US20040146505A1 - Substances - Google Patents
Substances Download PDFInfo
- Publication number
- US20040146505A1 US20040146505A1 US10/470,045 US47004504A US2004146505A1 US 20040146505 A1 US20040146505 A1 US 20040146505A1 US 47004504 A US47004504 A US 47004504A US 2004146505 A1 US2004146505 A1 US 2004146505A1
- Authority
- US
- United States
- Prior art keywords
- tyr
- cell
- human
- cells
- epitope
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 239000000126 substance Substances 0.000 title description 2
- 241000282414 Homo sapiens Species 0.000 claims abstract description 163
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 102
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 claims abstract description 77
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 68
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 66
- 229920001184 polypeptide Polymers 0.000 claims abstract description 60
- 230000005867 T cell response Effects 0.000 claims abstract description 27
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 claims abstract description 19
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 claims abstract description 19
- 230000004936 stimulating effect Effects 0.000 claims abstract description 13
- 244000052769 pathogen Species 0.000 claims abstract description 11
- 238000011282 treatment Methods 0.000 claims abstract description 9
- 108090000623 proteins and genes Proteins 0.000 claims description 54
- 238000000034 method Methods 0.000 claims description 44
- 150000007523 nucleic acids Chemical class 0.000 claims description 40
- 102000039446 nucleic acids Human genes 0.000 claims description 35
- 108020004707 nucleic acids Proteins 0.000 claims description 35
- 102000004169 proteins and genes Human genes 0.000 claims description 35
- 206010028980 Neoplasm Diseases 0.000 claims description 23
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 claims description 16
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 claims description 16
- 238000004519 manufacturing process Methods 0.000 claims description 16
- 210000002443 helper t lymphocyte Anatomy 0.000 claims description 15
- 201000011510 cancer Diseases 0.000 claims description 12
- 230000027455 binding Effects 0.000 claims description 10
- 239000003814 drug Substances 0.000 claims description 9
- 239000002671 adjuvant Substances 0.000 claims description 6
- 230000001472 cytotoxic effect Effects 0.000 claims description 5
- 230000001717 pathogenic effect Effects 0.000 claims description 5
- 241000124008 Mammalia Species 0.000 claims description 3
- 231100000433 cytotoxic Toxicity 0.000 claims description 3
- 238000007918 intramuscular administration Methods 0.000 claims description 3
- 238000011321 prophylaxis Methods 0.000 claims 1
- 210000004881 tumor cell Anatomy 0.000 abstract description 4
- 210000004027 cell Anatomy 0.000 description 89
- 239000013615 primer Substances 0.000 description 70
- 108020004414 DNA Proteins 0.000 description 68
- 238000003752 polymerase chain reaction Methods 0.000 description 42
- 235000018102 proteins Nutrition 0.000 description 34
- 230000004044 response Effects 0.000 description 33
- 241000699666 Mus <mouse, genus> Species 0.000 description 32
- ANHVRCNNGJMJNG-BZSNNMDCSA-N Tyr-Tyr-Cys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)N[C@@H](CS)C(=O)O)N)O ANHVRCNNGJMJNG-BZSNNMDCSA-N 0.000 description 31
- 239000000427 antigen Substances 0.000 description 30
- 102000036639 antigens Human genes 0.000 description 30
- 108091007433 antigens Proteins 0.000 description 30
- 102100021277 Beta-secretase 2 Human genes 0.000 description 27
- 101710150190 Beta-secretase 2 Proteins 0.000 description 27
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 27
- 230000035772 mutation Effects 0.000 description 27
- 239000013612 plasmid Substances 0.000 description 25
- 239000013598 vector Substances 0.000 description 25
- 241000699670 Mus sp. Species 0.000 description 24
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 23
- 235000001014 amino acid Nutrition 0.000 description 23
- 150000001413 amino acids Chemical group 0.000 description 23
- 239000000047 product Substances 0.000 description 23
- 230000014509 gene expression Effects 0.000 description 22
- 238000004458 analytical method Methods 0.000 description 21
- 238000003776 cleavage reaction Methods 0.000 description 20
- 238000010367 cloning Methods 0.000 description 20
- 230000007017 scission Effects 0.000 description 20
- 230000000638 stimulation Effects 0.000 description 20
- 241000699660 Mus musculus Species 0.000 description 19
- 238000000338 in vitro Methods 0.000 description 19
- 230000000694 effects Effects 0.000 description 18
- 230000035755 proliferation Effects 0.000 description 18
- 238000003780 insertion Methods 0.000 description 15
- 230000037431 insertion Effects 0.000 description 15
- 210000004698 lymphocyte Anatomy 0.000 description 14
- 239000000203 mixture Substances 0.000 description 13
- 230000003013 cytotoxicity Effects 0.000 description 12
- 231100000135 cytotoxicity Toxicity 0.000 description 12
- 210000004443 dendritic cell Anatomy 0.000 description 12
- 238000002474 experimental method Methods 0.000 description 12
- 238000002649 immunization Methods 0.000 description 12
- 239000011651 chromium Substances 0.000 description 11
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Natural products NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 11
- 238000010348 incorporation Methods 0.000 description 11
- 238000012545 processing Methods 0.000 description 11
- 239000012634 fragment Substances 0.000 description 10
- 210000004408 hybridoma Anatomy 0.000 description 10
- 238000003556 assay Methods 0.000 description 9
- 230000002147 killing effect Effects 0.000 description 9
- 101100481408 Danio rerio tie2 gene Proteins 0.000 description 8
- 101100481410 Mus musculus Tek gene Proteins 0.000 description 8
- 102100022019 Pregnancy-specific beta-1-glycoprotein 2 Human genes 0.000 description 8
- 210000004899 c-terminal region Anatomy 0.000 description 8
- 229910052804 chromium Inorganic materials 0.000 description 8
- 239000013604 expression vector Substances 0.000 description 8
- 102100031699 Choline transporter-like protein 1 Human genes 0.000 description 7
- 101000940912 Homo sapiens Choline transporter-like protein 1 Proteins 0.000 description 7
- 210000000612 antigen-presenting cell Anatomy 0.000 description 7
- 108010068265 aspartyltyrosine Proteins 0.000 description 7
- 239000012636 effector Substances 0.000 description 7
- 230000028327 secretion Effects 0.000 description 7
- 238000012163 sequencing technique Methods 0.000 description 7
- 229960005486 vaccine Drugs 0.000 description 7
- 102000009109 Fc receptors Human genes 0.000 description 6
- 108010087819 Fc receptors Proteins 0.000 description 6
- 108010076504 Protein Sorting Signals Proteins 0.000 description 6
- 230000006052 T cell proliferation Effects 0.000 description 6
- 238000006243 chemical reaction Methods 0.000 description 6
- 239000002299 complementary DNA Substances 0.000 description 6
- 239000002158 endotoxin Substances 0.000 description 6
- 230000004927 fusion Effects 0.000 description 6
- 230000028993 immune response Effects 0.000 description 6
- 229920006008 lipopolysaccharide Polymers 0.000 description 6
- 239000002609 medium Substances 0.000 description 6
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 6
- 239000006228 supernatant Substances 0.000 description 6
- 229940104230 thymidine Drugs 0.000 description 6
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 5
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 5
- 238000001712 DNA sequencing Methods 0.000 description 5
- 229940021995 DNA vaccine Drugs 0.000 description 5
- 241000588724 Escherichia coli Species 0.000 description 5
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 5
- JHNJNTMTZHEDLJ-NAKRPEOUSA-N Ile-Ser-Arg Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O JHNJNTMTZHEDLJ-NAKRPEOUSA-N 0.000 description 5
- 108060003951 Immunoglobulin Proteins 0.000 description 5
- 241001529936 Murinae Species 0.000 description 5
- UPODKYBYUBTWSV-BZSNNMDCSA-N Tyr-Phe-Cys Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CS)C(O)=O)C1=CC=C(O)C=C1 UPODKYBYUBTWSV-BZSNNMDCSA-N 0.000 description 5
- 230000003321 amplification Effects 0.000 description 5
- 238000000137 annealing Methods 0.000 description 5
- 102000018358 immunoglobulin Human genes 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 238000003199 nucleic acid amplification method Methods 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- 238000001543 one-way ANOVA Methods 0.000 description 5
- 230000006337 proteolytic cleavage Effects 0.000 description 5
- 230000002441 reversible effect Effects 0.000 description 5
- 238000002741 site-directed mutagenesis Methods 0.000 description 5
- 210000004988 splenocyte Anatomy 0.000 description 5
- 230000009466 transformation Effects 0.000 description 5
- 108010038745 tryptophylglycine Proteins 0.000 description 5
- CNKBMTKICGGSCQ-ACRUOGEOSA-N (2S)-2-[[(2S)-2-[[(2S)-2,6-diamino-1-oxohexyl]amino]-1-oxo-3-phenylpropyl]amino]-3-(4-hydroxyphenyl)propanoic acid Chemical compound C([C@H](NC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 CNKBMTKICGGSCQ-ACRUOGEOSA-N 0.000 description 4
- PQGCYSRGXCORLN-UHFFFAOYSA-N 2-[[2-[2-[[2-[[1-[2-[[2-[[2-[(2-amino-3-phenylpropanoyl)amino]-4-methylpentanoyl]amino]-3-(1h-indol-3-yl)propanoyl]amino]acetyl]pyrrolidine-2-carbonyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]propanoylamino]-4-methylpentanoyl]amino]-3-methylbutan Chemical compound C=1NC2=CC=CC=C2C=1CC(C(=O)NCC(=O)N1C(CCC1)C(=O)NC(CCCN=C(N)N)C(=O)NC(C)C(=O)NC(CC(C)C)C(=O)NC(C(C)C)C(O)=O)NC(=O)C(CC(C)C)NC(=O)C(N)CC1=CC=CC=C1 PQGCYSRGXCORLN-UHFFFAOYSA-N 0.000 description 4
- MDNAVFBZPROEHO-DCAQKATOSA-N Ala-Lys-Val Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O MDNAVFBZPROEHO-DCAQKATOSA-N 0.000 description 4
- MDNAVFBZPROEHO-UHFFFAOYSA-N Ala-Lys-Val Natural products CC(C)C(C(O)=O)NC(=O)C(NC(=O)C(C)N)CCCCN MDNAVFBZPROEHO-UHFFFAOYSA-N 0.000 description 4
- VQAVBBCZFQAAED-FXQIFTODSA-N Ala-Pro-Asn Chemical compound C[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(=O)N)C(=O)O)N VQAVBBCZFQAAED-FXQIFTODSA-N 0.000 description 4
- MFAMTAVAFBPXDC-LPEHRKFASA-N Arg-Asp-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCN=C(N)N)N)C(=O)O MFAMTAVAFBPXDC-LPEHRKFASA-N 0.000 description 4
- RVMXMLSYBTXCAV-VEVYYDQMSA-N Asp-Pro-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(O)=O RVMXMLSYBTXCAV-VEVYYDQMSA-N 0.000 description 4
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 4
- 108010041986 DNA Vaccines Proteins 0.000 description 4
- 238000011238 DNA vaccination Methods 0.000 description 4
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 4
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 4
- 239000011543 agarose gel Substances 0.000 description 4
- 230000003302 anti-idiotype Effects 0.000 description 4
- 238000007846 asymmetric PCR Methods 0.000 description 4
- 210000003719 b-lymphocyte Anatomy 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 210000004970 cd4 cell Anatomy 0.000 description 4
- 230000006037 cell lysis Effects 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 239000013078 crystal Substances 0.000 description 4
- 239000012228 culture supernatant Substances 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 238000013461 design Methods 0.000 description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 4
- 239000003623 enhancer Substances 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 238000000302 molecular modelling Methods 0.000 description 4
- 108010070409 phenylalanyl-glycyl-glycine Proteins 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 108010026333 seryl-proline Proteins 0.000 description 4
- 230000008685 targeting Effects 0.000 description 4
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 3
- KVWLTGNCJYDJET-LSJOCFKGSA-N Ala-Arg-His Chemical compound C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N KVWLTGNCJYDJET-LSJOCFKGSA-N 0.000 description 3
- TTXMOJWKNRJWQJ-FXQIFTODSA-N Ala-Arg-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C)CCCN=C(N)N TTXMOJWKNRJWQJ-FXQIFTODSA-N 0.000 description 3
- GIKOVDMXBAFXDF-NHCYSSNCSA-N Asp-Val-Leu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O GIKOVDMXBAFXDF-NHCYSSNCSA-N 0.000 description 3
- 206010009944 Colon cancer Diseases 0.000 description 3
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- JVSBYEDSSRZQGV-GUBZILKMSA-N Glu-Asp-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CCC(O)=O JVSBYEDSSRZQGV-GUBZILKMSA-N 0.000 description 3
- SJJHXJDSNQJMMW-SRVKXCTJSA-N Glu-Lys-Arg Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O SJJHXJDSNQJMMW-SRVKXCTJSA-N 0.000 description 3
- JYPCXBJRLBHWME-IUCAKERBSA-N Gly-Pro-Arg Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O JYPCXBJRLBHWME-IUCAKERBSA-N 0.000 description 3
- NVTPVQLIZCOJFK-FOHZUACHSA-N Gly-Thr-Asp Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O NVTPVQLIZCOJFK-FOHZUACHSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 108090000978 Interleukin-4 Proteins 0.000 description 3
- FEHQLKKBVJHSEC-SZMVWBNQSA-N Leu-Glu-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC(C)C)C(O)=O)=CNC2=C1 FEHQLKKBVJHSEC-SZMVWBNQSA-N 0.000 description 3
- SPSSJSICDYYTQN-HJGDQZAQSA-N Met-Thr-Gln Chemical compound CSCC[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CCC(N)=O SPSSJSICDYYTQN-HJGDQZAQSA-N 0.000 description 3
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 3
- 101100342977 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) leu-1 gene Proteins 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- GHNVJQZQYKNTDX-HJWJTTGWSA-N Phe-Ile-Met Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(O)=O GHNVJQZQYKNTDX-HJWJTTGWSA-N 0.000 description 3
- HQPWNHXERZCIHP-PMVMPFDFSA-N Phe-Leu-Trp Chemical compound C([C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(O)=O)C1=CC=CC=C1 HQPWNHXERZCIHP-PMVMPFDFSA-N 0.000 description 3
- BPCLGWHVPVTTFM-QWRGUYRKSA-N Phe-Ser-Gly Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)NCC(O)=O BPCLGWHVPVTTFM-QWRGUYRKSA-N 0.000 description 3
- 108010004729 Phycoerythrin Proteins 0.000 description 3
- JARJPEMLQAWNBR-GUBZILKMSA-N Pro-Asp-Arg Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O JARJPEMLQAWNBR-GUBZILKMSA-N 0.000 description 3
- YMTLKLXDFCSCNX-BYPYZUCNSA-N Ser-Gly-Gly Chemical compound OC[C@H](N)C(=O)NCC(=O)NCC(O)=O YMTLKLXDFCSCNX-BYPYZUCNSA-N 0.000 description 3
- UIGMAMGZOJVTDN-WHFBIAKZSA-N Ser-Gly-Ser Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O UIGMAMGZOJVTDN-WHFBIAKZSA-N 0.000 description 3
- XXXAXOWMBOKTRN-XPUUQOCRSA-N Ser-Gly-Val Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O XXXAXOWMBOKTRN-XPUUQOCRSA-N 0.000 description 3
- HBTCFCHYALPXME-HTFCKZLJSA-N Ser-Ile-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O HBTCFCHYALPXME-HTFCKZLJSA-N 0.000 description 3
- KCGIREHVWRXNDH-GARJFASQSA-N Ser-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CO)N KCGIREHVWRXNDH-GARJFASQSA-N 0.000 description 3
- MECLEFZMPPOEAC-VOAKCMCISA-N Thr-Leu-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)O)N)O MECLEFZMPPOEAC-VOAKCMCISA-N 0.000 description 3
- DEGCBBCMYWNJNA-RHYQMDGZSA-N Thr-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)[C@@H](C)O DEGCBBCMYWNJNA-RHYQMDGZSA-N 0.000 description 3
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 3
- BURPTJBFWIOHEY-UWJYBYFXSA-N Tyr-Ala-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 BURPTJBFWIOHEY-UWJYBYFXSA-N 0.000 description 3
- DXYWRYQRKPIGGU-BPNCWPANSA-N Tyr-Ala-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 DXYWRYQRKPIGGU-BPNCWPANSA-N 0.000 description 3
- IJUTXXAXQODRMW-KBPBESRZSA-N Tyr-Gly-His Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)NCC(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N)O IJUTXXAXQODRMW-KBPBESRZSA-N 0.000 description 3
- LMKKMCGTDANZTR-BZSNNMDCSA-N Tyr-Phe-Asp Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(O)=O)C(O)=O)C1=CC=C(O)C=C1 LMKKMCGTDANZTR-BZSNNMDCSA-N 0.000 description 3
- NUQZCPSZHGIYTA-HKUYNNGSSA-N Tyr-Trp-Gly Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CC3=CC=C(C=C3)O)N NUQZCPSZHGIYTA-HKUYNNGSSA-N 0.000 description 3
- SQUMHUZLJDUROQ-YDHLFZDLSA-N Tyr-Val-Asp Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O SQUMHUZLJDUROQ-YDHLFZDLSA-N 0.000 description 3
- XGJLNBNZNMVJRS-NRPADANISA-N Val-Glu-Ala Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O XGJLNBNZNMVJRS-NRPADANISA-N 0.000 description 3
- VHIZXDZMTDVFGX-DCAQKATOSA-N Val-Ser-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)N VHIZXDZMTDVFGX-DCAQKATOSA-N 0.000 description 3
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 3
- 108010086434 alanyl-seryl-glycine Proteins 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 108010069205 aspartyl-phenylalanine Proteins 0.000 description 3
- 230000009286 beneficial effect Effects 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000000295 complement effect Effects 0.000 description 3
- 108010016616 cysteinylglycine Proteins 0.000 description 3
- 208000035475 disorder Diseases 0.000 description 3
- 238000004520 electroporation Methods 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 108010057083 glutamyl-aspartyl-leucine Proteins 0.000 description 3
- JYPCXBJRLBHWME-UHFFFAOYSA-N glycyl-L-prolyl-L-arginine Natural products NCC(=O)N1CCCC1C(=O)NC(CCCN=C(N)N)C(O)=O JYPCXBJRLBHWME-UHFFFAOYSA-N 0.000 description 3
- 108010020688 glycylhistidine Proteins 0.000 description 3
- 108010050848 glycylleucine Proteins 0.000 description 3
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 3
- 229910052737 gold Inorganic materials 0.000 description 3
- 239000010931 gold Substances 0.000 description 3
- 239000001963 growth medium Substances 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 108010044374 isoleucyl-tyrosine Proteins 0.000 description 3
- 238000005304 joining Methods 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 239000000178 monomer Substances 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 102000005962 receptors Human genes 0.000 description 3
- 230000035945 sensitivity Effects 0.000 description 3
- 238000002864 sequence alignment Methods 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- 238000002255 vaccination Methods 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- LRFVTYWOQMYALW-UHFFFAOYSA-N 9H-xanthine Chemical compound O=C1NC(=O)NC2=C1NC=N2 LRFVTYWOQMYALW-UHFFFAOYSA-N 0.000 description 2
- YYSWCHMLFJLLBJ-ZLUOBGJFSA-N Ala-Ala-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YYSWCHMLFJLLBJ-ZLUOBGJFSA-N 0.000 description 2
- UCIYCBSJBQGDGM-LPEHRKFASA-N Ala-Arg-Pro Chemical compound C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1CCC[C@@H]1C(=O)O)N UCIYCBSJBQGDGM-LPEHRKFASA-N 0.000 description 2
- OQWQTGBOFPJOIF-DLOVCJGASA-N Ala-Lys-His Chemical compound C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N OQWQTGBOFPJOIF-DLOVCJGASA-N 0.000 description 2
- WQLDNOCHHRISMS-NAKRPEOUSA-N Ala-Pro-Ile Chemical compound [H]N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(O)=O WQLDNOCHHRISMS-NAKRPEOUSA-N 0.000 description 2
- IOFVWPYSRSCWHI-JXUBOQSCSA-N Ala-Thr-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](C)N IOFVWPYSRSCWHI-JXUBOQSCSA-N 0.000 description 2
- MTDDMSUUXNQMKK-BPNCWPANSA-N Ala-Tyr-Arg Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N MTDDMSUUXNQMKK-BPNCWPANSA-N 0.000 description 2
- MUGAESARFRGOTQ-IGNZVWTISA-N Ala-Tyr-Tyr Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)O)N MUGAESARFRGOTQ-IGNZVWTISA-N 0.000 description 2
- DBKNLHKEVPZVQC-LPEHRKFASA-N Arg-Ala-Pro Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@@H]1C(O)=O DBKNLHKEVPZVQC-LPEHRKFASA-N 0.000 description 2
- UXJCMQFPDWCHKX-DCAQKATOSA-N Arg-Arg-Glu Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(O)=O)C(O)=O UXJCMQFPDWCHKX-DCAQKATOSA-N 0.000 description 2
- KMSHNDWHPWXPEC-BQBZGAKWSA-N Arg-Asp-Gly Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O KMSHNDWHPWXPEC-BQBZGAKWSA-N 0.000 description 2
- FBLMOFHNVQBKRR-IHRRRGAJSA-N Arg-Asp-Tyr Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 FBLMOFHNVQBKRR-IHRRRGAJSA-N 0.000 description 2
- PRLPSDIHSRITSF-UNQGMJICSA-N Arg-Phe-Thr Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O PRLPSDIHSRITSF-UNQGMJICSA-N 0.000 description 2
- AOJYORNRFWWEIV-IHRRRGAJSA-N Arg-Tyr-Asp Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CC(O)=O)C(O)=O)CC1=CC=C(O)C=C1 AOJYORNRFWWEIV-IHRRRGAJSA-N 0.000 description 2
- CPTXATAOUQJQRO-GUBZILKMSA-N Arg-Val-Ser Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O CPTXATAOUQJQRO-GUBZILKMSA-N 0.000 description 2
- 206010003445 Ascites Diseases 0.000 description 2
- DXVMJJNAOVECBA-WHFBIAKZSA-N Asn-Gly-Asn Chemical compound NC(=O)C[C@H](N)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O DXVMJJNAOVECBA-WHFBIAKZSA-N 0.000 description 2
- RAKKBBHMTJSXOY-XVYDVKMFSA-N Asn-His-Ala Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(O)=O RAKKBBHMTJSXOY-XVYDVKMFSA-N 0.000 description 2
- LRCIOEVFVGXZKB-BZSNNMDCSA-N Asn-Tyr-Tyr Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O LRCIOEVFVGXZKB-BZSNNMDCSA-N 0.000 description 2
- NYQHSUGFEWDWPD-ACZMJKKPSA-N Asp-Gln-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CC(=O)O)N NYQHSUGFEWDWPD-ACZMJKKPSA-N 0.000 description 2
- HOBNTSHITVVNBN-ZPFDUUQYSA-N Asp-Ile-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)O)NC(=O)[C@H](CC(=O)O)N HOBNTSHITVVNBN-ZPFDUUQYSA-N 0.000 description 2
- HTSSXFASOUSJQG-IHPCNDPISA-N Asp-Tyr-Trp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O HTSSXFASOUSJQG-IHPCNDPISA-N 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- GEEXORWTBTUOHC-FXQIFTODSA-N Cys-Arg-Ser Chemical compound C(C[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CS)N)CN=C(N)N GEEXORWTBTUOHC-FXQIFTODSA-N 0.000 description 2
- BBQIWFFTTQTNOC-AVGNSLFASA-N Cys-Phe-Gln Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CS)N BBQIWFFTTQTNOC-AVGNSLFASA-N 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- 102000003915 DNA Topoisomerases Human genes 0.000 description 2
- 108090000323 DNA Topoisomerases Proteins 0.000 description 2
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 2
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- KRHYYFGTRYWZRS-UHFFFAOYSA-N F Chemical compound F KRHYYFGTRYWZRS-UHFFFAOYSA-N 0.000 description 2
- JXFLPKSDLDEOQK-JHEQGTHGSA-N Gln-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CCC(N)=O JXFLPKSDLDEOQK-JHEQGTHGSA-N 0.000 description 2
- VLOLPWWCNKWRNB-LOKLDPHHSA-N Gln-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCC(=O)N)N)O VLOLPWWCNKWRNB-LOKLDPHHSA-N 0.000 description 2
- LHIPZASLKPYDPI-AVGNSLFASA-N Glu-Phe-Asp Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O LHIPZASLKPYDPI-AVGNSLFASA-N 0.000 description 2
- LSYFGBRDBIQYAQ-FHWLQOOXSA-N Glu-Tyr-Tyr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O LSYFGBRDBIQYAQ-FHWLQOOXSA-N 0.000 description 2
- HQRHFUYMGCHHJS-LURJTMIESA-N Gly-Gly-Arg Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CCCN=C(N)N HQRHFUYMGCHHJS-LURJTMIESA-N 0.000 description 2
- YWAQATDNEKZFFK-BYPYZUCNSA-N Gly-Gly-Ser Chemical compound NCC(=O)NCC(=O)N[C@@H](CO)C(O)=O YWAQATDNEKZFFK-BYPYZUCNSA-N 0.000 description 2
- UQJNXZSSGQIPIQ-FBCQKBJTSA-N Gly-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)CN UQJNXZSSGQIPIQ-FBCQKBJTSA-N 0.000 description 2
- MIIVFRCYJABHTQ-ONGXEEELSA-N Gly-Leu-Val Chemical compound [H]NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O MIIVFRCYJABHTQ-ONGXEEELSA-N 0.000 description 2
- NTBOEZICHOSJEE-YUMQZZPRSA-N Gly-Lys-Ser Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O NTBOEZICHOSJEE-YUMQZZPRSA-N 0.000 description 2
- MKIAPEZXQDILRR-YUMQZZPRSA-N Gly-Ser-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)CN MKIAPEZXQDILRR-YUMQZZPRSA-N 0.000 description 2
- SBVMXEZQJVUARN-XPUUQOCRSA-N Gly-Val-Ser Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O SBVMXEZQJVUARN-XPUUQOCRSA-N 0.000 description 2
- 102000025850 HLA-A2 Antigen Human genes 0.000 description 2
- 108010074032 HLA-A2 Antigen Proteins 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- MUENHEQLLUDKSC-PMVMPFDFSA-N His-Tyr-Trp Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(O)=O)C1=CNC=N1 MUENHEQLLUDKSC-PMVMPFDFSA-N 0.000 description 2
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 2
- 101001005719 Homo sapiens Melanoma-associated antigen 3 Proteins 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- JCGMFFQQHJQASB-PYJNHQTQSA-N Ile-Val-His Chemical compound N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)O JCGMFFQQHJQASB-PYJNHQTQSA-N 0.000 description 2
- PMGDADKJMCOXHX-UHFFFAOYSA-N L-Arginyl-L-glutamin-acetat Natural products NC(=N)NCCCC(N)C(=O)NC(CCC(N)=O)C(O)=O PMGDADKJMCOXHX-UHFFFAOYSA-N 0.000 description 2
- KIZIOFNVSOSKJI-CIUDSAMLSA-N Leu-Ser-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)N KIZIOFNVSOSKJI-CIUDSAMLSA-N 0.000 description 2
- URHJPNHRQMQGOZ-RHYQMDGZSA-N Leu-Thr-Met Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCSC)C(O)=O URHJPNHRQMQGOZ-RHYQMDGZSA-N 0.000 description 2
- 102100025082 Melanoma-associated antigen 3 Human genes 0.000 description 2
- SITLTJHOQZFJGG-UHFFFAOYSA-N N-L-alpha-glutamyl-L-valine Natural products CC(C)C(C(O)=O)NC(=O)C(N)CCC(O)=O SITLTJHOQZFJGG-UHFFFAOYSA-N 0.000 description 2
- 108010079364 N-glycylalanine Proteins 0.000 description 2
- 241000588650 Neisseria meningitidis Species 0.000 description 2
- 101150093941 PORA gene Proteins 0.000 description 2
- 241000577979 Peromyscus spicilegus Species 0.000 description 2
- LLGTYVHITPVGKR-RYUDHWBXSA-N Phe-Gln-Gly Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O LLGTYVHITPVGKR-RYUDHWBXSA-N 0.000 description 2
- OSBADCBXAMSPQD-YESZJQIVSA-N Phe-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC2=CC=CC=C2)N OSBADCBXAMSPQD-YESZJQIVSA-N 0.000 description 2
- GCFNFKNPCMBHNT-IRXDYDNUSA-N Phe-Tyr-Gly Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)NCC(=O)O)N GCFNFKNPCMBHNT-IRXDYDNUSA-N 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 239000004698 Polyethylene Substances 0.000 description 2
- HFZNNDWPHBRNPV-KZVJFYERSA-N Pro-Ala-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O HFZNNDWPHBRNPV-KZVJFYERSA-N 0.000 description 2
- SFECXGVELZFBFJ-VEVYYDQMSA-N Pro-Asp-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O SFECXGVELZFBFJ-VEVYYDQMSA-N 0.000 description 2
- GBRUQFBAJOKCTF-DCAQKATOSA-N Pro-His-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(O)=O GBRUQFBAJOKCTF-DCAQKATOSA-N 0.000 description 2
- CLJLVCYFABNTHP-DCAQKATOSA-N Pro-Leu-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O CLJLVCYFABNTHP-DCAQKATOSA-N 0.000 description 2
- GFHOSBYCLACKEK-GUBZILKMSA-N Pro-Pro-Asn Chemical compound [H]N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(O)=O GFHOSBYCLACKEK-GUBZILKMSA-N 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- FMDHKPRACUXATF-ACZMJKKPSA-N Ser-Gln-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O FMDHKPRACUXATF-ACZMJKKPSA-N 0.000 description 2
- JFWDJFULOLKQFY-QWRGUYRKSA-N Ser-Gly-Phe Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O JFWDJFULOLKQFY-QWRGUYRKSA-N 0.000 description 2
- ZUDXUJSYCCNZQJ-DCAQKATOSA-N Ser-His-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](CO)N ZUDXUJSYCCNZQJ-DCAQKATOSA-N 0.000 description 2
- UIPXCLNLUUAMJU-JBDRJPRFSA-N Ser-Ile-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O UIPXCLNLUUAMJU-JBDRJPRFSA-N 0.000 description 2
- VMLONWHIORGALA-SRVKXCTJSA-N Ser-Leu-Leu Chemical compound CC(C)C[C@@H](C([O-])=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]([NH3+])CO VMLONWHIORGALA-SRVKXCTJSA-N 0.000 description 2
- UGTZYIPOBYXWRW-SRVKXCTJSA-N Ser-Phe-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O UGTZYIPOBYXWRW-SRVKXCTJSA-N 0.000 description 2
- 210000000662 T-lymphocyte subset Anatomy 0.000 description 2
- KEGBFULVYKYJRD-LFSVMHDDSA-N Thr-Ala-Phe Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 KEGBFULVYKYJRD-LFSVMHDDSA-N 0.000 description 2
- TWLMXDWFVNEFFK-FJXKBIBVSA-N Thr-Arg-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O TWLMXDWFVNEFFK-FJXKBIBVSA-N 0.000 description 2
- ZTPXSEUVYNNZRB-CDMKHQONSA-N Thr-Gly-Phe Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O ZTPXSEUVYNNZRB-CDMKHQONSA-N 0.000 description 2
- BIBYEFRASCNLAA-CDMKHQONSA-N Thr-Phe-Gly Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@H](C(=O)NCC(O)=O)CC1=CC=CC=C1 BIBYEFRASCNLAA-CDMKHQONSA-N 0.000 description 2
- MROIJTGJGIDEEJ-RCWTZXSCSA-N Thr-Pro-Pro Chemical compound C[C@@H](O)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 MROIJTGJGIDEEJ-RCWTZXSCSA-N 0.000 description 2
- SGAOHNPSEPVAFP-ZDLURKLDSA-N Thr-Ser-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)NCC(O)=O SGAOHNPSEPVAFP-ZDLURKLDSA-N 0.000 description 2
- JAWUQFCGNVEDRN-MEYUZBJRSA-N Thr-Tyr-Leu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC(C)C)C(=O)O)N)O JAWUQFCGNVEDRN-MEYUZBJRSA-N 0.000 description 2
- MBLJBGZWLHTJBH-SZMVWBNQSA-N Trp-Val-Arg Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O)=CNC2=C1 MBLJBGZWLHTJBH-SZMVWBNQSA-N 0.000 description 2
- CDRYEAWHKJSGAF-BPNCWPANSA-N Tyr-Ala-Met Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(O)=O CDRYEAWHKJSGAF-BPNCWPANSA-N 0.000 description 2
- HIINQLBHPIQYHN-JTQLQIEISA-N Tyr-Gly-Gly Chemical compound OC(=O)CNC(=O)CNC(=O)[C@@H](N)CC1=CC=C(O)C=C1 HIINQLBHPIQYHN-JTQLQIEISA-N 0.000 description 2
- CWVHKVVKAQIJKY-ACRUOGEOSA-N Tyr-Lys-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC2=CC=C(C=C2)O)N CWVHKVVKAQIJKY-ACRUOGEOSA-N 0.000 description 2
- JQOMHZMWQHXALX-FHWLQOOXSA-N Tyr-Tyr-Glu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O JQOMHZMWQHXALX-FHWLQOOXSA-N 0.000 description 2
- AGDDLOQMXUQPDY-BZSNNMDCSA-N Tyr-Tyr-Ser Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(O)=O AGDDLOQMXUQPDY-BZSNNMDCSA-N 0.000 description 2
- HZWPGKAKGYJWCI-ULQDDVLXSA-N Tyr-Val-Leu Chemical compound CC(C)C[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(C)C)C(O)=O HZWPGKAKGYJWCI-ULQDDVLXSA-N 0.000 description 2
- DIOSYUIWOQCXNR-ONGXEEELSA-N Val-Lys-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)NCC(O)=O DIOSYUIWOQCXNR-ONGXEEELSA-N 0.000 description 2
- IECQJCJNPJVUSB-IHRRRGAJSA-N Val-Tyr-Ser Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CO)C(O)=O IECQJCJNPJVUSB-IHRRRGAJSA-N 0.000 description 2
- VWQVUPCCIRVNHF-UHFFFAOYSA-N [Y] Chemical compound [Y] VWQVUPCCIRVNHF-UHFFFAOYSA-N 0.000 description 2
- 108010081404 acein-2 Proteins 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 229960000723 ampicillin Drugs 0.000 description 2
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 2
- 108010008355 arginyl-glutamine Proteins 0.000 description 2
- 108010029539 arginyl-prolyl-proline Proteins 0.000 description 2
- 108010084758 arginyl-tyrosyl-aspartic acid Proteins 0.000 description 2
- 125000004429 atom Chemical group 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 210000003969 blast cell Anatomy 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000002784 cytotoxicity assay Methods 0.000 description 2
- 231100000263 cytotoxicity test Toxicity 0.000 description 2
- 230000002939 deleterious effect Effects 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 229940088598 enzyme Drugs 0.000 description 2
- -1 from genomic sources Chemical class 0.000 description 2
- 102000054766 genetic haplotypes Human genes 0.000 description 2
- 108010078144 glutaminyl-glycine Proteins 0.000 description 2
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 2
- XBGGUPMXALFZOT-UHFFFAOYSA-N glycyl-L-tyrosine hemihydrate Natural products NCC(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 XBGGUPMXALFZOT-UHFFFAOYSA-N 0.000 description 2
- 239000001307 helium Substances 0.000 description 2
- 229910052734 helium Inorganic materials 0.000 description 2
- SWQJXJOGLNCZEY-UHFFFAOYSA-N helium atom Chemical compound [He] SWQJXJOGLNCZEY-UHFFFAOYSA-N 0.000 description 2
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 238000010166 immunofluorescence Methods 0.000 description 2
- 230000016784 immunoglobulin production Effects 0.000 description 2
- 230000001771 impaired effect Effects 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 230000001965 increasing effect Effects 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 238000011081 inoculation Methods 0.000 description 2
- 238000010255 intramuscular injection Methods 0.000 description 2
- 239000007927 intramuscular injection Substances 0.000 description 2
- 210000003292 kidney cell Anatomy 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 201000001441 melanoma Diseases 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 2
- 238000002887 multiple sequence alignment Methods 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- 230000000869 mutational effect Effects 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 239000008194 pharmaceutical composition Substances 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 108010051242 phenylalanylserine Proteins 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 210000004986 primary T-cell Anatomy 0.000 description 2
- 230000037452 priming Effects 0.000 description 2
- 230000002062 proliferating effect Effects 0.000 description 2
- 108010093296 prolyl-prolyl-alanine Proteins 0.000 description 2
- 108010070643 prolylglutamic acid Proteins 0.000 description 2
- 108020001580 protein domains Proteins 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 239000000523 sample Substances 0.000 description 2
- 238000003118 sandwich ELISA Methods 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- YEENEYXBHNNNGV-XEHWZWQGSA-M sodium;3-acetamido-5-[acetyl(methyl)amino]-2,4,6-triiodobenzoate;(2r,3r,4s,5s,6r)-2-[(2r,3s,4s,5r)-3,4-dihydroxy-2,5-bis(hydroxymethyl)oxolan-2-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound [Na+].CC(=O)N(C)C1=C(I)C(NC(C)=O)=C(I)C(C([O-])=O)=C1I.O[C@H]1[C@H](O)[C@@H](CO)O[C@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 YEENEYXBHNNNGV-XEHWZWQGSA-M 0.000 description 2
- 210000000952 spleen Anatomy 0.000 description 2
- 230000002269 spontaneous effect Effects 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 230000014723 transformation of host cell by virus Effects 0.000 description 2
- 238000011830 transgenic mouse model Methods 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 108010017949 tyrosyl-glycyl-glycine Proteins 0.000 description 2
- 241000701447 unidentified baculovirus Species 0.000 description 2
- 108010073969 valyllysine Proteins 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- ASWBNKHCZGQVJV-UHFFFAOYSA-N (3-hexadecanoyloxy-2-hydroxypropyl) 2-(trimethylazaniumyl)ethyl phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(O)COP([O-])(=O)OCC[N+](C)(C)C ASWBNKHCZGQVJV-UHFFFAOYSA-N 0.000 description 1
- WHTVZRBIWZFKQO-AWEZNQCLSA-N (S)-chloroquine Chemical compound ClC1=CC=C2C(N[C@@H](C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-AWEZNQCLSA-N 0.000 description 1
- RQZKULQRAMVTRE-UHFFFAOYSA-N *.N=[IH].[Y] Chemical compound *.N=[IH].[Y] RQZKULQRAMVTRE-UHFFFAOYSA-N 0.000 description 1
- WYWHKKSPHMUBEB-UHFFFAOYSA-N 6-Mercaptoguanine Natural products N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 1
- LPMXVESGRSUGHW-UHFFFAOYSA-N Acolongiflorosid K Natural products OC1C(O)C(O)C(C)OC1OC1CC2(O)CCC3C4(O)CCC(C=5COC(=O)C=5)C4(C)CC(O)C3C2(CO)C(O)C1 LPMXVESGRSUGHW-UHFFFAOYSA-N 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- VNYMOTCMNHJGTG-JBDRJPRFSA-N Ala-Ile-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O VNYMOTCMNHJGTG-JBDRJPRFSA-N 0.000 description 1
- UWIQWPWWZUHBAO-ZLIFDBKOSA-N Ala-Leu-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)N)CC(C)C)C(O)=O)=CNC2=C1 UWIQWPWWZUHBAO-ZLIFDBKOSA-N 0.000 description 1
- VHEVVUZDDUCAKU-FXQIFTODSA-N Ala-Met-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(O)=O VHEVVUZDDUCAKU-FXQIFTODSA-N 0.000 description 1
- RUXQNKVQSKOOBS-JURCDPSOSA-N Ala-Phe-Ile Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O RUXQNKVQSKOOBS-JURCDPSOSA-N 0.000 description 1
- GMGWOTQMUKYZIE-UBHSHLNASA-N Ala-Pro-Phe Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 GMGWOTQMUKYZIE-UBHSHLNASA-N 0.000 description 1
- GCTANJIJJROSLH-GVARAGBVSA-N Ala-Tyr-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](C)N GCTANJIJJROSLH-GVARAGBVSA-N 0.000 description 1
- 102000004400 Aminopeptidases Human genes 0.000 description 1
- 108090000915 Aminopeptidases Proteins 0.000 description 1
- YHQGEARSFILVHL-HJGDQZAQSA-N Arg-Gln-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCCN=C(N)N)N)O YHQGEARSFILVHL-HJGDQZAQSA-N 0.000 description 1
- FSNVAJOPUDVQAR-AVGNSLFASA-N Arg-Lys-Arg Chemical compound NC(=N)NCCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O FSNVAJOPUDVQAR-AVGNSLFASA-N 0.000 description 1
- FRBAHXABMQXSJQ-FXQIFTODSA-N Arg-Ser-Ser Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O FRBAHXABMQXSJQ-FXQIFTODSA-N 0.000 description 1
- CMLGVVWQQHUXOZ-GHCJXIJMSA-N Asn-Ala-Ile Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O CMLGVVWQQHUXOZ-GHCJXIJMSA-N 0.000 description 1
- HUZGPXBILPMCHM-IHRRRGAJSA-N Asn-Arg-Phe Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O HUZGPXBILPMCHM-IHRRRGAJSA-N 0.000 description 1
- JBDLMLZNDRLDIX-HJGDQZAQSA-N Asn-Thr-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O JBDLMLZNDRLDIX-HJGDQZAQSA-N 0.000 description 1
- NYLBGYLHBDFRHL-VEVYYDQMSA-N Asp-Arg-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O NYLBGYLHBDFRHL-VEVYYDQMSA-N 0.000 description 1
- GWTLRDMPMJCNMH-WHFBIAKZSA-N Asp-Asn-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O GWTLRDMPMJCNMH-WHFBIAKZSA-N 0.000 description 1
- XWSIYTYNLKCLJB-CIUDSAMLSA-N Asp-Lys-Asn Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O XWSIYTYNLKCLJB-CIUDSAMLSA-N 0.000 description 1
- SARSTIZOZFBDOM-FXQIFTODSA-N Asp-Met-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(O)=O SARSTIZOZFBDOM-FXQIFTODSA-N 0.000 description 1
- IOXWDLNHXZOXQP-FXQIFTODSA-N Asp-Met-Ser Chemical compound CSCC[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CC(=O)O)N IOXWDLNHXZOXQP-FXQIFTODSA-N 0.000 description 1
- ITGFVUYOLWBPQW-KKHAAJSZSA-N Asp-Thr-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O ITGFVUYOLWBPQW-KKHAAJSZSA-N 0.000 description 1
- PLNJUJGNLDSFOP-UWJYBYFXSA-N Asp-Tyr-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(O)=O PLNJUJGNLDSFOP-UWJYBYFXSA-N 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 101100505161 Caenorhabditis elegans mel-32 gene Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- TVYMKYUSZSVOAG-ZLUOBGJFSA-N Cys-Ala-Ala Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(O)=O TVYMKYUSZSVOAG-ZLUOBGJFSA-N 0.000 description 1
- AMRLSQGGERHDHJ-FXQIFTODSA-N Cys-Ala-Arg Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O AMRLSQGGERHDHJ-FXQIFTODSA-N 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 230000009946 DNA mutation Effects 0.000 description 1
- 108010008286 DNA nucleotidylexotransferase Proteins 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 102100029764 DNA-directed DNA/RNA polymerase mu Human genes 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- WHQDWFJSZSLFFB-ZZBKCAANSA-N F.S.[3H]P([V])[W] Chemical compound F.S.[3H]P([V])[W] WHQDWFJSZSLFFB-ZZBKCAANSA-N 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 1
- XZLLTYBONVKGLO-SDDRHHMPSA-N Gln-Lys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)N)N)C(=O)O XZLLTYBONVKGLO-SDDRHHMPSA-N 0.000 description 1
- SXFPZRRVWSUYII-KBIXCLLPSA-N Gln-Ser-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)N)N SXFPZRRVWSUYII-KBIXCLLPSA-N 0.000 description 1
- LPIKVBWNNVFHCQ-GUBZILKMSA-N Gln-Ser-Leu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O LPIKVBWNNVFHCQ-GUBZILKMSA-N 0.000 description 1
- ZFBBMCKQSNJZSN-AUTRQRHGSA-N Gln-Val-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O ZFBBMCKQSNJZSN-AUTRQRHGSA-N 0.000 description 1
- SBCYJMOOHUDWDA-NUMRIWBASA-N Glu-Asp-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O SBCYJMOOHUDWDA-NUMRIWBASA-N 0.000 description 1
- RFTVTKBHDXCEEX-WDSKDSINSA-N Glu-Ser-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(O)=O RFTVTKBHDXCEEX-WDSKDSINSA-N 0.000 description 1
- CGWHAXBNGYQBBK-JBACZVJFSA-N Glu-Trp-Tyr Chemical compound C([C@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CCC(O)=O)N)C(O)=O)C1=CC=C(O)C=C1 CGWHAXBNGYQBBK-JBACZVJFSA-N 0.000 description 1
- YQPFCZVKMUVZIN-AUTRQRHGSA-N Glu-Val-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O YQPFCZVKMUVZIN-AUTRQRHGSA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- GWCRIHNSVMOBEQ-BQBZGAKWSA-N Gly-Arg-Ser Chemical compound [H]NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(O)=O GWCRIHNSVMOBEQ-BQBZGAKWSA-N 0.000 description 1
- FMNHBTKMRFVGRO-FOHZUACHSA-N Gly-Asn-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)CN FMNHBTKMRFVGRO-FOHZUACHSA-N 0.000 description 1
- IWAXHBCACVWNHT-BQBZGAKWSA-N Gly-Asp-Arg Chemical compound NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCCN=C(N)N IWAXHBCACVWNHT-BQBZGAKWSA-N 0.000 description 1
- BYYNJRSNDARRBX-YFKPBYRVSA-N Gly-Gln-Gly Chemical compound NCC(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O BYYNJRSNDARRBX-YFKPBYRVSA-N 0.000 description 1
- GNPVTZJUUBPZKW-WDSKDSINSA-N Gly-Gln-Ser Chemical compound [H]NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O GNPVTZJUUBPZKW-WDSKDSINSA-N 0.000 description 1
- XPJBQTCXPJNIFE-ZETCQYMHSA-N Gly-Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CNC(=O)CN XPJBQTCXPJNIFE-ZETCQYMHSA-N 0.000 description 1
- XVYKMNXXJXQKME-XEGUGMAKSA-N Gly-Ile-Tyr Chemical compound NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 XVYKMNXXJXQKME-XEGUGMAKSA-N 0.000 description 1
- WMGHDYWNHNLGBV-ONGXEEELSA-N Gly-Phe-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)CN)CC1=CC=CC=C1 WMGHDYWNHNLGBV-ONGXEEELSA-N 0.000 description 1
- SOEGEPHNZOISMT-BYPYZUCNSA-N Gly-Ser-Gly Chemical compound NCC(=O)N[C@@H](CO)C(=O)NCC(O)=O SOEGEPHNZOISMT-BYPYZUCNSA-N 0.000 description 1
- NGBGZCUWFVVJKC-IRXDYDNUSA-N Gly-Tyr-Tyr Chemical compound C([C@H](NC(=O)CN)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=C(O)C=C1 NGBGZCUWFVVJKC-IRXDYDNUSA-N 0.000 description 1
- DUAWRXXTOQOECJ-JSGCOSHPSA-N Gly-Tyr-Val Chemical compound [H]NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C(C)C)C(O)=O DUAWRXXTOQOECJ-JSGCOSHPSA-N 0.000 description 1
- IZVICCORZOSGPT-JSGCOSHPSA-N Gly-Val-Tyr Chemical compound [H]NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O IZVICCORZOSGPT-JSGCOSHPSA-N 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 102000006354 HLA-DR Antigens Human genes 0.000 description 1
- 108010058597 HLA-DR Antigens Proteins 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 208000005176 Hepatitis C Diseases 0.000 description 1
- 208000028782 Hereditary disease Diseases 0.000 description 1
- PZUZIHRPOVVHOT-KBPBESRZSA-N His-Tyr-Gly Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)NCC(O)=O)C1=CN=CN1 PZUZIHRPOVVHOT-KBPBESRZSA-N 0.000 description 1
- BCSGDNGNHKBRRJ-ULQDDVLXSA-N His-Tyr-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](CC2=CN=CN2)N BCSGDNGNHKBRRJ-ULQDDVLXSA-N 0.000 description 1
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 description 1
- 101000746373 Homo sapiens Granulocyte-macrophage colony-stimulating factor Proteins 0.000 description 1
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- XYFCBTPGUUZFHI-UHFFFAOYSA-N I.P Chemical compound I.P XYFCBTPGUUZFHI-UHFFFAOYSA-N 0.000 description 1
- ZUWSVOYKBCHLRR-MGHWNKPDSA-N Ile-Tyr-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CCCCN)C(=O)O)N ZUWSVOYKBCHLRR-MGHWNKPDSA-N 0.000 description 1
- 108010065920 Insulin Lispro Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- LHSGPCFBGJHPCY-UHFFFAOYSA-N L-leucine-L-tyrosine Natural products CC(C)CC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 LHSGPCFBGJHPCY-UHFFFAOYSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 208000032420 Latent Infection Diseases 0.000 description 1
- XBBKIIGCUMBKCO-JXUBOQSCSA-N Leu-Ala-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XBBKIIGCUMBKCO-JXUBOQSCSA-N 0.000 description 1
- OGCQGUIWMSBHRZ-CIUDSAMLSA-N Leu-Asn-Ser Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O OGCQGUIWMSBHRZ-CIUDSAMLSA-N 0.000 description 1
- ZTLGVASZOIKNIX-DCAQKATOSA-N Leu-Gln-Glu Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N ZTLGVASZOIKNIX-DCAQKATOSA-N 0.000 description 1
- FQZPTCNSNPWHLJ-AVGNSLFASA-N Leu-Gln-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(O)=O FQZPTCNSNPWHLJ-AVGNSLFASA-N 0.000 description 1
- WIDZHJTYKYBLSR-DCAQKATOSA-N Leu-Glu-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O WIDZHJTYKYBLSR-DCAQKATOSA-N 0.000 description 1
- NRFGTHFONZYFNY-MGHWNKPDSA-N Leu-Ile-Tyr Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 NRFGTHFONZYFNY-MGHWNKPDSA-N 0.000 description 1
- DSFYPIUSAMSERP-IHRRRGAJSA-N Leu-Leu-Arg Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCCN=C(N)N DSFYPIUSAMSERP-IHRRRGAJSA-N 0.000 description 1
- IFMPDNRWZZEZSL-SRVKXCTJSA-N Leu-Leu-Cys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(O)=O IFMPDNRWZZEZSL-SRVKXCTJSA-N 0.000 description 1
- XVZCXCTYGHPNEM-UHFFFAOYSA-N Leu-Leu-Pro Natural products CC(C)CC(N)C(=O)NC(CC(C)C)C(=O)N1CCCC1C(O)=O XVZCXCTYGHPNEM-UHFFFAOYSA-N 0.000 description 1
- VCHVSKNMTXWIIP-SRVKXCTJSA-N Leu-Lys-Ser Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O VCHVSKNMTXWIIP-SRVKXCTJSA-N 0.000 description 1
- WMIOEVKKYIMVKI-DCAQKATOSA-N Leu-Pro-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O WMIOEVKKYIMVKI-DCAQKATOSA-N 0.000 description 1
- RNYLNYTYMXACRI-VFAJRCTISA-N Leu-Thr-Trp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O RNYLNYTYMXACRI-VFAJRCTISA-N 0.000 description 1
- AIQWYVFNBNNOLU-RHYQMDGZSA-N Leu-Thr-Val Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O AIQWYVFNBNNOLU-RHYQMDGZSA-N 0.000 description 1
- HQBOMRTVKVKFMN-WDSOQIARSA-N Leu-Trp-Val Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](C(C)C)C(O)=O HQBOMRTVKVKFMN-WDSOQIARSA-N 0.000 description 1
- JGKHAFUAPZCCDU-BZSNNMDCSA-N Leu-Tyr-Leu Chemical compound CC(C)C[C@H]([NH3+])C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C([O-])=O)CC1=CC=C(O)C=C1 JGKHAFUAPZCCDU-BZSNNMDCSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- XFIHDSBIPWEYJJ-YUMQZZPRSA-N Lys-Ala-Gly Chemical compound OC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN XFIHDSBIPWEYJJ-YUMQZZPRSA-N 0.000 description 1
- AIRZWUMAHCDDHR-KKUMJFAQSA-N Lys-Leu-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O AIRZWUMAHCDDHR-KKUMJFAQSA-N 0.000 description 1
- GILLQRYAWOMHED-DCAQKATOSA-N Lys-Val-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCCCN GILLQRYAWOMHED-DCAQKATOSA-N 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 208000024556 Mendelian disease Diseases 0.000 description 1
- QTZXSYBVOSXBEJ-WDSKDSINSA-N Met-Asp Chemical compound CSCC[C@H](N)C(=O)N[C@H](C(O)=O)CC(O)=O QTZXSYBVOSXBEJ-WDSKDSINSA-N 0.000 description 1
- ZBLSZPYQQRIHQU-RCWTZXSCSA-N Met-Thr-Val Chemical compound CSCC[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O ZBLSZPYQQRIHQU-RCWTZXSCSA-N 0.000 description 1
- UXJHNUBJSQQIOC-SZMVWBNQSA-N Met-Trp-Val Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](C(C)C)C(O)=O UXJHNUBJSQQIOC-SZMVWBNQSA-N 0.000 description 1
- GHQFLTYXGUETFD-UFYCRDLUSA-N Met-Tyr-Tyr Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)O)N GHQFLTYXGUETFD-UFYCRDLUSA-N 0.000 description 1
- 206010027457 Metastases to liver Diseases 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 1
- WUGMRIBZSVSJNP-UHFFFAOYSA-N N-L-alanyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)C(N)C)C(O)=O)=CNC2=C1 WUGMRIBZSVSJNP-UHFFFAOYSA-N 0.000 description 1
- PESQCPHRXOFIPX-UHFFFAOYSA-N N-L-methionyl-L-tyrosine Natural products CSCCC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 PESQCPHRXOFIPX-UHFFFAOYSA-N 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- LPMXVESGRSUGHW-GHYGWZAOSA-N Ouabain Natural products O([C@@H]1[C@@H](O)[C@@H](O)[C@@H](O)[C@H](C)O1)[C@H]1C[C@@H](O)[C@@]2(CO)[C@@](O)(C1)CC[C@H]1[C@]3(O)[C@@](C)([C@H](C4=CC(=O)OC4)CC3)C[C@@H](O)[C@H]21 LPMXVESGRSUGHW-GHYGWZAOSA-N 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- DXGDXPBHUPFGGI-DUVDYHTOSA-N P.[2HH].[3H][V].[Y].[Y] Chemical compound P.[2HH].[3H][V].[Y].[Y] DXGDXPBHUPFGGI-DUVDYHTOSA-N 0.000 description 1
- NPUMGENRRUINKI-UHFFFAOYSA-N P.[V].[W] Chemical compound P.[V].[W] NPUMGENRRUINKI-UHFFFAOYSA-N 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 238000010222 PCR analysis Methods 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- HTKNPQZCMLBOTQ-XVSYOHENSA-N Phe-Asn-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC1=CC=CC=C1)N)O HTKNPQZCMLBOTQ-XVSYOHENSA-N 0.000 description 1
- NAXPHWZXEXNDIW-JTQLQIEISA-N Phe-Gly-Gly Chemical compound OC(=O)CNC(=O)CNC(=O)[C@@H](N)CC1=CC=CC=C1 NAXPHWZXEXNDIW-JTQLQIEISA-N 0.000 description 1
- IAOZOFPONWDXNT-IXOXFDKPSA-N Phe-Ser-Thr Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O IAOZOFPONWDXNT-IXOXFDKPSA-N 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- JMVQDLDPDBXAAX-YUMQZZPRSA-N Pro-Gly-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1 JMVQDLDPDBXAAX-YUMQZZPRSA-N 0.000 description 1
- RYJRPPUATSKNAY-STECZYCISA-N Pro-Ile-Tyr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)NC(=O)[C@@H]2CCCN2 RYJRPPUATSKNAY-STECZYCISA-N 0.000 description 1
- RMODQFBNDDENCP-IHRRRGAJSA-N Pro-Lys-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O RMODQFBNDDENCP-IHRRRGAJSA-N 0.000 description 1
- JDJMFMVVJHLWDP-UNQGMJICSA-N Pro-Thr-Phe Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O JDJMFMVVJHLWDP-UNQGMJICSA-N 0.000 description 1
- VBZXFFYOBDLLFE-HSHDSVGOSA-N Pro-Trp-Thr Chemical compound N([C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H]([C@H](O)C)C(O)=O)C(=O)[C@@H]1CCCN1 VBZXFFYOBDLLFE-HSHDSVGOSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 244000078856 Prunus padus Species 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- OBXVZEAMXFSGPU-FXQIFTODSA-N Ser-Asn-Arg Chemical compound C(C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CO)N)CN=C(N)N OBXVZEAMXFSGPU-FXQIFTODSA-N 0.000 description 1
- HJEBZBMOTCQYDN-ACZMJKKPSA-N Ser-Glu-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O HJEBZBMOTCQYDN-ACZMJKKPSA-N 0.000 description 1
- QYSFWUIXDFJUDW-DCAQKATOSA-N Ser-Leu-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O QYSFWUIXDFJUDW-DCAQKATOSA-N 0.000 description 1
- UBRMZSHOOIVJPW-SRVKXCTJSA-N Ser-Leu-Lys Chemical compound OC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(O)=O UBRMZSHOOIVJPW-SRVKXCTJSA-N 0.000 description 1
- UPLYXVPQLJVWMM-KKUMJFAQSA-N Ser-Phe-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(O)=O UPLYXVPQLJVWMM-KKUMJFAQSA-N 0.000 description 1
- SRSPTFBENMJHMR-WHFBIAKZSA-N Ser-Ser-Gly Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O SRSPTFBENMJHMR-WHFBIAKZSA-N 0.000 description 1
- VLMIUSLQONKLDV-HEIBUPTGSA-N Ser-Thr-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O VLMIUSLQONKLDV-HEIBUPTGSA-N 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 244000166550 Strophanthus gratus Species 0.000 description 1
- 101150050863 T gene Proteins 0.000 description 1
- 241000589500 Thermus aquaticus Species 0.000 description 1
- GFDUZZACIWNMPE-KZVJFYERSA-N Thr-Ala-Met Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(O)=O GFDUZZACIWNMPE-KZVJFYERSA-N 0.000 description 1
- VRUFCJZQDACGLH-UVOCVTCTSA-N Thr-Leu-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O VRUFCJZQDACGLH-UVOCVTCTSA-N 0.000 description 1
- SPVHQURZJCUDQC-VOAKCMCISA-N Thr-Lys-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O SPVHQURZJCUDQC-VOAKCMCISA-N 0.000 description 1
- KPNSNVTUVKSBFL-ZJDVBMNYSA-N Thr-Met-Thr Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)O)C(=O)O)N)O KPNSNVTUVKSBFL-ZJDVBMNYSA-N 0.000 description 1
- GUHLYMZJVXUIPO-RCWTZXSCSA-N Thr-Met-Val Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(O)=O GUHLYMZJVXUIPO-RCWTZXSCSA-N 0.000 description 1
- MXDOAJQRJBMGMO-FJXKBIBVSA-N Thr-Pro-Gly Chemical compound C[C@@H](O)[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O MXDOAJQRJBMGMO-FJXKBIBVSA-N 0.000 description 1
- HUPLKEHTTQBXSC-YJRXYDGGSA-N Thr-Ser-Tyr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 HUPLKEHTTQBXSC-YJRXYDGGSA-N 0.000 description 1
- LECUEEHKUFYOOV-ZJDVBMNYSA-N Thr-Thr-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@@H](N)[C@@H](C)O LECUEEHKUFYOOV-ZJDVBMNYSA-N 0.000 description 1
- BZTSQFWJNJYZSX-JRQIVUDYSA-N Thr-Tyr-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O BZTSQFWJNJYZSX-JRQIVUDYSA-N 0.000 description 1
- YOPQYBJJNSIQGZ-JNPHEJMOSA-N Thr-Tyr-Tyr Chemical compound C([C@H](NC(=O)[C@@H](N)[C@H](O)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=C(O)C=C1 YOPQYBJJNSIQGZ-JNPHEJMOSA-N 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- DVLHKUWLNKDINO-PMVMPFDFSA-N Trp-Tyr-Leu Chemical compound [H]N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(O)=O DVLHKUWLNKDINO-PMVMPFDFSA-N 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- TVOGEPLDNYTAHD-CQDKDKBSSA-N Tyr-Ala-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 TVOGEPLDNYTAHD-CQDKDKBSSA-N 0.000 description 1
- TZXFLDNBYYGLKA-BZSNNMDCSA-N Tyr-Asp-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=C(O)C=C1 TZXFLDNBYYGLKA-BZSNNMDCSA-N 0.000 description 1
- AZGZDDNKFFUDEH-QWRGUYRKSA-N Tyr-Gly-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CC1=CC=C(O)C=C1 AZGZDDNKFFUDEH-QWRGUYRKSA-N 0.000 description 1
- GGXUDPQWAWRINY-XEGUGMAKSA-N Tyr-Ile-Gly Chemical compound OC(=O)CNC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 GGXUDPQWAWRINY-XEGUGMAKSA-N 0.000 description 1
- NKUGCYDFQKFVOJ-JYJNAYRXSA-N Tyr-Leu-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 NKUGCYDFQKFVOJ-JYJNAYRXSA-N 0.000 description 1
- KSCVLGXNQXKUAR-JYJNAYRXSA-N Tyr-Leu-Glu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O KSCVLGXNQXKUAR-JYJNAYRXSA-N 0.000 description 1
- SOAUMCDLIUGXJJ-SRVKXCTJSA-N Tyr-Ser-Asn Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O SOAUMCDLIUGXJJ-SRVKXCTJSA-N 0.000 description 1
- KHPLUFDSWGDRHD-SLFFLAALSA-N Tyr-Tyr-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CC3=CC=C(C=C3)O)N)C(=O)O KHPLUFDSWGDRHD-SLFFLAALSA-N 0.000 description 1
- 108010064997 VPY tripeptide Proteins 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- VFOHXOLPLACADK-GVXVVHGQSA-N Val-Gln-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](C(C)C)N VFOHXOLPLACADK-GVXVVHGQSA-N 0.000 description 1
- PIFJAFRUVWZRKR-QMMMGPOBSA-N Val-Gly-Gly Chemical compound CC(C)[C@H]([NH3+])C(=O)NCC(=O)NCC([O-])=O PIFJAFRUVWZRKR-QMMMGPOBSA-N 0.000 description 1
- HQYVQDRYODWONX-DCAQKATOSA-N Val-His-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CO)C(=O)O)N HQYVQDRYODWONX-DCAQKATOSA-N 0.000 description 1
- BMOFUVHDBROBSE-DCAQKATOSA-N Val-Leu-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](C(C)C)N BMOFUVHDBROBSE-DCAQKATOSA-N 0.000 description 1
- NSUUANXHLKKHQB-BZSNNMDCSA-N Val-Pro-Trp Chemical compound CC(C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(O)=O)CC1=CNC2=CC=CC=C12 NSUUANXHLKKHQB-BZSNNMDCSA-N 0.000 description 1
- QWCZXKIFPWPQHR-JYJNAYRXSA-N Val-Pro-Tyr Chemical compound CC(C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 QWCZXKIFPWPQHR-JYJNAYRXSA-N 0.000 description 1
- OFTXTCGQJXTNQS-XGEHTFHBSA-N Val-Thr-Ser Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](C(C)C)N)O OFTXTCGQJXTNQS-XGEHTFHBSA-N 0.000 description 1
- 241000602423 Vibrio cholerae O1 Species 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- NWJUARNXABNMDW-UHFFFAOYSA-N [V][W] Chemical compound [V][W] NWJUARNXABNMDW-UHFFFAOYSA-N 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 208000037919 acquired disease Diseases 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 108010076324 alanyl-glycyl-glycine Proteins 0.000 description 1
- 108010050025 alpha-glutamyltryptophan Proteins 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 229910021502 aluminium hydroxide Inorganic materials 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 239000012298 atmosphere Substances 0.000 description 1
- OHDRQQURAXLVGJ-HLVWOLMTSA-N azane;(2e)-3-ethyl-2-[(e)-(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound [NH4+].[NH4+].S/1C2=CC(S([O-])(=O)=O)=CC=C2N(CC)C\1=N/N=C1/SC2=CC(S([O-])(=O)=O)=CC=C2N1CC OHDRQQURAXLVGJ-HLVWOLMTSA-N 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- 238000010364 biochemical engineering Methods 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 210000000234 capsid Anatomy 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 230000005859 cell recognition Effects 0.000 description 1
- 229940030156 cell vaccine Drugs 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 229960003677 chloroquine Drugs 0.000 description 1
- WHTVZRBIWZFKQO-UHFFFAOYSA-N chloroquine Natural products ClC1=CC=C2C(NC(C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-UHFFFAOYSA-N 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 238000004891 communication Methods 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 230000001010 compromised effect Effects 0.000 description 1
- 238000002939 conjugate gradient method Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 230000016396 cytokine production Effects 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 230000007402 cytotoxic response Effects 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 210000003162 effector t lymphocyte Anatomy 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 238000005194 fractionation Methods 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 108010062266 glycyl-glycyl-argininal Proteins 0.000 description 1
- 108010089804 glycyl-threonine Proteins 0.000 description 1
- 108010015792 glycyllysine Proteins 0.000 description 1
- 101150106093 gpt gene Proteins 0.000 description 1
- 244000144993 groups of animals Species 0.000 description 1
- 210000004524 haematopoietic cell Anatomy 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 108010018006 histidylserine Proteins 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 101150062015 hyg gene Proteins 0.000 description 1
- 230000036737 immune function Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000002998 immunogenetic effect Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000010324 immunological assay Methods 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 238000011221 initial treatment Methods 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 1
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 108010057821 leucylproline Proteins 0.000 description 1
- 108010012058 leucyltyrosine Proteins 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000012669 liquid formulation Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 210000000207 lymphocyte subset Anatomy 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 239000003068 molecular probe Substances 0.000 description 1
- 108700043516 mouse H-2Kb Proteins 0.000 description 1
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 1
- 229960000951 mycophenolic acid Drugs 0.000 description 1
- 230000025020 negative regulation of T cell proliferation Effects 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 125000003835 nucleoside group Chemical group 0.000 description 1
- TVMXDCGIABBOFY-UHFFFAOYSA-N octane Chemical compound CCCCCCCC TVMXDCGIABBOFY-UHFFFAOYSA-N 0.000 description 1
- 238000005580 one pot reaction Methods 0.000 description 1
- LPMXVESGRSUGHW-HBYQJFLCSA-N ouabain Chemical compound O[C@@H]1[C@H](O)[C@@H](O)[C@H](C)O[C@H]1O[C@@H]1C[C@@]2(O)CC[C@H]3[C@@]4(O)CC[C@H](C=5COC(=O)C=5)[C@@]4(C)C[C@@H](O)[C@@H]3[C@@]2(CO)[C@H](O)C1 LPMXVESGRSUGHW-HBYQJFLCSA-N 0.000 description 1
- 229960003343 ouabain Drugs 0.000 description 1
- 210000002741 palatine tonsil Anatomy 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 1
- 210000001539 phagocyte Anatomy 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 108010055837 phosphocarrier protein HPr Proteins 0.000 description 1
- 230000008884 pinocytosis Effects 0.000 description 1
- 230000003169 placental effect Effects 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000447 polyanionic polymer Polymers 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000009696 proliferative response Effects 0.000 description 1
- 108010020755 prolyl-glycyl-glycine Proteins 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000030788 protein refolding Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 238000011536 re-plating Methods 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000004064 recycling Methods 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 210000001995 reticulocyte Anatomy 0.000 description 1
- 239000012266 salt solution Substances 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 230000002992 thymic effect Effects 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- MNRILEROXIRVNJ-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=NC=N[C]21 MNRILEROXIRVNJ-UHFFFAOYSA-N 0.000 description 1
- 238000012090 tissue culture technique Methods 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 108010080629 tryptophan-leucine Proteins 0.000 description 1
- 108010044292 tryptophyltyrosine Proteins 0.000 description 1
- 229910052721 tungsten Inorganic materials 0.000 description 1
- 108010003137 tyrosyltyrosine Proteins 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 229940075420 xanthine Drugs 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/42—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins
- C07K16/4208—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig
- C07K16/4241—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig against anti-human or anti-animal Ig
- C07K16/4258—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig against anti-human or anti-animal Ig against anti-receptor Ig
- C07K16/4266—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig against anti-human or anti-animal Ig against anti-receptor Ig against anti-tumor receptor Ig
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y10—TECHNICAL SUBJECTS COVERED BY FORMER USPC
- Y10S—TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y10S530/00—Chemistry: natural resins or derivatives; peptides or proteins; lignins or reaction products thereof
- Y10S530/806—Antigenic peptides or proteins
Definitions
- the present invention relates to T cell epitopes, and in particular to molecules for delivering such epitopes so as to raise a cytotoxic T cell (CTL) response.
- the molecules may be modified antibodies, especially human monoclonal IgG1 antibodies which bind to CD64 receptor and which are engineered to express T cell epitopes within their CDR regions to stimulate both helper and cytotoxic T cell responses.
- Antibodies are composed of constant regions (Fc) that determine the effector function of the antibody and the antigen binding domains (Fab) which comprise a unique set of complementarity determining regions (CDRs).
- Fc constant regions
- Fab antigen binding domains
- CDRs complementarity determining regions
- Fc receptor internalisation of antigen-antibody complexes by dendritic cells also allows more efficient processing of antigen into class I and class II presentation pathways to allow stimulation of not only helper but also cytotoxic T cell responses (Regnault et al., (1999) J exp Med. 189: 371-380). Furthermore, Fc receptor internalisation activates dendritic cells to express co-stimulatory molecules essential for priming naive responses. Fc receptor internalisation is a consequence of receptor cross linking by antigen/antibody complexes and previous studies have shown that Ab alone cannot mediate this effect.
- WO 96/19584 discloses chimeric antibodies in which T cell epitopes are inserted into the CDRs of an antibody, and alleges that such chimeric antibodies are suitable for raising a CTL response.
- this document only discloses that a CTL can be induced by nucleic acid encoding such a chimeric antibody but does not disclose how a CTL response can be induced by the application of chimeric antibody itself.
- lines 8-10 that “only proteins synthesised by the target cells themselves are presented by MHC class I molecules and recognised by CTLs”.
- WO 00/64488 discloses that a CTL response can be raised by nucleic acid encoding a chimeric antibody having heterologous T cell epitopes inserted in the CDRs thereof, provided that the nucleic acid is directed for expression in haematopoietic cells.
- human monoclonal antibodies which have distinct T cell epitopes within their CDR regions can stimulate both helper and antigen specific T cell responses.
- human Fc ⁇ I region is essential for the generation of the cytotoxic responses and greatly increases the sensitivity of stimulating helper T cell responses.
- This region binds CD64 of dendritic cells. Accordingly, it can be used to deliver T cell epitopes to dendritic cells which can process them and present them to T cells, thereby stimulating cytotoxic and/or helper T cell responses.
- the present invention provides the use of a polypeptide which comprises (i) a first portion comprising the part of human Fc which binds to CD64, and (ii) a second portion comprising one or more heterologous T cell epitopes in the manufacture of a medicament for stimulating a cytotoxic T cell response.
- the first portion may comprise the Fc segment of IgG, for example IgG1.
- the first portion may comprise the heavy chain ( ⁇ ) region of the Fc segment.
- the first portion comprises the heavy chain ( ⁇ ) region of the Fc segment of IgG1 (Fc ⁇ I).
- Heterologous T cell epitope is intended to mean a T cell epitope which is heterologous to the first portion.
- the second portion comprises the Fab fragment of an antibody
- a heterologous T cell epitope is one which was not previously present in the Fab fragment.
- the second portion may be a polypeptide.
- the second portion may be a Fab fragment, which may be from human or non-human, preferably, mouse. It is preferred if the, or each, T cell epitope is/are inserted to replace the CDRs, although this is not necessary, provided that the T cell epitopes are delivered to and presented by antigen presenting cells.
- the heterologous T cell epitope may be inserted as a whole, although it may made up from an inserted amino acid sequence, together with flanking amino acids of the second portion.
- an anti-idiotypic antibody may be raised in one species, e.g. mouse, in respect of a particular antigen, and the Fab fragment of that antibody grafted to the part of human Fc which binds to CD64.
- polypeptide means, in general terms, a plurality of amino acid residues joined together by peptide bonds. It is used interchangeably and means the same as peptide, protein, oligopeptide, or oligomer.
- polypeptide is also intended to include fragments, analogues and derivatives of a polypeptide wherein the fragment, analogue or derivative retains essentially the same biological activity or function as a reference protein.
- polypeptide useful in the invention is a protein domain Fc construct or a monoclonal antibody.
- Polypeptides useful in the present invention may be referred to herein as “Immunobodies”.
- the invention provides nucleic acid encoding the polypeptide of the first aspect of the invention.
- the nucleic acid may be DNA, cDNA, or RNA such as mRNA obtained by cloning or produced by chemical synthesis.
- the nucleic acid is preferably in a form capable of being expressed in the subject to be treated.
- the polypeptide useful in the present invention or the nucleic acid of the present invention may be provided as an isolate, in isolated and/or purified form, or free or substantially free of material with which it is naturally associated. In the case of a nucleic acid, it may be free or substantially free of nucleic acid flanking the gene in the human genome, except possibly one or more regulatory sequence(s) for expression. Nucleic acid may be wholly or partially synthetic and may include genomic DNA, cDNA or RNA. Where nucleic acid according to the invention includes RNA, reference to the sequence shown should be construed as reference to the RNA equivalent, with U substituted for T.
- Nucleic acid sequences encoding a polypeptide useful in the present invention can be readily prepared by the skilled person, for example using the information and references contained herein and techniques known in the art (for example, see Sambrook, Fritsch and Maniatis, “Molecular Cloning”, A Laboratory Manual, Cold Spring Harbor Laboratory Press, 1989, and Ausubel et al, Short Protocols in Molecular Biology, John Wiley and Sons, 1992), given the nucleic acid sequences and clones available. These techniques include (i) the use of the polymerase chain reaction (PCR) to amplify samples of such nucleic acid, e.g. from genomic sources, (ii) chemical synthesis, or (iii) preparing cDNA sequences.
- PCR polymerase chain reaction
- DNA encoding the polypeptide may be generated and used in any suitable way known to those of skill in the art, including by taking encoding DNA, identifying suitable restriction enzyme recognition sites either side of the portion to be expressed, and cutting out said portion from the DNA.
- the portion may then be operably linked to a suitable promoter in a standard commercially-available expression system.
- Another recombinant approach is to amplify the relevant portion of the DNA with suitable PCR primers. Modifications to the sequences can be made, e.g. using site directed mutagenesis, to lead to the expression of modified peptide or to take account of codon preferences in the host cells used to express the nucleic acid.
- the sequences can be incorporated into a vector having one or more control sequences operably linked to the nucleic o control its expression.
- the vectors may include other sequences such as prot or enhancers to drive the expression of the inserted nucleic acid, nucleic acid sequences so that the polypeptide is produced as a fusion and/or nucleic acid encoding secretion signals so that the polypeptide produced in the host cell is secreted from the cell.
- Polypeptide can btained by transforming the vectors into host cells in which the vector is fur ulturing the host cells so that the polypeptide is produced and recovering the polypeptide from the host cells or the surrounding medium.
- Prokaryotic and eukaryotic cells are used for this purpose in the art, including strains of E. coli , yeast, and eukaryotic cells such as insect cells, and animal cells, for example, COS, CHO cells, Bowes Melanoma and other suitable human cells.
- the part of the human Fc of the first portion binds to CD64 of dendritic cells.
- a further aspect of the invention provides dendritic cells which present, express or are bound to the heterologous T cell epitopes of the second portion.
- the invention provides a method for stimulating a cytotoxic T cell response in a patient such as a mammal, including human, comprising administering to a recipient a therapeutically effective amount of a polypeptide which comprises (i) a first portion comprising the part of human Fc which binds to CD64, and (ii) a second portion comprising one or more heterologous T cell epitopes.
- the invention further provides a method for stimulating a cytotoxic T cell response in a patient such as a mammal, including human, comprising administering to a recipient a therapeutically effective amount of a nucleic acid encoding a polypeptide which comprises (i) a first portion comprising the part of human Fc which binds to CD64, and (ii) a second portion comprising one or more heterologous T cell epitopes.
- a nucleic acid encoding a polypeptide which comprises (i) a first portion comprising the part of human Fc which binds to CD64, and (ii) a second portion comprising one or more heterologous T cell epitopes.
- the polypeptide and the nucleic acid are administered as a combination therapy.
- the polypeptide or nucleic acid may be administered intravenously, intradermally, intramuscularly, orally or by other routes.
- Intradermal or intramuscular administration is preferred because these tissues contain dendritic cells and they do not have high levels of serum IgG that may act as a competitive inhibitor for binding to CD64.
- the term “treatment” includes any regime that can benefit a human or non-human animal.
- the treatment may be of an inherited or acquired disease.
- the treatment is of a condition/disorder associated with cell proliferation such as cancer.
- the polypeptide or nucleic acid may be employed in combination with a pharmaceutically acceptable carrier or carriers.
- a pharmaceutically acceptable carrier or carriers may include, but are not limited to, saline, buffered saline, dextrose, liposomes, water, glycerol, ethanol and combinations thereof.
- Adjuvants may be employed to facilitate stimulation of the host's immune response, and may include, aluminium hydroxide, lysolecithin, pluronic, polyols, polyanions, peptides, proteins and oil emulsions.
- the present invention relates to raising an anti-idiotypic antibody in one species, e.g. mouse, in respect of a particular antigen, grafting the Fab fragment of that antibody, or a polypeptide fragment, (which may be at least 300 amino acids in length, or even at least 10-20 amino acids long, for example, 16 amino acids (corresponding to the size of a class II epitope) or 9 amino acids (corresponding to the size of a class I epitope) in length) to the part of human Fc which binds to CD64 (e.g. human Fc ⁇ I), and using the resulting polypeptide to raise a cytotoxic T cell response against that antigen.
- a polypeptide fragment which may be at least 300 amino acids in length, or even at least 10-20 amino acids long, for example, 16 amino acids (corresponding to the size of a class II epitope) or 9 amino acids (corresponding to the size of a class I epitope) in length
- CD64 e.g. human Fc ⁇ I
- the present invention relates to a method of engineering T cell epitopes from target antigens into any of the CDR regions of human monoclonal IgG1 antibodies, and the use of such engineered antibodies as vaccines to stimulate both helper and cytotoxic T cell responses.
- T cell epitope can be inserted, provided that the antibody can bind to CD64 and stimulate a cytotoxic T cell response.
- T cell epitopes from pathogens such as HIV, Hepatitis C and other infections that require CTLs to clear latent infections may be used, although it is preferred if the epitope is a “self-epitope”, i.e. associated with a condition/disorder associated with cell proliferation such as cancer.
- the T cell epitope is such that the antibody can fold correctly and be secreted. It is therefore preferred if the inserted epitopes are of similar size and amino acid composition to the original CDRs.
- the second portion may have a plurality of different T cell epitopes so as to generate a wide variety of T cell vaccines.
- the second portion may incorporate multiple epitopes from a single antigen, thereby ensuring that the majority of individuals with different HLA types respond to the single vaccine.
- multiple T cell epitopes from multiple antigens targeting a restricted spectrum of HLA types could be inserted.
- the molecules may include a variety of antigens from a single pathogen or cancer type or they could include disperate antigens targeting a wide range of solid tumours or pathogens.
- the molecules may even be designed to target different cell populations within a tumour, such as tumour epithelial and endothelial antigens.
- a preferred polypeptide useful in the present invention is a human IgG1 monoclonal antibody engineered to express within its CDR regions cytotoxic T cell epitopes, optionally with helper T cell epitopes.
- the human monoclonal antibodies useful in the invention may be prepared by immortalising nucleic acid sequences that encode antibodies.
- the immortalisation process may be carried out by hybridoma fusion techniques, by viral transformation of human antibody-producing lymphocytes, by techniques that combine cell fusion and viral transformation methodologies, or by any other technique known to the skilled person.
- the polypeptide useful in the present invention is prepared using a combination of Epstein-Barr virus (EBV) transformation and hybridoma fusion techniques, such as those described by Kozbor et al., Proc. Natl. Acad. Sci. (1982) 79:6551.
- the hybridomas may be created by fusing stimulated B cells obtained from a human, with a mouse/human heterohybrid fusion partner.
- a variety of such fusion partners have been described. See, for example, James & Bell, J. Immunol. Methds . (1987) 100:5-04 and U.S. Pat. No. 4,624,921.
- a mouse/human fusion partner may be constructed by fusing human lymphocytes stimulated or transformed by EBV with readily-available mouse myeloma lines such as NS-1 or P3NS-1, in the presence of polyethylene glycol, for instance.
- the hybrid could be suitably drug-marked, which may be accomplished by cultivation of the hybrid in increasing concentrations of the desired drug, such as 6-thiogua-nine, ouabain, or neomycin.
- the immortalisation of cells producing the human anti-idiotype antibodies of interest may be accomplished using EBV transformation techniques.
- EBV transformation techniques For example, B-lymphocytes derived from peripheral blood, bone marrow, lymph nodes, tonsils, etc. of patients immunised with the idiotype antibody are immortalised using EBV according to methods such as those described in U.S. Pat. No. 4,464,465 and Chan et al., J Immunol. ( 1986) 136:106.
- the hybridomas or lymphobastoid cells which secrete the antibody of interest may be identified by screening culture supernatants for human IgG1 production. Cells from wells possessing the desired activity may be cloned and subcloned in accordance with conventional techniques, and monitored until stable immortalised lines producing the human monoclonal antibody of interest are identified.
- monoclonal antibody is meant an antibody produced by a clonal, continuous cell line separate from cells which produce monoclonal antibodies of a different specificity. Thus, such antibodies are produced isolated from other antibodies and, accordingly, in substantially pure form at a concentration greater than normally occurring in human serum.
- the immortalised cell lines of the present invention may also be fused with other cell, to produce hybridomas or heterohybridomas, and thus provide for the transfer of genes encoding the human monoclonal antibodies.
- recombinant DNA techniques may be used to isolate and transfer the DNA encoding the immunoglobulins or regions thereof to a variety of hosts for specific antibody production.
- the invention further includes a modified antibody having the constant region of a human antibody, and the variable or hypervariable region of a mouse monoclonal antibody into which heterologoous T cell epitopes have been inserted, and its use in raising a CTL response.
- the variable region other than the hypervariable region may also be derived from the variable region of a human antibody.
- Such an antibody is said to be humanised. Methods for making humanised antibodies are known in the art. Methods are described, for example, in Winter, U.S. Pat. No. 5,225,539.
- variable region of the antibody outside of the mouse hypervariable region may also be derived from a mouse monoclonal antibody.
- the entire variable region is derived from murine monoclonal antibody and the antibody is said to be chimerised.
- Methods for making chimerised antibodies are known in the art. Such methods include, for example, those described in U.S. patents by Boss (Celltech) and by Cabilly (Genentech). See also U.S. Pat. Nos. 4,816,397 and 4,816,567, respectively.
- the invention includes the use of modified human monoclonal antibodies having the constant region of a human IgG1 antibody but replacement of one or more of the hypervariable regions with T cell epitopes for inducing a CTL response.
- a modified antibody of the present invention can have one, two, three, four, five or all of its hypervariable regions replaced with T cell epitopes.
- the incorporated T cell epitopes are of similar size and charge to the amino acids of the original CDR of the antibody so that the antibody folds and is secreted correctly.
- T cell epitopes can be predicted using known T cell algorithms or synthesised as peptides and screened using standard T cell assays.
- the identified T cell epitopes may be cytotoxic T cell epitopes and/or helper T cell epitopes, and may have a preferred amino acid length 9-20 amino acids.
- epitopes are preferably carefully matched to the closest CDR of a human monoclonal antibody and the sequences modified using site directed mutagenesis of the encoding DNA.
- Each CDR is preferably replaced sequentially and the ability of the immunobody to fold and be secreted as an intact immunoglobulin molecule screened.
- the ability of the immunobody to stimulate helper and cytotoxic T cell responses can be screened as exemplified herein.
- the invention further includes a modified antibody having the constant region of a human antibody fused to a whole or domain of a protein into which heterologous T cell epitopes have been inserted, and its use in raising a CTL response.
- Polypeptides useful in the present invention can incorporate multiple T cell epitopes from a single target antigen that can bind to the majority of both class I and class II MHC molecules. This may create a vaccine that can be used in widespread population vaccination. Alternatively polypeptides useful in the invention can incorporate multiple T cell epitopes from multiple target antigens that can bind to the most common class I and class II phenotypes. This may create a vaccine that may prevent selection of antigen loss variants.
- Target antigens may be from a single pathogen or tumour type or may be selected to give an immune response against a variety of pathogens or cancers.
- Polypeptides useful in the present invention targeting specific common HLA phenotypes may incorporate numerous T cell epitopes from a wide variety of cancers and/or pathogens, providing a single vaccine to prevent disease.
- the present invention also encompasses a method of making a polypeptide of the first aspect, the method including expression from nucleic acid encoding the polypeptide (generally nucleic acid according to the invention). This may conveniently be achieved by growing a host cell in culture, containing such a vector, under appropriate conditions which cause or allow expression of the polypeptide. Polypeptides may also be expressed in in vitro systems, such as reticulocyte lysate.
- Suitable host cells include bacteria, eukaryotic cells such as mammalian and yeast, and baculovirus systems.
- Mammalian cell lines available in the art for expression of a heterologous polypeptide include Chinese hamster ovary cells, HeLa cells, baby hamster kidney cells, COS cells and many others.
- a common, preferred bacterial host is E. coli.
- Suitable vectors can be chosen or constructed, containing appropriate regulatory sequences, including promoter sequences, terminator fragments, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate.
- Vectors may be plasmids, viral e.g. ‘phage, or phagemid, as appropriate.
- phage a virus
- Many techniques and protocols for manipulation of nucleic acid for example in preparation of nucleic acid constructs, mutagenesis, sequencing, introduction of DNA into cells and gene expression, and analysis of proteins, are described in detail in Current Protocols in Molecular Biology, Ausubel et al. eds., John Wiley and Sons, 1992.
- a further aspect of the present invention provides a host cell containing heterologous nucleic acid as disclosed herein.
- the nucleic acid of the invention may be integrated into the genome (e.g. chromosome) of the host cell. Integration may be promoted by inclusion of sequences which promote recombination with the genome in accordance with standard techniques.
- the nucleic acid may be on an extra-chromosomal vector within the cell, or otherwise identifiably heterologous or foreign to the cell.
- a still further aspect provides a method which includes introducing the nucleic acid into a host cell.
- the introduction which may (particularly for in vitro introduction) be generally referred to without limitation as “transformation”, may employ any available technique.
- suitable techniques may include calcium phosphate transfection, DEAE-Dextran, electroporation, liposome-mediated transfection and transduction using retrovirus or other virus, e.g. vaccinia or, for insect cells, baculovirus.
- suitable techniques may include calcium chloride transformation, electroporation and transfection using bacteriophage.
- direct injection of the nucleic acid could be employed.
- Marker genes such as antibiotic resistance or sensitivity genes may be used in identifying clones containing nucleic acid of interest, as is well known in the art.
- the introduction may be followed by causing or allowing expression from the nucleic acid, e.g. by culturing host cells (which may include cells actually transformed although more likely the cells will be descendants of the transformed cells) under conditions for expression of the gene, so that the encoded polypeptide (or peptide) is produced. If the polypeptide is expressed coupled to an appropriate signal leader peptide it may be secreted from the cell into the culture medium.
- a polypeptide or peptide may be isolated and/or purified from the host cell and/or culture medium, as the case may be, and subsequently used as desired, e.g. in the formulation of a composition which may include one or more additional components, such as a pharmaceutical composition which includes one or more pharmaceutically acceptable excipients, vehicles or carriers (e.g. see below).
- compositions can be formulated in pharmaceutical compositions.
- These compositions may comprise, in addition to one of the above substances, a pharmaceutically acceptable excipient, carrier, buffer, stabiliser or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient.
- the precise nature of the carrier or other material may depend on the route of administration, e.g. intradermal, oral, intravenous, cutaneous or subcutaneous, nasal, intramuscular, intraperitoneal routes.
- the formulation is preferably liquid, and is ordinarily a physiologic salt solution containing non-phosphate buffer at pH 6.8-7.6, or may be lyophilised powder.
- compositions comprising or for the delivery of polypeptides are preferably administered to an individual in a “therapeutically effective amount”, this being sufficient to show benefit to the individual.
- the actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated. Prescription of treatment, e.g. decisions on dosage etc, is within the responsibility of general practitioners and other medical doctors, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners.
- the polypeptides of the invention are particularly relevant to the treatment of existing cancer and in the prevention of the recurrence of cancer after initial treatment or surgery. Examples of the techniques and protocols mentioned above can be found in Remington's Pharmaceutical Sciences, 16 th edition, Oslo, A. (ed), 1980.
- the polypeptides of the invention stimulate helper and cytotoxic T cells that can significantly inhibit the growth of tumour cells when administered to a human in an effective amount.
- the optimal dose can be determined by physicians based on a number of parameters including, for example, age, sex, weight, severity of the condition being treated, the active ingredient being administered and the route of administration. For example, a dose of 10-100 ⁇ g of polypeptides is sufficient to stimulate both helper and cytotoxic T cell responses.
- polypeptides of the invention may be administered along with additional pharmaceutically acceptable ingredients.
- additional pharmaceutically acceptable ingredients include, for example, immune system stimulators.
- a composition may be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated.
- Other cancer treatments include other monoclonal antibodies, other chemotherapeutic agents, other radiotherapy techniques or other immuno therapy known in the art.
- One particular application of the compositions of the invention are as an adjunct to surgery, i.e. to help to reduce the risk of cancer reoccurring after a tumour is removed.
- Injections (im) may be the primary route for therapeutic administration of the polypeptides of this invention.
- Liquid formulations may be utilised after reconstitution from powder formulations.
- the polypeptides may be administered in a localised manner to a tumour site or other desired site or may be delivered in a manner in which it targets tumour or other cells.
- the dose of polypeptide will be dependent upon the properties of the agent employed, e.g. its binding activity and in vivo plasma half-life, the concentration of the polypeptide in the formulation, the administration route, the site and rate of dosage, the clinical tolerance of the patient involved, the pathological condition afflicting the patient and the like, as is well within the skill of the physician. For example, doses of 100 ⁇ g of polypeptide per patient per administration are preferred, although dosages may range from about 10 ⁇ g to 1 mg per dose. Different dosages are utilised during a series of sequential inoculations; the practitioner may administer an initial inoculation and then boost with relatively smaller doses of antibody.
- polypeptide compositions of the invention can be administered in a variety of ways and to different classes of recipients.
- types of cancer that can be treated with the antibody include colorectal cancer, lung, breast, gastric and ovarian cancers.
- the invention is also directed to optimise immunisation schedules for enhancing a protective immune response against cancer.
- the invention provides nucleic acid, encoding a polypeptide which comprises (i) a first portion comprising the part of human Fc which binds to CD64 and (ii) a second portion comprising one or more heterologous T cell epitopes, which is administered in combination with an isolated or recombinant polypeptide comprising (i) a first portion comprising the part of human Fc which binds to CD64 and (ii) a second portion comprising one or more heterologous T cell epitopes.
- the administration of the nucleic acid and isolated or recombinant polypeptide may take place either simultaneously or sequentially dependent upon the condition to be treated.
- the nucleic acid may be formulated as a DNA vaccine such as described herein.
- FIG. 1 Human monoclonal antibody stimulating helper T cell proliferation in donors expressing HLA-DR, 1,3,7,11 and 15 haplotypes
- FIG. 2 Human monoclonal antibody stimulating helper T cell proliferation responses ( ⁇ ). Results show that removing the Fc to form a Fab fragment significantly reduced the sensitivity of T cells to proliferate ( ⁇ ). No response was seen to hIgG that does not express a T cell epitope ( ⁇ ).
- FIG. 3 A human monoclonal IgG1 antibody stimulates helper T cell proliferation responses that are inhibited by an excess of hIgG that competes for Fc binding.
- FIG. 4 Chomeric hIgG1 708 antibody but not mouse ( ⁇ ) or human IgG ( ⁇ ) or medium alone stimulated proliferation of lymphocytes from naive donors.
- FIG. 5 Chomeric human IgG1 708 ( ⁇ ) antibody but not mouse 708 ( ⁇ ) or hIgG ( ⁇ ) induced redirected killing by human CD8 T cells of a mouse cell line P815 coated with OKT3 antibody. Cytotoxicity was assessed by chromium release at different effector target ratios.
- FIG. 6 Mice immunised with a 105AD7 DNA vaccine induced CTL responses that recognise target cells pulsed with CDRH3 peptide.
- FIG. 7 HLA matched human IgG1 708 can stimulate cytotoxic T cells that recognise tumour cells expressing CEA antigen. These results show 708 mimics a T cell epitope processed and presented from CEA antigens which are expressed by target cells.
- FIG. 8 Cytotoxic T Cell Assay following DNA Prime/Protein Boost (open symbols refer to target cells pulsed with irrelevant peptide; closed symbols refer to mice pulsed with H-2Kd peptide).
- FIGS. 9 a and 9b a. Antibody Heavy Chain Expression Vector Antibody b. Light Chain Expression Vector.
- FIGS. 10 a and 10b a. Effect of C-terminal amino acid insertions. FLWGPRALV in SC100 CDRs b. Effect of C-terminal amino acid insertions. Percentage change from native, FLWGPRALV in SC100 CDRs.
- FIG. 11 Effects of C-Terminal Amino Acid Substitutions on the NetChop Y Value of Tyrosine (TPPA Y PPNAPIL); T Helper Epitope in SC100 CDR-L1.
- FIG. 12 Molecular Model of the Fv Region of the Antibody SC100.
- FIG. 13 X-Ray Crystal Structure of the T Helper Epitope TPPAYRPPNAPIL.
- FIG. 14 Molecular Model of the Fv Region of the Antibody SC100 (top view).
- FIG. 15 Diagrammatic representation of Mutation PCR.
- FIG. 16 Agarose Gel Representation of CTL1 L3 Mutation PCR.
- FIG. 17 Agarose Gel Representation of Mutational Asymmetric PCR Results.
- FIG. 18 PCR Analysis of CDR-L3 Sequence Mutations.
- FIG. 19 Result of Clone 74:1 DNA Sequencing
- FIG. 20 Results of CTL Assays
- FIG. 21 Proliferation of T Cell Clone to Tie-2 Fc Presented by Dendritic Cells.
- 105AD7 is a human IgGI monoclonal antibody (Austin et at., (1989) Immunol, 67: 525-530) purified from tissue culture supernatant on a protein G column. Fab was produced using immobilised papain (Pierce, Chester, UK), protein A removal of Fc and size fractionation on S400 sepharose (Pharmacia, Upsala, Sweden). Polyclonal human IgG (Sigma, Poole, UK) was used as a control antibody (Sigma, Poole, Dorset, UK). Keyhole limpet haemocyanin (KLH, Sigma) was used as a control antigen to measure naive immune responses. 708 is a mouse lgG2b monoclonal antibody purified from tissue culture supernatant on a protein A column (Durrant et at., (1992) Int. J. Cancer 50: 811-816).
- Chimeric 708 was prepared broadly according to the protocol of (Orlandi et al., (1989) Proc. Natl. Acad. Sci (USA) 86: 3833-3837). PCR was used to link the heavy and light chains variable region sequences from hybridoma 708 with flanking sequences from vectors M13-VHPCR1 and M13-VKPCR1 respectively. The resulting heavy chain variable region cassette was sub cloned into mammalian expression vector pSVgpt containing a human heavy chain constant region. Similarly, the 708 light chain variable region cassette was sub-cloned into the expression vector pSVhyg containing a human kappa chain constant region.
- Vectors were linearised with Pvu1 and co-transfected into nonsecreting mouse myeloma line NSO by electroporation.
- Transfectomas growing in 96 well dishes were selected by growth in medium containing xanthine and mycophenolic acid and supernatants screened for production of human immunoglobulin after 14 days. Screening was by an ELISA, developed with an anti-human kappa chain specific reagent (The Binding Site, Birmingham, UK). The best producing line was expanded for antibody production and chimeric antibody was prepared using a protein A agarose preparation and conditions recommended by the supplier (Bioprocessing Ltd. Consett, UK).
- Venous blood samples were taken into preservative-free heparin from normal healthy donors. All blood had been HLA typed using molecular probes. Blood samples were separated on lymphoprep (Flow laboratories, Irvine, Scotland) and peripheral blood mononuclear cells (PBMC) isolated at the plasma/lymphoprep interface. A sample of PBMCs was removed, irradiated and used as antigen presenting cells. The remaining PBMCs were depleted of CD45RO cells by magnetic bead depletion (Dynal, Oslo Norway). The CD45RA cells were used at 2 ⁇ 10 6 /ml in serum free AIMV (Life Technologies, Paisley, Scotland) supplemented with 4 mM glutamine.
- PBMC peripheral blood mononuclear cells
- 105AD7 (0.003-30 g/ml), 105AD7 Fab (0.01-30 g/ml), control human IgG antibody (10 g/ml), mouse 708 (10 g/ml) or chimeric 708 (10 g/ml).
- antigen presenting cells were pulsed with 105AD7 for 2 hrs in the presence or absence of the inhibitors. Antigen presenting cells were then washed prior to addition of naive T cells. All cultures were incubated in a humidified atmosphere of 5% CO 2 and 95% air at 37C. After 5 days IL-2 (10/ml; Eurocetus, UK) was added.
- Proliferation of naive lumphocytes was quantitifed after 7-10 days. Proliferation was estimated using 3 [H] thymidine incorporation of quadruplicate samples. This was carried out by resuspending the bulk cultures, removing 4 ⁇ 1001 aliquots of cells and replating in 96 well plates prior to pulsing overnight with 3 H-thymidine.
- ⁇ IFN and IL-4 were detected using a sandwich ELISA using Duo set antibodies (Genzyme, Cambridge, Mass.).
- Peripheral blood mononuclear cells (2 ⁇ 10 5 ) were incubated with a panel of monoclonal antibodies directly labelled with fluorescein isothiocyanate (FITC) or phycoerythrin (PE) for dual colour analysis of lymphocyte subsets.
- Antibodies tested were 2H4 FITC (CD45RA) in combination with either CD4-PE or CD8-PE to enumerate memory or activated T helper and cytotoxic T cells respectively.
- Antibodies were obtained from Becton Dickinson (Cowley, Oxford, UK). After 30 min incubation at 4C, PBMC were washed twice by centrifugation and analyzed using a FACScan flow cytometer (Becton Dickinson, Sunnyvale, Calif.).
- CD45RO depleted lymphocytes from normal donors were stimulated for 9-10 days as described above and were then assayed for lytic activity by a redirected cytotoxicity assay.
- P815 cells were labelled with chromium (10 6 cells labelled with 100 ⁇ Ci of 51 [Cr] -chromium for 1 hr at 37° C.) and washed extensively. Labelled cells were then coated with OKT3 antibody (20 ⁇ g/ml, 30 min, 5 ⁇ 10 3 /well at 4° C.).
- Responder cells were mixed with 10 4 chromium labelled target cells to produce ratios of 100:1-12.5:1. Chromium release was measured in 50 ⁇ l of supernatant at 4 hrs.
- CEA purified by affinity chromatography from colorectal cancer liver metastases
- microtitre plates 5 ⁇ g/ml
- Plates were blocked with 1% BSA.
- Mouse or chimerised 708 was preincubated with biotinylated NCRC23 (Ab1) for 1 hr at 4C prior to adding to the CEA coated plates. Binding of biotinylated NCRC23 was detected with streptavidin horseradish peroxidase (SA-HRP; Gibco-BRL, Gaithersburg, Md.).
- the ELISA was developed with ABTS substrate (Sigma) solution (0.50 ⁇ g/ml, 2,2′-azino-bis-3-ethyl-benzthiazoline-6-sulphonate) in 15 ml 0.1M citrate phophate buffer, pH4.0, with 30 v/v hydrogen peroxide added at 0.3 ⁇ l/ml immediately before use. Absorbance was read at 405 nm.
- FIG. 1 shows proliferation responses of lymphocytes from 6 naive donors to in vitro stimulation 105AD7 (10 ⁇ g/ml: ′), human IgG (10 ⁇ g/ml; ⁇ ) KLH (10 ⁇ g/ml; ⁇ ) or medium alone ( ⁇ ). Proliferation was assessed at days 7,8,9 and 10 of in vitro culture and measured by an overnight pulse with 3 [H]-thymidine.
- Results were analysed for statistical significance by one way analysis of variance, using the Bonferroni modified least significant difference method to allow for multiple comparisons.
- Donors expressing HLA/DR1,3,7,11 and 15phenotypes showed a significant response to 105AD7 but not to human IgG.
- the only consistent non-responder had an HLA/DR4,8 phenotype suggesting that these are non-permissive haplotypes.
- Proliferation to 105AD7 peaked at 8-10 days in all donors indicating primary kinetic responses.
- the immunophenotypes of the cells responding to 105AD7 were measured by immunofluorescence and flow cytometry (Table 1). At the start of the cultures there were twice as many CD4 as CD8 T cells and greater than 80% of the cultures expressed the CD45RA antigen. After 10 days, cultures stimulated with 105AD7 had 4.4 times more CD4 cells than CD8 cells suggesting it was the CD4 cells that were predominantly proliferating. However, this effect was not as dramatic as seen in the cells cultured with KLH, as after 10 days there were 7 times more CD4 than CD8 cells.
- Ratio of T cell subsets 1 Redirected Cytotoxicity CD4/8 CD4/8 CD45RO/ ⁇ IFN (% cytotoxicity) 3 Stimulant pre post RApost (pg/ml) 2 100:1 50:1 25:1 12.5:1 105AD7 2.3 4.4 2.0 750 34 ⁇ 2 22 ⁇ 3 15 ⁇ 1 7 ⁇ 1 HigG 2.3 2.3 1.0 ⁇ 62.5 6 ⁇ 1 1 ⁇ 0.2 1 ⁇ 0.2 ND KLH 2.3 6.9 6.5 >>1,000 2 ⁇ 0.01 2 ⁇ 0.2 0 ⁇ 0.1 1 ⁇ 0.1
- Results were analysed for statistical significance by one way analysis of variance, using the Bonferroni modified least significant difference method to allow for multiple comparisons. Although both 105AD7 and Fab stimulate significant proliferation, FIG. 2 shows that the Fab was 1,000 fold less efficient at stimulating T cell proliferation than the whole antibody.
- 708 is a mouse IgG2b monoclonal antibody which mimics CEA and can stimulate T cell responses in vitro in lymphocytes from colorectal cancer patients.
- 708 failed to stimulate unprimed human T cells from healthy donors. Its mouse Fc region was therefore replaced with human Fc to see if this improved its ability to stimulate T cell responses.
- the chimerised antibody was produced and showed similar binding to the mouse anti-idiotype as both mouse and chimerised 708 inhibited binding of Ab1, to CEA.
- FIG. 4 shows that only chimeric 708 and not mouse 708 induced a significant proliferative response when compared to medium alone indicating the importance of a human IgG1 constant region.
- Lymphocytes from naive donors were stimulated in vitro with either chimeric 708 (10 ⁇ g/ml), mouse 708 (10 ⁇ g/ml), human IgG (10 ⁇ g/ml) or no antigen (media).
- ⁇ IFN production in culture supernatants was measured by sandwich ELISA (range 62.5-1500 pg/ml), following primary stimulation for 10 days, or 5-days post-restimulation.
- FIG. 5 shows redirected cytotoxicity following a) 9 days of primary in vitro culture or b) 5 days following restimulation with either mouse 708 ( ⁇ ), chimeric 708 (′) or human IgG ( ⁇ ). Cytotoxicity was assessed by killing of 51 [Cr]-chromium labelled P815 cells coated with OKT3 antibody at different effector: target cell ratios. Chimerised 708 but not mouse 708 or human IgG could stimulate T cells to induce significant cell lysis. These cultures could be boosted by further in vitro stimulation to produce a higher level of cytotoxicity (FIG. 7 b ).
- 105AD7 cytotoxic T cell epitopes within the human monoclonal antibody.
- 105AD7 was reconfigured as a scFv-DNA vaccine by cloning the antibody and then joining the hypervariable regions of the heavy and light chain with either a 15 (scFv-15) or a 5 amino acid (scFv-5) linker.
- the CHRH3 region of 105AD7 was cloned and spliced to its leader sequence to form a minigene.
- FIG. 6 shows CTL responses following vaccination with A) scFv-15, B) scFv-5, C) the minigene and D) the control vector pCR3.1.
- Mice were vaccinated at weeks 0, 2 and 7 and the spleens harvested at week 8. The splenocytes were cultured in vitro for 6 days with 105AD7.
- P815 target cells were labelled with 51 Cr+/ ⁇ the CDRH3 peptide. Specific cell lysis was then measured using effector: target ratios of 100:1 to 12.5:1.
- Mice immunised with 105AD7 DNA vaccine stimulated cytotoxic T cell responses against target cells pulsed with the CDRH3 peptide.
- FIG. 7 shows the cytotoxicity following 28 days of primary in vitro culture of human lymphocytes with deimmunised 708 (′) with restimulation on days 7, 14 and 21. Cytotoxicity was assessed by killing of 51 [Cr]-chromium labelled human tumour cells expressing CEA at different effector: target cell ratios. Deimmunised 708 could stimulate T cells to induce significant cell lysis of HLA matched target cells expressing CEA.
- 105AD7 was used as an example of a human Fc region linked to a mouse H-2Kb CTL epitope.
- 105AD7 was reconfigured as a scFv DNA vaccine by cloning the antibody and then joining the hypervariable regions of the heavy and light chains with a 5 amino acid linker. This DNA was coated onto gold particles and this DNA was administered to balb/c mice intradermally using a helium powered GeneGun (Biorad Laboratories Limited, Hemel Hempstead, UK).
- H-2Kd peptide 100 ⁇ g per 2 ⁇ 10 7 cells incubated in 1 mL
- H-2Kd peptide 100 ⁇ g per 2 ⁇ 10 7 cells incubated in 1 mL
- these cells were then washed and used as feeder cells for splenocytes from immunised mice. After 5 days incubation, these cells were forwarded for routine cytotoxic T cell experiment. Assays were set up, to analyse the response against an irrelevant peptide and the H-2Kd peptide.
- the antibody which was selected to deliver the CTL determinants is the de-immunised SC100 antibody (WO 01/88138).
- the use of a de-immunised antibody is advantageous in its utility as an epitope delivery system as the de-immunisation protocol removes any pre-existing T cell epitopes. This ensures an immunologically inert carrier that directs the immune responses against the ImmunoBody itself to be based on those epitopes grafted into the CDRs.
- the epitope chosen for initial analysis is a CTL epitope based on the MAGE-3 antigen that is over-expressed by malignant melanoma.
- the heavy chain expression vector pSV gptHuIgG1 is based on pSV 2 gpt (Mulligan and Berg, (1980) Science, 209: 1422-1427). It includes the ampicillin resistance gene for selection in bacterial cells, the gpt gene for selection in mammalian cells, the murine heavy chain immunoglobulin enhancer region, genomic sequence encoding the Human IgG1 constant region gene and SV40 poly A sequences.
- the heavy chain variable region for expression is inserted as a Hind 111 to BamH1 fragment.
- This expression cassette includes the murine heavy chain promoter, the signal peptide coding sequence and the signal sequence intron, the V H gene, the V-C splice donor sequence and intron sequences. Sites in brackets have been removed
- the light chain expression vector pSVhygHuC ⁇ is based on the vector pSVhyg. It includes the ampicillin resistance gene for selection in bacterial cells, the hyg gene for selection in mammalian cells, the murine heavy chain immunoglobulin enhancer region, genomic sequence encoding the Human kappa constant region gene and including the kappa enhancer and SV40 poly A sequences.
- the light chain variable region for expression is inserted as a Hind 111 to BamH1 fragment.
- This expression cassette includes the murine heavy chain promoter, the signal peptide coding sequence and the signal sequence intron, the V ⁇ gene, the V-C splice donor sequence and intron sequences.
- the antibody contains 6 CDRs (3 on the heavy and 3 on the light chain), it may be possible to replace any of these regions with the MAGE-3 epitope.
- this generalisation determined by the nature of the epitope to be introduced and the acceptor CDR site that is to receive it. Serious perturbations of the antibody secondary structure at the splicing site may have a deleterious effect on protein refolding to such an extent that immune function is impaired.
- a more rational approach based on the need to both preserve the structure of the antibody itself and more importantly to allow an element of control in the ultimate processing of the epitopes would seem to be of benefit in the design of an ImmunoBody molecule.
- a strategy based on both the use of algorithms which predict proteolytic cleavage of the molecule and molecular modelling of the native and grafted antibody was devised.
- NetChop set at a default threshold of 0.8 predicts no internal cleavage of CTL peptide when spliced into H1, H2, H3, L1 and L3 (Table 5b). Insertion into L2 gives one C-terminal cleavage site after the amino acid residue F. There is one internal cleavage site for all of the T helper insertions where the Y amino acid residue is cleaved at its N-terminus. NetChop also predicted that there are no C-terminal cleavage sites for the CTL epitope, but the T helper epitope in H2 and L1 is cleaved at its C-terminus.
- PaProC is more difficult to analyse empirically, since multiple cleavage sites are generated for each epitope, especially for T helper. Based on the data presented here, future sequence manipulations should therefore start with analysis of CTL in H1, H3 and L3 and T helper in H3 and L3.
- the score for these events is given as being that of the native value, so that the percentage change is recorded as zero. These events are therefore easily identifiable upon scrutiny of the graphical depiction.
- the addition of some of the amino acids at the C-terminus of the epitope may lead to an increase in the ability of the epitope to be successfully processed by C-terminal cleavage. These include C, G, K, R and S and to an extent in CDR H1 only, A. NetChop has also identified some amino acids, such as F, I P, V W and Y whose effects allied to the SC100 sequence hinder the processing of the epitope.
- the first residue (which is part of the antibody scaffold) downstream from the spliced epitope does not consist of one of those residues which is likely to lead to inappropriate processing of the epitope. This may give a further element of control over the resultant processing of the epitope by antigen presenting cells, allowing a semblance of predictability into the formation of the epitopic stimulant.
- the C-terminal cleavage of the sequence is altered to a position which maintains the integrity of the epitope to be presented, with obvious beneficial effects for presentation of the peptide.
- Some amino acids such as A, C, G, K, Q R and S
- Antibodies lend themselves to molecular modelling with relative ease due to their very high sequence similarity, even in the so-called variable region (Fv). Also, a large number of antibodies have been crystallized, whose co-ordinates have been deposited in the public access database, the Protein Data Bank (PDB). Other factors facilitate the modelling of antibodies such as canonical classification of the loop regions in the Fv, which are paramount to the normal function of binding to a target antigen.
- Fv variable region
- PDB Protein Data Bank
- the TH epitope has a high content of proline, which can mean forcing the sequence into a hairpin loop often observed in CDRs may be very difficult.
- CDR1 in the light chain lies in a relatively extended conformation along the top surface of the Fv. Also, because most of the loop is observed near the surface, it should be involved in less structural constraints as some parts, that are buried within the structure. This is highlighted in FIG. 14.
- the TH sequence was incorporated into the section of the CDR1 shown im the alignment viewed as Table 12. Residues which had been mutated were minimised as before. There were little or no problems with the incorporation of this epitope into the CDR1. Small sidechain clashes were alleviated by minimisation.
- the CDR-L3 was taken from file line.pdb and mutated to the desired sequence in Sybyl. This was then grafted on to the existing framework of the antibody between the cysteine and the valine. Sidechains of inserted residues were minimised, and the model was checked for any unusual sidechain clashed.
- this epitope is likely to exist in a relatively extended conformation, mainly due to the high proline content.
- the epitope would have to demonstrate a tight turn within part of the structure, and b-sheet like conformation in the rest of the peptide. It is the authors' opinion that this would not be possible for the TH epitope, and insertion of this peptide into this area would yield a defectively folded antibody. Therefore, this epitope has not been modelled.
- the primers are designed to replace the CDRs chosen with the epitope of interest. This is performed by a variation on the overlap extension (OLE) technique used for many DNA mutations. Unlike site directed mutagenesis which is mainly aimed at introducing point mutations, OLE allows the mutation of a number of nucleosides at once so that the need for sub-cloning is kept to a minimum.
- a primer is designed based on the sequences 5′ and 3′ of the length of DNA to be mutated and are manufactured to be exactly complementary to these regions. Providing sufficient complementarity is achieved here based on the number of residues chosen and their annealing strengths, the site in between this region can be any sequence of DNA.
- T helper epitope was unable to be modelled into CDR-H3 due to structural constraints.
- Many helper determinants are much larger than their CTL counterparts, so this may be indeed the case for many helper determinants.
- the CDR-L1 may be a more appropriate acceptor site for helper determinants.
- TPPAYRPNNAPIL cause modelled into CDR-L1 due to its more relaxed structure, which may also be the case for other helper determinants. Based on the results of the proteolytic cleavage and modelling studies the following initial construct-variants were chosen:
- FIG. 16 A representation of the agarose gel, identifying FLWGPRALV encoding SC100 CDR-L3 mutated PCR products is shown in FIG. 16.
- the upper and lower band configuration in lane 5 is consistent with the products of amplification theorised in FIG. 15.
- the upper band therefore should contain a proportion of mutated sequence, since the mutation primer is clearly able to anneal to the template strand, as shown by the presence of the lower band (which represents truncated, mutated sequence). Therefore cloning of the PCR products visually represented in lane 5 should be able to isolate mutated (non-truncated) PCR product.
- PCR amplification using such a primer as the forward primer in conjunction with the reverse primer of the original reaction should only yield amplification products in those clones where the mutation is present. In this manner, many clones can be analysed quickly and efficiently and yield products which can verify, due to their size, where on the native sequence the mutation has been introduced. Clones giving positive results here would then be used to produce plasmid for sequence verification.
- PCR products represented in FIG. 18 were therefore forwarded for cloning. This was achieved by using the TOPO TA cloning kit (Invitrogen Corporation, San Diego, Calif., USA).
- the cloning vector pCR®2.1-TOPO®
- T 3′-thymidine
- Topoisomerase I which is covalently bound to the vector.
- the cloning strategy takes into account the non-template dependent terminal transferase activity of the Thermus aquaticus (Taq) enzyme used in the generation of PCR products which adds a single deoxyadenosine (A) to the 3′ end of the PCR product.
- any PCR products can be cloned into this vector. Transformation of appropriate strains of E. coli facilitates the growing of PCR incorporated pCR®2.1-TOPO® plasmid for DNA sequencing analysis. As mentioned above transformed E. coli can be used directly in PCR reactions to analyse the mutation content of individual clones.
- Cloning was again performed in the manner described using the Invitrogen TOPO TA cloning strategy. Clones were positively identified with mutated CDR-L1 using PCR with the THL1 primer and one clone, namely 213:4 was forwarded for DNA sequence analysis. Sequence data for this clone is presented in FIG. 20.
- the primers have been carefully designed both to introduce appropriate primers into the CDRs of interest and to allow splicing of mutated DNA back into the original plasmids used for protein expression. This provides a way of examining the effects of the mutations produced against a background of native protein.
- the use of PCR also allows the sub-cloning of interesting products into other intermediate vectors in order for interim experiments to be performed. In this manner, we were able to introduce native and CDR mutated sequences into vectors appropriate for DNA vaccination experiments to be performed.
- the plasmid incorporated as the vaccine vehicle must contain a eukaryotic promoter sequence in order for this DNA to be transcribed and translated. Since the pCR®2.1-TOPO® vector contains a prokaryotic promoter region, so the mutated sequences of clones 74:1 and 213:4 had to be spliced into an alternate vector. Again an Invitrogen vector was chosen to achieve this, namely the vector pCR3.1®. This vector contains the cytomegalovirus (CMV) immediate-early promoter allowing high level expression of cloned genes in a eukaryotic system.
- CMV cytomegalovirus
- DNA vaccination itself was performed using GeneGun technology (Biorad Laboratories Limited, Hemel Hempsted, UK). Briefly, plasmid DNA is introduced intradermally into animals using a helium powered gun. The bullets take the form of gold particles which can be coated with DNA of choice. In our case plasmids produced from the clones 74:1, 213:4, K2 and H8 were mixed with gold particles and used to immunize groups of four mice. The following immunizations were studied:
- mice with having no immunisations were set up as well as positive control mice. These were mice immunised with the peptide FLWGPRALV in an appropriate immunisation regime for peptide immunogens.
- Splenocytes from immunised and control mice were harvested and cultured using standard tissue culture techniques and growth media. Na ⁇ ve mice were utilised to produce feeder cells for in vitro peptide stimulation by a standard technique based on the production of lipopolysaccharide (LPS) stimulated blasts cells (again of spleen origin). On day three, these LPS blast cells were irradiated and MAGE-3 peptide (FLWGPRALV: 100 ⁇ g per 2 ⁇ 10 7 cells incubated in 1 mL) added for 1 hour. These cells were then washed and used as feeder cells for splenocytes from immunised mice. After 5 days incubation, these cells were forwarded for routine cytotoxic T cell experiment. Assays were set up, to analyse the response against no peptide, au irrelevant peptide and the MAGE-3 peptide. The results of CTL assays are given in FIG. 20. The highest responder mice are viewed for each immunisation set.
- LPS lipopolys
- mice immunised with MAGE3 peptide there is killing at the highest effector: target ratio (E:T ratio) of cells pulsed with the MAGE-3 peptide.
- E:T ratio target ratio
- This result is virtually mirrored in the plasmid C74:1 immunised mice.
- the cytotoxic activity of the C74:1 (Mage 3 in CDR-L3) group mice is in sharp contrast to the lack of CTL activity in the K2 (Native SC100) plasmid immunised mice.
- the presence of the T helper epitope may be providing T cell help, as indicated by the fact that killing is occurring at a lower E:T ratio than seen in the C74:1 immunised group.
- Another observation from FIG. 20, is that relatively high cytotoxic activity seems to be occurring in the mice immunised with a combination of the plasmids C74:1 and H8 that encode both light and heavy chains in the same cell. This could have the effect of producing a whole ImmunoBody entity within the transfected cell. Presentation of the epitopes to antigen presenting cells could lead to cell killing, and to release of the whole ImmunoBody entity into the surrounding environment. This would then allow the targeting of Langerhan cells (specialised dendritic cells found in the skin) through CD64, the ligand being provided by the heavy chain portion of the ImmunoBody . This may account for the relatively higher amount of killing observed in this group.
- cDNA synthesised from 5 ⁇ g of total RNA isolated from the cell line TF1 (grown in the presence of 200 units/ml GMCSF) was used as a template for the amplification of truncated Tie-2 (1-196 amino acids) using the primers: 5′ primer, 5′-GAT CTC GAG ATT TGG GGA AGC ATG GAC-3′, corresponding to the nucleotide sequence 128-154 of the Tie-2 gene with an additional Xho1 restriction site; and 3′ primer, 5′-GAA GAT ATC TCC TCC TAT ATA CCT GGC CGA-3′, corresponding to the nucleotide sequence 716-745 of the Tie-2 gene with a incorporated EcoRV site.
- the PCR fragment was cut and ligated into the Xho-1/EcoRV multiple cloning site of the mammalian expression vector Signal pigplus (R and D systems) inframe with a CD33 signal sequence and C terminal human IgG, Fc tail to generate a secretory fusion protein.
- This plasmid was identified by restriction analysis and confirmed by DNA sequencing.
- Z84 primers anneal to the nucleotide sequence from 524-557; Z95 primers: 160-201;
- Z101 primers 512-548 And Z107 primers: 509-548 of the wild type Tie-2 gene. (Accession number L06139)
- Plasmids were sequenced using BigDye terminator cycle sequencing ready reaction (PE Applied Biosystems) and sequencing reactions were electrophoresed using the ABI prism 373A DNA sequencer (Applied Biosystems). Resulting DNA sequences were aligned with wild type cDNA (Accession no:.L06139) obtained from the NIH database using the Blast 2 pairwise search programme. 293 human kidney cells were stably transfected with tie2-Fc and the protein recovered from the supernatant purified on a protein A column.
- n is a or g or c or t 1 antngantgg gccctctaga tgcatgctcg agcggccgcc agtgtgatgg atatctgcag 60 aattcgccct ttgtgagant ctgccaggat ccaactgagg aagcaaagtt taaattctac 120 tcacgtttga ttcccagcttt ggtgcctcca ccgaaaacga gggcccttgg accccacagg 180 aagcagtaat aaattcccag atcctcagcc tccactctgc tgatcttgag tgaaatct 240 gtccctgatc cact
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Jellies, Jams, And Syrups (AREA)
Abstract
The invention relates to the use of a polypeptide which comprises i) a first portion comprising the part of human Fc which binds to CD64, and ii) a second portion comprising one or more heterologous T cell epitopes for stimulating a cytotoxic T cell response. The polypeptide may be an antibody which may be used to stimulate an cytotoxic T cell response against pathogens and tumour cells in patients in need of such treatment.
Description
- The present invention relates to T cell epitopes, and in particular to molecules for delivering such epitopes so as to raise a cytotoxic T cell (CTL) response. In the present invention, the molecules may be modified antibodies, especially human monoclonal IgG1 antibodies which bind to CD64 receptor and which are engineered to express T cell epitopes within their CDR regions to stimulate both helper and cytotoxic T cell responses.
- Antibodies are composed of constant regions (Fc) that determine the effector function of the antibody and the antigen binding domains (Fab) which comprise a unique set of complementarity determining regions (CDRs). The role of antibodies is to bind to antigens, thereby making them more visible to the immune system. Antigen-antibody (Ag-Ab) complexes can bind to Fc receptor on phagocytic cells to allow efficient digestion of harmful pathogens. Fc receptor internalisation also allows efficient antigen presentation to stimulate T cell responses. Previous studies have shown that Fc receptor internalisation of Ag-Ab complexes is 1,000 fold more efficient than pinocytosis for stimulation of helper T cell responses. More recently, it has been shown that Fc receptor internalisation of antigen-antibody complexes by dendritic cells also allows more efficient processing of antigen into class I and class II presentation pathways to allow stimulation of not only helper but also cytotoxic T cell responses (Regnault et al., (1999)J exp Med. 189: 371-380). Furthermore, Fc receptor internalisation activates dendritic cells to express co-stimulatory molecules essential for priming naive responses. Fc receptor internalisation is a consequence of receptor cross linking by antigen/antibody complexes and previous studies have shown that Ab alone cannot mediate this effect.
- Although several studies have suggested that anti-idiotype antibodies mimicking antigens can stimulate cytotoxic T cell responses, they have failed to demonstrate antigen-specific cytotoxic T cell responses stimulated by specific class I MHC presentation. Indeed, in a study whereby a helper and a cytotoxic T cell epitope were transplanted into the CDR region of a mouse antibody, only helper responses could be stimulated.
- For example, WO 96/19584 discloses chimeric antibodies in which T cell epitopes are inserted into the CDRs of an antibody, and alleges that such chimeric antibodies are suitable for raising a CTL response. However, this document only discloses that a CTL can be induced by nucleic acid encoding such a chimeric antibody but does not disclose how a CTL response can be induced by the application of chimeric antibody itself. Thus, it is stated at page 51, lines 8-10 that “only proteins synthesised by the target cells themselves are presented by MHC class I molecules and recognised by CTLs”.
- In addition, WO 00/64488 discloses that a CTL response can be raised by nucleic acid encoding a chimeric antibody having heterologous T cell epitopes inserted in the CDRs thereof, provided that the nucleic acid is directed for expression in haematopoietic cells.
- Surprisingly, the present inventors have found that certain human monoclonal antibodies which have distinct T cell epitopes within their CDR regions can stimulate both helper and antigen specific T cell responses. Furthermore, they have shown that human FcγI region is essential for the generation of the cytotoxic responses and greatly increases the sensitivity of stimulating helper T cell responses. This region binds CD64 of dendritic cells. Accordingly, it can be used to deliver T cell epitopes to dendritic cells which can process them and present them to T cells, thereby stimulating cytotoxic and/or helper T cell responses.
- Thus, in a first aspect, the present invention provides the use of a polypeptide which comprises (i) a first portion comprising the part of human Fc which binds to CD64, and (ii) a second portion comprising one or more heterologous T cell epitopes in the manufacture of a medicament for stimulating a cytotoxic T cell response.
- The first portion may comprise the Fc segment of IgG, for example IgG1. The first portion may comprise the heavy chain (γ) region of the Fc segment. Preferably, the first portion comprises the heavy chain (γ) region of the Fc segment of IgG1 (FcγI).
- “Heterologous T cell epitope” is intended to mean a T cell epitope which is heterologous to the first portion. For example, where the second portion comprises the Fab fragment of an antibody, a heterologous T cell epitope is one which was not previously present in the Fab fragment.
- The second portion may be a polypeptide. Alternatively, the second portion may be a Fab fragment, which may be from human or non-human, preferably, mouse. It is preferred if the, or each, T cell epitope is/are inserted to replace the CDRs, although this is not necessary, provided that the T cell epitopes are delivered to and presented by antigen presenting cells. The heterologous T cell epitope may be inserted as a whole, although it may made up from an inserted amino acid sequence, together with flanking amino acids of the second portion. Alternatively, for example, an anti-idiotypic antibody may be raised in one species, e.g. mouse, in respect of a particular antigen, and the Fab fragment of that antibody grafted to the part of human Fc which binds to CD64.
- In the prior art, it has been shown that FcγI can be used to direct molecules to dendritic cells (Liu et al, (1999)J. Clin Invest 98(9): 2001-2007). However, these studies were not able to show that such molecules could not stimulate a CTL response, in spite of earlier speculation that this might be possible (Guyre, et al, (1997) Cancer Immunol. Immunothr. 45: 146-148).
- As used herein, the term “polypeptide” means, in general terms, a plurality of amino acid residues joined together by peptide bonds. It is used interchangeably and means the same as peptide, protein, oligopeptide, or oligomer. The term “polypeptide” is also intended to include fragments, analogues and derivatives of a polypeptide wherein the fragment, analogue or derivative retains essentially the same biological activity or function as a reference protein.
- Preferably, the polypeptide useful in the invention is a protein domain Fc construct or a monoclonal antibody. Polypeptides useful in the present invention may be referred to herein as “Immunobodies”.
- The invention provides nucleic acid encoding the polypeptide of the first aspect of the invention. The nucleic acid may be DNA, cDNA, or RNA such as mRNA obtained by cloning or produced by chemical synthesis. For therapeutic use, the nucleic acid is preferably in a form capable of being expressed in the subject to be treated.
- The polypeptide useful in the present invention or the nucleic acid of the present invention may be provided as an isolate, in isolated and/or purified form, or free or substantially free of material with which it is naturally associated. In the case of a nucleic acid, it may be free or substantially free of nucleic acid flanking the gene in the human genome, except possibly one or more regulatory sequence(s) for expression. Nucleic acid may be wholly or partially synthetic and may include genomic DNA, cDNA or RNA. Where nucleic acid according to the invention includes RNA, reference to the sequence shown should be construed as reference to the RNA equivalent, with U substituted for T.
- Nucleic acid sequences encoding a polypeptide useful in the present invention can be readily prepared by the skilled person, for example using the information and references contained herein and techniques known in the art (for example, see Sambrook, Fritsch and Maniatis, “Molecular Cloning”, A Laboratory Manual, Cold Spring Harbor Laboratory Press, 1989, and Ausubel et al, Short Protocols in Molecular Biology, John Wiley and Sons, 1992), given the nucleic acid sequences and clones available. These techniques include (i) the use of the polymerase chain reaction (PCR) to amplify samples of such nucleic acid, e.g. from genomic sources, (ii) chemical synthesis, or (iii) preparing cDNA sequences. DNA encoding the polypeptide may be generated and used in any suitable way known to those of skill in the art, including by taking encoding DNA, identifying suitable restriction enzyme recognition sites either side of the portion to be expressed, and cutting out said portion from the DNA. The portion may then be operably linked to a suitable promoter in a standard commercially-available expression system. Another recombinant approach is to amplify the relevant portion of the DNA with suitable PCR primers. Modifications to the sequences can be made, e.g. using site directed mutagenesis, to lead to the expression of modified peptide or to take account of codon preferences in the host cells used to express the nucleic acid.
- In order to obtain expression of the nucleic acid sequences, the sequences can be incorporated into a vector having one or more control sequences operably linked to the nucleic o control its expression. The vectors may include other sequences such as protor enhancers to drive the expression of the inserted nucleic acid, nucleic acid sequences so that the polypeptide is produced as a fusion and/or nucleic acid encoding secretion signals so that the polypeptide produced in the host cell is secreted from the cell. Polypeptide canbtained by transforming the vectors into host cells in which the vector is furulturing the host cells so that the polypeptide is produced and recovering the polypeptide from the host cells or the surrounding medium. Prokaryotic and eukaryotic cells are used for this purpose in the art, including strains of E. coli, yeast, and eukaryotic cells such as insect cells, and animal cells, for example, COS, CHO cells, Bowes Melanoma and other suitable human cells.
- Preferably, the part of the human Fc of the first portion binds to CD64 of dendritic cells. Thus, a further aspect of the invention provides dendritic cells which present, express or are bound to the heterologous T cell epitopes of the second portion.
- In a second aspect, the invention provides a method for stimulating a cytotoxic T cell response in a patient such as a mammal, including human, comprising administering to a recipient a therapeutically effective amount of a polypeptide which comprises (i) a first portion comprising the part of human Fc which binds to CD64, and (ii) a second portion comprising one or more heterologous T cell epitopes. The invention further provides a method for stimulating a cytotoxic T cell response in a patient such as a mammal, including human, comprising administering to a recipient a therapeutically effective amount of a nucleic acid encoding a polypeptide which comprises (i) a first portion comprising the part of human Fc which binds to CD64, and (ii) a second portion comprising one or more heterologous T cell epitopes. Preferably, the polypeptide and the nucleic acid are administered as a combination therapy. In such a method, the polypeptide or nucleic acid may be administered intravenously, intradermally, intramuscularly, orally or by other routes.
- Intradermal or intramuscular administration is preferred because these tissues contain dendritic cells and they do not have high levels of serum IgG that may act as a competitive inhibitor for binding to CD64.
- As used herein, the term “treatment” includes any regime that can benefit a human or non-human animal. The treatment may be of an inherited or acquired disease. Preferably, the treatment is of a condition/disorder associated with cell proliferation such as cancer.
- The polypeptide or nucleic acid may be employed in combination with a pharmaceutically acceptable carrier or carriers. Such carriers may include, but are not limited to, saline, buffered saline, dextrose, liposomes, water, glycerol, ethanol and combinations thereof.
- Adjuvants may be employed to facilitate stimulation of the host's immune response, and may include, aluminium hydroxide, lysolecithin, pluronic, polyols, polyanions, peptides, proteins and oil emulsions.
- In one embodiment, the present invention relates to raising an anti-idiotypic antibody in one species, e.g. mouse, in respect of a particular antigen, grafting the Fab fragment of that antibody, or a polypeptide fragment, (which may be at least 300 amino acids in length, or even at least 10-20 amino acids long, for example, 16 amino acids (corresponding to the size of a class II epitope) or 9 amino acids (corresponding to the size of a class I epitope) in length) to the part of human Fc which binds to CD64 (e.g. human FcγI), and using the resulting polypeptide to raise a cytotoxic T cell response against that antigen.
- In certain other embodiments, the present invention relates to a method of engineering T cell epitopes from target antigens into any of the CDR regions of human monoclonal IgG1 antibodies, and the use of such engineered antibodies as vaccines to stimulate both helper and cytotoxic T cell responses.
- Any T cell epitope can be inserted, provided that the antibody can bind to CD64 and stimulate a cytotoxic T cell response. T cell epitopes from pathogens such as HIV, Hepatitis C and other infections that require CTLs to clear latent infections may be used, although it is preferred if the epitope is a “self-epitope”, i.e. associated with a condition/disorder associated with cell proliferation such as cancer. Preferably, the T cell epitope is such that the antibody can fold correctly and be secreted. It is therefore preferred if the inserted epitopes are of similar size and amino acid composition to the original CDRs. The second portion may have a plurality of different T cell epitopes so as to generate a wide variety of T cell vaccines. The second portion may incorporate multiple epitopes from a single antigen, thereby ensuring that the majority of individuals with different HLA types respond to the single vaccine. Alternatively, multiple T cell epitopes from multiple antigens targeting a restricted spectrum of HLA types could be inserted. The molecules may include a variety of antigens from a single pathogen or cancer type or they could include disperate antigens targeting a wide range of solid tumours or pathogens. The molecules may even be designed to target different cell populations within a tumour, such as tumour epithelial and endothelial antigens.
- A preferred polypeptide useful in the present invention is a human IgG1 monoclonal antibody engineered to express within its CDR regions cytotoxic T cell epitopes, optionally with helper T cell epitopes. The human monoclonal antibodies useful in the invention may be prepared by immortalising nucleic acid sequences that encode antibodies. The immortalisation process may be carried out by hybridoma fusion techniques, by viral transformation of human antibody-producing lymphocytes, by techniques that combine cell fusion and viral transformation methodologies, or by any other technique known to the skilled person.
- In one embodiment, the polypeptide useful in the present invention, is prepared using a combination of Epstein-Barr virus (EBV) transformation and hybridoma fusion techniques, such as those described by Kozbor et al.,Proc. Natl. Acad. Sci. (1982) 79:6551. For instance, the hybridomas may be created by fusing stimulated B cells obtained from a human, with a mouse/human heterohybrid fusion partner. A variety of such fusion partners have been described. See, for example, James & Bell, J. Immunol. Methds. (1987) 100:5-04 and U.S. Pat. No. 4,624,921. A mouse/human fusion partner may be constructed by fusing human lymphocytes stimulated or transformed by EBV with readily-available mouse myeloma lines such as NS-1 or P3NS-1, in the presence of polyethylene glycol, for instance. The hybrid could be suitably drug-marked, which may be accomplished by cultivation of the hybrid in increasing concentrations of the desired drug, such as 6-thiogua-nine, ouabain, or neomycin.
- Alternatively, the immortalisation of cells producing the human anti-idiotype antibodies of interest may be accomplished using EBV transformation techniques. For example, B-lymphocytes derived from peripheral blood, bone marrow, lymph nodes, tonsils, etc. of patients immunised with the idiotype antibody are immortalised using EBV according to methods such as those described in U.S. Pat. No. 4,464,465 and Chan et al.,J Immunol. (1986) 136:106.
- The hybridomas or lymphobastoid cells which secrete the antibody of interest may be identified by screening culture supernatants for human IgG1 production. Cells from wells possessing the desired activity may be cloned and subcloned in accordance with conventional techniques, and monitored until stable immortalised lines producing the human monoclonal antibody of interest are identified. By “monoclonal antibody” is meant an antibody produced by a clonal, continuous cell line separate from cells which produce monoclonal antibodies of a different specificity. Thus, such antibodies are produced isolated from other antibodies and, accordingly, in substantially pure form at a concentration greater than normally occurring in human serum.
- The immortalised cell lines of the present invention may also be fused with other cell, to produce hybridomas or heterohybridomas, and thus provide for the transfer of genes encoding the human monoclonal antibodies. Alternatively, recombinant DNA techniques may be used to isolate and transfer the DNA encoding the immunoglobulins or regions thereof to a variety of hosts for specific antibody production.
- The invention further includes a modified antibody having the constant region of a human antibody, and the variable or hypervariable region of a mouse monoclonal antibody into which heterologoous T cell epitopes have been inserted, and its use in raising a CTL response. The variable region other than the hypervariable region may also be derived from the variable region of a human antibody. Such an antibody is said to be humanised. Methods for making humanised antibodies are known in the art. Methods are described, for example, in Winter, U.S. Pat. No. 5,225,539.
- The variable region of the antibody outside of the mouse hypervariable region may also be derived from a mouse monoclonal antibody. In such case, the entire variable region is derived from murine monoclonal antibody and the antibody is said to be chimerised. Methods for making chimerised antibodies are known in the art. Such methods include, for example, those described in U.S. patents by Boss (Celltech) and by Cabilly (Genentech). See also U.S. Pat. Nos. 4,816,397 and 4,816,567, respectively.
- The invention includes the use of modified human monoclonal antibodies having the constant region of a human IgG1 antibody but replacement of one or more of the hypervariable regions with T cell epitopes for inducing a CTL response.
- A modified antibody of the present invention can have one, two, three, four, five or all of its hypervariable regions replaced with T cell epitopes. Preferably the incorporated T cell epitopes are of similar size and charge to the amino acids of the original CDR of the antibody so that the antibody folds and is secreted correctly. T cell epitopes can be predicted using known T cell algorithms or synthesised as peptides and screened using standard T cell assays. The identified T cell epitopes may be cytotoxic T cell epitopes and/or helper T cell epitopes, and may have a preferred amino acid length 9-20 amino acids. These epitopes are preferably carefully matched to the closest CDR of a human monoclonal antibody and the sequences modified using site directed mutagenesis of the encoding DNA. Each CDR is preferably replaced sequentially and the ability of the immunobody to fold and be secreted as an intact immunoglobulin molecule screened. The ability of the immunobody to stimulate helper and cytotoxic T cell responses can be screened as exemplified herein. The invention further includes a modified antibody having the constant region of a human antibody fused to a whole or domain of a protein into which heterologous T cell epitopes have been inserted, and its use in raising a CTL response.
- Polypeptides useful in the present invention can incorporate multiple T cell epitopes from a single target antigen that can bind to the majority of both class I and class II MHC molecules. This may create a vaccine that can be used in widespread population vaccination. Alternatively polypeptides useful in the invention can incorporate multiple T cell epitopes from multiple target antigens that can bind to the most common class I and class II phenotypes. This may create a vaccine that may prevent selection of antigen loss variants. Target antigens may be from a single pathogen or tumour type or may be selected to give an immune response against a variety of pathogens or cancers.
- Polypeptides useful in the present invention targeting specific common HLA phenotypes may incorporate numerous T cell epitopes from a wide variety of cancers and/or pathogens, providing a single vaccine to prevent disease.
- Thus, the present invention also encompasses a method of making a polypeptide of the first aspect, the method including expression from nucleic acid encoding the polypeptide (generally nucleic acid according to the invention). This may conveniently be achieved by growing a host cell in culture, containing such a vector, under appropriate conditions which cause or allow expression of the polypeptide. Polypeptides may also be expressed in in vitro systems, such as reticulocyte lysate.
- Systems for cloning and expression of a polypeptide in a variety of different host cells are well known. Suitable host cells include bacteria, eukaryotic cells such as mammalian and yeast, and baculovirus systems. Mammalian cell lines available in the art for expression of a heterologous polypeptide include Chinese hamster ovary cells, HeLa cells, baby hamster kidney cells, COS cells and many others. A common, preferred bacterial host isE. coli.
- Suitable vectors can be chosen or constructed, containing appropriate regulatory sequences, including promoter sequences, terminator fragments, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate. Vectors may be plasmids, viral e.g. ‘phage, or phagemid, as appropriate. For further details see, for example, Molecular Cloning: a Laboratory Manuel: 2nd edition, Sambrook et al., 1989, Cold Spring Harbor Laboratory Press. Many techniques and protocols for manipulation of nucleic acid, for example in preparation of nucleic acid constructs, mutagenesis, sequencing, introduction of DNA into cells and gene expression, and analysis of proteins, are described in detail in Current Protocols in Molecular Biology, Ausubel et al. eds., John Wiley and Sons, 1992.
- Thus, a further aspect of the present invention provides a host cell containing heterologous nucleic acid as disclosed herein.
- The nucleic acid of the invention may be integrated into the genome (e.g. chromosome) of the host cell. Integration may be promoted by inclusion of sequences which promote recombination with the genome in accordance with standard techniques. The nucleic acid may be on an extra-chromosomal vector within the cell, or otherwise identifiably heterologous or foreign to the cell.
- A still further aspect provides a method which includes introducing the nucleic acid into a host cell. The introduction, which may (particularly for in vitro introduction) be generally referred to without limitation as “transformation”, may employ any available technique. For eukaryotic cells, suitable techniques may include calcium phosphate transfection, DEAE-Dextran, electroporation, liposome-mediated transfection and transduction using retrovirus or other virus, e.g. vaccinia or, for insect cells, baculovirus. For bacterial cells, suitable techniques may include calcium chloride transformation, electroporation and transfection using bacteriophage. As an alternative, direct injection of the nucleic acid could be employed.
- Marker genes such as antibiotic resistance or sensitivity genes may be used in identifying clones containing nucleic acid of interest, as is well known in the art.
- The introduction may be followed by causing or allowing expression from the nucleic acid, e.g. by culturing host cells (which may include cells actually transformed although more likely the cells will be descendants of the transformed cells) under conditions for expression of the gene, so that the encoded polypeptide (or peptide) is produced. If the polypeptide is expressed coupled to an appropriate signal leader peptide it may be secreted from the cell into the culture medium. Following production by expression, a polypeptide or peptide may be isolated and/or purified from the host cell and/or culture medium, as the case may be, and subsequently used as desired, e.g. in the formulation of a composition which may include one or more additional components, such as a pharmaceutical composition which includes one or more pharmaceutically acceptable excipients, vehicles or carriers (e.g. see below).
- The polypeptides useful in the invention can be formulated in pharmaceutical compositions. These compositions may comprise, in addition to one of the above substances, a pharmaceutically acceptable excipient, carrier, buffer, stabiliser or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient. The precise nature of the carrier or other material may depend on the route of administration, e.g. intradermal, oral, intravenous, cutaneous or subcutaneous, nasal, intramuscular, intraperitoneal routes. The formulation is preferably liquid, and is ordinarily a physiologic salt solution containing non-phosphate buffer at pH 6.8-7.6, or may be lyophilised powder.
- The compositions comprising or for the delivery of polypeptides are preferably administered to an individual in a “therapeutically effective amount”, this being sufficient to show benefit to the individual. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated. Prescription of treatment, e.g. decisions on dosage etc, is within the responsibility of general practitioners and other medical doctors, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. The polypeptides of the invention are particularly relevant to the treatment of existing cancer and in the prevention of the recurrence of cancer after initial treatment or surgery. Examples of the techniques and protocols mentioned above can be found in Remington's Pharmaceutical Sciences, 16th edition, Oslo, A. (ed), 1980.
- Preferably, the polypeptides of the invention stimulate helper and cytotoxic T cells that can significantly inhibit the growth of tumour cells when administered to a human in an effective amount. The optimal dose can be determined by physicians based on a number of parameters including, for example, age, sex, weight, severity of the condition being treated, the active ingredient being administered and the route of administration. For example, a dose of 10-100 μg of polypeptides is sufficient to stimulate both helper and cytotoxic T cell responses.
- The polypeptides of the invention may be administered along with additional pharmaceutically acceptable ingredients. Such ingredients include, for example, immune system stimulators.
- A composition may be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated. Other cancer treatments include other monoclonal antibodies, other chemotherapeutic agents, other radiotherapy techniques or other immuno therapy known in the art. One particular application of the compositions of the invention are as an adjunct to surgery, i.e. to help to reduce the risk of cancer reoccurring after a tumour is removed.
- Injections (im) may be the primary route for therapeutic administration of the polypeptides of this invention. Liquid formulations may be utilised after reconstitution from powder formulations.
- The polypeptides may be administered in a localised manner to a tumour site or other desired site or may be delivered in a manner in which it targets tumour or other cells.
- The dose of polypeptide will be dependent upon the properties of the agent employed, e.g. its binding activity and in vivo plasma half-life, the concentration of the polypeptide in the formulation, the administration route, the site and rate of dosage, the clinical tolerance of the patient involved, the pathological condition afflicting the patient and the like, as is well within the skill of the physician. For example, doses of 100 μg of polypeptide per patient per administration are preferred, although dosages may range from about 10 μg to 1 mg per dose. Different dosages are utilised during a series of sequential inoculations; the practitioner may administer an initial inoculation and then boost with relatively smaller doses of antibody.
- The polypeptide compositions of the invention can be administered in a variety of ways and to different classes of recipients. Examples of types of cancer that can be treated with the antibody include colorectal cancer, lung, breast, gastric and ovarian cancers.
- This invention is also directed to optimise immunisation schedules for enhancing a protective immune response against cancer. In this respect, the invention provides nucleic acid, encoding a polypeptide which comprises (i) a first portion comprising the part of human Fc which binds to CD64 and (ii) a second portion comprising one or more heterologous T cell epitopes, which is administered in combination with an isolated or recombinant polypeptide comprising (i) a first portion comprising the part of human Fc which binds to CD64 and (ii) a second portion comprising one or more heterologous T cell epitopes. The administration of the nucleic acid and isolated or recombinant polypeptide may take place either simultaneously or sequentially dependent upon the condition to be treated. The nucleic acid may be formulated as a DNA vaccine such as described herein.
- Preferred features of each aspect of the invention are as for each of the other aspects mutatis mutandis. The prior art documents mentioned herein are incorporated to the fullest extent permitted by law.
- The invention will now be described further in the following non-limiting examples. Reference is made to the following drawings:
- FIG. 1—Human monoclonal antibody stimulating helper T cell proliferation in donors expressing HLA-DR, 1,3,7,11 and 15 haplotypes
- FIG. 2—Human monoclonal antibody stimulating helper T cell proliferation responses (▪). Results show that removing the Fc to form a Fab fragment significantly reduced the sensitivity of T cells to proliferate (). No response was seen to hIgG that does not express a T cell epitope (□).
- FIG. 3—A human monoclonal IgG1 antibody stimulates helper T cell proliferation responses that are inhibited by an excess of hIgG that competes for Fc binding.
- FIG. 4—
Chimeric hIgG1 708 antibody but not mouse (♦) or human IgG () or medium alone stimulated proliferation of lymphocytes from naive donors. - FIG. 5—Chimeric human IgG1 708 (▪) antibody but not mouse 708 (♦) or hIgG () induced redirected killing by human CD8 T cells of a mouse cell line P815 coated with OKT3 antibody. Cytotoxicity was assessed by chromium release at different effector target ratios.
- FIG. 6—Mice immunised with a 105AD7 DNA vaccine induced CTL responses that recognise target cells pulsed with CDRH3 peptide.
- FIG. 7—HLA matched
human IgG1 708 can stimulate cytotoxic T cells that recognise tumour cells expressing CEA antigen. These results show 708 mimics a T cell epitope processed and presented from CEA antigens which are expressed by target cells. - FIG. 8—Cytotoxic T Cell Assay following DNA Prime/Protein Boost (open symbols refer to target cells pulsed with irrelevant peptide; closed symbols refer to mice pulsed with H-2Kd peptide).
- FIGS. 9a and 9b: a. Antibody Heavy Chain Expression Vector Antibody b. Light Chain Expression Vector.
- FIGS. 10a and 10b: a. Effect of C-terminal amino acid insertions. FLWGPRALV in SC100 CDRs b. Effect of C-terminal amino acid insertions. Percentage change from native, FLWGPRALV in SC100 CDRs.
- FIG. 11. Effects of C-Terminal Amino Acid Substitutions on the NetChop Y Value of Tyrosine (TPPAYPPNAPIL); T Helper Epitope in SC100 CDR-L1.
- FIG. 12. Molecular Model of the Fv Region of the Antibody SC100.
- FIG. 13. X-Ray Crystal Structure of the T Helper Epitope TPPAYRPPNAPIL.
- FIG. 14. Molecular Model of the Fv Region of the Antibody SC100 (top view).
- FIG. 15. Diagrammatic representation of Mutation PCR.
- FIG. 16. Agarose Gel Representation of CTL1 L3 Mutation PCR.
- FIG. 17. Agarose Gel Representation of Mutational Asymmetric PCR Results.
- FIG. 18. PCR Analysis of CDR-L3 Sequence Mutations.
- FIG. 19. Result of Clone 74:1 DNA Sequencing
- FIG. 20. Results of CTL Assays
- FIG. 21. Proliferation of T Cell Clone to Tie-2 Fc Presented by Dendritic Cells.
- Material and Methods
- Antigens
- 105AD7 is a human IgGI monoclonal antibody (Austin et at., (1989)Immunol, 67: 525-530) purified from tissue culture supernatant on a protein G column. Fab was produced using immobilised papain (Pierce, Chester, UK), protein A removal of Fc and size fractionation on S400 sepharose (Pharmacia, Upsala, Sweden). Polyclonal human IgG (Sigma, Poole, UK) was used as a control antibody (Sigma, Poole, Dorset, UK). Keyhole limpet haemocyanin (KLH, Sigma) was used as a control antigen to measure naive immune responses. 708 is a mouse lgG2b monoclonal antibody purified from tissue culture supernatant on a protein A column (Durrant et at., (1992) Int. J. Cancer 50: 811-816).
-
Chimeric 708 was prepared broadly according to the protocol of (Orlandi et al., (1989) Proc. Natl. Acad. Sci (USA) 86: 3833-3837). PCR was used to link the heavy and light chains variable region sequences fromhybridoma 708 with flanking sequences from vectors M13-VHPCR1 and M13-VKPCR1 respectively. The resulting heavy chain variable region cassette was sub cloned into mammalian expression vector pSVgpt containing a human heavy chain constant region. Similarly, the 708 light chain variable region cassette was sub-cloned into the expression vector pSVhyg containing a human kappa chain constant region. Vectors were linearised with Pvu1 and co-transfected into nonsecreting mouse myeloma line NSO by electroporation. Transfectomas growing in 96 well dishes were selected by growth in medium containing xanthine and mycophenolic acid and supernatants screened for production of human immunoglobulin after 14 days. Screening was by an ELISA, developed with an anti-human kappa chain specific reagent (The Binding Site, Birmingham, UK). The best producing line was expanded for antibody production and chimeric antibody was prepared using a protein A agarose preparation and conditions recommended by the supplier (Bioprocessing Ltd. Consett, UK). - In Vitro Stimulation of Blood from Unimmunised Donors
- Venous blood samples were taken into preservative-free heparin from normal healthy donors. All blood had been HLA typed using molecular probes. Blood samples were separated on lymphoprep (Flow laboratories, Irvine, Scotland) and peripheral blood mononuclear cells (PBMC) isolated at the plasma/lymphoprep interface. A sample of PBMCs was removed, irradiated and used as antigen presenting cells. The remaining PBMCs were depleted of CD45RO cells by magnetic bead depletion (Dynal, Oslo Norway). The CD45RA cells were used at 2×106/ml in serum free AIMV (Life Technologies, Paisley, Scotland) supplemented with 4 mM glutamine. They were stimulated with 105AD7 (0.003-30 g/ml), 105AD7 Fab (0.01-30 g/ml), control human IgG antibody (10 g/ml), mouse 708 (10 g/ml) or chimeric 708 (10 g/ml). To assess inhibition of T cell proliferation by chloroquine or NH4CI, antigen presenting cells were pulsed with 105AD7 for 2 hrs in the presence or absence of the inhibitors. Antigen presenting cells were then washed prior to addition of naive T cells. All cultures were incubated in a humidified atmosphere of 5% CO2 and 95% air at 37C. After 5 days IL-2 (10/ml; Eurocetus, UK) was added. Proliferation of naive lumphocytes was quantitifed after 7-10 days. Proliferation was estimated using 3[H] thymidine incorporation of quadruplicate samples. This was carried out by resuspending the bulk cultures, removing 4×1001 aliquots of cells and replating in 96 well plates prior to pulsing overnight with 3H-thymidine.
- Cytokine Secretion
- γIFN and IL-4 were detected using a sandwich ELISA using Duo set antibodies (Genzyme, Cambridge, Mass.).
- Immunofluorescence
- Peripheral blood mononuclear cells (2×105) were incubated with a panel of monoclonal antibodies directly labelled with fluorescein isothiocyanate (FITC) or phycoerythrin (PE) for dual colour analysis of lymphocyte subsets. Antibodies tested were 2H4 FITC (CD45RA) in combination with either CD4-PE or CD8-PE to enumerate memory or activated T helper and cytotoxic T cells respectively. Antibodies were obtained from Becton Dickinson (Cowley, Oxford, UK). After 30 min incubation at 4C, PBMC were washed twice by centrifugation and analyzed using a FACScan flow cytometer (Becton Dickinson, Sunnyvale, Calif.).
- Redirected Cytotoxicity
-
- Competition Assay
- CEA (purified by affinity chromatography from colorectal cancer liver metastases) was coated onto microtitre plates (5 μg/ml) by overnight incubation at 4C. Plates were blocked with 1% BSA. Mouse or
chimerised 708 was preincubated with biotinylated NCRC23 (Ab1) for 1 hr at 4C prior to adding to the CEA coated plates. Binding of biotinylated NCRC23 was detected with streptavidin horseradish peroxidase (SA-HRP; Gibco-BRL, Gaithersburg, Md.). The ELISA was developed with ABTS substrate (Sigma) solution (0.50 μg/ml, 2,2′-azino-bis-3-ethyl-benzthiazoline-6-sulphonate) in 15 ml 0.1M citrate phophate buffer, pH4.0, with 30 v/v hydrogen peroxide added at 0.3 μl/ml immediately before use. Absorbance was read at 405 nm. - Statistics
- Immunological assay data was analysed by one way analysis of variance, using the Bonferroni modified least significant difference method to allow for multiple comparisons (SPSS/PC Chicago, Ill.).
- To determine if a human monoclonal antibody could present T cell epitopes from its CHDRH3 region, peripheral blood lymphocytes from normal donors were enriched for CD45RA, unprimed lymphocytes and then they were stimulated with 105AD7 or control human IgG. FIG. 1 shows proliferation responses of lymphocytes from 6 naive donors to in vitro stimulation 105AD7 (10 μg/ml: ′), human IgG (10 μg/ml; ♦) KLH (10 μg/ml; ) or medium alone (▴). Proliferation was assessed at
days - The immunophenotypes of the cells responding to 105AD7 were measured by immunofluorescence and flow cytometry (Table 1). At the start of the cultures there were twice as many CD4 as CD8 T cells and greater than 80% of the cultures expressed the CD45RA antigen. After 10 days, cultures stimulated with 105AD7 had 4.4 times more CD4 cells than CD8 cells suggesting it was the CD4 cells that were predominantly proliferating. However, this effect was not as dramatic as seen in the cells cultured with KLH, as after 10 days there were 7 times more CD4 than CD8 cells. Interestingly, there was also a shift from a predominance of CD45RA cells to CD45RO cells in response to 105AD7 stimulation, although again the response was more marked in the KLH cultures. Although there was a slight proliferation to human IgG this was not significant. Supernatants from the cultures were analysed to determine if the cells were producing γIFN (Table 1) or IL-4. Supernatant from both the 105AD7 and KLH, but not the human IgG, stimulated cultures contained γIFN. IL-4 was not detected in any of the cultures. Although the predominant cell type proliferating in response to 105AD7 were CD4 cells there were still a significant number of CD8 cells within these cultures. To determine if these cells were capable of cell lysis they were assayed in a redirected cytotoxicity assay. Significant killing was observed at all effector to target ratios. In contrast no killing was observed in either the human IgG or KLH stimulated cultures. The later was of particular interest as KLH had induced both proliferation and γIFN secretion. However, very few CD8 cells remained in the KLH cultures at
day 10, suggesting that CD4 cells predominantly mediated the response to this antigen.TABLE 1 T cell subsets and γIFN production by lymphocytes from naive donors primed vitro with 105AD7. Ratio of T cell subsets1 Redirected Cytotoxicity CD4/8 CD4/8 CD45RO/ γIFN (% cytotoxicity)3 Stimulant pre post RApost (pg/ml)2 100:1 50:1 25:1 12.5:1 105AD7 2.3 4.4 2.0 750 34 ± 2 22 ± 3 15 ± 1 7 ± 1 HigG 2.3 2.3 1.0 <62.5 6 ± 1 1 ± 0.2 1 ± 0.2 ND KLH 2.3 6.9 6.5 >>1,000 2 ± 0.01 2 ± 0.2 0 ± 0.1 1 ± 0.1 - Having established a reproducible in vitro proliferation assay on naive donors this culture system was used to investigate if the Fc region of 105AD7 was important in stimulating T cell proliferation. The Fc region of 105AD7 was removed to form a Fab fragment. Proliferation responses of lymphocytes from naive donors to in vitro stimulation with the 105AD7 Fab fragment (0.01-30 μg/ml; ), to 105AD7 (0.003-30 μg/ml; ′) or human IgG (0.01-10 μg/ml; ♦). Proliferation was assessed at
day 9 of in vitro culture and measured by an overnight pulse with 3[H]-thymidine. Results were analysed for statistical significance by one way analysis of variance, using the Bonferroni modified least significant difference method to allow for multiple comparisons. Although both 105AD7 and Fab stimulate significant proliferation, FIG. 2 shows that the Fab was 1,000 fold less efficient at stimulating T cell proliferation than the whole antibody. - Further evidence for Fc involvement in the stimulation of T cell responses by 105AD7 was provided by competition studies between 105AD7 and human IgG (FIG. 3).
- Proliferation responses of lymphocytes from naive donors at
day 9 of in vitro stimulation with 105AD7 (10 μg/ml; ′) in the presence of 0-1000 μg/ml of human IgG, or stimulation with human IgG (♦) alone at 0-1000 μg/ml4. Proliferation was assessed in quadruplicate cultures and measured by an overnight pulse with 3[H] -thymidine. Results were analysed for statistical significance by one way analysis of variance, using the Bonferroni modified least significant difference method to allow for multiple comparisons. Proliferation to 105AD7 was significantly inhibited by addition of 300-1,000 μg/ml of human IgG. A three and ten fold excess of human IgG significantly inhibited T cell proliferation by 15% and 66% respectively. No significant proliferation response to human IgG was observed at any concentration. - To investigate whether 105AD7 was unique or whether presentation of T cell epitopes from other antibodies could be enhanced by improved Fc uptake, a second antibody was studied. 708 is a mouse IgG2b monoclonal antibody which mimics CEA and can stimulate T cell responses in vitro in lymphocytes from colorectal cancer patients. However, 708 failed to stimulate unprimed human T cells from healthy donors. Its mouse Fc region was therefore replaced with human Fc to see if this improved its ability to stimulate T cell responses. The chimerised antibody was produced and showed similar binding to the mouse anti-idiotype as both mouse and chimerised 708 inhibited binding of Ab1, to CEA. Stimulation of primary T cells from healthy donors by both mouse and chimeric 708 antibody was screened. Proliferation responses of lymphocytes from naive donors to in vitro stimulation with chimeric 708 (1 μg/ml:′), mouse 708 (10 μg/ml; ♦) or human IgG (10 μg/ml; ) or medium alone (▴). Proliferation was assessed at
days mouse 708 induced a significant proliferative response when compared to medium alone indicating the importance of a human IgG1 constant region. - Stimulation of primary T cells from healthy donors by both mouse and chimeric 708 antibody was screened for cytokine production. Supernatants from these cultures showed that the chimerised antibody but not the mouse anti-idiotype induced γIFN secretion (Table 2).
TABLE 2 Secretion of γIFN in cultures of lymphocytes from unimmunised donors stimulated with mouse or chimeric 708 antibodies. γIFN (pg/ml) Immunogen Primary stimulation Secondary stimulation Chimeric 708 250 ± 1 1125 ± 60 Mouse 708<62.5 <62.5 Human IgG <62.5 <62.5 Media <62.5 <62.5 - Lymphocytes from naive donors were stimulated in vitro with either chimeric 708 (10 μg/ml), mouse 708 (10 μg/ml), human IgG (10 μg/ml) or no antigen (media). γIFN production in culture supernatants was measured by sandwich ELISA (range 62.5-1500 pg/ml), following primary stimulation for 10 days, or 5-days post-restimulation.
- It was of interest to determine if the chimerised 708 antibody could also stimulate unprimed CD8 cells to become lytically active effector T cells. FIG. 5 shows redirected cytotoxicity following a) 9 days of primary in vitro culture or b) 5 days following restimulation with either mouse 708 (♦), chimeric 708 (′) or human IgG (). Cytotoxicity was assessed by killing of51[Cr]-chromium labelled P815 cells coated with OKT3 antibody at different effector: target cell ratios.
Chimerised 708 but notmouse 708 or human IgG could stimulate T cells to induce significant cell lysis. These cultures could be boosted by further in vitro stimulation to produce a higher level of cytotoxicity (FIG. 7b). - To prove that the cytotoxic T cell epitopes within the human monoclonal antibody 105AD7 were presented from the CDRH3 region of this human IgG1 antibody. 105AD7 was reconfigured as a scFv-DNA vaccine by cloning the antibody and then joining the hypervariable regions of the heavy and light chain with either a 15 (scFv-15) or a 5 amino acid (scFv-5) linker. Alternatively the CHRH3 region of 105AD7 was cloned and spliced to its leader sequence to form a minigene. These 105AD7 DNA constructs were used to immunise balb/c mice by intramuscular injection of 100 μg of DNA admixed with a CpG oligonucleotide. FIG. 6 shows CTL responses following vaccination with A) scFv-15, B) scFv-5, C) the minigene and D) the control vector pCR3.1. Mice were vaccinated at
weeks week 8. The splenocytes were cultured in vitro for 6 days with 105AD7. P815 target cells were labelled with 51 Cr+/− the CDRH3 peptide. Specific cell lysis was then measured using effector: target ratios of 100:1 to 12.5:1. Mice immunised with 105AD7 DNA vaccine stimulated cytotoxic T cell responses against target cells pulsed with the CDRH3 peptide. - To prove that the deimmunised 708 antibody presented a cytotoxic T cell epitope from a tumour associated antigen. FIG. 7 shows the cytotoxicity following 28 days of primary in vitro culture of human lymphocytes with deimmunised 708 (′) with restimulation on
days Deimmunised 708 could stimulate T cells to induce significant cell lysis of HLA matched target cells expressing CEA. - Optimisation of the in vivo immunisation protocol. 105AD7 was used as an example of a human Fc region linked to a mouse H-2Kb CTL epitope. 105AD7 was reconfigured as a scFv DNA vaccine by cloning the antibody and then joining the hypervariable regions of the heavy and light chains with a 5 amino acid linker. This DNA was coated onto gold particles and this DNA was administered to balb/c mice intradermally using a helium powered GeneGun (Biorad Laboratories Limited, Hemel Hempstead, UK). Four groups of animals were immunised with either11) three injections of DNA with CpG adjuvant, 2) one immunisation with DNA and two with 105AD7 protein with CpG adjuvant, 3) three immunisation with 105AD7 protein with CpG adjuvant or 4) three immunisations with 105AD7 protein and Freund's adjuvant as described or by intramuscular injection of 105AD7 protein (see table 3). Splenocytes were harvested two weeks later. Naive mice were utilised to produce feeder cells for in vitro peptide stimulation by a standard technique based on the production of lipopolysaccharide (LPS) stimulated blasts cells. On day three, these LPS blast cells were irradiated and H-2Kd peptide (100 μg per 2×107 cells incubated in 1 mL) added for 1 hour. These cells were then washed and used as feeder cells for splenocytes from immunised mice. After 5 days incubation, these cells were forwarded for routine cytotoxic T cell experiment. Assays were set up, to analyse the response against an irrelevant peptide and the H-2Kd peptide.
TABLE 3 Vaccination Schedule eek 0 2 4 6 1 DNA + CpG DNA + CpG DNA + CpG Cytotoxic T Gene Gun Gene Gun Gene Gun Cell Assay 2 DNA + CpG Protein + CpG Protein + CpG Gene Gun IM IM 3 Protein + CpG Protein + CpG Protein + CpG IM IM IM 4 Protein + IFA Protein + IFA Protein + IFA IM IM IM - Only the group receiving a DNA prime and two protein booster immunisations showed a CTL response (FIG. 8). These results suggest that a combination of DNA priming and protein boosting gives optimal CTL responses.
- Grafting of a CTL epitope from the MAGE-3 protein into a deimmunised antibody.
- The antibody which was selected to deliver the CTL determinants is the de-immunised SC100 antibody (WO 01/88138). The use of a de-immunised antibody is advantageous in its utility as an epitope delivery system as the de-immunisation protocol removes any pre-existing T cell epitopes. This ensures an immunologically inert carrier that directs the immune responses against the ImmunoBody itself to be based on those epitopes grafted into the CDRs.
- The epitope chosen for initial analysis is a CTL epitope based on the MAGE-3 antigen that is over-expressed by malignant melanoma.
- In FIG. 9a, the heavy chain expression vector pSV gptHuIgG1 is based on pSV2 gpt (Mulligan and Berg, (1980) Science, 209: 1422-1427). It includes the ampicillin resistance gene for selection in bacterial cells, the gpt gene for selection in mammalian cells, the murine heavy chain immunoglobulin enhancer region, genomic sequence encoding the Human IgG1 constant region gene and SV40 poly A sequences. The heavy chain variable region for expression is inserted as a Hind 111 to BamH1 fragment. This expression cassette includes the murine heavy chain promoter, the signal peptide coding sequence and the signal sequence intron, the VH gene, the V-C splice donor sequence and intron sequences. Sites in brackets have been removed
- In FIG. 9b, the light chain expression vector pSVhygHuCκ is based on the vector pSVhyg. It includes the ampicillin resistance gene for selection in bacterial cells, the hyg gene for selection in mammalian cells, the murine heavy chain immunoglobulin enhancer region, genomic sequence encoding the Human kappa constant region gene and including the kappa enhancer and SV40 poly A sequences. The light chain variable region for expression is inserted as a Hind 111 to BamH1 fragment. This expression cassette includes the murine heavy chain promoter, the signal peptide coding sequence and the signal sequence intron, the Vκ gene, the V-C splice donor sequence and intron sequences. There are 3 EcoR1 sites internal to HuCκ. Sites in brackets have been removed. The vector pSVhygHuCκ was obtained from G Winter, Laboratory of Molecular Biology, Cambridge, UK. The constant region gene in the vector was replaced with a human Kappa constant region gene cloned from placental DNA. In order to maintain the integrity of the expression vectors after mutation a strategy was devised which would utilise the restriction sites of HindIII and BamHI at either end of the VH and VL encoding regions (see FIG. 9a and 9b) to excise out native SC100 sequence and replace it with CDR grafted ImmunoBody sequence.
- In this manner, only the grafted region would differ from the expression sequence that had already proved to be successful in the production of antibody molecules.
- Since the antibody contains 6 CDRs (3 on the heavy and 3 on the light chain), it may be possible to replace any of these regions with the MAGE-3 epitope. However, there may be certain structural constraints on this generalisation, determined by the nature of the epitope to be introduced and the acceptor CDR site that is to receive it. Serious perturbations of the antibody secondary structure at the splicing site may have a deleterious effect on protein refolding to such an extent that immune function is impaired. A more rational approach based on the need to both preserve the structure of the antibody itself and more importantly to allow an element of control in the ultimate processing of the epitopes would seem to be of benefit in the design of an ImmunoBody molecule. In this respect, a strategy based on both the use of algorithms which predict proteolytic cleavage of the molecule and molecular modelling of the native and grafted antibody was devised.
- Proteolytic Cleavage
- Web based (internet accessible) algorithms (see Table 4) were used to scrutinise the SC100 primary sequence for sites of predicted proteosomal cleavage. This is an attempt to identify a potential hierarchy of acceptor CDR sites, which would allow favourable processing of the internalised ImmunoBody. This would allow the release of grafted epitopes for presentation in a more controlled and defined manner.
TABLE 4 Internet Sites of Proteolytic Cleavage Algorithms Algorithm NetChop* PAProC Authors C. Kesmir, A. C. Kuttler, A Nussbaum, T.P. Nussbaum, Hansjorg Dick, H-G. Rammensee and H. Schild, Vincent Schild Detours, and S. Brunak References Manuscript submitted J. Mol. Biol. 298: 417-429 (2000) (C. Kesmir, personal Immunogenetics 53: 87-94 (2001) communication) Internet www.cbs.dtu.dk/ www.uni-tuebingen.de/uni/kxi address services/NetChop - Therefore the analyses undertaken were specific for the ImmunoBody to be produced, both in terms of the ImmunoBody antibody framework to be utilised and the epitope sequences which are to be grafted onto this framework. Initial predictive experiments analysed the incorporation of the MAGE3 CTL epitope (FLWGPRALV) and the T helper epitope (TPPAYRPPNAPIL) into each of the SC100 CDRs. In each analysis, the whole of the antibody primary sequence was scrutinised in order for the influences of flanking region residues to be taken into account. The results of PaProC and NetChop analyses are summarised in Table 5.
TABLE 5a NetChop Version 1.0. Number of Predicted Cleavage Sites Graft Site Epitope CDR Native CTL T Helper H1 0 0 x 1 x H2 0 0 x 1 ✓ H3 1 0 x 1 x L1 2 0 x 1 ✓ L2 1 1 x 1 x L3 1 0 x 1 x -
TABLE 5b PaProC Number of Predicted Cleavage Sites Graft Site Epitope CDR Native CTL T Helper H1 0 1 5 x H2 3 2 5 ✓ H3 3 1 4 x L1 6 2 6 x L2 3 2 5 x L3 2 1 4 ✓ - NetChop, set at a default threshold of 0.8 predicts no internal cleavage of CTL peptide when spliced into H1, H2, H3, L1 and L3 (Table 5b). Insertion into L2 gives one C-terminal cleavage site after the amino acid residue F. There is one internal cleavage site for all of the T helper insertions where the Y amino acid residue is cleaved at its N-terminus. NetChop also predicted that there are no C-terminal cleavage sites for the CTL epitope, but the T helper epitope in H2 and L1 is cleaved at its C-terminus. PaProC is more difficult to analyse empirically, since multiple cleavage sites are generated for each epitope, especially for T helper. Based on the data presented here, future sequence manipulations should therefore start with analysis of CTL in H1, H3 and L3 and T helper in H3 and L3.
- These studies although only predictive in nature, indicate that caution has to be taken when designing the combination of epitopes to be grafted and the acceptor sites used. The structure of the epitopes coupled to the sequence of the CDRs and flanking region can ultimately have effects on the processing and presentation of the epitopes themselves. Here, NetChop in particular has given an indication of the likelihood of problems arising with internal cleavage of the grafted epitopes. This would obviously have a terminally deleterious effect on the presentation of these epitopes by antigen presenting cells.
- Current processing dogma decrees that during processing of the epitope in the proteosome environment, C-terminal cleavage occurs at a point immediate to the C-terminus of the peptide to be presented and that no other processing occurs at this end of the peptide. This is in sharp contrast to the cleavage pattern at the N-terminus, where cleavage occurs at a site some distance upstream of the N-terminus. The peptide is then trimmed by the activity of N-terminal aminopeptidases until the epitope achieves the required length for MHC associated peptide presentation. It may therefore be possible to control the cleavage at the C-terminus of the epitope in question by providing alongside it, in the graft, a residue which is prone to cleavage when placed in this environment. This would allow processing to be initiated in a more precise manner and would greatly increase the chances of the correct peptide being forwarded for presentation. Again, the flanking residues are of importance to this process and their influence has to be taken into account. Bearing these points in mind, a series of experimental sequences were processed by the NetChop (Version 1.0) algorithm. In these experiments, both the CTL and the T helper epitope were grafted into each of the CDRs, as was performed previously. However, at each grafting site, NetChop analysis was performed after the addition, in individual steps of each of the 20 amino (or imido) acids. The results of analyses performed with the CTL epitope FLWGPRALV, plus an additional amino acid variant at the C-terminus, when inserted into each of the 6 CDRs is summarized in FIG. 10a. The results are given as a percentage change induced by the insertion of the additional C-terminal amino acid from the value obtained by insertion of the epitope alone (FIG. 10b). The results are corrected for internal cleavage. Where this occurs the epitope is therefore destroyed and will not be able to be presented in a worthwhile manner. The score for these events is given as being that of the native value, so that the percentage change is recorded as zero. These events are therefore easily identifiable upon scrutiny of the graphical depiction. The addition of some of the amino acids at the C-terminus of the epitope may lead to an increase in the ability of the epitope to be successfully processed by C-terminal cleavage. These include C, G, K, R and S and to an extent in CDR H1 only, A. NetChop has also identified some amino acids, such as F, I P, V W and Y whose effects allied to the SC100 sequence hinder the processing of the epitope. It therefore becomes important to analyse the sequence at the junction site, so that the first residue (which is part of the antibody scaffold) downstream from the spliced epitope does not consist of one of those residues which is likely to lead to inappropriate processing of the epitope. This may give a further element of control over the resultant processing of the epitope by antigen presenting cells, allowing a semblance of predictability into the formation of the epitopic stimulant.
- Also determined through predictive analyses using amino acid insertions at the C-terminus, is the ability to predict the removal of a splicing point which is internally situated within the grafted epitope itself. An example of this would be to try to remove the predicted cleavage site at Y (underlined) in the T Helper sequence TPPAYPPNAPIL (indicated to be cleaved in each of the CDRs, as shown in Table 5a and 5B epitope column 3). Analysis has shown that removal of internal cleavage sites may be possible using the influence of amino acids placed at the C-terminus of the epitope (FIG. 11). Here, the C-terminal cleavage of the sequence is altered to a position which maintains the integrity of the epitope to be presented, with obvious beneficial effects for presentation of the peptide. Some amino acids (such as A, C, G, K, Q R and S) both lower the internal value of the mid-epitope tyrosine and divert cleavage towards the C-terminal leucine, with beneficial effects for presentation of this epitope. Again, it appears to be important to take such predictive data into account when designing both the epitope and the splicing point for the production of a viable ImmunoBody construct.
- Molecular Modeling of the SC100 Antibody and Derivatives Modelling of the Fv.
- Antibodies lend themselves to molecular modelling with relative ease due to their very high sequence similarity, even in the so-called variable region (Fv). Also, a large number of antibodies have been crystallized, whose co-ordinates have been deposited in the public access database, the Protein Data Bank (PDB). Other factors facilitate the modelling of antibodies such as canonical classification of the loop regions in the Fv, which are paramount to the normal function of binding to a target antigen.
- Standard homology modeling techniques were employed to model the Fv region. This began with sequence alignment of the SC100 antibody against a database of sequences that correspond to crystal structures in the PDB. The heavy chain (without CDR3), light chain and CDR3 of the heavy chain were examined individually. The results of these analyses are shown in Tables 6, 7 and 8.
TABLE 6 Heavy Chain Alignment (without CDR3) 1F4YH top CRYSTAL STRUCTURE OF AN ANTI-CARBOHYDRATE ANTIBODY DIRECTE AGAINST VIBRIO CHOLERAE O1 IN COMPLEX WITH ANTIGEN MOL_ID: 1; MOLECULE: ANTIBODY S-20-4, FAB FRAGMENT, LIGHT CHAIN; CHAIN: L; MOL_ID: 2; MOLECULE: ANTIBODY S-20-4, FAB FRAGMENT, HEAVY CHAIN; CHAIN: H MOL_ID: 1; ORGANISM_SCIENTIFIC: MUS MUSCULUS; ORGANISM_COMMON: MOUSE; SECRETION: ASCITES; MOL_ID: 2; ORGANISM_SCIENTIFIC: MUS MUSCULUS; ORGANISM_COMMON: MOUSE; SECRETION: ASCITES P. M. ALZARI, H. SOUCHON Length = 216 Score = 172 bits (432), Expect = 3e-44 Identities = 79/98 (80 Positives = 90/98 (91%)) Query: 1 QVQLQESGGGLVKAGGSLKLSCAASGFAFNTYDMAWVRQTPEKRLEWVAYIGSGGDRTYY 60 VQL ESGGGLV GGSL LSCAASG F TYDM WVRQTPEKRLEWVA I SGG RT Y Sbjct: 1 EVQLEESGGGLVTPGGSLRLSCAASGYVFSTYDMSWVRQTPEFKRLEWVAFISSGGGRTSY 60 Query: 61 PDTVKGRFTISRDNGKNTLYLQLNSLKSEDTAMYYCAR 98 PDTVKGRFTISRD KNTLYLQ SL SEDTAMYYC R Sbjct: 61 PDTVKGRFTISRDDAKNTLYLQMSSLQSEDTAMYYCTR 98 -
TABLE 7 Light Chain Alignment 2JELL top JEL42 FAB/HPR COMPLEX MOL_ID: 1; MOLECULE: JEL42 FAB FRAGMENT; CHAIN: L, H; MOL_ID: 2; MOLECULE: HISTIDINE-CONTAINING PROTEIN; CHAIN: P; SYNONYM: HPR MOL_ID: 1; ORGANISM_SCIENTIFIC: MUS MUSCULUS; ORGANISM_COMMON: MOUSE; STRAIN: BALB/C; MOL_ID: 2; ORGANISM_SCIENTIFIC: ESCHERICHIA COLI L. PRASAD, E. B. WAYGOOD, J. S. LEE, L. T. J. DELBAERE Length = 217 Score = 223 bits (562), Expect = 2e-59 Identities = 105/109 (96 Positives = 108/109 (98%)) Query: 1 DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRF 60 DVLMTQTPLSLPVSLGDQASISCRSSQSIVH NGNTYLEWYLQKPGQSPKLLIYK SNRF Sbjct: 1 DVLMTQTPLSLPVSLGDQASISCRSSQSIVHGNGNTYLEWYLQKPGQSPKLLIYKISNRF 60 Query: 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGIYYCFQGSHVPWTFGGGTKL 109 SGVPDRFSGSGSGTDFTLKISRVEAEDLG YYCFQGSHVP TFGGGTKL Sbjct: 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKL 109 -
TABLE 8 CDR3 Alignments Initially: 2MPAH top BACTERICIDAL ANTIBODY AGAINST NEISSERIA MENINGITIDIS MOL_ID: 1; MOLECULE: MN12H2 IGG2A-KAPPA; CHAIN: L; FRAGMENT: FAB FRAGMENT; BIOLOGICAL_UNIT: MONOMER; MOL_ID: 2; MOLECULE: MN12H2 IGG2A-KAPPA; CHAIN: H; FRAGMENT: FAB FRAGMENT; BIOLOGICAL_UNIT: MONOMER; MOL_ID: 3; MOLECULE: CONJUGATE OF PORA P1.16 PEPTIDE WITH FLUORESCEI CHAIN: P; FRAGMENT: APEX OF EXTRACELLULAR LOOP 4 (VR2) OF PORA, RESIDUES 180-187; SYNONYM: P1.16, AC-TKDTNNNLC(FLUORESCEIN)-NH2; ENGINEERED: YES; BIOLOGICAL_UNIT: MONOMER MOL_ID: 1; ORGANISM_SCIENTIFIC: MUS MUSCULUS; ORGANISM_COMMON: MOUSE; STRAIN: BALB/C; CELL_LINE: MN12H2 MURINE—MURINE HYBRIDOMA; CELL: B-LYMPHOCYTE HYBRIDOMA; MOL_ID: 2; ORGANISM_SCIENTIFIC: MUS MUSCULUS; ORGANISM_COMMON: MOUSE; STRAIN: BALB/C; CELL_LINE: MN12H2 MURINE—MURINE HYBRIDOMA; CELL: B-LYMPHOCYTE HYBRIDOMA; MOL_ID: 3; SYNTHETIC: YES; OTHER_DETAILS: SEQUENCE FROM NEISSERIA MENINGITIDIS (MENINGOCOCCUS), STRAIN: H44/76, VARIANT: P1.16; J. M. H. VAN DEN ELSEN, J. N. HERRON, J. KROON, P. GROS Length = 224 Score = 40.2 bits (92), Expect = 1e-04 Identities = 15/24 (62 Positives = 18/24 (74%)) Query: 1 YYCARHYGHYVDYAVDYWGQGTTV 24YYC Y Y D DYWGQGTTV Sbjct: 94 YYCSIIYFDYADFIMDYWGQGTTV 117 - The alignment for the CDR-H3 alignment was discounted after studying rules defined by Morea et al., (1998)J. Moi. Biol. 275: 269-294). These show sequence specificity at the YYCAX and the XYWG positions, which can determine the presence of beta-bulges in the loop. The protein database was checked again for loops of correct length, which had the YYCAR and DYWG sequence. The sequence in between these two points was examined closely for any resemblance with the SC100 CDR-H3 sequence and X-ray crystal structures with loops of the same length were selected. These are shown in Table 9.
TABLE 9 Selected CDR-H3 Sequences With X-Ray Crystal Lengths Similar to SC100 PDB Code Sequence Chosen Query YYCAR HYGHYVDYAVDY 1AP2 YYCAR REVYSYYSPLDV ✓ 1C12 YYCVT SLTWLLRRKRSY 1DEE YYCAK VKFYDPTAPNDY ✓ 1DN0 YYCAR PPHDTSGHYWNY 1DSF YYCGR SPIYYDYAPFTY 1IAI YFCAR DGYYENYYAMDY ✓ 1IGA YYCAR DPYGGGKSEFDY ✓ 1IGM YYCAK HRVSYVLTGFDS ✓ 1IL1 YYCNA ISTTRDYYALDY 1JRH YYCAR RAPFYGNHAMDY ✓ 1MNU YYCSI IYFDYADFIMDY 1MPA YYCSI IYFDYADFIMDY 1OSP YYCAR SRDYYGSSGFAF 1QLR YYCAR PPHDTSGHYWNY 1SBS YYCTR GAYYRYDYAMDY ✓ 6FAB YFCAR SEYYGGSYKFDY ✓ 8FAB YYCAR DPDILTAFSFDY ✓ 1HEZ YYCAK VKFYDPTAPNDY ✓ - These sequences were then aligned to find the sequence most similar to the SC100. This was done using the CLUSTAL W (1.81) multiple sequence alignment (Table 10). Of the sequences identified, 1SBS was chosen from these alignments as the template for modelling CDR3.
TABLE 10 CLUSTAL Multiple Sequence Alignment Identities SC100 YYCARHYGHYVDYAVDY 1IAI YFCARDGYYENYYAMDY * *** ** ** 8 SC100 YYCARHYGHYVDYAVDY 6FAB YFCARSEYYGGSYKFDY * *** * ** 7 SC100 YYCARHYGHYVDYAVDY 1IGA YYCARDPYGGGKSEFDY ***** ** SC100 YYCARHYGHYVDYAVDY 8FAB YYCARDPDILTAFSFDY ***** ** 7 SC100 YYCARHYGHYVDYAVDY 1SBS YYCTRGAYYRYDYAMDY *** * *** ** 9 SC100 YYCARHYGHYVDYAVDY 1DEE YYCAKVKFYDPTAPNDY **** ** 6 SC100 YYCARHYGHYVDYAVDY 1HEZ YYCAKVKFYDPTAPNDY **** ** 6 SC100 YYCARHYGHYVDYAVDY 1AP2 YYCARREVYSYYSPLDV ***** * 6 SC100 YYCARHYGHYVDYAVDY 1JRH YYCARRAPFYGNHAMDY ***** * * ** 9 SC100 YYCARHYGHYVDYAVDY 1IGM YYCAKHRVSYVLTGFDS **** * ** * 8 - Molecular Modelling Methodology.
- All modelling was performed on a
SGI Octane 2 R12000 workstation, using Sybyl 6.7 (Tripos, UK). - The light chain of 2JEL was loaded and residues were mutated to that of the required sequence. Hydrogen atoms were then added. Those residues that had been added to the structure were then minimized as follows:
- Hydrogen atoms only (rest of protein held fixed in position) were minimized by 100 iterations of Steepest descent optimisation, followed by Conjugate gradient method to a convergence criterion of an energy derivative of 0.01 kcal/mol/angstrom2.
- Sidechain atoms were allowed to move (rest of protein held) and minimized as in
step 1. - Sidechain and backbone atoms were allowed to move (rest of protein held) and minimized as in
step 1. - The model was then scrutinized by eye, to ensure no errors had been incorporated. For the heavy chain, modelling was performed as in the light chain section, but CDRH3 had been removed from the protein chain. Minimization was performed in the same manner as the light chain.
- The CDR3 loop from the heavy chain of 1SBS was mutated to that of the SC100. The structure was then overlaid onto the existing heavy chain model, using residues YYCAR and DYWG to position the loop. The loop was then grafted through its N-terminus onto the framework at position, and through its C-terminus at position. Manual rotation of backbone dihedrals were performed to bring the
framework 4 region back to its usual position (quirk of Sybyl). Joining regions and newly incorporated residues were minimized as above. - VH-VL Construction
- To provide a model of the Fv, the constructed VH and VL regions had to be brought together as a pair. In order to do this, the original sequence alignments were checked to find matches that ranked highly in both heavy and light chain scores. This approach should yield an Fv onto which we could superimpose the individual VH and VL using conserved residues in the framework. The top five ranked structures are shown in Table 11. 1ATM was chosen for superimposition of the VH and VL. Once this had been performed, residues at the VH-VL interface were checked for bad clashes and minimised as needed. The completed Fv is shown in FIG. 12. The model of the Fv was then checked using PROCHECK (Laskowski et al., (1993)J. Appl. Crystallog 26: 283-291) to ensure that backbone and sidechain conformations were of good quality.
TABLE 11 Ranking of Heavy and Light Chains for VH-VL Superimposition Sample Heavy rank Light rank 1ATM 21 12 1CLZ 20 13 1BLN 14 20 2HIP 16 30 1CLY 18 31 - Epitope Incorporation Modelling.
- The major aim of the modeling exercise has been to examine the possibility of incorporation of immunologically active epitopes into the CDRs of the SC100 carrier antibody. Therefore, in line with the grafting results of proteolytic cleavage experiments, attempts were made to model the epitopic peptides FLWGPRALV (CTL) and TPPAYRPPNAPIL (T Helper) into appropriate SC100 CDRs. The combinations chosen were:
- CTL in L3
- TH in L1
- CTL in H2
- TH in L3
- To aid in modelling, both epitope sequences were tested against sequence and structure databases. The CTL1 epitope yielded no closely related sequences. The TH epitope resides in the C-terminal portion of Human hepatitis b viral capsid (hbcag) protein, which has been crystallized (PDB code: 1QGT). As can be seen from FIG. 13, this portion of the protein exists in an extended, non-structured form, partially due to the high content of proline in the sequence. Initial sequence alignments were produced as a guide to the insertion of these peptides into the antibody model. These are shown in Table 11. Similar residues are highlighted in green. Each model is described separately below.
- CDR-L1 TH Epitope Insertion
- As has been mentioned previously, the TH epitope has a high content of proline, which can mean forcing the sequence into a hairpin loop often observed in CDRs may be very difficult. However, CDR1 in the light chain lies in a relatively extended conformation along the top surface of the Fv. Also, because most of the loop is observed near the surface, it should be involved in less structural constraints as some parts, that are buried within the structure. This is highlighted in FIG. 14. The TH sequence was incorporated into the section of the CDR1 shown im the alignment viewed as Table 12. Residues which had been mutated were minimised as before. There were little or no problems with the incorporation of this epitope into the CDR1. Small sidechain clashes were alleviated by minimisation.
TABLE 12 Original Alignments for Epitope/CDR Incorporation CDR-L1 TH CDR-L3 CTL CDR-H2 CTL CDR-H3 TH - CDR-L3 CTL Epitope Insertion
- Upon examination of the above alignments, it was thought that the CTL epitope may have a sequence too dissimilar to that of the antibody, which may make modelling difficult. To resolve this problem, a loop from a crystal structure of an antibody was used to model the inserted sequence. The alignment is shown below, with similar residues highlighted:
line.pdb CDR-L3 CTh epitope - It was noted from antibody structure with the LW sequence near the N-terminus of the loop, that the sidechain orientation of the tryptophan was unusual, and highly conserved in antibodies with this sequence. Because this is the largest sidechain group to be incorporated in the epitope sequence, the priority in modelling was the correct positioning of it. The GP sequence fitted well in to the observed hairpin structure seen in the template CDR-L3.
- The CDR-L3 was taken from file line.pdb and mutated to the desired sequence in Sybyl. This was then grafted on to the existing framework of the antibody between the cysteine and the valine. Sidechains of inserted residues were minimised, and the model was checked for any unusual sidechain clashed.
- CDR-H2 CTL Epitope Insertion
- The alignment of this epitope with the latter part of CDR-H2 is encouraging, with 4 of the 9 residues showing similarity with the sequence already present in the antibody. Also, the proline is central in each section, and when examined in the structure, is apparent at the bottom turn of the CDR. This case was relatively facile to model, with residues being mutated to the desired sequence, and minimised as described.
- CDR-H3 TH.Epitope Insertion
- As mentioned in the CDR-L1 insertion modelling, this epitope is likely to exist in a relatively extended conformation, mainly due to the high proline content. To form a loop which would be capable of insertion into the space restricted CDR-H3 position, the epitope would have to demonstrate a tight turn within part of the structure, and b-sheet like conformation in the rest of the peptide. It is the authors' opinion that this would not be possible for the TH epitope, and insertion of this peptide into this area would yield a defectively folded antibody. Therefore, this epitope has not been modelled.
- Primer Design and OLE technology
- The primers are designed to replace the CDRs chosen with the epitope of interest. This is performed by a variation on the overlap extension (OLE) technique used for many DNA mutations. Unlike site directed mutagenesis which is mainly aimed at introducing point mutations, OLE allows the mutation of a number of nucleosides at once so that the need for sub-cloning is kept to a minimum. A primer is designed based on the
sequences 5′ and 3′ of the length of DNA to be mutated and are manufactured to be exactly complementary to these regions. Providing sufficient complementarity is achieved here based on the number of residues chosen and their annealing strengths, the site in between this region can be any sequence of DNA. The complementarity at either end will still allow annealing of this primer to take place during PCR. When used in conjunction with other forward and reverse primers, this has the effect of introducing the mutation into the newly synthesised DNA strand. Since this in the next PCR round constitutes a template strand, the mutation is faithfully duplicated by the polymerase enzyme and therefore amplified throughout subsequent PCR. Usually primers are manufactured to mutate the same number of bases that were present in the original sequence. However, this technique can also be used to introduce extra bases as well as reduce the number of bases in a sequence. Here extra care has to be taken with the design of the primers so that the formation of secondary structures such as hairpin loops is avoided and DNA polymerase activity is not impaired. - This study highlighted the fact that although incorporation of many different primary structures is accepted in this CDRH3, there may be instances where grafted sequences lead to the integrity of the antibody structure being compromised. Modelling studies, such as this one, indicate that care has to be taken when undergoing epitope grafting. Loop modelling can help to identify those sequences which are going to compromise antibody folding which would lead to failure in the production of an antibody delivery vehicle and utility of a vaccine.
- Of the four epitope/CDR combinations chosen for the modelling studies, it is interesting to note, that the T helper epitope was unable to be modelled into CDR-H3 due to structural constraints. Many helper determinants are much larger than their CTL counterparts, so this may be indeed the case for many helper determinants. Although data for this phenomenon has only been generated for the SC100 antibody it is also interesting to note that the CDR-L1 may be a more appropriate acceptor site for helper determinants. TPPAYRPNNAPIL cause modelled into CDR-L1 due to its more relaxed structure, which may also be the case for other helper determinants. Based on the results of the proteolytic cleavage and modelling studies the following initial construct-variants were chosen:
- CTL into CDR-L3
- TH into CDR-L1
- Based on the modelling study data, which had highlighted CDR-H2 with the potential to favourably accommodate the CTL epitope readily due to similarities in sequence, this graft was initiated.
- CTL into CDR-H2
- Mutation PCR
- Once the epitopic grafts had been chosen, a combination of sequence data analysis and de novo primer design should allow the incorporation of such grafts into the chosen CDRs using the polymerase chain reaction (PCR). For initial prototype ImmunoBody construction, primers were designed in order to facilitate the grafting of the epitope/CDRs combinations described above and these primers are presented in Table 13a.
TABLE 13a CDR Mutating Primers Name Sequence CTL1 L3 CTGGGAAATTATTACTGCTTCCTGTGGGGTCC AAGGGCCCTCGTTTTCGGTGGAGGCACCAAG TH1 L1 CAAGCCTCCATCTCTTGCACTCCTCCAGCCTA TAGACCACCAAATGCCCCTATCTTATGGTACCTGCAGAAACCA CTL1 ATTGGTAGTGGTGGTTTCCTGTGGGGTCCAAG H2 GGCCCTCGTTCGATTCACCATTTCC TH1 H3 ATGTATTACTGTGCAAGAACTCCTCCAGCCTA TAGACCACCAAATGCCCCTATCTTATGGGGTCAAGGAACCACG CTL1 TTCCTGTGGGGTCCAAGGGCCCTCGTT TH1 ACTCCTCCAGCCTATAGACCACCAAATGCCCCTATCTTA -
TABLE 13b SC100 Specific Oligonucleotide Primers Name Sequence GD SC100 FORH GTCGACCTGCAGCCCAAGCTT 2 H FOR GCTTATCATCGATAAGCTTAT GD SC100 REVL TGTGAGACTCTGCCAGGATCC GD SC100 REVH CAGAAAGCTAGCTTGGGATCC - These primers are then utilised in appropriate combinations with the primers detailed in Table 13b for to yield a three primer system capable of mutation the CTL and T helper sequences into the SC100 CDRs. In this scenario, two forward primers are used and anneal to the template strand at similar temperatures (the annealing temperature). This primes the DNA polymerase activity, which then fills in complementary base pairs. In conjunction with the action of the reverse primer, this amplifies the DNA template strands exponentially through recycling of denaturing, annealing and elongation temperatures. In early cycles, if the mutation primer is able to anneal to the target strand, the mutation is then incorporated into subsequent template strands. A diagrammatic representation of this process is given in FIG. 15. The ease of annealing of the mutation primer governs the ratio of mutated DNA present in the amplified mixture. Mixtures of native (non-mutated) and mutated PCR products can then be separated by cloning.
- Lead experiments utilised the three primer PCR system to incorporate FLWGPRALV into SC100 CDR-L3. PCR was performed using pSVhyg SC100 Chimaeric VK, HuCK plasmid as a template for the SC100 light chain and an equimolar combination of the primers GD SC100 For H+L, GD SC100 REVL and CTL1 L3 were used to prime the PCR reaction. Standard PCR conditions and reagents were used and applied to PCR cycles consisting of 45 seconds at 94° C., 45 seconds at 56° C. and 90 seconds at 72° C. Thirty cycles of these temperatures allowed the amplification of PCR products in large enough concentrations to be viewed by standard agarose gel electrophoresis. A representation of the agarose gel, identifying FLWGPRALV encoding SC100 CDR-L3 mutated PCR products is shown in FIG. 16. In this Figure the differences in utility of the mutation primer are highlighted in the difference of product sizes found in
lanes lane 5 is consistent with the products of amplification theorised in FIG. 15. The upper band therefore should contain a proportion of mutated sequence, since the mutation primer is clearly able to anneal to the template strand, as shown by the presence of the lower band (which represents truncated, mutated sequence). Therefore cloning of the PCR products visually represented inlane 5 should be able to isolate mutated (non-truncated) PCR product. - In order to facilitate easier cloning, it would be advisable to try to alter the relative concentrations of the different species of PCR products in favour of the mutated, non-truncated-sequence. This can be performed by asymmetric PCR. Here, the product represented in FIG. 16,
lane 5, lower band, is, itself, used as the reverse primer in conjunction with the addition of the forward primer (in this instance GD SC100 ForH+L). Amplification using these primers under the same conditions as the original PCR, leads to the production of an excess of mutated sequence, since this sequence is represented in the reverse primer. The result of this PCR is shown in FIG. 17. The products oflanes - Cloning and Sequencing
- Once mutational PCR has been undertaken, cloning and subsequent sequencing of the PCR products generated would indicate whether the appropriate mutations have been introduced. As one can see from FIG. 15 both native and mutated sequence will be present in the PCR products derived. Identifying those clones with mutations from the native background can be achieved in a number of ways. One way is to grow up clones and purify plasmid from each for sequencing analysis. This is a rather labour intensive exercise, especially when dozens of clones need to be processed at once. The use of PCR can assist in bypassing most of this work by identifying those clones which contain the mutated sequence. Here, primers are manufactured based on the mutated sequence only (i.e. without the portions complementary to the native sequence). PCR amplification using such a primer as the forward primer in conjunction with the reverse primer of the original reaction should only yield amplification products in those clones where the mutation is present. In this manner, many clones can be analysed quickly and efficiently and yield products which can verify, due to their size, where on the native sequence the mutation has been introduced. Clones giving positive results here would then be used to produce plasmid for sequence verification.
- PCR products represented in FIG. 18 were therefore forwarded for cloning. This was achieved by using the TOPO TA cloning kit (Invitrogen Corporation, San Diego, Calif., USA). Here, the cloning vector (pCR®2.1-TOPO®) is supplied with single 3′-thymidine (T) overhangs alongside Topoisomerase I which is covalently bound to the vector. The cloning strategy takes into account the non-template dependent terminal transferase activity of theThermus aquaticus (Taq) enzyme used in the generation of PCR products which adds a single deoxyadenosine (A) to the 3′ end of the PCR product. The T overhangs, therefore provide a “sticky end” for base pairing of the A and T nucleotides, a reaction which is catalysed by Topoisomerase I. Thus in a simple, one step reaction (virtually) any PCR products can be cloned into this vector. Transformation of appropriate strains of E. coli facilitates the growing of PCR incorporated pCR®2.1-TOPO® plasmid for DNA sequencing analysis. As mentioned above transformed E. coli can be used directly in PCR reactions to analyse the mutation content of individual clones. In the context of FLWGPRALV incorporation into CDR-L3 this was achieved using pCR®2.1-TOPO® transformed clones with primers CTL1 L3 and GD SC100 REVL (see Tables 13a and 13b respectively). Agarose gel representation of the results of these PCR analyses is shown in FIG. 18.
- These experiments yielded many cloned products one of, which was named 74:1. This clone was forwarded for plasmid purification in order for DNA sequencing to verify the presence of the incorporated mutation. The results of sequence analysis are shown in FIG. 19.
- Much the same overall strategy was utilised to incorporate the T helper epitope into CDR-L1. In lead experiments, this epitope would be used alongside that of the CTL epitope in order to ascertain the beneficial (or otherwise) effects of T cell help for CTL activity. Thus the manufacture of a double mutant was attempted, which incorporated the CTL graft in CDR L3 and the T helper graft in CDR-L1. Successful mutation to produce the 74:1 clone meant that this construct could be used as a template to mutate the T helper into CDR-L1. Success at this attempted mutation would obviously lead to a double mutant. This was indeed the case and asymmetric PCR to increase the ratio of mutant to native DNA sequence was again successful. These products were therefore forwarded for cloning. Cloning was again performed in the manner described using the Invitrogen TOPO TA cloning strategy. Clones were positively identified with mutated CDR-L1 using PCR with the THL1 primer and one clone, namely 213:4 was forwarded for DNA sequence analysis. Sequence data for this clone is presented in FIG. 20.
- DNA Vaccination
- In these studies, the primers have been carefully designed both to introduce appropriate primers into the CDRs of interest and to allow splicing of mutated DNA back into the original plasmids used for protein expression. This provides a way of examining the effects of the mutations produced against a background of native protein. The use of PCR also allows the sub-cloning of interesting products into other intermediate vectors in order for interim experiments to be performed. In this manner, we were able to introduce native and CDR mutated sequences into vectors appropriate for DNA vaccination experiments to be performed.
- In order to perform DNA vaccination experiments in a transgenic mouse system, the plasmid incorporated as the vaccine vehicle must contain a eukaryotic promoter sequence in order for this DNA to be transcribed and translated. Since the pCR®2.1-TOPO® vector contains a prokaryotic promoter region, so the mutated sequences of clones 74:1 and 213:4 had to be spliced into an alternate vector. Again an Invitrogen vector was chosen to achieve this, namely the vector pCR3.1®. This vector contains the cytomegalovirus (CMV) immediate-early promoter allowing high level expression of cloned genes in a eukaryotic system. Simple TA cloning experiments again facilitated the introduction of the 74:1 and 213:4 mutated sequences into this vector. To signify their difference from the pCR®2.1-TOPO® generated clones, each clone isolated containing the pCR3.1® vector was prefixed with the letter “C”. Such incorporation was also performed on native SC100 light chain PCR products (generated from the plasmid pSVhyg SC100 Chimaeric VK, HuCK) and native heavy chain products (generated from the plasmid pSVgpt SC100 Chimaeric VH). Cloned versions of these constructs were named K2 and H8 for the light chain and heavy chain versions respectively.
- DNA vaccination itself was performed using GeneGun technology (Biorad Laboratories Limited, Hemel Hempsted, UK). Briefly, plasmid DNA is introduced intradermally into animals using a helium powered gun. The bullets take the form of gold particles which can be coated with DNA of choice. In our case plasmids produced from the clones 74:1, 213:4, K2 and H8 were mixed with gold particles and used to immunize groups of four mice. The following immunizations were studied:
- C74:1 plasmid
- C213:4 plasmid
- K2 plasmid
- C74:1 plasmid plus H8 plasmid
- Groups of mice with having no immunisations were set up as well as positive control mice. These were mice immunised with the peptide FLWGPRALV in an appropriate immunisation regime for peptide immunogens.
- Cytotoxic T cell Assays
- The end point of these initial studies on epitope/CDR incorporation is to generate CTL responses against the CDR introduced T cell epitope. These studies were performed in transgenic mice bearing the gene, which produces human HLA-A2 molecules, allowing translational study of human immune epitopic function in these mice. Again, the appropriate epitope to examine ImmunoBody proof of principle have been utilised, since the MAGE-3 epitopic peptide FLWGPRALV is known to bind with high affinity to HLA-A2.
- Splenocytes from immunised and control mice were harvested and cultured using standard tissue culture techniques and growth media. Naïve mice were utilised to produce feeder cells for in vitro peptide stimulation by a standard technique based on the production of lipopolysaccharide (LPS) stimulated blasts cells (again of spleen origin). On day three, these LPS blast cells were irradiated and MAGE-3 peptide (FLWGPRALV: 100 μg per 2×107 cells incubated in 1 mL) added for 1 hour. These cells were then washed and used as feeder cells for splenocytes from immunised mice. After 5 days incubation, these cells were forwarded for routine cytotoxic T cell experiment. Assays were set up, to analyse the response against no peptide, au irrelevant peptide and the MAGE-3 peptide. The results of CTL assays are given in FIG. 20. The highest responder mice are viewed for each immunisation set.
- In mice immunised with MAGE3 peptide there is killing at the highest effector: target ratio (E:T ratio) of cells pulsed with the MAGE-3 peptide. This result is virtually mirrored in the plasmid C74:1 immunised mice. In both cases, as in all cases shown in FIG. 20, there is no significant killing of cells pulsed with either no peptide or an irrelevant peptide. The cytotoxic activity of the C74:1 (
Mage 3 in CDR-L3) group mice is in sharp contrast to the lack of CTL activity in the K2 (Native SC100) plasmid immunised mice. This difference in cytotoxicity suggests that, upon immunisation, the sequence encoding FLWGPRALV has been translated and that this peptide has been appropriately presented to CTLs. This supports a successful epitope graft an ImmunoBody type structure which elicits an immune response in immunised mice. Further evidence in the generation of CTLs is shown in those groups of mice immunised with plasmid C213:4 and also in those mice immunised with a combination of C74:1 and H8. Plasmid C213:4 also contains sequence encoding the peptide FLWGPRALV in CDR-L3, but also contains the T Helper epitope (TPPAYRPPNAPIL) in CDR-L1. The presence of the T helper epitope may be providing T cell help, as indicated by the fact that killing is occurring at a lower E:T ratio than seen in the C74:1 immunised group. Another observation from FIG. 20, is that relatively high cytotoxic activity seems to be occurring in the mice immunised with a combination of the plasmids C74:1 and H8 that encode both light and heavy chains in the same cell. This could have the effect of producing a whole ImmunoBody entity within the transfected cell. Presentation of the epitopes to antigen presenting cells could lead to cell killing, and to release of the whole ImmunoBody entity into the surrounding environment. This would then allow the targeting of Langerhan cells (specialised dendritic cells found in the skin) through CD64, the ligand being provided by the heavy chain portion of the ImmunoBody . This may account for the relatively higher amount of killing observed in this group. - Preparation of Polypeptide-Fc constructs (Signal pigplus Tie2-FC and mutants). A protein domain of a molecule was cloned and spliced to human IgGI Fc region. This would be recognised by CD64 receptor on dendritic cells be internalised and processed into peptides for presentation on class I and Class II MHC molecules. If these epitopes are high affinity self epitopes the T cells recognising them may have been deleted in the thymus. T cells recognising moderate affinity epitopes will still be presented but these epitopes will not be well represented on MHC molecules, as they will be outcompeted by the higher affinity epitopes. By changing the anchor residues that bind to MHC it is possible to generate high affinity peptides without altering T cell recognition (Rosenberg et al., (1998)Nature Medicine 4: 321-327).
- Methods & Results
- cDNA synthesised from 5 μg of total RNA isolated from the cell line TF1 (grown in the presence of 200 units/ml GMCSF) was used as a template for the amplification of truncated Tie-2 (1-196 amino acids) using the primers: 5′ primer, 5′-GAT CTC GAG ATT TGG GGA AGC ATG GAC-3′, corresponding to the nucleotide sequence 128-154 of the Tie-2 gene with an additional Xho1 restriction site; and 3′ primer, 5′-GAA GAT ATC TCC TCC TAT ATA CCT GGC CGA-3′, corresponding to the nucleotide sequence 716-745 of the Tie-2 gene with a incorporated EcoRV site. The PCR fragment was cut and ligated into the Xho-1/EcoRV multiple cloning site of the mammalian expression vector Signal pigplus (R and D systems) inframe with a CD33 signal sequence and C terminal human IgG, Fc tail to generate a secretory fusion protein. This plasmid was identified by restriction analysis and confirmed by DNA sequencing.
- From this wild type plasmid five further constructs were generated by PCR mutagenesis. The “Quik™ Change Site Directed Mutagenesis” kit (Stratagene) was used according to the manufacturers protocol to switch specific amino acids in order to produce potential CTL epitopes using the designed primers Z84, Z95, Z101 and Z107 as listed in table 14.
TABLE 14 Primers used for site directed mutagenesis of the Signal pigplus Tie2-FC wild type construct Mutation Primer Z84 5′ 5′-CCA GCT ACT TTA ACT ATG GTT GTG GAC AAG GGA G-3′ 3′ 5′-C TCC CTT GTC CAC AAC CAT AGT TAA AGT AGC TGG-3 ′ Z95 5′ 5′-A GCC AGC TTA CTT CTC TGT GGA GTC AGC TTG GTC CTT TCT GG-3′ 3′ 5′-CC AGA AAG GAC CAA GCT GAC TCC ACA GAG AAG TAA GCT GGC T-3 ′ Z101 5′ 5′-GCT TCC TTC CTA CTA GCT ACT TTA ACT ATG ACT GTG G-3′ 3′ 5′-C CAC AGT CAT AGT TAA AGT AGC TAG TAG GAA GGA AGC-3 ′ Z107 5′ 5′-CAA GCT TCC TTA CTA CCA GCT ACT TTA ACT GTG ACT GTG G-3′ 3′ 5′-C CAC AGT CAC AGT TAA AGT AGC TGG TAG TAA GGA AGC TTG-3′ - Nucleotides highlighted in red are the substituted bases required to code for the switched specific amino acid of the Epitope.
- Z84 primers anneal to the nucleotide sequence from 524-557; Z95 primers: 160-201;
- Z101 primers: 512-548 And Z107 primers: 509-548 of the wild type Tie-2 gene. (Accession number L06139)
- For one construct both Z95 and Z107 primers were utilised to incorporate two potential CTL epitopes. All site specific mutations were confirmed by DNA sequencing (Table 15).
TABLE 15 Alignment of wild type Tie-2 cDNA and amino acids with sequencing obtained from the incorporated site specific mutations present in the Signal pigplus Tie-2-FC constructs. 518-544 TTC CTA CCA GCT ACT TTA ACT ATG ACT Wild F L P A T L T M T type TTC CTA CCA GCT ACT TTA ACT ATG GTT Z84 124-132 F L P A T L T M V 167-193 TTA GTT CTC TGT GGA GTC AGC TTG CTC Wild L V L C G V S L L type TTA CTT CTC TGT GGA GTC AGC TTG GTC Z95 7-15 L L L C G V S L V 521-547 CTA CCA GCT ACT TTA ACT ATG ACT GTG Wild L P A T L T M T V type CTA CTA GCT ACT TTA ACT ATG ACT GTG Z101 125-133 L L A T L T M T V 515-541 TCC TTC CTA CCA GCT ACT TTA ACT ATG Wild S F L P A T L T M type TCC TTA CTA CCA GCT ACT TTA ACT GTG Z107 123-131 S L L P A T L T V - Plasmids were sequenced using BigDye terminator cycle sequencing ready reaction (PE Applied Biosystems) and sequencing reactions were electrophoresed using the ABI prism 373A DNA sequencer (Applied Biosystems). Resulting DNA sequences were aligned with wild type cDNA (Accession no:.L06139) obtained from the NIH database using the
Blast 2 pairwise search programme. 293 human kidney cells were stably transfected with tie2-Fc and the protein recovered from the supernatant purified on a protein A column. - Human T cells recognising a peptide within the Tie2 molecule were cloned. These clones were shown to be of moderate affinity requiring 5 ug of peptide to give 50% maximum stimulation and are therefore representative of the T cells that have escaped thymic selection. Dendritic cells were fed with either Tie2 recombinant protein, peptide or the Tie2Fc construct and were then exposed to the T cell clone. FIG. 21 shows that the clone responded weakly to peptide, failed to respond at all to the recombinant protein but gave an excellent response to the Tie2Fc construct. Furthermore the response to the Tie2Fc construct could be blocked by an anti-CD64 antibody.
-
1 101 1 1041 DNA Homo sapiens misc_feature (2)..(2) n is a or g or c or t 1 antngantgg gccctctaga tgcatgctcg agcggccgcc agtgtgatgg atatctgcag 60 aattcgccct ttgtgagant ctgccaggat ccaactgagg aagcaaagtt taaattctac 120 tcacgtttga ttcccagctt ggtgcctcca ccgaaaacga gggcccttgg accccacagg 180 aagcagtaat aaattcccag atcctcagcc tccactctgc tgatcttgag tgtgaaatct 240 gtccctgatc cactgccact gaatctgtct gggaccccag aaaatcggtt ggaaactttg 300 tagatcagga gctttggaga ctggcctggt ttctgcaggt accattctaa ataggtgttt 360 ccattactat gtacaatgct ctgactagat ctgcaagaga tggaggcttg atccccaaga 420 ctgacaggca gggagagtgg agtttgggtc atcaacacat cggagtggac acctgtggag 480 agaaaggcaa agtggatgtc attgtcaccc atatatatgt ccagacctca agcctgctac 540 tgtgagcccc ttacctgtag ctgttgctac caagaagagg atgatacagc ttccatccca 600 tggtgaggtc ctgtgtgctc agtaactgta gagagaactg tgatctcatg tttntctgtn 660 tgtggtatag acaaacccta tatttaccat gtacgattca naggatttgc atatttcata 720 agcttgggct gcangntcga caagggccga atttccagcc acacttggcg gcccgttacc 780 tagtgggatc ccgagcttcg gtacccnagc nttggccgta aatcatnggn ccattagcct 840 ggtttccctt gngtggaaaa tttggttatt nccgcttacc aattcccacc acnaanatta 900 ccgaaacccg ggaagccntt aaagtngtaa aangccctgg ggggngcctt aatgangnga 960 ncttaacctc accatttatt tgcgttnncc cttcactggg ccngcttttc caatncgggg 1020 naaaaccttg tcgtngcccc t 1041 2 27 DNA Homo sapiens 2 aacgagggcc cttggacccc acaggaa 27 3 27 DNA Homo sapiens 3 ttcctgtggg gtccaagggc cctcgtt 27 4 9 PRT Homo sapiens 4 Phe Leu Trp Gly Pro Arg Ala Leu Val 1 5 5 27 DNA Homo sapiens 5 ttcctaccag ctactttaac tatgact 27 6 9 PRT Homo sapiens 6 Phe Leu Pro Ala Thr Leu Thr Met Thr 1 5 7 27 DNA Homo sapiens 7 ttcctaccag ctactttaac tatggtt 27 8 9 PRT Homo sapiens 8 Phe Leu Pro Ala Thr Leu Thr Met Val 1 5 9 27 DNA Homo sapiens 9 ttagttctct gtggagtcag cttgctc 27 10 9 PRT Homo sapiens 10 Leu Val Leu Cys Gly Val Ser Leu Leu 1 5 11 27 DNA Homo sapiens 11 ttacttctct gtggagtcag cttggtc 27 12 9 PRT Homo sapiens 12 Leu Leu Leu Cys Gly Val Ser Leu Val 1 5 13 27 DNA Homo sapiens 13 ctaccagcta ctttaactat gactgtg 27 14 9 PRT Homo sapiens 14 Leu Pro Ala Thr Leu Thr Met Thr Val 1 5 15 27 DNA Homo sapiens 15 ctactagcta ctttaactat gactgtg 27 16 9 PRT Homo sapiens 16 Leu Leu Ala Thr Leu Thr Met Thr Val 1 5 17 27 DNA Homo sapiens 17 tccttcctac cagctacttt aactatg 27 18 9 PRT Homo sapiens 18 Ser Phe Leu Pro Ala Thr Leu Thr Met 1 5 19 27 DNA Homo sapiens 19 tccttactac cagctacttt aactgtg 27 20 9 PRT Homo sapiens 20 Ser Leu Leu Pro Ala Thr Leu Thr Val 1 5 21 34 DNA artificial sequence Primer 21 ccagctactt taactatggt tgtggacaag ggag 34 22 34 DNA artificial sequence Primer 22 ctcccttgtc cacaaccata gttaaagtag ctgg 34 23 42 DNA artificial sequence Primer 23 agccagctta cttctctgtg gagtcagctt ggtcctttct gg 42 24 42 DNA artificial sequence Primer 24 ccagaaagga ccaagctgac tccacagaga agtaagctgg ct 42 25 37 DNA artificial sequence Primer 25 gcttccttcc tactagctac tttaactatg actgtgg 37 26 37 DNA artificial sequence Primer 26 ccacagtcat agttaaagta gctagtagga aggaagc 37 27 40 DNA artificial sequence Primer 27 caagcttcct tactaccagc tactttaact gtgactgtgg 40 28 40 DNA artificial sequence Primer 28 ccacagtcac agttaaagta gctggtagta aggaagcttg 40 29 27 DNA Artificial sequence Primer 29 gatctcgaga tttggggaag catggac 27 30 30 DNA Artificial sequence Primer 30 gaagatatct cctcctatat acctggccga 30 31 13 PRT Homo sapiens 31 Thr Pro Pro Ala Tyr Arg Pro Pro Asn Ala Pro Ile Leu 1 5 10 32 9 PRT Homo sapiens 32 Phe Leu Trp Gly Pro Arg Ala Leu Val 1 5 33 21 DNA Artificial sequence Primer 33 gtcgacctgc agcccaagct t 21 34 21 DNA Artificial sequence Primer 34 gcttatcatc gataagctta t 21 35 21 DNA Artificial sequence Primer 35 tgtgagactc tgccaggatc c 21 36 21 DNA Artificial sequence Primer 36 cagaaagcta gcttgggatc c 21 37 32 DNA Artificial sequence Primer 37 ctgggaaatt attactgctt cctgtggggt cc 32 38 31 DNA Artificial sequence Primer 38 aagggccctc gttttcggtg gaggcaccaa g 31 39 32 DNA Artificial sequence Primer 39 caagcctcca tctcttgcac tcctccagcc ta 32 40 43 DNA Artificial sequence Primer 40 tagaccacca aatgccccta tcttatggta cctgcagaaa cca 43 41 32 DNA Artificial sequence Primer 41 attggtagtg gtggtttcct gtggggtcca ag 32 42 25 DNA Artificial sequence Primer 42 ggccctcgtt cgattcacca tttcc 25 43 32 DNA Artificial sequence Primer 43 atgtattact gtgcaagaac tcctccagcc ta 32 44 43 DNA Artificial sequence Primer 44 tagaccacca aatgccccta tcttatgggg tcaaggaacc acg 43 45 27 DNA Artificial sequence Primer 45 ttcctgtggg gtccaagggc cctcgtt 27 46 39 DNA Artificial sequence Primer 46 actcctccag cctatagacc accaaatgcc cctatctta 39 47 16 PRT Homo Sapiens 47 Tyr Phe Cys Ala Leu Trp Tyr Ser Asn Leu Trp Val Phe Gly Gly Gly 1 5 10 15 48 9 PRT Homo sapiens 48 Phe Gln Gly Ser His Val Pro Trp Thr 1 5 49 9 PRT Homo sapiens 49 Phe Leu Trp Gly Pro Arg Ala Leu Val 1 5 50 17 PRT Homo sapiens 50 Tyr Ile Gly Ser Gly Gly Asp Arg Thr Tyr Tyr Pro Asp Thr Val Lys 1 5 10 15 Gly 51 12 PRT Homo sapiens 51 His Tyr Gly His Tyr Val Asp Tyr Ala Val Asp Tyr 1 5 10 52 13 PRT Homo sapiens 52 Thr Pro Pro Ala Tyr Arg Pro Pro Asn Ala Pro Ile Leu 1 5 10 53 16 PRT Homo sapiens 53 Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu 1 5 10 15 54 5 PRT Homo ssapiens 54 Tyr Tyr Cys Ala Arg 1 5 55 5 PRT Homo sapiens misc_feature (5)..(5) Xaa is any amino acid 55 Tyr Tyr Cys Ala Xaa 1 5 56 4 PRT Homo sapiens 56 Asp Tyr Trp Gly 1 57 4 PRT Homo sapiens misc_feature (1)..(1) Xaa is any amino acid 57 Xaa Tyr Trp Gly 1 58 17 PRT Homo sapiens 58 Tyr Tyr Cys Ala Arg His Tyr Gly His Tyr Val Asp Tyr Ala Val Asp 1 5 10 15 Tyr 59 17 PRT Homo sapiens 59 Tyr Phe Cys Ala Arg Asp Gly Tyr Tyr Glu Asn Tyr Tyr Ala Met Asp 1 5 10 15 Tyr 60 17 PRT Homo sapiens 60 Tyr Phe Cys Ala Arg Ser Glu Tyr Tyr Gly Gly Ser Tyr Lys Phe Asp 1 5 10 15 Tyr 61 17 PRT Homo sapiens 61 Tyr Tyr Cys Ala Arg Asp Pro Tyr Gly Gly Gly Lys Ser Glu Phe Asp 1 5 10 15 Tyr 62 17 PRT Homo sapiens 62 Tyr Tyr Cys Ala Arg Asp Pro Asp Ile Leu Thr Ala Phe Ser Phe Asp 1 5 10 15 Tyr 63 17 PRT Homo sapiens 63 Tyr Tyr Cys Thr Arg Gly Ala Tyr Tyr Arg Tyr Asp Tyr Ala Met Asp 1 5 10 15 Tyr 64 17 PRT Homo sapiens 64 Tyr Tyr Cys Ala Lys Val Lys Phe Tyr Asp Pro Thr Ala Pro Asn Asp 1 5 10 15 Tyr 65 17 PRT Homo sapiens 65 Tyr Tyr Cys Ala Lys Val Lys Phe Tyr Asp Pro Thr Ala Pro Asn Asp 1 5 10 15 Tyr 66 17 PRT Homo sapiens 66 Tyr Tyr Cys Ala Arg Arg Glu Val Tyr Ser Tyr Tyr Ser Pro Leu Asp 1 5 10 15 Val 67 17 PRT Homo sapiens 67 Tyr Tyr Cys Ala Arg Arg Ala Pro Phe Tyr Gly Asn His Ala Met Asp 1 5 10 15 Tyr 68 17 PRT Homo sapiens 68 Tyr Tyr Cys Ala Lys His Arg Val Ser Tyr Val Leu Thr Gly Phe Asp 1 5 10 15 Ser 69 17 PRT Homo sapiens 69 Tyr Tyr Cys Ala Arg His Tyr Gly His Tyr Val Asp Tyr Ala Val Asp 1 5 10 15 Tyr 70 17 PRT Homo sapiens 70 Tyr Tyr Cys Ala Arg Arg Glu Val Tyr Ser Tyr Tyr Ser Pro Leu Asp 1 5 10 15 Val 71 17 PRT Homo sapiens 71 Tyr Tyr Cys Val Thr Ser Leu Thr Trp Leu Leu Arg Arg Lys Arg Ser 1 5 10 15 Tyr 72 17 PRT Homo sapiens 72 Tyr Tyr Cys Ala Lys Val Lys Phe Tyr Asp Pro Thr Ala Pro Asn Asp 1 5 10 15 Tyr 73 17 PRT Homo sapiens 73 Tyr Tyr Cys Ala Arg Pro Pro His Asp Thr Ser Gly His Tyr Trp Asn 1 5 10 15 Tyr 74 17 PRT Homo sapiens 74 Tyr Tyr Cys Gly Arg Ser Pro Ile Tyr Tyr Asp Tyr Ala Pro Phe Thr 1 5 10 15 Tyr 75 17 PRT Homo sapiens 75 Tyr Phe Cys Ala Arg Asp Gly Tyr Tyr Glu Asn Tyr Tyr Ala Met Asp 1 5 10 15 Tyr 76 17 PRT Homo sapiens 76 Tyr Tyr Cys Ala Arg Asp Pro Tyr Gly Gly Gly Lys Ser Glu Phe Asp 1 5 10 15 Tyr 77 17 PRT Homo sapiens 77 Tyr Tyr Cys Ala Lys His Arg Val Ser Tyr Val Leu Thr Gly Phe Asp 1 5 10 15 Ser 78 17 PRT Homo sapiens 78 Tyr Tyr Cys Asn Ala Ile Ser Thr Thr Arg Asp Tyr Tyr Ala Leu Asp 1 5 10 15 Tyr 79 17 PRT Homo sapiens 79 Tyr Tyr Cys Ala Arg Arg Ala Pro Phe Tyr Gly Asn His Ala Met Asp 1 5 10 15 Tyr 80 17 PRT Homo sapiens 80 Tyr Tyr Cys Ser Ile Ile Tyr Phe Asp Tyr Ala Asp Phe Ile Met Asp 1 5 10 15 Tyr 81 17 PRT Homo sapiens 81 Tyr Tyr Cys Ser Ile Ile Tyr Phe Asp Tyr Ala Asp Phe Ile Met Asp 1 5 10 15 Tyr 82 17 PRT Homo sapiens 82 Tyr Tyr Cys Ala Arg Ser Arg Asp Tyr Tyr Gly Ser Ser Gly Phe Ala 1 5 10 15 Phe 83 17 PRT Homo sapiens 83 Tyr Tyr Cys Ala Arg Pro Pro His Asp Thr Ser Gly His Tyr Trp Asn 1 5 10 15 Tyr 84 17 PRT Homo sapiens 84 Tyr Tyr Cys Thr Arg Gly Ala Tyr Tyr Arg Tyr Asp Tyr Ala Met Asp 1 5 10 15 Tyr 85 17 PRT Homo sapiens 85 Tyr Phe Cys Ala Arg Ser Glu Tyr Tyr Gly Gly Ser Tyr Lys Phe Asp 1 5 10 15 Tyr 86 17 PRT Homo sapiens 86 Tyr Tyr Cys Ala Arg Asp Pro Asp Ile Leu Thr Ala Phe Ser Phe Asp 1 5 10 15 Tyr 87 17 PRT Homo sapiens 87 Tyr Tyr Cys Ala Lys Val Lys Phe Tyr Asp Pro Thr Ala Pro Asn Asp 1 5 10 15 Tyr 88 24 PRT Mus musculus 88 Tyr Tyr Cys Ser Ile Ile Tyr Phe Asp Tyr Ala Asp Phe Ile Met Asp 1 5 10 15 Tyr Trp Gly Gln Gly Thr Thr Val 20 89 9 PRT Mus musculus 89 Asp Tyr Trp Gly Gln Gly Thr Thr Val 1 5 90 24 PRT Homo sapiens 90 Tyr Tyr Cys Ala Arg His Tyr Gly His Tyr Val Asp Tyr Ala Val Asp 1 5 10 15 Tyr Trp Gly Gln Gly Thr Thr Val 20 91 60 PRT Mus musculus 91 Asp Val Leu Met Thr Gln Thr Pro Leu Ser Leu Pro Val Ser Leu Gly 1 5 10 15 Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His Ser 20 25 30 Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45 Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe 50 55 60 92 58 PRT Mus musculus 92 Asp Val Leu Met Thr Gln Thr Pro Leu Ser Leu Pro Val Ser Leu Gly 1 5 10 15 Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His Asn 20 25 30 Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser Pro 35 40 45 Lys Leu Leu Ile Tyr Lys Ser Asn Arg Phe 50 55 93 60 PRT Mus musculus 93 Asp Val Leu Met Thr Gln Thr Pro Leu Ser Leu Pro Val Ser Leu Gly 1 5 10 15 94 49 PRT Mus musculus 94 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe 1 5 10 15 Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Ile Tyr Tyr 20 25 30 Cys Phe Gln Gly Ser His Val Pro Trp Thr Phe Gly Gly Gly Thr Lys 35 40 45 Leu 95 47 PRT Mus musculus 95 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe 1 5 10 15 Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Tyr Tyr Cys 20 25 30 Phe Gln Gly Ser His Val Pro Thr Phe Gly Gly Gly Thr Lys Leu 35 40 45 96 49 PRT Mus musculus 96 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe 1 5 10 15 Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr 20 25 30 Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys 35 40 45 Leu 97 60 PRT Mus musculus 97 Gln Val Gln Leu Gln Glu Ser Gly Gly Gly Leu Val Lys Ala Gly Gly 1 5 10 15 Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Phe Ala Phe Asn Thr Tyr 20 25 30 Asp Met Ala Trp Val Arg Gln Thr Pro Glu Lys Arg Leu Glu Trp Val 35 40 45 Ala Tyr Ile Gly Ser Gly Gly Asp Arg Thr Tyr Tyr 50 55 60 98 47 PRT Mus musculus 98 Val Gln Leu Glu Ser Gly Gly Gly Leu Val Gly Gly Ser Leu Leu Ser 1 5 10 15 Cys Ala Ala Ser Gly Phe Thr Tyr Asp Met Trp Val Arg Gln Thr Pro 20 25 30 Glu Lys Arg Leu Glu Trp Val Ala Ile Ser Gly Gly Arg Thr Tyr 35 40 45 99 60 PRT Mus musculus 99 Glu Val Gln Leu Glu Glu Ser Gly Gly Gly Leu Val Thr Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Val Phe Ser Thr Tyr 20 25 30 Asp Met Ser Trp Val Arg Gln Thr Pro Glu Lys Arg Leu Glu Trp Val 35 40 45 Ala Phe Ile Ser Ser Gly Gly Gly Arg Thr Ser Tyr 50 55 60 100 38 PRT Mus musculus 100 Pro Asp Thr Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Gly Lys 1 5 10 15 Asn Thr Leu Tyr Leu Gln Leu Asn Ser Leu Lys Ser Glu Asp Thr Ala 20 25 30 Met Tyr Tyr Cys Ala Arg 35 101 32 PRT Mus musculus 101 Pro Asp Thr Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Lys Asn Thr 1 5 10 15 Leu Tyr Leu Gln Ser Leu Ser Glu Asp Thr Ala Met Tyr Tyr Cys Arg 20 25 30
Claims (22)
1. The use of a polypeptide which comprises (i) a first portion comprising the part of human Fc which binds to CD64, and (ii) a second portion comprising one or more heterologous T cell epitopes in the manufacture of a medicament for stimulating a cytotoxic T cell response.
2. The use as claimed in claim 1 , wherein the first portion comprises the Fc segment of human IgG.
3. The use as claimed in claim 2 , wherein the IgG is human IgG1.
4. The use as claimed in claim 3 , wherein the first portion comprises human FcγI.
5. The use as claimed in any one of claims 1 to 4 , wherein the second portion is a Fab fragment.
6. The use as claimed in claim 5 , wherein the Fab fragment is non-human, preferably from mouse.
7. The use as claimed claim 5 , wherein the Fab fragment is from human.
8. The use as claimed in any preceding claim wherein the heterologous T cell epitope is a pathogen epitope.
9. The use as claimed in any of claims 1 to 7 , wherein the heterologous T cell epitope is a non-pathogen epitope.
10. The use as claimed in claim 9 , wherein the non-pathogen epitope is a tumour epitope.
11. The use as claimed in any preceding claim, wherein the polypeptide is a monoclonal antibody.
12. The use as claimed in any one of claims 1 to 10 , wherein the polypeptide is a protein domain-Fc construct.
13. The use as claimed in any preceding claim, wherein the medicament stimulates cytotoxic and helper T cell responses.
14. The use as claimed in any preceding claim, wherein the medicament is for the treatment and/or prophylaxis of cancer.
15. The use as claimed in any preceding claim, wherein the medicament is for intramuscular and/or intradermal administration.
16. The use as claimed in any preceding claim further comprising the use of a nucleic acid which encodes a polypeptide which comprises (i) a first portion comprising the part of human Fc which binds to CD64, and (ii) a second portion comprising one or more heterologous T cell epitopes in the manufacture of a medicament for stimulating a cytotoxic T cell response.
17. The use as claimed in any preceding claim, wherein the medicament further comprises an adjuvant
18. A method for stimulating a cytotoxic T cell response in a patient such as a mammal, including human, comprising administering to the patient a therapeutically effective amount of a polypeptide which comprises (i) a first portion comprising the part of human Fc which binds to CD64, and (ii) a second portion comprising one or more heterologous T cell epitopes.
19. A method as claimed in claim 18 modified by the features of any one of claims 1 to 17 .
20. The constant region of a human antibody capable of binding CD64 fused to a polypeptide comprising one or more T cell.
21. The constant region of a human antibody as claimed in claim 20 , modified by the features of any one of claims 2-10.
22. A nucleic acid encoding the constant region of a human antibody as claimed in claim 20 or claim 21.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US12/805,752 US8187600B2 (en) | 2001-01-26 | 2010-08-18 | Polypeptides capable of binding to CD64 comprising one or more heterologous T cell epitopes and their uses |
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB0102145.0 | 2001-01-26 | ||
GBGB0102145.0A GB0102145D0 (en) | 2001-01-26 | 2001-01-26 | Substances |
PCT/GB2002/000354 WO2002058728A2 (en) | 2001-01-26 | 2002-01-28 | Polypeptides capable of binding to cd64 and comprising one or more heterologous t cell epitopes, and their uses |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/805,752 Continuation US8187600B2 (en) | 2001-01-26 | 2010-08-18 | Polypeptides capable of binding to CD64 comprising one or more heterologous T cell epitopes and their uses |
Publications (1)
Publication Number | Publication Date |
---|---|
US20040146505A1 true US20040146505A1 (en) | 2004-07-29 |
Family
ID=9907631
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/470,045 Abandoned US20040146505A1 (en) | 2001-01-26 | 2002-01-28 | Substances |
US12/805,752 Expired - Lifetime US8187600B2 (en) | 2001-01-26 | 2010-08-18 | Polypeptides capable of binding to CD64 comprising one or more heterologous T cell epitopes and their uses |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/805,752 Expired - Lifetime US8187600B2 (en) | 2001-01-26 | 2010-08-18 | Polypeptides capable of binding to CD64 comprising one or more heterologous T cell epitopes and their uses |
Country Status (12)
Country | Link |
---|---|
US (2) | US20040146505A1 (en) |
EP (1) | EP1354054B1 (en) |
JP (1) | JP5198715B2 (en) |
KR (1) | KR20030083698A (en) |
AT (1) | ATE307209T1 (en) |
AU (1) | AU2002225230B2 (en) |
CA (1) | CA2435672C (en) |
DE (1) | DE60206731T2 (en) |
DK (1) | DK1354054T3 (en) |
ES (1) | ES2254663T3 (en) |
GB (1) | GB0102145D0 (en) |
WO (1) | WO2002058728A2 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20100260806A1 (en) * | 2007-03-28 | 2010-10-14 | Linda Gillian Durrant | Nucleic acids |
Families Citing this family (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20040101428A (en) * | 2002-04-09 | 2004-12-02 | 메르크 파텐트 게엠베하 | Anti-idiotype anti-cea antibody molecules and its use as cancer vaccine |
AT502293B1 (en) * | 2002-05-15 | 2008-03-15 | Igeneon Krebs Immuntherapie | IMMUNOGENERAL, MONOCLONAL ANTIBODY |
DE602004030617D1 (en) * | 2003-11-26 | 2011-01-27 | Fraunhofer Ges Forschung | RECOMBINANT ANTI-CD64-ETA 'IMMUNOTOXINES |
GB0605735D0 (en) * | 2006-03-22 | 2006-05-03 | Immunobiology Ltd | Composition and method for mediating an immune response |
CN107427590B (en) | 2015-02-02 | 2021-08-31 | 伯明翰大学 | Targeting moiety peptide epitope complexes with multiple T cell epitopes |
GB202005779D0 (en) | 2020-04-21 | 2020-06-03 | Scancell Ltd | Anti-tumour immune responses |
JP2023539642A (en) | 2020-08-26 | 2023-09-15 | スキャンセル リミテッド | Nucleic acid encoding a polypeptide comprising a modified FC region of human IgG1 and at least one heterologous antigen |
GB202018395D0 (en) | 2020-11-23 | 2021-01-06 | Scancell Ltd | Immunotherapy |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5969109A (en) * | 1990-02-28 | 1999-10-19 | Bona; Constantin | Chimeric antibodies comprising antigen binding sites and B and T cell epitopes |
US20040248113A1 (en) * | 1999-12-28 | 2004-12-09 | Alessandro Sette | Method and system for optimizing multi-epitope nucleic acid constructs and peptides encoded thereby |
US20050026229A1 (en) * | 1997-03-10 | 2005-02-03 | The Regents Of The University Of California | PSCA antibodies and hybridomas producing them |
US7067110B1 (en) * | 1999-07-21 | 2006-06-27 | Emd Lexigen Research Center Corp. | Fc fusion proteins for enhancing the immunogenicity of protein and peptide antigens |
Family Cites Families (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DE69023900T4 (en) * | 1989-02-24 | 1996-10-02 | Univ California | Genetically modified immunoglobulins. |
WO1992018540A1 (en) * | 1991-04-18 | 1992-10-29 | Mount Sinai School Of Medicine Of The City University Of New York | Anti-human immunodeficiency virus recombinant antibodies |
ATE204300T1 (en) | 1994-05-13 | 2001-09-15 | Biovation Ltd | TARGET CELL-BINDING CHIMERIC PEPTIDES |
DE60045707D1 (en) * | 1999-04-27 | 2011-04-21 | Nevagen Llc | SOMATIC TRANSGENIC IMMUNIZATION AND METHODS THEREFOR |
SK782002A3 (en) | 1999-07-21 | 2003-08-05 | Lexigen Pharm Corp | FC fusion proteins for enhancing the immunogenicity of protein and peptide antigens |
-
2001
- 2001-01-26 GB GBGB0102145.0A patent/GB0102145D0/en not_active Ceased
-
2002
- 2002-01-28 US US10/470,045 patent/US20040146505A1/en not_active Abandoned
- 2002-01-28 ES ES02715584T patent/ES2254663T3/en not_active Expired - Lifetime
- 2002-01-28 CA CA2435672A patent/CA2435672C/en not_active Expired - Lifetime
- 2002-01-28 KR KR10-2003-7009871A patent/KR20030083698A/en not_active Application Discontinuation
- 2002-01-28 AT AT02715584T patent/ATE307209T1/en active
- 2002-01-28 DE DE60206731T patent/DE60206731T2/en not_active Expired - Lifetime
- 2002-01-28 WO PCT/GB2002/000354 patent/WO2002058728A2/en active IP Right Grant
- 2002-01-28 AU AU2002225230A patent/AU2002225230B2/en not_active Expired
- 2002-01-28 DK DK02715584T patent/DK1354054T3/en active
- 2002-01-28 JP JP2002559062A patent/JP5198715B2/en not_active Expired - Lifetime
- 2002-01-28 EP EP02715584A patent/EP1354054B1/en not_active Expired - Lifetime
-
2010
- 2010-08-18 US US12/805,752 patent/US8187600B2/en not_active Expired - Lifetime
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5969109A (en) * | 1990-02-28 | 1999-10-19 | Bona; Constantin | Chimeric antibodies comprising antigen binding sites and B and T cell epitopes |
US20050026229A1 (en) * | 1997-03-10 | 2005-02-03 | The Regents Of The University Of California | PSCA antibodies and hybridomas producing them |
US7067110B1 (en) * | 1999-07-21 | 2006-06-27 | Emd Lexigen Research Center Corp. | Fc fusion proteins for enhancing the immunogenicity of protein and peptide antigens |
US20040248113A1 (en) * | 1999-12-28 | 2004-12-09 | Alessandro Sette | Method and system for optimizing multi-epitope nucleic acid constructs and peptides encoded thereby |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20100260806A1 (en) * | 2007-03-28 | 2010-10-14 | Linda Gillian Durrant | Nucleic acids |
US8742088B2 (en) * | 2007-03-28 | 2014-06-03 | Scancell Limited | Nucleic acids encoding antibodies or portions thereof comprising a heterologous T cell epitope and their use in modulating T cell responses |
Also Published As
Publication number | Publication date |
---|---|
DK1354054T3 (en) | 2006-02-13 |
KR20030083698A (en) | 2003-10-30 |
CA2435672A1 (en) | 2002-08-01 |
AU2002225230B2 (en) | 2007-08-16 |
CA2435672C (en) | 2013-10-29 |
GB0102145D0 (en) | 2001-03-14 |
ES2254663T3 (en) | 2006-06-16 |
ATE307209T1 (en) | 2005-11-15 |
WO2002058728A3 (en) | 2002-10-03 |
EP1354054B1 (en) | 2005-10-19 |
DE60206731T2 (en) | 2006-07-20 |
US20110165180A1 (en) | 2011-07-07 |
JP5198715B2 (en) | 2013-05-15 |
DE60206731D1 (en) | 2006-03-02 |
US8187600B2 (en) | 2012-05-29 |
JP2004520376A (en) | 2004-07-08 |
WO2002058728A2 (en) | 2002-08-01 |
EP1354054A2 (en) | 2003-10-22 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8187600B2 (en) | Polypeptides capable of binding to CD64 comprising one or more heterologous T cell epitopes and their uses | |
US7399849B2 (en) | Murine monoclonal anti-idiotype antibody 11D10 and methods of use thereof | |
JP4214173B2 (en) | Induction of tolerance by a tolerogenic fusion protein | |
US6294654B1 (en) | Modified immunoglobulin molecule incorporating an antigen in a non-CDR loop region | |
US6509016B1 (en) | Monoclonal antibody 1A7 and use for the treatment of melanoma and small cell carcinoma | |
US7090842B1 (en) | Murine monoclonal anti-idiotype antibody 3H1 sequences for human carcinoembryonic antigen | |
US20030114398A1 (en) | Monoclonal antibody 1A7 and use for the treatment of melanoma and small cell carcinoma | |
JP2000511403A (en) | Humanization of anti-carcinoembryonic antigen anti-idiotype antibodies and their use as tumor vaccines and for targeting applications | |
JP2000506723A (en) | Antibody variant | |
Okada et al. | TCR vaccines for active immunotherapy of T cell malignancies. | |
AU2002225230A1 (en) | Polypeptides capable of binding to CD64 and comprising one or more heterologous T cell epitopes, and their uses | |
JP3683278B2 (en) | Mouse monoclonal anti-idiotype antibody 11D10 and method of use thereof | |
EP1355946A1 (en) | Dna vaccines expressing hypervariable vh-cdr3 idiotipic determinants | |
WO1997032021A1 (en) | Therapeutic agents based on monoclonal anti-idiotypic antibody 105ad7 | |
MXPA98004982A (en) | Monoclonal antibody, murine, anti-idiotipo, 11d10, and methods for use | |
AU5398401A (en) | Anti-idiotype antibody 11D10 and methods of use thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: SCANCELL LIMITED, UNITED KINGDOM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:DURRANT, LINDA G.;PARSON, TINA;REEL/FRAME:014907/0038 Effective date: 20031223 Owner name: CANCER RESEARCH CAMPAIGN TECHNOLOGY LIMITED, UNITE Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:ROBINS, ADRIAN;REEL/FRAME:014907/0044 Effective date: 20040105 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |