US20030108563A1 - Reagents for the simultaneous detection of HCV core antigens and antibodies - Google Patents

Reagents for the simultaneous detection of HCV core antigens and antibodies Download PDF

Info

Publication number
US20030108563A1
US20030108563A1 US10/268,562 US26856202A US2003108563A1 US 20030108563 A1 US20030108563 A1 US 20030108563A1 US 26856202 A US26856202 A US 26856202A US 2003108563 A1 US2003108563 A1 US 2003108563A1
Authority
US
United States
Prior art keywords
hcv
core
antibodies
antibody
antigen
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US10/268,562
Inventor
Chander Bahl
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ortho Clinical Diagnostics Inc
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Individual filed Critical Individual
Priority to US10/268,562 priority Critical patent/US20030108563A1/en
Priority to EP02257659A priority patent/EP1310796A3/en
Priority to JP2002321299A priority patent/JP2003202345A/en
Publication of US20030108563A1 publication Critical patent/US20030108563A1/en
Assigned to ORTHO-CLINICAL DIAGNOSTICS, INC. reassignment ORTHO-CLINICAL DIAGNOSTICS, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: BAHL, CHANDER
Abandoned legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
    • C07K16/1081—Togaviridae, e.g. flavivirus, rubella virus, hog cholera virus
    • C07K16/109—Hepatitis C virus; Hepatitis G virus
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/576—Immunoassay; Biospecific binding assay; Materials therefor for hepatitis
    • G01N33/5767—Immunoassay; Biospecific binding assay; Materials therefor for hepatitis non-A, non-B hepatitis
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011—Details
    • C12N2770/24011—Flaviviridae
    • C12N2770/24211—Hepacivirus, e.g. hepatitis C virus, hepatitis G virus
    • C12N2770/24222—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
    • G01N2333/08—RNA viruses
    • G01N2333/18—Togaviridae; Flaviviridae

Definitions

  • HCV Hepatitis C Virus
  • the present invention is directed to core protein sequences and anti-core antibodies that can be used to detect core antigen and anti core antibodies in serum collected from HCV infected individuals.
  • Anti-core antibodies are major contributors to the sensitivity of the anti-HCV antibodies assays. These antibodies are generally among the earlier antibodies to develop. HCV anti-core antibodies are directed against multiple epitopes. Most of the HCV anti-core activity can be accounted for by the amino terminal 1 ⁇ 3 rd of the HCV core protein. HCV infected individuals have antibodies to multiple epitopes in HCV core protein sequence. It is possible to detect HCV anti-core antibodies by using part of the HCV core sequence. Analysis of serum from HCV infected individuals using overlapping pentadecapeptides showed that the antibodies to HCV core are distributed over many of the peptides.
  • HCV core protein when further analyzed by a peptide walk analysis using overlapping octapeptides showed that 6-8 amino acids stretch of sequences between amino acids 10-43 represent multiple epitopes in HCV core sequence.
  • the antibodies to HCV core were spread all across the core protein sequence, it should be possible to delete or alter amino acid sequences outside the 10-43 sequence with little impact on the ability of these modified antigens to detect anti-core antibodies. Based on the serological information a sensitive assay for the simultaneous detection of core antigen and anti-core antibodies can be designed as follows.
  • a mixture of HCV core protein as recombinant protein or synthetic peptides along with anti-core monoclonal or polyclonal antibodies is coated onto microwells.
  • the anti-core antibodies selected for this assay are selected from a group of antibodies that do not recognize core sequence 10-43.
  • This solid phase is then used to capture anti HCV core antibodies and core antigen from patient serum or plasma specimens using standard ELISA format.
  • the captured proteins, human anti-HCV core antibodies and core protein are detected using immunochemical methods.
  • the anti-HCV core human antibodies are detected using peroxidase labeled anti-human IgG.
  • the core antigen is detected using peroxidase labeled anti-core monoclonal antibodies.
  • the anti-core antibodies used for detection are selected from a group of antibodies that do not recognize aa 10-43 and are different from the antibodies used to capture the core antigen onto the solid phase.
  • the core antigen used to detect ant-HCV core antibodies includes most of the sequence 10-43 are modified by HCV core sequences.
  • the core sequences outside of aa 10-43 are modified by deleting or altering amino sequence in the region recognized by the anti-core antibodies used to capture or detect core antigen.
  • an ELISA based assay for the detection of HCV infection.
  • This new assay can detect HCV infected blood earlier than the currently used anti-HCV antibodies detection assay.
  • the method described herein can detect HCV infection earlier because in addition to the detection of anti-HCV antibodies, this assay method also detects HCV core antigen.
  • a specific detergent from the polyoxyethylene class is used in the HCV assay. The detergent used should be able to release the HCV core antigen from the virus by possibly disrupting the envelope protein and/or the lipid layer but this detergent should not affect the ability of the HCV recombinant antigens to capture the anti-HCV antibodies.
  • Some of the common detergents such as N-lauryl sarcosine used in the detection of HCV core antigen destroy the ability of HCV recombinant proteins such as c22, c200, and NS5 to detect anti-HCV antibodies in a standard ELISA.
  • HCV antigens c200-3, NS5 and a modified core antigen such as c22KS ⁇ 47,48 or c22KSR47L along with anti-core monoclonal antibodies were coated onto microwells in a buffer solution. After overnight incubation the buffer containing the coating proteins are removed and the microwells washed with phosphate buffered saline (PBS) containing a detergent, TWEEN 20. The antigen/antibody coated microwells were then treated with bovine serum albumin (BSA)/sucrose solution to block the remaining protein binding sites that may be available on the microwells. After 2-24 hours, the BSA/sucrose solution is removed and the microwells air dried and stored under a descicant.
  • BSA bovine serum albumin
  • Two aliquotes of the specimen to be tested are diluted into 100 uL of PBS solution containing BSA, superoxide dismutase, yeast extract and 1% BRIJ 58 or BRIJ 35 or a mixture of both.
  • the two diluted specimens were then pipetted into two HCV antigen/antibody coated wells described above.
  • the microwells were incubated for 90 minutes at 37 degrees Celsius.
  • the microwells were then washed five times with PBS containing 0.5% TWEEN 20 detergent.
  • To one microwell 200 uL of a murine anti-human IgG labeled with HRP was added and in the other well the same volume of anti-HCV core monoclonal antibodies (Anti Pep4) labeled with HRP was added.
  • HCV core sequences are synthesized based on the HCV core sequence represented below. These sequences are prepared using recombinant techniques or standard peptide synthesis methods.
  • Modifications can be made in the italicized and underlined amino acid sequence of HCV core protein. These modifications can be alterations of amino acids or deletion of sets of amino acids to remove sites of reagent anti-core antibodies.
  • the antigen used for the assay is paired with the monoclonal antibodies that have their binding sites outside the core region 10-43.
  • the modified core antigens along with the appropriate anti-core antibodies are used for the simultaneous detection of HCV core antigen and anti-HCV antibodies in specimens infected with HCV.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Virology (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Communicable Diseases (AREA)
  • Urology & Nephrology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

The present invention is directed to core protein sequences and anti-core antibodies that can be used to detect core antigen and anti core antibodies in serum collected from HCV infected individuals.

Description

    BACKGROUND OF THE INVENTION
  • Hepatitis C Virus (HCV) is the leading cause of transfusion-associated and community-acquired hepatitis. HCV antibodies and antigens are used in immunoassays to test blood that might be used in transfusion in order to detect the presence of HCV. This type of blood screening has significantly reduced the spread of this virus due to blood transfusion. [0001]
  • During the last 10 years there has been considerable progress made in improving the sensitivity of blood screening assays but there is a window period of 60-80 days from the time of infection in which there are no detectable antibodies. During this window period the persons are highly infective. To close this window, nucleic acids based tests are being developed to detect HCV infection. These nucleic acids based test are very laborious and have not yet been adapted for routine blood screening assays. Recently methods have been developed for detecting HCV core antigen. HCV core antigen can be detected in most HCV antibody negative HCV RNA positive individuals. From the published research it appears that HCV core antigen detection can be used as an earlier indication of HCV infection. (S. R. Lee et al., Vox Sanguinis, Efficacy Of A Hepatitis C Virus Core Antigen Enzyme-Linked Immunosorbent Assay For The Identification Of The ‘Window-Phase’ Blood Donation. 2001; 80: 19-23.) Though core antigen detection can detect HCV infection during the window period, the detection of core antigen becomes difficult once the anti-core antibodies appear. The core antigen gets complexed with the anti-core antibodies and it requires strong dissociating reagents to separate the core antigen from the antibodies. [0002]
  • Therefore, there remains a need for a more effective assay that detects HCV infection. We describe herein a combination assay that detects anti-HCV antibodies and HCV core antigen in a single assay will able to detect HCV infection much more effectively than the current HCV core antigen or anti-HCV antibody assays. [0003]
    • SUMMARY OF THE INVENTION
  • The present invention is directed to core protein sequences and anti-core antibodies that can be used to detect core antigen and anti core antibodies in serum collected from HCV infected individuals. [0004]
    • DETAILED DESCRIPTION
  • Anti-core antibodies are major contributors to the sensitivity of the anti-HCV antibodies assays. These antibodies are generally among the earlier antibodies to develop. HCV anti-core antibodies are directed against multiple epitopes. Most of the HCV anti-core activity can be accounted for by the amino terminal ⅓[0005] rd of the HCV core protein. HCV infected individuals have antibodies to multiple epitopes in HCV core protein sequence. It is possible to detect HCV anti-core antibodies by using part of the HCV core sequence. Analysis of serum from HCV infected individuals using overlapping pentadecapeptides showed that the antibodies to HCV core are distributed over many of the peptides. Four peptides towards the amino terminus end have lot more reactivity than the peptides towards the carboxy terminus of the HCV c22-3 protein. This region of HCV core protein when further analyzed by a peptide walk analysis using overlapping octapeptides showed that 6-8 amino acids stretch of sequences between amino acids 10-43 represent multiple epitopes in HCV core sequence. Though the antibodies to HCV core were spread all across the core protein sequence, it should be possible to delete or alter amino acid sequences outside the 10-43 sequence with little impact on the ability of these modified antigens to detect anti-core antibodies. Based on the serological information a sensitive assay for the simultaneous detection of core antigen and anti-core antibodies can be designed as follows.
  • A mixture of HCV core protein as recombinant protein or synthetic peptides along with anti-core monoclonal or polyclonal antibodies is coated onto microwells. The anti-core antibodies selected for this assay are selected from a group of antibodies that do not recognize core sequence 10-43. This solid phase is then used to capture anti HCV core antibodies and core antigen from patient serum or plasma specimens using standard ELISA format. The captured proteins, human anti-HCV core antibodies and core protein, are detected using immunochemical methods. The anti-HCV core human antibodies are detected using peroxidase labeled anti-human IgG. The core antigen is detected using peroxidase labeled anti-core monoclonal antibodies. The anti-core antibodies used for detection are selected from a group of antibodies that do not recognize aa 10-43 and are different from the antibodies used to capture the core antigen onto the solid phase. The core antigen used to detect ant-HCV core antibodies includes most of the sequence 10-43 are modified by HCV core sequences. The core sequences outside of aa 10-43 are modified by deleting or altering amino sequence in the region recognized by the anti-core antibodies used to capture or detect core antigen. [0006]
  • Therefore, we have developed an ELISA based assay for the detection of HCV infection. This new assay can detect HCV infected blood earlier than the currently used anti-HCV antibodies detection assay. The method described herein can detect HCV infection earlier because in addition to the detection of anti-HCV antibodies, this assay method also detects HCV core antigen. A specific detergent from the polyoxyethylene class is used in the HCV assay. The detergent used should be able to release the HCV core antigen from the virus by possibly disrupting the envelope protein and/or the lipid layer but this detergent should not affect the ability of the HCV recombinant antigens to capture the anti-HCV antibodies. Some of the common detergents such as N-lauryl sarcosine used in the detection of HCV core antigen destroy the ability of HCV recombinant proteins such as c22, c200, and NS5 to detect anti-HCV antibodies in a standard ELISA. [0007]
  • The effectiveness and advantages of the invention are further illustrated by the following examples. The examples are meant to illustrate, but not to limit, the scope and spirit of the invention. [0008]
    • EXAMPLE 1
  • In the present assay, HCV antigens c200-3, NS5 and a modified core antigen such as c22KS∇ 47,48 or c22KSR47L along with anti-core monoclonal antibodies (anti core murine monoclonals Pep 10, 12) were coated onto microwells in a buffer solution. After overnight incubation the buffer containing the coating proteins are removed and the microwells washed with phosphate buffered saline (PBS) containing a detergent, TWEEN 20. The antigen/antibody coated microwells were then treated with bovine serum albumin (BSA)/sucrose solution to block the remaining protein binding sites that may be available on the microwells. After 2-24 hours, the BSA/sucrose solution is removed and the microwells air dried and stored under a descicant. [0009]
    • EXAMPLE 2
  • Two aliquotes of the specimen to be tested are diluted into 100 uL of PBS solution containing BSA, superoxide dismutase, yeast extract and 1% BRIJ 58 or BRIJ 35 or a mixture of both. The two diluted specimens were then pipetted into two HCV antigen/antibody coated wells described above. The microwells were incubated for 90 minutes at 37 degrees Celsius. The microwells were then washed five times with PBS containing 0.5% TWEEN 20 detergent. To one microwell 200 uL of a murine anti-human IgG labeled with HRP was added and in the other well the same volume of anti-HCV core monoclonal antibodies (Anti Pep4) labeled with HRP was added. To each well a solution of ORTHO phenylenediamine and hydrogen peroxide was added. After incubation in the dark for 30 minutes, the reaction is stopped by adding 50 microliters of 4N sulfuric acid. An orange color in either well indicates that the specimen being tested is infected with HCV. The microwell tested with anti-human IgG tests for anti-HCV antibodies and the one tested with anti-core conjugate tests for HCV core antigen. [0010]
    • EXAMPLE 3
  • HCV core sequences are synthesized based on the HCV core sequence represented below. These sequences are prepared using recombinant techniques or standard peptide synthesis methods. [0011]
    SEQ ID NO.: 1
    MSTNPKPQKKNKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPR
    LGVRATRKTSERSQPRGRRQPIPKARRPEGRTWAQPGYPWPLYG
    NEGCGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGF
    ADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCS
    FSIFLLALLSCLTVPAS (AA 1-190 HCV Core Sequence)
    SEQ ID NO.: 2
    MSTNPKPQKKNKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPR
    (AA1-43)
    SEQ ID NO.: 3
    KNKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPR (AA 10-43)
    SEQ ID NO.: 1
    MSTNPKPQK KNKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPR L
    GVRATRKTSERSQPRGRRQPIPKARRPEGRTWAQPGYPWPLYGNEG
    CGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGY
    IPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSC
    LTVPAS .
  • Modifications can be made in the italicized and underlined amino acid sequence of HCV core protein. These modifications can be alterations of amino acids or deletion of sets of amino acids to remove sites of reagent anti-core antibodies. The antigen used for the assay is paired with the monoclonal antibodies that have their binding sites outside the core region 10-43. The modified core antigens along with the appropriate anti-core antibodies are used for the simultaneous detection of HCV core antigen and anti-HCV antibodies in specimens infected with HCV. [0012]
  • 1 3 1 190 PRT Hepatitis C virus 1 Met Ser Thr Asn Pro Lys Pro Gln Lys Lys Asn Lys Arg Asn Thr Asn 1 5 10 15 Arg Arg Pro Gln Asp Val Lys Phe Pro Gly Gly Gly Gln Ile Val Gly 20 25 30 Gly Val Tyr Leu Leu Pro Arg Arg Gly Pro Arg Leu Gly Val Arg Ala 35 40 45 Thr Arg Lys Thr Ser Glu Arg Ser Gln Pro Arg Gly Arg Arg Gln Pro 50 55 60 Ile Pro Lys Ala Arg Arg Pro Glu Gly Arg Thr Trp Ala Gln Pro Gly 65 70 75 80 Tyr Pro Trp Pro Leu Tyr Gly Asn Glu Gly Cys Gly Trp Ala Gly Trp 85 90 95 Leu Leu Ser Pro Arg Gly Ser Arg Pro Ser Trp Gly Pro Thr Asp Pro 100 105 110 Arg Arg Arg Ser Arg Asn Leu Gly Lys Val Ile Asp Thr Leu Thr Cys 115 120 125 Gly Phe Ala Asp Leu Met Gly Tyr Ile Pro Leu Val Gly Ala Pro Leu 130 135 140 Gly Gly Ala Ala Arg Ala Leu Ala His Gly Val Arg Val Leu Glu Asp 145 150 155 160 Gly Val Asn Tyr Ala Thr Gly Asn Leu Pro Gly Cys Ser Phe Ser Ile 165 170 175 Phe Leu Leu Ala Leu Leu Ser Cys Leu Thr Val Pro Ala Ser 180 185 190 2 43 PRT Hepatitis C virus 2 Met Ser Thr Asn Pro Lys Pro Gln Lys Lys Asn Lys Arg Asn Thr Asn 1 5 10 15 Arg Arg Pro Gln Asp Val Lys Phe Pro Gly Gly Gly Gln Ile Val Gly 20 25 30 Gly Val Tyr Leu Leu Pro Arg Arg Gly Pro Arg 35 40 3 34 PRT Hepatitis C virus 3 Lys Asn Lys Arg Asn Thr Asn Arg Arg Pro Gln Asp Val Lys Phe Pro 1 5 10 15 Gly Gly Gly Gln Ile Val Gly Gly Val Tyr Leu Leu Pro Arg Arg Gly 20 25 30 Pro Arg

Claims (8)

We claim:
1. An antibody/antigen composition comprising a mixture of HCV protein and modified HCV core protein and anti-core antibodies wherein said anti-core antibodies do not recognize HCV core sequence amino acids 10-43.
2. The antibody composition as claimed in claim 1 wherein said HCV protein is selected from the group consisting of: c200-3 and NS5 and said modified HCV core protein is selected from the group consisting of: c22KS∇ 47,48 and c22KSR47L.
3. The antibody composition as claimed in claim 1 wherein said anti-core antibodies comprise a monoclonal antibody.
4. The antibody composition as claimed in claim 1 wherein said anti-core antibodies comprise a polyclonal antibody.
5. A method of immunoassay for HCV which comprises a) immobilizing onto a solid phase an antibody/antigen composition according to claim 1, b) contacting said antibody/antigen composition with blood or serum from a patient to form an HCV antibody/antigen complex, c) adding anti-human IgG carrying a label, and d) detecting said complex.
6. The immunoassay method as claimed in claim 5 wherein said solid phase is a microwell, mircrotitre plate, membrane or bead.
7. The immunoassay method as claimed in claim 5 wherein said label is an enzyme, a dye, colored particle, radionuclide or fluorescent substance.
8. A kit containing the antibody/antigen composition as claimed in claim 1.
US10/268,562 2001-11-07 2002-10-10 Reagents for the simultaneous detection of HCV core antigens and antibodies Abandoned US20030108563A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US10/268,562 US20030108563A1 (en) 2001-11-07 2002-10-10 Reagents for the simultaneous detection of HCV core antigens and antibodies
EP02257659A EP1310796A3 (en) 2001-11-07 2002-11-05 Reagents for the simultaneous detection of HCV core antigens and antibodies
JP2002321299A JP2003202345A (en) 2001-11-07 2002-11-05 Reagent for simultaneous detection of hcv core antigen and antibody

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US34794301P 2001-11-07 2001-11-07
US10/268,562 US20030108563A1 (en) 2001-11-07 2002-10-10 Reagents for the simultaneous detection of HCV core antigens and antibodies

Publications (1)

Publication Number Publication Date
US20030108563A1 true US20030108563A1 (en) 2003-06-12

Family

ID=26953175

Family Applications (1)

Application Number Title Priority Date Filing Date
US10/268,562 Abandoned US20030108563A1 (en) 2001-11-07 2002-10-10 Reagents for the simultaneous detection of HCV core antigens and antibodies

Country Status (3)

Country Link
US (1) US20030108563A1 (en)
EP (1) EP1310796A3 (en)
JP (1) JP2003202345A (en)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030152965A1 (en) * 2001-11-11 2003-08-14 Chander Bahl HCV core protein sequences
WO2006081701A1 (en) * 2005-02-02 2006-08-10 Peng Cui A kit for detecting the antibody of hcv and its preparing method
US20080113339A1 (en) * 2006-09-01 2008-05-15 Rodgers Brian C Combination hepatitis c virus antigen and antibody detection method
US20100297607A1 (en) * 2009-05-20 2010-11-25 Jian Zheng Reagents For HCV Antigen-Antibody Combination Assays

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP4533656B2 (en) * 2004-04-28 2010-09-01 アボットジャパン株式会社 Hepatitis C virus (HCV) antibody assay with improved specificity
FR2984328B1 (en) * 2011-12-20 2016-12-30 Bio-Rad Innovations METHOD FOR DETECTING HEPATITIS C VIRUS INFECTION
CN113549148A (en) * 2013-03-14 2021-10-26 雅培制药有限公司 HCV core lipid binding domain monoclonal antibodies
CA2906407A1 (en) 2013-03-14 2014-09-18 Abbott Laboratories Hcv ns3 recombinant antigens and mutants thereof for improved antibody detection
WO2014158272A1 (en) 2013-03-14 2014-10-02 Abbott Laboratories Hcv antigen-antibody combination assay and methods and compositions for use therein

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4198398A (en) * 1977-07-12 1980-04-15 Derek Hudson Enkephalin analogues
US5380668A (en) * 1993-07-06 1995-01-10 University Of Utah Research Foundation Compounds having the antigenicity of hCG
US5683864A (en) * 1987-11-18 1997-11-04 Chiron Corporation Combinations of hepatitis C virus (HCV) antigens for use in immunoassays for anti-HCV antibodies
US6623921B2 (en) * 1998-07-30 2003-09-23 Advanced Life Science Institute, Inc. Method for measurement of hepatitis C virus
US6727092B2 (en) * 2001-06-26 2004-04-27 Abbott Laboratories Methods for the simultaneous detection of HCV antigens and HCV antibodies

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE4112743C2 (en) * 1991-04-19 2000-01-13 Dade Behring Marburg Gmbh Synthetic core peptides for the determination of HCV antibodies and HCV antigens, agents therefor and their use in these detection methods
EP1801591B1 (en) * 1997-08-04 2016-12-28 Advanced Life Science Institute, Inc. Methods for detection or measurement of viruses
KR100847586B1 (en) * 1998-07-30 2008-07-22 가부시끼가이샤 센단세메이가가꾸겐큐죠 Method for assaying hepatitis c virus
AR033448A1 (en) * 2001-03-28 2003-12-17 Ortho Clinical Diagnostics Inc ANTIGEN-ANTIBODY COMBINATION TEST FOR HEPATITIS C FOR AN EARLY DETECTION OF INFECTION

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4198398A (en) * 1977-07-12 1980-04-15 Derek Hudson Enkephalin analogues
US5683864A (en) * 1987-11-18 1997-11-04 Chiron Corporation Combinations of hepatitis C virus (HCV) antigens for use in immunoassays for anti-HCV antibodies
US5380668A (en) * 1993-07-06 1995-01-10 University Of Utah Research Foundation Compounds having the antigenicity of hCG
US6623921B2 (en) * 1998-07-30 2003-09-23 Advanced Life Science Institute, Inc. Method for measurement of hepatitis C virus
US6727092B2 (en) * 2001-06-26 2004-04-27 Abbott Laboratories Methods for the simultaneous detection of HCV antigens and HCV antibodies
US7101683B2 (en) * 2001-06-26 2006-09-05 Abbott Laboratories Methods for the simultaneous detection of HCV antigens and HCV antibodies

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030152965A1 (en) * 2001-11-11 2003-08-14 Chander Bahl HCV core protein sequences
US7332269B2 (en) 2001-11-11 2008-02-19 Ortho-Clinical Diagnostics, Inc. HCV core protein sequences
WO2006081701A1 (en) * 2005-02-02 2006-08-10 Peng Cui A kit for detecting the antibody of hcv and its preparing method
US20090029348A1 (en) * 2005-02-02 2009-01-29 Peng Cui Kit for Detecting the Antibody of HCV and Its Preparing Method
US7658930B2 (en) 2005-02-02 2010-02-09 Peng Cui Kit for detecting the antibody of HCV and its preparing method
US20080113339A1 (en) * 2006-09-01 2008-05-15 Rodgers Brian C Combination hepatitis c virus antigen and antibody detection method
US8865398B2 (en) 2006-09-01 2014-10-21 Abbott Laboratories Combination hepatitis C virus antigen and antibody detection method
EP2910949A1 (en) 2006-09-01 2015-08-26 Abbott Laboratories Combination hepatitis C virus antigen and antibody detection method
US9470686B2 (en) 2006-09-01 2016-10-18 Abbott Laboratories Combination hepatitis C virus antigen and antibody detection method
US20100297607A1 (en) * 2009-05-20 2010-11-25 Jian Zheng Reagents For HCV Antigen-Antibody Combination Assays
US9915658B2 (en) 2009-05-20 2018-03-13 Ortho-Clinical Diagnostics, Inc. Reagents for HCV antigen-antibody combination assays
US10041946B2 (en) 2009-05-20 2018-08-07 Ortho-Clinical Diagnostics Inc. Reagents for HCV antigen-antibody combination assays

Also Published As

Publication number Publication date
EP1310796A3 (en) 2004-06-09
JP2003202345A (en) 2003-07-18
EP1310796A2 (en) 2003-05-14

Similar Documents

Publication Publication Date Title
US6489129B1 (en) Antigen-specific IgM detection
US6596476B1 (en) Hepatitis C assay
EP0445423A2 (en) Hepatitis C assay
US20010006824A1 (en) Antigen-specific igg detection
KR101828767B1 (en) Reagents for HCV antigen-antibody combination assays
WO2008027942A2 (en) Combination hepatitis c virus antigen and antibody detection method
KR930004055B1 (en) Peptide and its use
EP1328811B1 (en) Hcv mosaic antigen composition
US20030108563A1 (en) Reagents for the simultaneous detection of HCV core antigens and antibodies
US6723502B2 (en) Hepatitis C antigen—antibody combination assay for the early detection of infection
JP2666903B2 (en) HCV peptide antigen and method for measuring HCV
AU754309B2 (en) Diagnosis of feline immunodeficiency virus infection using env/gag polypeptide markers
JP2837669B2 (en) T-cell lymphotropic virus protein and its analysis
CA2405849A1 (en) Reagents for the simultaneous detection of hcv core antigens and antibodies
JP4283527B2 (en) HCV core protein sequence
CN114478716B (en) Polypeptide combination and application thereof in novel coronavirus antibody detection
NL9402224A (en) Peptides effective in the detection and diagnosis of hepatitis C.
EP0536838A2 (en) Non-A, non-B peptides
KR960014341A (en) Toxoplasma Gondi Antigen
WO1993011158A2 (en) Non-a, non-b peptides
JPH05307040A (en) Reagent for inspection of c-type hepatitis and inspecting method
CN114478716A (en) Polypeptide combination and application thereof in novel coronavirus antibody detection
CA2081888A1 (en) Method of determining type specific antibodies to herpes simplex virus types 1 and 2
AU2007200598A1 (en) A hepatitis C antigen - antibody combination assay for the early detection of HCV infection

Legal Events

Date Code Title Description
AS Assignment

Owner name: ORTHO-CLINICAL DIAGNOSTICS, INC., NEW YORK

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:BAHL, CHANDER;REEL/FRAME:014174/0266

Effective date: 20021009

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION