | Multimeric ELP fusion constructs |
US12/712,615 US20110082283A1 (en) | 2006-01-04 | 2010-02-25 | Multimeric elp fusion constructs |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/620,034 Continuation US7709227B2 (en) | 2006-01-04 | 2007-01-04 | Multimeric ELP fusion constructs |
Publications (1)
Publication Number | Publication Date |
---|---|
US20110082283A1 true US20110082283A1 (en) | 2011-04-07 |
Family
ID=39609209
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/620,034 Active 2027-08-18 US7709227B2 (en) | 2006-01-04 | 2007-01-04 | Multimeric ELP fusion constructs |
US12/712,615 Abandoned US20110082283A1 (en) | 2006-01-04 | 2010-02-25 | Multimeric elp fusion constructs |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/620,034 Active 2027-08-18 US7709227B2 (en) | 2006-01-04 | 2007-01-04 | Multimeric ELP fusion constructs |
Country Status (3)
Country | Link |
---|---|
US (2) | US7709227B2 (en) |
EP (1) | EP2115156A4 (en) |
WO (1) | WO2008085543A2 (en) |
Cited By (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2020028806A1 (en) * | 2018-08-02 | 2020-02-06 | Duke University | Dual agonist fusion proteins |
US11135301B2 (en) | 2016-09-14 | 2021-10-05 | Duke University | Triblock polypeptide-based nanoparticles for the delivery of hydrophilic drugs |
US11155584B2 (en) | 2016-09-23 | 2021-10-26 | Duke University | Unstructured non-repetitive polypeptides having LCST behavior |
US11458205B2 (en) | 2015-08-04 | 2022-10-04 | Duke University | Genetically encoded intrinsically disordered stealth polymers for delivery and methods of using same |
US11467156B2 (en) | 2016-06-01 | 2022-10-11 | Duke University | Nonfouling biosensors |
US11512314B2 (en) | 2019-07-12 | 2022-11-29 | Duke University | Amphiphilic polynucleotides |
US11554097B2 (en) | 2017-05-15 | 2023-01-17 | Duke University | Recombinant production of hybrid lipid-biopolymer materials that self-assemble and encapsulate agents |
US11648200B2 (en) | 2017-01-12 | 2023-05-16 | Duke University | Genetically encoded lipid-polypeptide hybrid biomaterials that exhibit temperature triggered hierarchical self-assembly |
US11680083B2 (en) | 2017-06-30 | 2023-06-20 | Duke University | Order and disorder as a design principle for stimuli-responsive biopolymer networks |
US11752213B2 (en) | 2015-12-21 | 2023-09-12 | Duke University | Surfaces having reduced non-specific binding and antigenicity |
Families Citing this family (15)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20130172274A1 (en) | 2005-12-20 | 2013-07-04 | Duke University | Methods and compositions for delivering active agents with enhanced pharmacological properties |
US8178495B2 (en) | 2008-06-27 | 2012-05-15 | Duke University | Therapeutic agents comprising a GLP-1 receptor agonist and elastin-like peptide |
EP2437769B1 (en) | 2009-06-03 | 2019-09-25 | Basf Se | Recombinant production of peptides |
WO2012109624A2 (en) * | 2011-02-11 | 2012-08-16 | Zyngenia, Inc. | Monovalent and multivalent multispecific complexes and uses thereof |
EP2717902B1 (en) | 2011-06-06 | 2018-01-24 | Phasebio Pharmaceuticals, Inc. | Use of modified vasoactive intestinal peptides in the treatment of hypertension |
WO2013028989A1 (en) * | 2011-08-24 | 2013-02-28 | Phasebio Pharmaceuticals, Inc. | Formulations of active agents for sustained release |
ES2818824T3 (en) | 2014-05-08 | 2021-04-14 | Phasebio Pharmaceuticals Inc | Compositions comprising a VIP-ELP fusion protein for use in the treatment of cystic fibrosis |
US11564991B2 (en) | 2014-11-12 | 2023-01-31 | University Of Mississippi Medical Center | Molecular-size of elastin-like polypeptide delivery system for therapeutics modulates intrarenal deposition and bioavailability |
WO2016077618A1 (en) * | 2014-11-12 | 2016-05-19 | University Of Mississippi Medical Center | Kidney-targeted drug delivery systems |
WO2016081884A2 (en) | 2014-11-21 | 2016-05-26 | Phasebio Pharmaceuticals, Inc. | Elp fusion proteins for controlled and sustained release |
CA2976038A1 (en) | 2015-02-09 | 2016-08-18 | Phasebio Pharmaceuticals, Inc. | Methods and compositions for treating muscle disease and disorders |
AU2017261216B2 (en) | 2016-05-06 | 2023-08-03 | Immunoforge Co., Ltd. | ELP fusion proteins for controlled and sustained release |
WO2020048996A1 (en) | 2018-09-06 | 2020-03-12 | ETH Zürich | Self-assembling globular proteins and uses thereof |
US11248038B2 (en) | 2019-03-29 | 2022-02-15 | University Of Mississippi Medical Center | Molecular-size of elastin-like polypeptide delivery system for therapeutics modulates intrarenal deposition and bioavailability |
CN111603551B (en) * | 2020-04-16 | 2022-04-22 | 北京大学 | Application of fusion protein IFN-ELP (IFN-ELP) (V) in preparation of medicine for preventing or treating glioblastoma |
Family Cites Families (54)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4474851A (en) * | 1981-10-02 | 1984-10-02 | The University Of Alabama In Birmingham | Elastomeric composite material comprising a polypeptide |
US4752638A (en) * | 1983-11-10 | 1988-06-21 | Genetic Systems Corporation | Synthesis and use of polymers containing integral binding-pair members |
US4749647A (en) * | 1984-06-22 | 1988-06-07 | Genetic Systems Corporation | Polymerization-induced separation assay using recognition pairs |
US5028419A (en) * | 1984-11-26 | 1991-07-02 | Repligen Corporation | Use of thioredoxin, thioredoxin-derived, or thioredoxin-like dithiol peptides in hair care preparations |
US4783523A (en) * | 1986-08-27 | 1988-11-08 | Urry Dan W | Temperature correlated force and structure development of elastin polytetrapeptides and polypentapeptides |
US4870055A (en) * | 1986-04-17 | 1989-09-26 | University Of Alabama At Birmingham | Segmented polypeptide bioelastomers to modulate elastic modulus |
US4898926A (en) * | 1987-06-15 | 1990-02-06 | The University Of Alabama At Birmingham/Research Foundation | Bioelastomer containing tetra/penta-peptide units |
US5496712A (en) * | 1990-11-06 | 1996-03-05 | Protein Polymer | High molecular weight collagen-like protein polymers |
US5770697A (en) * | 1986-11-04 | 1998-06-23 | Protein Polymer Technologies, Inc. | Peptides comprising repetitive units of amino acids and DNA sequences encoding the same |
US5830713A (en) * | 1986-11-04 | 1998-11-03 | Protein Polymer Technologies, Inc. | Methods for preparing synthetic repetitive DNA |
US5773249A (en) * | 1986-11-04 | 1998-06-30 | Protein Polymer Technologies, Inc. | High molecular weight collagen-like protein polymers |
US5641648A (en) * | 1986-11-04 | 1997-06-24 | Protein Polymer Technologies, Inc. | Methods for preparing synthetic repetitive DNA |
US5243038A (en) * | 1986-11-04 | 1993-09-07 | Protein Polymer Technologies, Inc. | Construction of synthetic DNA and its use in large polypeptide synthesis |
US6018030A (en) * | 1986-11-04 | 2000-01-25 | Protein Polymer Technologies, Inc. | Peptides comprising repetitive units of amino acids and DNA sequences encoding the same |
US5514581A (en) * | 1986-11-04 | 1996-05-07 | Protein Polymer Technologies, Inc. | Functional recombinantly prepared synthetic protein polymer |
US6184348B1 (en) * | 1986-11-04 | 2001-02-06 | Protein Polymer Technologies | Functional recombinantly prepared synthetic protein polymer |
US5606019A (en) * | 1987-10-29 | 1997-02-25 | Protien Polymer Technologies, Inc. | Synthetic protein as implantables |
US5143854A (en) * | 1989-06-07 | 1992-09-01 | Affymax Technologies N.V. | Large scale photolithographic solid phase synthesis of polypeptides and receptor binding screening thereof |
US5633076A (en) * | 1989-12-01 | 1997-05-27 | Pharming Bv | Method of producing a transgenic bovine or transgenic bovine embryo |
ATE114458T1 (en) * | 1990-03-27 | 1994-12-15 | Bioelastics Res Ltd | BIOELASTOMERIC DRUG DELIVERY SYSTEM. |
US5235041A (en) * | 1990-12-28 | 1993-08-10 | Protein Polymer Technologies, Inc. | Purification of structurally ordered recombinant protein polymers |
US5646016A (en) * | 1991-02-06 | 1997-07-08 | Genetics Institute, Inc. | Peptide and protein fusions to thioredoxin, thioredoxin-like molecules, and modified thioredoxin-like molecules |
US5952034A (en) * | 1991-10-12 | 1999-09-14 | The Regents Of The University Of California | Increasing the digestibility of food proteins by thioredoxin reduction |
US5792506A (en) * | 1991-10-12 | 1998-08-11 | The Regents Of The University Of California | Neutralization of food allergens by thioredoxin |
US5288514A (en) * | 1992-09-14 | 1994-02-22 | The Regents Of The University Of California | Solid phase and combinatorial synthesis of benzodiazepine compounds on a solid support |
US5900405A (en) * | 1994-01-24 | 1999-05-04 | Bioelastics Research, Ltd. | Polymers responsive to electrical energy |
US5527610A (en) * | 1994-05-20 | 1996-06-18 | The Uab Research Foundation | Elastomeric polypeptide matrices for preventing adhesion of biological materials |
US5972406A (en) * | 1995-04-14 | 1999-10-26 | Bioelastics Research Ltd. | Bioelastomers suitable as food product additives |
US6004782A (en) * | 1995-04-14 | 1999-12-21 | Bioelastics Research Ltd. | Hyperexpression of bioelastic polypeptides |
US5854387A (en) | 1995-04-14 | 1998-12-29 | Bioelastics Research, Ltd. | Simple method for the purification of a bioelastic polymer |
US5624711A (en) * | 1995-04-27 | 1997-04-29 | Affymax Technologies, N.V. | Derivatization of solid supports and methods for oligomer synthesis |
WO1997009068A2 (en) * | 1995-09-01 | 1997-03-13 | University Of Washington | Interactive molecular conjugates |
US5702717A (en) * | 1995-10-25 | 1997-12-30 | Macromed, Inc. | Thermosensitive biodegradable polymers based on poly(ether-ester)block copolymers |
US5985261A (en) * | 1996-06-28 | 1999-11-16 | National Jewish Medical And Research Center | Use of thioredoxin-like molecules for induction of MnSOD to treat oxidative damage |
US5816259A (en) * | 1997-01-13 | 1998-10-06 | Rose; Samuel | Method for the diagnosis and treatment of cancer by the accumulation of radioactive precipitates in targeted cells |
US5919657A (en) * | 1997-04-09 | 1999-07-06 | Incyte Pharmaceuticals, Inc. | Nucleic acids encoding human thioredoxin protein; related reagents |
CA2319558A1 (en) * | 1998-02-27 | 1999-09-02 | Bioelastics Research, Ltd. | Injectable implants for tissue augmentation and restoration |
US6153655A (en) * | 1998-04-17 | 2000-11-28 | Enzon, Inc. | Terminally-branched polymeric linkers and polymeric conjugates containing the same |
US6200598B1 (en) * | 1998-06-18 | 2001-03-13 | Duke University | Temperature-sensitive liposomal formulation |
US6406921B1 (en) * | 1998-07-14 | 2002-06-18 | Zyomyx, Incorporated | Protein arrays for high-throughput screening |
WO2000056774A1 (en) | 1999-03-19 | 2000-09-28 | Duke University | Methods of using bioelastomers |
US6235264B1 (en) | 1999-12-01 | 2001-05-22 | General Electric Company | Medical imaging method for characterizing tumor angiogenesis using polymeric contrast agents |
US7833992B2 (en) | 2001-05-18 | 2010-11-16 | Merck Sharpe & Dohme | Conjugates and compositions for cellular delivery |
US6852834B2 (en) * | 2000-03-20 | 2005-02-08 | Ashutosh Chilkoti | Fusion peptides isolatable by phase transition |
US20050255554A1 (en) * | 2000-03-20 | 2005-11-17 | Ashutosh Chilkoti | Fusion peptides isolatable by phase transition |
US6637521B2 (en) * | 2001-07-11 | 2003-10-28 | Hilti Aktiengesellschaft | Earth borer |
DE10155862A1 (en) | 2001-11-14 | 2003-05-28 | Ipk Inst Fuer Pflanzengenetik | Production of recombinant antibodies by fusion with elastin-like peptides |
MXPA05012201A (en) * | 2003-05-14 | 2006-02-10 | Dow Corning | Repeat sequence protein polymer active agent conjugates, methods and uses. |
WO2006001806A2 (en) | 2004-06-15 | 2006-01-05 | Duke University | Method for non-invasive thermometry using elastin-like polypeptide conjugates |
US20080312156A1 (en) | 2005-01-18 | 2008-12-18 | Duke University | In-Situ Crosslinkable Elastin-Like Polypeptides for Defect Filling in Cartilaginous Tissue Repair |
WO2006110292A2 (en) | 2005-03-25 | 2006-10-19 | The Regents Of The University Of California | Temperature-triggered immobilization and purification of antibodies |
KR101446503B1 (en) * | 2005-06-24 | 2014-10-06 | 듀크 유니버시티 | Direct drug delivery system based on thermally responsive biopolymers |
CA2634034A1 (en) * | 2005-12-20 | 2007-06-28 | Duke University | Methods and compositions for delivering active agents with enhanced pharmacological properties |
US20110039776A1 (en) | 2006-09-06 | 2011-02-17 | Ashutosh Chilkoti | Fusion peptide therapeutic compositions |
-
2007
- 2007-01-04 US US11/620,034 patent/US7709227B2/en active Active
- 2007-07-11 WO PCT/US2007/073273 patent/WO2008085543A2/en active Application Filing
- 2007-07-11 EP EP07812809A patent/EP2115156A4/en not_active Withdrawn
-
2010
- 2010-02-25 US US12/712,615 patent/US20110082283A1/en not_active Abandoned
Cited By (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11458205B2 (en) | 2015-08-04 | 2022-10-04 | Duke University | Genetically encoded intrinsically disordered stealth polymers for delivery and methods of using same |
US11752213B2 (en) | 2015-12-21 | 2023-09-12 | Duke University | Surfaces having reduced non-specific binding and antigenicity |
US11467156B2 (en) | 2016-06-01 | 2022-10-11 | Duke University | Nonfouling biosensors |
US11135301B2 (en) | 2016-09-14 | 2021-10-05 | Duke University | Triblock polypeptide-based nanoparticles for the delivery of hydrophilic drugs |
US11155584B2 (en) | 2016-09-23 | 2021-10-26 | Duke University | Unstructured non-repetitive polypeptides having LCST behavior |
US11648200B2 (en) | 2017-01-12 | 2023-05-16 | Duke University | Genetically encoded lipid-polypeptide hybrid biomaterials that exhibit temperature triggered hierarchical self-assembly |
US11554097B2 (en) | 2017-05-15 | 2023-01-17 | Duke University | Recombinant production of hybrid lipid-biopolymer materials that self-assemble and encapsulate agents |
US11680083B2 (en) | 2017-06-30 | 2023-06-20 | Duke University | Order and disorder as a design principle for stimuli-responsive biopolymer networks |
WO2020028806A1 (en) * | 2018-08-02 | 2020-02-06 | Duke University | Dual agonist fusion proteins |
US11649275B2 (en) | 2018-08-02 | 2023-05-16 | Duke University | Dual agonist fusion proteins |
US11512314B2 (en) | 2019-07-12 | 2022-11-29 | Duke University | Amphiphilic polynucleotides |
US11965164B2 (en) | 2019-07-12 | 2024-04-23 | Duke University | Amphiphilic polynucleotides |
Also Published As
Publication number | Publication date |
---|---|
WO2008085543A3 (en) | 2008-12-24 |
EP2115156A4 (en) | 2010-01-13 |
US7709227B2 (en) | 2010-05-04 |
WO2008085543A2 (en) | 2008-07-17 |
WO2008085543A8 (en) | 2009-07-30 |
EP2115156A2 (en) | 2009-11-11 |
US20080032400A1 (en) | 2008-02-07 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US7709227B2 (en) | Multimeric ELP fusion constructs | |
US6852834B2 (en) | Fusion peptides isolatable by phase transition | |
US20220098293A1 (en) | Split inteins, conjugates and uses thereof | |
US11142550B2 (en) | Split inteins with exceptional splicing activity | |
CN104619726B (en) | By super fusion protein for folding green fluorescent protein and forming and application thereof | |
US20090220455A1 (en) | Pharmaceutical compositions comprising elp fusion proteins | |
KR100959549B1 (en) | A Method of Producing Glucagon-like Peptide 1 GLP-17-36 And An GLP-1 Analogue | |
CN101418290A (en) | High efficiency ELP fusion protease as well as preparation and application thereof | |
CA2398605A1 (en) | Methods for the purification and aqueous fiber spinning of spider silks and other structural proteins | |
Zhao et al. | Recombinant production of medium-to large-sized peptides in Escherichia coli using a cleavable self-aggregating tag | |
EP1220933B3 (en) | Purification of recombinant proteins fused to multiple epitopes | |
Sharma | On the recovery of genetically engineered proteins from Escherichia coli | |
CN100432230C (en) | Fusion expression method for metallothionein and use thereof | |
CA2206848A1 (en) | Production of peptides using recombinant fusion protein constructs | |
WO2022241831A1 (en) | Preparation method for polypeptide | |
CN113004375B (en) | Small molecular protein for efficiently mediating recombinant polypeptide to form inclusion body | |
JP4088584B2 (en) | A method for separating a target protein from a fusion protein. | |
Kumar et al. | Easy and efficient protocol for purification of recombinant peptides | |
CN108707193B (en) | Method for expressing and purifying recombinant CXCL9 protein and application thereof | |
CN107629129B (en) | Method for producing and purifying polypeptides | |
Lavergne-Mazeau et al. | Linear correlation between bacterial overexpression of recombinant peptides and cell light scatter | |
WO2008024311A2 (en) | Purification of low-abundant recombinant proteins from cell culture | |
Chandrasekaran et al. | Expression, purification and characterization of individual bromodomains from human Polybromo-1 | |
JP6525171B2 (en) | Circularized cytokine and method for producing the same | |
CN117801123B (en) | Wo Suoli peptide soluble intermediate, intermediate preparation method and Wo Suoli peptide preparation method |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: PHASE BIOSCIENCE, INC., NORTH CAROLINA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:DAGHER, SUZANNE;REEL/FRAME:025618/0640 Effective date: 20070108 Owner name: PHASEBIO PHARMACEUTICALS, INC., PENNSYLVANIA Free format text: CHANGE OF NAME;ASSIGNOR:PHASE BIOSCIENCE , INC.;REEL/FRAME:025619/0746 Effective date: 20081119 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |