JP2019532617A - Anti-transthyretin antibody - Google Patents

Abstract

The present invention provides antibodies that specifically bind to transthyretin (TTR). The antibody can be used to treat or prevent a disease or disorder associated with TTR accumulation or TTR deposit accumulation (eg, TTR amyloidosis). This antibody can also be used to diagnose TTR amyloidosis and to inhibit or reduce TTR aggregation, among other applications. [Selection] FIG. 1, FIG. 1A. 2, Fig. 1B

Description

CROSS REFERENCE TO RELATED APPLICATIONS This application claims priority to US Patent Application No. 15 / 201,423, filed July 2, 2016, and filed US Provisional Patent Application No. 62, filed January 28, 2015. US patent application Ser. No. 15/009, filed Jan. 28, 2016, which claims the benefit of US Provisional Patent Application No. 62 / 266,556, filed Dec. 11, 2015 , 662, each of which is incorporated by reference in its entirety.

Reference to Sequence Listing In the present application, file name 498967_SEQLST. TXT, date of creation June 29, 2017, includes an electronic sequence table with a capacity of 135,046 bytes, which is incorporated herein by reference in its entirety for all purposes.

  There are several diseases that are believed to be caused by abnormalities in the folding and aggregation of disease-specific proteins. Such proteins may accumulate as pathological diagnostic deposits known as amyloid and are visualized by specific histological staining. Amyloid is thought to induce an inflammatory response and has multiple negative consequences for the tissues involved. In addition, small aggregates of proteins with abnormal folding may be present, resulting in cytotoxic effects.

  Transthyretin (TTR) is one of many proteins known to misfold and aggregate (eg, form amyloid). Transthyretin-related amyloidosis includes two forms of disease: familial disease caused by misfolding of mutant TTR or variant TTR, and sporadic non-hereditary disease caused by inappropriate aggregation of wild-type TTR It is. During the process of TTR amyloid formation, pathology may occur in the nervous system and / or heart and other tissues.

  The present invention provides an antibody that binds to transthyretin and comprises three heavy chain CDRs and three light chain CDRs substantially derived from antibody 14G8. Some antibodies include the three Kabat heavy chain CDRs and the three Kabat light chain CDRs of antibody 14G8, provided that the H52 and L26 positions are N or S, respectively. Some antibodies comprise the three Kabat heavy chain CDRs and the three Kabat light chain CDRs of antibody 14G8. CDR-H1 is optionally the Kabat-Chothia CDR complex of antibody 14G8. Some antibodies contain three Kabat heavy chain CDRs of antibody 9D5. CDR-H1 is optionally the Kabat-Chothia CDR complex of antibody 9D5.

  Some antibodies bind to the same epitope as 9D5 or 14G8 on transthyretin and contain three light chain CDRs and three heavy chain CDRs, (a) each CDR is a 9D5 heavy chain variable region and Has at least 90% sequence identity with the corresponding CDR of the light chain variable region, or (b) each CDR has at least 90% sequence identity with the corresponding CDR of the heavy chain variable region and the light chain variable region of 14G8 Where L26 can be N or S. Some antibodies are (a) 9D5 3 heavy chain CDRs and 3 light chain CDRs, or (b) 14G8 3 heavy chain CDRs and 3 light chain CDRs, provided that the L26 position is N Or what can be S is included. In some antibodies, the three heavy chain CDRs and three light chain CDRs of 9D5 are SEQ ID NOs: 13-15 and 24-26, respectively. In some antibodies, the three heavy chain and three light chain CDRs of 14G8 are SEQ ID NOs: 67-69 and 77-79, respectively, provided that the L26 position can be N or S.

  Any of the above antibodies can be a monoclonal antibody. Any of the above antibodies can be a chimeric antibody, a humanized antibody, a veneered antibody, or a human antibody. Any of the above antibodies can have a human IgG1 isotype, a human IgG2 isotype, or a human IgG4 isotype.

  The invention further provides a humanized or chimeric antibody of a murine antibody that specifically binds to transthyretin, wherein the murine antibody comprises a mature heavy chain variable region of SEQ ID NO: 61 and a mature light chain of SEQ ID NO: 70. Characterized by a variable region, provided that position H52 can be S or N, position H69 can be F or I, position L26 can be S or N, and R at position L107 is optional. The antibody is optionally a humanized 9D5 antibody, chimeric 9D5 antibody, humanized 14G8 antibody or chimeric 14G8 antibody that specifically binds to transthyretin, wherein 9D5 is the mature heavy chain variable region of SEQ ID NO: 1 and A mouse antibody characterized by the mature light chain variable region of SEQ ID NO: 16, and 14G8 is a mouse antibody characterized by the mature heavy chain variable region of SEQ ID NO: 61 and the mature light chain variable region of SEQ ID NO: 70. The humanized antibody is optionally (a) a humanized mature heavy chain variable region comprising 3 heavy chain CDRs of 9D5 and a humanized mature light chain variable region comprising 3 light chain CDRs of 9D5, or (b) 14G8 A humanized mature heavy chain variable region comprising three heavy chain CDRs and a humanized mature light chain variable region comprising three 14G8 light chain CDRs, including those wherein L26 can be N or S . The three heavy chain CDRs and three light chain CDRs of 9D5 are optionally SEQ ID NOs: 13-15 and 24-26, respectively. The three heavy chain CDRs and three light chain CDRs of 14G8 are optionally SEQ ID NOs: 67-69 and 77-79, respectively, provided that position L26 can be N or S. Optionally, any differences in the CDRs of the mature heavy chain variable region and mature light chain variable region from SEQ ID NOs: 1 and 16, respectively, are at positions H60-H65. Optionally, the CDR differences in the mature heavy chain variable region and mature light chain variable region from SEQ ID NOs: 61 and 70, respectively, are at positions H60-H65, provided that position L26 is N or S obtain.

  The humanized antibody is optionally a humanized mature heavy chain variable region having an amino acid sequence at least 90% identical to any one of SEQ ID NOs: 5-12 and any one of SEQ ID NOs: 19-23. And a humanized mature light chain variable region having an amino acid sequence at least 90% identical to each other, provided that H19 can be R or K, H40 can be A or T, and H44 can be G or R can be R, H49 can be S or A, H77 can be S or T, H82a can be N or S, H83 can be R or K, and H84 can be A or S and H89 can be V or M. Optionally, at least one of the following positions is occupied by the designated amino acid: position H42 is occupied by E, position H47 is occupied by L, position H69 is occupied by F, position H82 is S H82b is occupied by L, H108 is occupied by L, L8 is occupied by A, L9 is occupied by P, L18 is occupied by S, and L19 is occupied by V. L36 is occupied by F, L39 is occupied by R, L60 is occupied by S, L70 is occupied by A, and L74 is occupied by R. Optionally, positions H47, H69, and H82 are occupied by L, F, and S, respectively. Optionally, positions H47, H69, H82, and H82b are occupied by L, F, S, and L, respectively. Optionally, positions H42, H47 and H108 are occupied by E, L and L, respectively. Optionally, positions H69, H82, and H82b are occupied by F, S, and L, respectively. Optionally, positions H47 and H108 are each occupied by L. Optionally, positions H82 and H82b are occupied by S and L, respectively. Optionally, positions H42, H47, and H82b are occupied by E, L, and L, respectively. Optionally, position L36 is occupied by F. Optionally, position L60 is occupied by S. Optionally, L8, L9, L19, L36, L39, L60, L70, and L74 are occupied by A, P, V, F, R, S, A, and R, respectively. Yes. Optionally, L8, L9, L18, L19, L36, L39, L60, L70, and L74 are respectively A, P, S, V, F, R, S, A, and Occupied by R.

  The humanized antibody is optionally a mature heavy chain variable region having an amino acid sequence at least 95% identical to any one of SEQ ID NOs: 5-12, and any one of SEQ ID NOs: 19-23. A mature light chain variable region having an amino acid sequence that is at least 95% identical, provided that the H19 position can be R or K, the H40 position can be A or T, and the H44 position can be G or R. H49 can be S or A, H77 can be S or T, H82a can be N or S, H83 can be R or K, and H84 can be A or S. And the H89 position can be V or M. The humanized antibody is optionally a mature heavy chain variable region having an amino acid sequence at least 98% identical to any one of SEQ ID NOs: 5-12, and any one of SEQ ID NOs: 19-23. A mature light chain variable region having an amino acid sequence at least 98% identical, provided that the H19 position can be R or K, the H40 position can be A or T, and the H44 position can be G or R. H49 can be S or A, H77 can be S or T, H82a can be N or S, H83 can be R or K, and H84 can be A or S. And the H89 position can be V or M. Optionally, the mature heavy chain variable region has an amino acid sequence of any one of SEQ ID NOs: 5-12, and the mature light chain variable region has an amino acid sequence of any one of SEQ ID NOs: 19-23. . In some antibodies, the mature heavy chain variable region has the amino acid sequence of SEQ ID NO: 11, and the mature light chain variable region has the amino acid sequence of SEQ ID NO: 19.

  The humanized antibody is optionally a humanized mature heavy chain variable region having an amino acid sequence at least 90% identical to any one of SEQ ID NOs: 64-66 and any one of SEQ ID NOs: 74-76. And a humanized mature light chain variable region having an amino acid sequence that is at least 90% identical, wherein H82a can be N or S, H83 can be R or K, and H84 can be A or It can be S, the H89 position can be V or M, and the L18 position can be S or P. Optionally, at least one of the following positions is occupied by the designated amino acid: position H1 is occupied by E, position H47 is occupied by L and position L36 is occupied by F. Optionally, positions H1 and H47 are occupied by E and L, respectively. Optionally, position L36 is occupied by F. At least one of the following positions is optionally occupied by the designated amino acid: H3 position is occupied by K, H105 position is occupied by T, L8 position is occupied by A, and L9 position is L is occupied by P, L19 is occupied by V, L26 is occupied by S, L60 is occupied by S, and L70 is occupied by A. Optionally, the H3 and H105 positions are occupied by K and T, respectively. Optionally, positions L8, L9, L19, and L70 are occupied by A, P, V, and A, respectively. Optionally, positions L26 and L60 are each occupied by S.

  The humanized antibody is optionally a mature heavy chain variable region having an amino acid sequence at least 95% identical to any one of SEQ ID NOs: 64-66 and any one of SEQ ID NOs: 74-76. A mature light chain variable region having an amino acid sequence at least 95% identical, provided that position H82a can be N or S, position H83 can be R or K, and position H84 can be A or S. , H89 can be V or M, and L18 can be S or P. The humanized antibody is optionally a mature heavy chain variable region having an amino acid sequence at least 98% identical to any one of SEQ ID NOs: 64-66, and any one of SEQ ID NOs: 74-76. And a mature light chain variable region having at least 98% identical amino acid sequence, provided that position H82a can be N or S, position H83 can be R or K, and position H84 can be A or S. , H89 can be V or M, and L18 can be S or P. Optionally, the mature heavy chain variable region has an amino acid sequence of any one of SEQ ID NOs: 64-66, and the mature light chain variable region has an amino acid sequence of any one of SEQ ID NOs: 74-76. . In some antibodies, the mature heavy chain variable region has the amino acid sequence of SEQ ID NO: 65, and the mature light chain variable region has the amino acid sequence of SEQ ID NO: 76.

  Any of the above antibodies can be an intact antibody, a binding fragment, a single chain antibody fragment, a Fab fragment, or a Fab'2 fragment. In any of the above antibodies, the mature light chain variable region may be fused to the light chain constant region and the mature heavy chain variable region may be fused to the heavy chain constant region. The heavy chain constant region is optionally a variant of a natural human heavy chain constant region that has reduced binding to an Fcγ receptor relative to a natural human heavy chain constant region. The heavy chain constant region is optionally of the IgG1 isotype. Optionally, the mature heavy chain variable region is fused to a heavy chain constant region having the sequence of SEQ ID NO: 103, and / or the mature light chain variable region is fused to the mature light chain variable region having the sequence of SEQ ID NO: 104 or 105 is doing.

  The present invention further provides a pharmaceutical composition comprising any of the antibodies described above and a pharmaceutically acceptable carrier.

  The present invention further provides a nucleic acid encoding the heavy chain and / or light chain of any of the above-described antibodies, such as any one of SEQ ID NOs: 40, 42, 44 to 56, 87, 89, 91 to 96, and 106 to 108. Provide one etc.

  The present invention further provides a recombinant expression vector containing the above-described nucleic acid, and a host cell transformed with the recombinant expression vector.

  The present invention is further a method of humanizing an antibody comprising: (a) selecting one or more acceptor antibodies; (b) identifying the amino acid residues of a mouse antibody to be retained; (C) synthesizing a nucleic acid encoding a humanized heavy chain comprising a CDR of a mouse antibody heavy chain and a nucleic acid encoding a humanized light chain comprising a CDR of a mouse antibody light chain; Wherein the murine antibody is 9D5 or 14G8, wherein 9D5 is characterized by the mature heavy chain variable region of SEQ ID NO: 1 and the mature light chain variable region of SEQ ID NO: 16, and 14G8 Provides a mature heavy chain variable region of SEQ ID NO: 61 and a mature light chain variable region of SEQ ID NO: 70.

  The invention further provides a method of making a humanized antibody, chimeric antibody, or veneered antibody, wherein (a) nucleic acids encoding the heavy and light chains of the antibody so that the cell secretes the antibody Culturing the cells transformed with, and (b) purifying the antibody from the cell culture medium, wherein the antibody is humanized, chimeric, or veneered 9D5 or 14G8 I will provide a.

The invention further provides a method of making a cell line that produces a humanized antibody, chimeric antibody, or veneered antibody comprising: (a) the heavy and light chains of the antibody and a selectable marker in the cell. Introducing an encoding vector; (b) growing the cell under conditions that select for cells with an increased vector copy number; and (c) isolating a single cell from the selected cell. And (d) banking cells cloned from a single cell selected based on the amount of antibody produced, wherein the antibody is humanized, chimeric, or veneered. A method is provided that is 9D5 or 14G8. The method optionally further comprises a growing the cells under selective conditions, and screening the cell lines of at least 100 mg / L 10 ⁶ cells per naturally expressed and secreted in 24 hours.

  The invention further provides a method for inhibiting or reducing the aggregation of transthyretin in a subject having or at risk of developing transthyretin-mediated amyloidosis, wherein the subject is And a method comprising: inhibiting or reducing aggregation of transthyretin in a subject.

  The present invention further provides a method of inhibiting or reducing transthyretin fibril formation in a subject having or at risk of developing transthyretin-mediated amyloidosis, wherein the subject is administered any of the antibodies described above. A method is provided comprising performing an effective regimen thereby inhibiting or reducing transthyretin accumulation in a subject.

  The invention further provides a method for reducing transthyretin deposits in a subject having or at risk of developing transthyretin-mediated amyloidosis, wherein the subject is an effective regimen of any of the above-described antibodies. Is provided, thereby reducing transthyretin deposits in the subject.

  The present invention further provides a method of removing aggregated transthyretin in a subject having or at risk of developing transthyretin-mediated amyloidosis, wherein the subject is provided with an effective regimen of any of the above antibodies. Performing and thereby removing aggregate transthyretin from the subject relative to a subject having or at risk of developing amyloidosis due to transthyretin not receiving the antibody .

  The present invention further provides a method for stabilizing transthyretin in a nontoxic conformation in a subject having or at risk of developing transthyretin-mediated amyloidosis, wherein And a method comprising stabilizing a non-toxic conformation of transthyretin in a subject.

  The present invention further provides a method of treating or preventing transthyretin-mediated amyloidosis in a subject, comprising performing an effective regimen of any of the above antibodies on the subject.

  The present invention further provides a method of delaying the onset of transthyretin-mediated amyloidosis in a subject, comprising performing an effective regimen of any of the above antibodies on the subject.

  The present invention further provides a method of diagnosing transthyretin-mediated amyloidosis in a subject, comprising contacting a biological sample from the subject with an effective amount of any of the antibodies described above. The method optionally further comprises detecting binding of the antibody to transthyretin, and the presence of the bound antibody indicates that the subject has transthyretin-mediated amyloidosis. The method optionally further comprises comparing the binding of the antibody to the biological sample with the binding of the antibody to the control sample, wherein the binding of the antibody to the biological sample is increased relative to the control sample. Indicates that the subject has transthyretin-mediated amyloidosis. The biological sample and the control sample optionally contain cells of the same tissue origin. The biological sample and / or control sample is optionally blood, serum, plasma, or solid tissue. The solid tissue is optionally derived from the heart, peripheral nervous system, autonomic nervous system, kidney, eyeball, or gastrointestinal tract.

  In any of the above methods, transthyretin-mediated amyloidosis may be cardiomyopathy or cardiac hypertrophy, familial amyloid neuropathy, central nervous system selective amyloidosis (CNSA), senile systemic amyloidosis, senile cardiac amyloidosis, spinal column It may be associated with a pathological condition selected from ductal stenosis, osteoarthritis, rheumatoid arthritis, juvenile idiopathic arthritis, macular degeneration and ligament or tendon disorders.

  The present invention further includes cardiomyopathy or cardiac hypertrophy, familial amyloid neuropathy, central nervous system selective amyloidosis (CNSA), senile systemic amyloidosis, senile cardiac amyloidosis, spinal canal stenosis, osteoarthritis, rheumatoid arthritis, A method of treating a subject having or at risk for any of juvenile idiopathic arthritis, macular degeneration and ligament or tendon disorder, comprising an effective regimen of the antibody of any one of the claims A method is provided comprising performing the method.

  In any of the above methods, the transthyretin-mediated amyloidosis can optionally be familial transthyretin amyloidosis or sporadic transthyretin amyloidosis. Familial transthyretin amyloidosis is optionally familial amyloid cardiomyopathy (FAC), familial amyloid neuropathy (FAP), or central nervous system selective amyloidosis (CNSA). The sporadic transthyretin amyloidosis is optionally senile systemic amyloidosis (SSA) or senile cardiac amyloidosis (SCA). In any of the above methods, transthyretin-mediated amyloidosis can optionally be associated with amyloid accumulation in the subject's heart, peripheral nervous system, autonomic nervous system, kidney, eyeball, or gastrointestinal tract.

  The present invention is further a method for detecting the presence or absence of transthyretin deposits in a subject, wherein a biological sample from a subject suspected of having amyloid accumulation is contacted with an effective amount of any of the antibodies described above. To provide a method. The method optionally further comprises detecting binding of the antibody to transthyretin, and detection of bound antibody indicates the presence of a transthyretin deposit. The method optionally further comprises comparing the binding of the antibody to the biological sample with the binding of the antibody to the control sample, wherein the binding of the antibody to the biological sample is increased relative to the control sample. Indicates that the subject has transthyretin-mediated amyloidosis. The biological sample and the control sample optionally contain cells of the same tissue origin. The biological sample and / or control sample is optionally blood, serum, plasma, or solid tissue. The solid tissue is optionally derived from the heart, peripheral nervous system, autonomic nervous system, kidney, eyeball, or gastrointestinal tract.

  The present invention further includes a method for determining the level of transthyretin deposits in a subject, comprising administering any of the antibodies described above and detecting the presence of bound antibody in the subject. . Optionally, the presence of bound antibody is determined by positron emission tomography (PET).

It is a figure which shows the alignment of the heavy chain variable region of mouse | mouth 9D5 antibody, a mouse | mouth model antibody, a human acceptor antibody, and humanized type 9D5 antibody. The CDR defined by Kabat is surrounded by a square, with the exception that the part enclosed by the first square is a complex of Chothia CDR-H1 and Kabat CDR-H1, and the underlined bold part Kabat CDR-H1. It is a figure which shows alignment of the light chain variable region of a mouse | mouth 9D5 antibody, a mouse | mouth model antibody, a human acceptor antibody, and a humanized 9D5 antibody. The CDR defined by Kabat is enclosed in a square. It is a figure which shows alignment of the heavy chain variable region of a mouse | mouth 14G8 antibody, a mouse | mouth model antibody, a human acceptor antibody, and a humanized type 14G8 antibody. The CDR defined by Kabat is surrounded by a square, with the exception that the part enclosed by the first square is a complex of Chothia CDR-H1 and Kabat CDR-H1, and the underlined bold part Kabat CDR-H1. It is a figure which shows alignment of the light chain variable region of a mouse | mouth 14G8 antibody, a mouse | mouth model antibody, a human acceptor antibody, and a humanized type 14G8 antibody. The CDR defined by Kabat is enclosed in a square. FIG. 3A is a diagram showing binding curves of mouse 5A1, 6C1, 9D5, and 14G8 antibodies to pH4-treated TTR. FIG. 3B shows the binding curves of mouse 5A1, 6C1, 9D5, and 14G8 antibodies to native TTR. FIG. 4A is a diagram showing inhibition of TTR-Y78F fibril formation by a mis-TTR antibody. FIG. 4B shows inhibition of TTR-V122I fibril formation by 14G8. FIG. 4C shows inhibition of TTR-V122I fibril formation by a control antibody. FIG. 5A shows a plasma sample (sample number 11, 12, 15, 18, 19, 20) derived from a patient with confirmed V30M ATTR and a sample derived from a normal subject (sample number 21, sample) using 9D5 mis-TTR antibody. It is a figure which shows the densitometric analysis of the western blot analysis of 22, 23, 24, 25, 27). FIG. 5B is a diagram showing densitometric analysis of Western blot analysis of the same sample using 5A1 mis-TTR antibody. Plasma samples from patients with confirmed V30M ATTR (sample numbers 11, 12, 15, 18, 19, 20) and samples from normal subjects (numbers 21, 22, 23, 24, 25, 6C1 antibody) It is a figure which shows the MesoScale Discovery (MSD) plate assay of 27). FIG. 7A shows the effect of antibody 14G8 on F87M / L110M TTR uptake by THP-1 cells. FIG. 7B shows the effect of each mis-TTR antibody on V30M TTR uptake by THP-1 cells. FIG. 14 shows that 14G8 binds to TTR-V122I fibril ends and to oligomeric aggregates as assessed using TEM and AFM. Immunogold labeling with 14G8 was observed on TTR-V122I oligomer aggregates and fibril ends (FIG. 8A), whereas immunogold labeling with anti-TTR pAb leads to binding and oligomer clusters along the length of TTR fibers. (Fig. 8B). The IgG1 isotype control mAb did not show immunogold labeling (FIG. 8C). ATR was used to evaluate TTR-V122I fibers alone and in the presence of 14G8 ± 6 nm colloidal gold conjugate secondary antibody. Gold labeling was observed at the fiber end (FIG. 8D). FIG. 4 shows that the interaction between 14G8 and mature TTR-V122I fibrils assessed using ITC is consistent with a two-binding site model. ITC data and binding isotherms for 14G8 binding to aggregated TTR variants are shown in FIG. 8A. Binding fit to the two binding site model and had the KD values shown (FIG. 8B). FIG. 5 shows 14G8 immunolabeled TTR amyloid present between fibers of nerve bundles of patients with ATTR amyloidosis due to TTR-V30M mutation. Panels 1 and 2 of FIG. 10A show amyloid between nerve bundle fibers in tissues from patients with ATTR amyloidosis, which are Congo red (panels 1 and 2 of FIG. 8B) and Thioflavin T (panel 1 of FIG. 10C). And 2) overlapped with staining as well as immunolabeling with total TTR antibody (FIG. 10D). Although no staining was seen with the use of two isotype control antibodies (FIGS. 10E-10F), axonal degeneration (lack of Schwann cell nuclei) was also observed in regions containing TTR amyloid deposits (FIGS. 10E-). 10F [red area in 6E]). Peripheral nerves from healthy controls were not labeled using either 14G8 or total TTR antibody (panels 1-3 of FIG. 10G). FIG. 11 shows that antibody 14G8 immunolabels TTR amyloid in the gastrointestinal tract derived from a patient with TTR-C30M amyloidosis. Panel 1 in FIGS. 11A and 11B shows the Meissner plexus and glands in the esophagus, panel 1 in FIG. 11C shows a rich vascular bed of submucosa, and panel 1 in FIG. 11D shows Congo red fluorescent staining ( FIG. 11 shows the 14G8 positive TTR amyloid of the intrinsic muscle layer (MP) and mucosal muscle lamina superimposed with panels 2) of FIGS. Panel 3 of FIGS. 11A-11D shows that ATTR amyloidosis tissue stained with isotype control mAb 14G8 immunoreactivity was absent from healthy control tissues (panels 1-4 of FIG. 11).

BRIEF DESCRIPTION OF THE SEQUENCES SEQ ID NO: 1 represents the amino acid sequence of the heavy chain variable region of the mouse 9D5 antibody.

  SEQ ID NO: 2 represents the amino acid sequence of template 1SEQ_H of mouse heavy chain variable region structure.

  SEQ ID NO: 3 represents the amino acid sequence of heavy chain variable acceptor ACC number BAC02114.

  SEQ ID NO: 4 represents the amino acid sequence of heavy chain variable acceptor ACC number AAX82494.1.

  SEQ ID NO: 5 represents the amino acid sequence of heavy chain variable region version 1 (Hu9D5VHv1) of the humanized 9D5 antibody.

  SEQ ID NO: 6 represents the amino acid sequence of heavy chain variable region version 2 (Hu9D5VHv2) of the humanized 9D5 antibody.

  SEQ ID NO: 7 represents the amino acid sequence of heavy chain variable region version 2b (Hu9D5VHv2b) of the humanized 9D5 antibody.

  SEQ ID NO: 8 represents the amino acid sequence of heavy chain variable region version 3 (Hu9D5VHv3) of the humanized 9D5 antibody.

  SEQ ID NO: 9 represents the amino acid sequence of heavy chain variable region version 3b (Hu9D5VHv3b) of the humanized 9D5 antibody.

  SEQ ID NO: 10 represents the amino acid sequence of heavy chain variable region version 4 (Hu9D5VHv4) of the humanized 9D5 antibody.

  SEQ ID NO: 11 represents the amino acid sequence of heavy chain variable region version 4b (Hu9D5VHv4b) of the humanized 9D5 antibody.

  SEQ ID NO: 12 represents the amino acid sequence of heavy chain variable region version 5 (Hu9D5VHv5) of the humanized 9D5 antibody.

  SEQ ID NO: 13 represents the amino acid sequence of Kabat CDR-H1 of mouse 9D5 antibody.

  SEQ ID NO: 14 represents the amino acid sequence of Kabat CDR-H2 of mouse 9D5 antibody.

  SEQ ID NO: 15 represents the amino acid sequence of Kabat CDR-H3 of mouse 9D5 antibody.

  SEQ ID NO: 16 represents the amino acid sequence of the light chain variable region of the mouse 9D5 antibody.

  SEQ ID NO: 17 represents the amino acid sequence of template 1MJU_L of mouse light chain variable region structure.

  SEQ ID NO: 18 represents the amino acid sequence of light chain variable acceptor ACC number ABC66952.

  SEQ ID NO: 19 represents the amino acid sequence of light chain variable region version 1 (Hu9D5VLv1) of the humanized 9D5 antibody.

  SEQ ID NO: 20 represents the amino acid sequence of light chain variable region version 2 (Hu9D5VLv2) of the humanized 9D5 antibody.

  SEQ ID NO: 21 represents the amino acid sequence of light chain variable region version 3 (Hu9D5VLv3) of the humanized 9D5 antibody.

  SEQ ID NO: 22 represents the amino acid sequence of light chain variable region version 4 (Hu9D5VLv4) of the humanized 9D5 antibody.

  SEQ ID NO: 23 represents the amino acid sequence of light chain variable region version 5 (Hu9D5VLv5) of the humanized 9D5 antibody.

  SEQ ID NO: 24 represents the amino acid sequence of Kabat CDR-L1 of mouse 9D5 antibody.

  SEQ ID NO: 25 represents the amino acid sequence of Kabat CDR-L2 of mouse 9D5 antibody.

  SEQ ID NO: 26 represents the amino acid sequence of Kabat CDR-L3 of mouse 9D5 antibody.

  SEQ ID NO: 27 represents the amino acid sequence of humanized 9D5 heavy chain version 1.

  SEQ ID NO: 28 represents the amino acid sequence of humanized 9D5 heavy chain version 2.

  SEQ ID NO: 29 represents the amino acid sequence of humanized 9D5 heavy chain version 2b.

  SEQ ID NO: 30 represents the amino acid sequence of humanized 9D5 heavy chain version 3.

  SEQ ID NO: 31 represents the amino acid sequence of humanized 9D5 heavy chain version 3b.

  SEQ ID NO: 32 represents the amino acid sequence of humanized 9D5 heavy chain version 4.

  SEQ ID NO: 33 represents the amino acid sequence of humanized 9D5 heavy chain version 4b.

  SEQ ID NO: 34 represents the amino acid sequence humanized 9D5 heavy chain version 5.

  SEQ ID NO: 35 represents the amino acid sequence of humanized 9D5 light chain version 1.

  SEQ ID NO: 36 represents the amino acid sequence of humanized 9D5 light chain version 2.

  SEQ ID NO: 37 represents the amino acid sequence of humanized 9D5 light chain version 3.

  SEQ ID NO: 38 represents the amino acid sequence of humanized 9D5 light chain version 4.

  SEQ ID NO: 39 represents the amino acid sequence of humanized 9D5 light chain version 5.

  SEQ ID NO: 40 represents the nucleic acid sequence of the heavy chain variable region of the mouse 9D5 antibody having a signal peptide.

  SEQ ID NO: 41 represents the amino acid sequence of the heavy chain variable region of the mouse 9D5 antibody having a signal peptide.

  SEQ ID NO: 42 represents the nucleic acid sequence of the light chain variable region of the mouse 9D5 antibody with signal peptide.

  SEQ ID NO: 43 represents the amino acid sequence of the light chain variable region of the mouse 9D5 antibody having a signal peptide.

  SEQ ID NO: 44 represents the nucleic acid sequence of heavy chain variable region version 1 (Hu9D5VHv1) of the humanized 9D5 antibody.

  SEQ ID NO: 45 represents the nucleic acid sequence of heavy chain variable region version 2 (Hu9D5VHv2) of the humanized 9D5 antibody.

  SEQ ID NO: 46 represents the nucleic acid sequence of heavy chain variable region version 2b (Hu9D5VHv2b) of the humanized 9D5 antibody.

  SEQ ID NO: 47 represents the nucleic acid sequence of heavy chain variable region version 3 (Hu9D5VHv3) of the humanized 9D5 antibody.

  SEQ ID NO: 48 represents the nucleic acid sequence of heavy chain variable region version 3b (Hu9D5VHv3b) of the humanized 9D5 antibody.

  SEQ ID NO: 49 represents the nucleic acid sequence of heavy chain variable region version 4 (Hu9D5VHv4) of the humanized 9D5 antibody.

  SEQ ID NO: 50 represents the nucleic acid sequence of heavy chain variable region version 4b (Hu9D5VHv4b) of the humanized 9D5 antibody.

  SEQ ID NO: 51 represents the nucleic acid sequence of heavy chain variable region version 5 (Hu9D5VHv5) of the humanized 9D5 antibody.

  SEQ ID NO: 52 represents the nucleic acid sequence of light chain variable region version 1 (Hu9D5VLv1) of the humanized 9D5 antibody.

  SEQ ID NO: 53 represents the nucleic acid sequence of light chain variable region version 2 (Hu9D5VLv2) of the humanized 9D5 antibody.

  SEQ ID NO: 54 represents the nucleic acid sequence of humanized 9D5 antibody light chain variable region version 3 (Hu9D5VLv3).

  SEQ ID NO: 55 represents the nucleic acid sequence of light chain variable region version 4 (Hu9D5VLv4) of the humanized 9D5 antibody.

  SEQ ID NO: 56 represents the nucleic acid sequence of light chain variable region version 5 (Hu9D5VLv5) of the humanized 9D5 antibody.

  SEQ ID NO: 57 represents the amino acid sequence of mouse 9D5 heavy chain variable region signal peptide.

  SEQ ID NO: 58 represents the nucleic acid sequence of the mouse 9D5 heavy chain variable region signal peptide.

  SEQ ID NO: 59 represents the amino acid sequence of mouse 9D5 light chain variable region signal peptide.

  SEQ ID NO: 60 represents the nucleic acid sequence of the mouse 9D5 light chain variable region signal peptide.

  SEQ ID NO: 61 represents the amino acid sequence of the heavy chain variable region of the mouse 14G8 antibody.

  SEQ ID NO: 62 represents the amino acid sequence of template 1 MQK_H of mouse heavy chain variable region structure.

  SEQ ID NO: 63 represents the amino acid sequence of heavy chain variable acceptor ACC number AAD30410.1.

  SEQ ID NO: 64 represents the amino acid sequence of heavy chain variable region version 1 (Hu14G8VHv1) of the humanized 14G8 antibody.

  SEQ ID NO: 65 represents the amino acid sequence of heavy chain variable region version 2 (Hu14G8VHv2) of the humanized 14G8 antibody.

  SEQ ID NO: 66 represents the amino acid sequence of heavy chain variable region version 3 (Hu14G8VHv3) of the humanized 14G8 antibody.

  SEQ ID NO: 67 represents the amino acid sequence of Kabat CDR-H1 of mouse 14G8 antibody.

  SEQ ID NO: 68 represents the amino acid sequence of Kabat CDR-H2 of mouse 14G8 antibody.

  SEQ ID NO: 69 represents the amino acid sequence of Kabat CDR-H3 of mouse 14G8 antibody.

  SEQ ID NO: 70 represents the amino acid sequence of the light chain variable region of the mouse 14G8 antibody.

  SEQ ID NO: 71 represents the amino acid sequence of template 1MJU_L of mouse light chain variable region structure.

  SEQ ID NO: 72 represents the amino acid sequence of light chain variable acceptor ACC number ABA71374.1.

  SEQ ID NO: 73 represents the amino acid sequence of light chain variable acceptor ACC number ABC669952.1.

  SEQ ID NO: 74 represents the amino acid sequence of light chain variable region version 1 (Hu14G8VLv1) of the humanized 14G8 antibody.

  SEQ ID NO: 75 represents the amino acid sequence of light chain variable region version 2 (Hu14G8VLv2) of the humanized 14G8 antibody.

  SEQ ID NO: 76 represents the amino acid sequence of light chain variable region version 3 (Hu14G8VLv3) of the humanized 14G8 antibody.

  SEQ ID NO: 77 represents the amino acid sequence of Kabat CDR-L1 of mouse 14G8 antibody.

  SEQ ID NO: 78 represents the amino acid sequence of Kabat CDR-L2 of mouse 14G8 antibody.

  SEQ ID NO: 79 represents the amino acid sequence of Kabat CDR-L3 of mouse 14G8 antibody.

  SEQ ID NO: 80 represents the amino acid sequence of Kabat CDR-L1 of humanized 14G8 antibody version 3 (Hu14G8VLv3).

  SEQ ID NO: 81 represents the amino acid sequence of humanized 14G8 heavy chain version 1.

  SEQ ID NO: 82 represents the amino acid sequence of humanized 14G8 heavy chain version 2.

  SEQ ID NO: 83 represents the amino acid sequence of humanized 14G8 heavy chain version 3.

  SEQ ID NO: 84 represents the amino acid sequence of humanized 14G8 light chain version 1.

  SEQ ID NO: 85 represents the amino acid sequence of humanized 14G8 light chain version 2.

  SEQ ID NO: 86 represents the amino acid sequence of humanized 14G8 light chain version 3.

  SEQ ID NO: 87 represents the nucleic acid sequence of the heavy chain variable region of the mouse 14G8 antibody with signal peptide.

  SEQ ID NO: 88 represents the amino acid sequence of the heavy chain variable region of the mouse 14G8 antibody having a signal peptide.

  SEQ ID NO: 89 represents the nucleic acid sequence of the light chain variable region of the mouse 14G8 antibody with signal peptide.

  SEQ ID NO: 90 represents the amino acid sequence of the light chain variable region of the mouse 14G8 antibody having a signal peptide.

  SEQ ID NO: 91 represents the nucleic acid sequence of heavy chain variable region version 1 (Hu14G8VHv1) of the humanized 14G8 antibody.

  SEQ ID NO: 92 represents the nucleic acid sequence of heavy chain variable region version 2 (Hu14G8VHv2) of the humanized 14G8 antibody.

  SEQ ID NO: 93 represents the nucleic acid sequence of heavy chain variable region version 3 (Hu14G8VHv3) of the humanized 14G8 antibody.

  SEQ ID NO: 94 represents the nucleic acid sequence of light chain variable region version 1 (Hu14G8VLv1) of the humanized 14G8 antibody.

  SEQ ID NO: 95 represents the nucleic acid sequence of humanized 14G8 antibody light chain variable region version 2 (Hu14G8VLv2).

  SEQ ID NO: 96 represents the nucleic acid sequence of humanized 14G8 antibody light chain variable region version 3 (Hu14G8VLv3).

  SEQ ID NO: 97 represents the amino acid sequence of mouse 14G8 heavy chain variable region signal peptide.

  SEQ ID NO: 98 represents the nucleic acid sequence of mouse 14G8 heavy chain variable region signal peptide.

  SEQ ID NO: 99 represents the amino acid sequence of mouse 14G8 light chain variable region signal peptide.

  SEQ ID NO: 100 represents the nucleic acid sequence of mouse 14G8 light chain variable region signal peptide.

  SEQ ID NO: 101 represents the amino acid sequence of an exemplary human IgG1 heavy chain constant region.

  SEQ ID NO: 102 represents the amino acid sequence of an exemplary human IgG1 heavy chain constant region of the IgG1 G1m3 allotype.

  SEQ ID NO: 103 represents the amino acid sequence of an exemplary human IgG1 heavy chain constant region of the IgG1 G1m3 allotype.

  SEQ ID NO: 104 represents the amino acid sequence of an exemplary human kappa light chain constant region with an N-terminal arginine.

  SEQ ID NO: 105 represents the amino acid sequence of an exemplary human kappa light chain constant region without an N-terminal arginine.

  SEQ ID NO: 106 represents the nucleic acid sequence of an exemplary heavy chain constant region of the G1m3 allotype.

  SEQ ID NO: 107 represents the nucleic acid sequence of an exemplary light chain constant region with an N-terminal arginine.

  SEQ ID NO: 108 represents the nucleic acid sequence of an exemplary light chain constant region without an N-terminal arginine.

  SEQ ID NO: 109 represents the amino acid sequence of human transthyretin represented by Accession No. P02766.1 (UniProt).

  SEQ ID NO: 110 represents the amino acid sequence of human transthyretin represented by accession number AAB35639.1 (GenBank).

  SEQ ID NO: 111 represents the amino acid sequence of human transthyretin represented by accession number AAB35640.1 (GenBank).

  SEQ ID NO: 112 represents the amino acid sequence of human transthyretin represented by the accession number and ABI63351.1 (GenBank).

  SEQ ID NO: 113 represents the amino acid sequence of residues 89-97 of human transthyretin.

  SEQ ID NO: 114 represents the amino acid sequence of a potential transthyretin immunogen.

  SEQ ID NO: 115 represents the amino acid sequence of a potential transthyretin immunogen.

  SEQ ID NO: 116 represents the amino acid sequence of a potential transthyretin immunogen.

  SEQ ID NO: 117 represents the amino acid sequence of the Chothia-Kabat CDR-H1 complex of mouse 9D5 antibody.

  SEQ ID NO: 118 represents the amino acid sequence of the Chothia-Kabat CDR-H1 complex of mouse 14G8 antibody.

Definitions Biological entities, including monoclonal antibodies, are usually provided in isolated form. This means that biological entities, including antibodies, are usually at least 50% pure by weight relative to contaminants, including interfering proteins resulting from their production or purification, but monoclonal antibodies It does not exclude the possibility of being combined with a medium, including an excess of pharmaceutically acceptable carrier (s) intended to facilitate its use. Monoclonal antibodies are optionally at least 60%, 70%, 80%, 90%, 95% or 99% pure by weight relative to contaminants, including interfering proteins resulting from production or purification. . In many cases, biological entities, including isolated monoclonal antibodies, are the major macromolecular species remaining after their purification.

Specific binding of an antibody to its target antigen is with an affinity of at least 10 ⁶ M ⁻¹ , 10 ⁷ M ⁻¹ , 10 ⁸ M ⁻¹ , 10 ⁹ M ⁻¹ , or 10 ¹⁰ M ⁻¹ . Means that. Specific binding is detectably higher in intensity and is distinguishable from non-specific binding that occurs against at least one unrelated target. Specific binding can be the result of bond formation or specific spatial engagement (eg, key-keyhole type) between specific functional groups, whereas non-specific binding is usually van der Waals forces Is the result of Specific binding, however, does not necessarily mean that the antibody binds only one target.

  The basic structural unit of an antibody is a tetramer of subunits. Each tetramer contains two identical pairs of polypeptide chains, each pair having one “light chain” (about 25 kDa) and one “heavy chain” (about 50-70 kDa). The amino terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids mainly responsible for antigen recognition. This variable region is initially expressed linked to a cleavable signal peptide. A variable region that does not have a signal peptide may be referred to as a mature variable region. Thus, for example, a light chain maturation variable region refers to a light chain variable region that does not have a light chain signal peptide. The carboxy-terminal portion of each chain defines a constant region primarily responsible for effector functions.

  Light chains are classified as either kappa or lambda. Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, and define the antibody's isotype IgG, IgM, IgA, IgD, and IgE, respectively. Within the light and heavy chains, the variable and constant regions are joined by a “J” region of about 12 or more amino acids, and the heavy chain also includes a “D” region of about 10 or more amino acids. See generally, Fundamental Immunology, Paul, W .; Hen, 2nd edition, Raven Press, N.M. Y. 1989, Chapter 7, which is incorporated by reference in its entirety for all purposes.

  An immunoglobulin light chain variable region or heavy chain variable region (also referred to herein as a “light chain variable domain” (“VL domain”) or “heavy chain variable domain” (“VH domain”), respectively) has three It consists of “framework” regions separated by “complementarity determining regions” or “CDRs”. The “framework region” is responsible for aligning the CDRs for specific binding of the antigen to the epitope. CDRs comprise the amino acid residues of an antibody that are primarily responsible for antigen binding. Both the VL and VH domains include the following framework (FR) and CDR regions: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4, from the amino terminus to the carboxyl terminus. The CDR1, CDR2, and CDR3 of the VL domain are also referred to herein as CDR-L1, CDR-L2, and CDR-L3, respectively, and the CDR1, CDR2, and CDR3 of the VH domain are referred to herein as CDR-H1, respectively. Also referred to as CDR-H2 and CDR-H3.

  The assignment of amino acids to each VL domain and VH domain is in accordance with the conventional CDR definition. Conventional definitions include Kabat's definition (Kabat, Sequences of Proteins of Immunological Intersect (National Institutes of Health, Bethesda, MD, 1987 and 1991), Chothia's definition (Cho. Chothia et al., Nature 342: 878-883, 1989); Chothia Kabat CDR complex in which CDR-H1 is a complex of Chothia CDR and Kabat CDR; AbM used in the antibody modeling software of Oxford Molecular Definition; and Martin et al. Contact definition (conta t definition) (bioinfo.org.uk/abs) (see Table 1) Kabat provides a widely used conventional numbering (Kabat numbering), which In addition, the same number is assigned to the corresponding residues in different heavy chains or in different light chains, where an antibody contains a CDR according to a specific CDR definition (eg Kabat), that definition exists in the antibody. Specify the minimum number of CDR residues (ie, Kabat CDR), which does not exclude other residues that apply to another conventional CDR definition, but not the specified definition, for example. Among the possible antibodies, the CDR-containing antibodies defined by Kabat include, among others, Kabat C Antibodies that contain DR residues and no other CDR residues, and CDR H1 is a Chothia-Kabat CDR H1 complex and other CDRs contain Kabat CDR residues and contain additional CDR residues based on different definitions No antibodies.

^* CDR-H1 by Chothia can end in H32, H33, or H34 (depending on the length of the loop). This is because the Kabat numbering scheme positions the extra residue insertion at 35A and 35B, while Chothia numbering positions it at 31A and 31B. In the absence of both H35A and H35B (Kabat numbering), the Chothia CDR-H1 loop ends with H32. If only H35A is present, it ends with H33. If both H35A and H35B are present, it ends with H34.

The term “antibody” encompasses “intact antibodies” and binding fragments thereof. The fragment typically competes with the original intact antibody for specific binding to the target and is separated heavy chain, separated light chain, Fab, Fab ′, F (ab ′) ₂ , F (ab) c, Dab, Nanobody And Fv. Fragments can be made by recombinant DNA techniques or by enzymatic or chemical separation of intact immunoglobulins. The term “antibody” also encompasses bispecific antibodies and / or humanized antibodies. Bispecific or bifunctional antibodies are artificial hybrid antibodies having two different heavy / light chain pairs and two different binding sites (eg, Songsivillai and Lachmann, Clin. Exp. Immunol). 79, 315-321 (1990); see Kostelny et al., J. Immunol., 148: 1547-53 (1992)). In some bispecific antibodies, two different heavy / light chain pairs are directed against a humanized 9D5 heavy / light chain pair and a different epitope on transthyretin than the 9D5 binds to. Specific heavy / light chain pairs. In some bispecific antibodies, two different heavy / light chain pairs are directed against a humanized 14G8 heavy / light chain pair and a different epitope on transthyretin than the one to which 14G8 binds. Specific heavy / light chain pairs.

  In some bispecific antibodies, one heavy chain / light chain pair is a humanized 9D5 or 14G8 antibody that is further disclosed later, and the other heavy chain / light chain pair is expressed at the blood brain barrier. Derived from antibodies that bind to receptors such as insulin receptor, insulin-like growth factor (IGF) receptor, leptin receptor, lipoprotein receptor, or transferrin receptor (Friden et al., Proc. Natl. Acad. Sci. USA 88: 4771-4775, 1991; Friden et al., Science 259: 373-377, 1993). Such bispecific antibodies can cross the blood brain barrier by receptor-mediated transcytosis. By designing a bispecific antibody such that its affinity for the blood brain barrier receptor is reduced, the uptake of the bispecific antibody in the brain can be further increased. By reducing the affinity for the receptor, results have been obtained that are more widely distributed in the brain (eg, Atwal et al., Sci. Trans. Med. 3, 84ra43, 2011; Yu et al., Sci. Trans. Med. 3, 84ra44, 2011).

  Exemplary bispecific antibodies also include (1) a dual variable domain antibody (DVD-Ig) (Antibody Engineering), each light and heavy chain comprising two variable domains in tandem via short peptide bonds. Springer Berlin Heidelberg (2010), Wu et al., Generation and Charactorization of a Dual Variable Domain Immunoglobulin (DVD-Ig ™) Molecule); Tandab, which is a fusion of two single chain diabodies that yields a sex antibody; ibody); (4) When applied to a Fab, “dimerization / dimerization with protein kinase A results in a trivalent bispecific binding protein consisting of two identical Fab fragments linked to one different Fab fragment. It may be a so-called “dock and lock” molecule based on a “docking domain”; or (5) a so-called Scorpion molecule comprising, for example, two scFvs fused to both ends of a human Fc region . Examples of effective platforms for the preparation of bispecific antibodies include BiTE (Micromet), DART (MacroGenics), Fcab and Mab2 (F-star), Fc engineered IgG1 (Xencor) or DuoBody (Fab arm) Based on the exchange of Genmab).

  The term “epitope” refers to the site on an antigen to which an antibody binds. Epitopes can be formed from contiguous amino acids or non-contiguous amino acids that are juxtaposed by tertiary fielding of one or more proteins. Epitopes formed from contiguous amino acids (also known as linear epitopes) are usually retained upon exposure to denaturing solvents, whereas epitopes formed by tertiary folding (also known as conformational epitopes) Is usually lost upon treatment with a denaturing solvent. An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids of unique spatial structure. Examples of the method for clarifying the spatial structure of the epitope include X-ray crystal structure analysis and two-dimensional nuclear magnetic resonance. See, for example, Methods in Molecular Biology, Vol. 66, Glenn E. et al. See Epitope Mapping Protocols, edited by Morris (1996). The epitope can be linear, such as an epitope consisting of 2-5, 3-5, 3-9, or 5-9 consecutive amino acids of SEQ ID NO: 109. The epitope can also be a conformational epitope comprising, for example, two or more non-contiguous segments of amino acids within residues 89-97 of SEQ ID NO: 109.

  When an antibody is said to bind to an epitope within amino acids 89-97 of transthyretin (TTR), for example, the meaning is that the epitope is within the range of amino acids described, including those that delimit the outside of the range. That is. It does not necessarily mean that every amino acid within that range forms part of the epitope. Thus, for example, an epitope within amino acids 89-97 of TTR can include amino acids 89-97, 89-96, 90-96, 91-96, 92-96, 93, among other linear segments of SEQ ID NO: 113. ~ 96, 94-96, 89-96, 89-95, 89-94, 89-93, 89-92 or 89-93, or in the case of a conformational epitope, from a non-contiguous segment of amino acids of SEQ ID NO: 113 Can be.

  Antibodies that recognize the same or overlapping epitopes can be identified by simple immunoassays that demonstrate the ability of one antibody to compete with another antibody for binding to a target antigen. Antibody epitopes can also be revealed by X-ray crystallographic analysis of the antibody bound to its antigen to identify contact residues. Alternatively, two antibodies have the same epitope if all amino acid mutations in the antigen that reduce or eliminate binding of one antibody reduce or eliminate binding of the other antibody. If several amino acid mutations that reduce or eliminate the binding of one antibody reduce or eliminate the binding of the other antibody, the two antibodies have overlapping epitopes.

  Competition between antibodies is determined by assays in which the test antibody inhibits the binding of the reference antibody to a common antigen (see, eg, Junghans et al., Cancer Res. 50: 1495, 1990). A test antibody competes with a reference antibody if an excess of the test antibody (eg, at least 2-fold, 5-fold, 10-fold, 20-fold or 100-fold) inhibits reference antibody binding by at least 50% as measured by a competitive binding assay. To do. Some test antibodies inhibit reference antibody binding by at least 75%, 90%, or 99%. Antibodies identified by competitive assays (competitive antibodies) include antibodies that bind to the same epitope as the reference antibody and antibodies that bind to a nearby epitope that is close to the epitope to which the reference antibody binds to the extent that it causes steric hindrance. It is done.

  The term “native” with respect to structural transthyretin (TTR) refers to the structure of TTR that normally folds and functions properly (ie, a TTR tetramer). Since TTR is a tetramer in a naturally folded form, non-natural forms of TTR include, for example, misfolded TTR tetramers, TTR monomers, aggregated forms of TTR, and fibrillar forms of TTR. Is mentioned. Non-native forms of TTR may include molecules comprising the amino acid sequence or mutation of wild-type TTR.

  The term “misfolded” with respect to TTR refers to the secondary or tertiary structure of a monomer or multimer of a TTR polypeptide, where the polypeptide is not normal for that protein in a state of functioning correctly. Indicates that you are taking TTR misfolding can be caused by protein mutations (eg, deletions, substitutions, or additions), but wild-type TTR proteins can also misfold in disease, exposing specific epitopes.

  The term “pharmaceutically acceptable” means that the carrier, diluent, excipient, or adjuvant is compatible with the other ingredients of the formulation and not substantially deleterious to the recipient thereof.

  The term “patient” includes human and other mammalian subjects that receive either prophylactic or therapeutic treatment.

  An individual is a known risk factor (eg, genetic factor, biochemical factor, family history, and environmental exposure), and an individual with that risk factor develops disease more than an individual without it If the subject has at least one risk factor that is statistically significantly higher, the risk of the disease is high.

  The term “biological sample” refers to a sample of biological material in or obtainable from a biological source, eg, a human or mammalian subject. Such samples may be organs, organelles, tissues, tissue sections, body fluids, peripheral blood, plasma, serum, molecules such as cells, proteins and peptides, and any part or combination derived therefrom. The term biological sample can also encompass any material obtained by processing a sample. The resulting material can include cells or their progeny. The processing of the biological sample can include one or more of filtration, distillation, extraction, concentration, fixation, inactivation of interfering components, and the like.

  The term “control sample” refers to organisms that are not known or suspected to contain monomeric, misfolded, aggregated, or fibrillar forms of transthyretin (TTR), such as TTR amyloid deposits. Refers to the sample. Control samples are obtained from individuals not suffering from TTR amyloidosis or specifically selected types of TTR amyloidosis. Alternatively, the control sample is obtained from a patient suffering from TTR amyloidosis or a specifically selected type of TTR amyloidosis. Such a sample may be obtained at the same time as a biological sample suspected of containing TTR amyloidosis or may be obtained at a different time. Both the biological sample and the control sample may be obtained from the same tissue (eg, a tissue section containing both TTR amyloid deposits and surrounding normal tissue). Preferably, the control sample consists of tissue substantially or completely free of TTR amyloid deposits and can be used for comparison with a biological sample that is believed to contain TTR amyloid deposits. Preferably, the tissue in the control sample is of the same type as the tissue in the biological sample (eg, cardiomyocytes in the heart).

  The term “disease” refers to any abnormal condition that impairs physiological function. The term is used in a broad sense and encompasses any disorder, disease, disorder, condition, disease, condition, or syndrome that impairs physiological function regardless of the nature of the etiology.

  The term “symptom” refers to subjective evidence of a disease perceived by a subject, such as gait abnormalities. “Sign” refers to objective evidence of a disease observed by a physician.

  In order to classify amino acid substitutions into conservative or non-conservative substitutions, amino acids are divided into the following groups: Group I (hydrophobic side chains): met, ala, val, leu, ile; Group II (neutral hydrophilicity) Sex side chain): cys, ser, thr; Group III (acid side chain): asp, glu; Group IV (basic side chain): asn, gln, his, lys, arg; Group V (influences on chain orientation) Residues): gly, pro; and Group VI (aromatic side chains): trp, tyr, phe. Conservative substitutions include substitutions between amino acids of the same class. A non-conservative substitution is one in which a member of one class replaces a member of another class.

  The percent sequence identity is determined by the sequence of the antibody aligned to the maximum by conventional Kabat numbering. After alignment, when comparing the antibody region of interest (eg, the entire heavy or light chain mature variable region) to the same region of the reference antibody, the sequence identity between the region of interest and the region of the reference antibody The percent is calculated by dividing the number of positions occupied by the same amino acid in both the region of interest and the region of the reference antibody by the total number of aligned positions in the two regions and counting 100 without counting the gap. Multiply and convert to percent.

  A composition or method that “comprises” one or more of the described elements may include other elements not specifically described. For example, a composition “comprising” an antibody may contain the antibody alone or in combination with other components.

  The designation of a range of numerical values includes an integer included in the range or an integer that defines the range, and all subranges defined by the integers in the range.

  The term “about” encompasses a numerical value within the standard error of measurement (eg, SEM) of the numerical value recited unless the context clearly indicates otherwise.

  Statistically significant means p ≦ 0.05.

  The singular articles “a”, “an”, and “the” include plural referents unless the context clearly indicates otherwise. For example, “a compound” or “at least one compound” may include a plurality of compounds, including mixtures thereof.

Detailed description Overview The present invention provides antibodies that specifically bind to residues 89-97 of transthyretin (TTR). This antibody has the ability to bind to a monomeric, misfolded, aggregated, or fibrillar form of TTR. The antibody can be used to treat or prevent a disease or disorder associated with TTR accumulation or TTR deposit accumulation (eg, TTR amyloidosis). This antibody can also be used to diagnose TTR amyloidosis and inhibit or reduce TTR aggregation, among other applications.

II. Target molecule Transthyretin (TTR) is a 127 amino acid, 55 kDa transport protein present in serum and cerebrospinal fluid, and is synthesized primarily in the liver. It is also called prealbumin, thyroxine-conjugated prealbumin, ATTR, and TBPA. In its natural state, TTR exists as a tetramer. In homozygotes, the tetramer contains the same 127 amino acid beta sheet rich subunits. In heterozygotes, the TTR tetramer consists of variant and / or wild-type subunits that are usually combined statistically.

An established function of TTR in blood is the transport of holo-retinol binding protein. In rodent blood, TTR is the major carrier of thyroxine (T ₄ ) and utilizes a binding site that is orthogonal to that used for holo-retinol binding protein, but in humans this T ₄ binding site is virtually empty. It is.

  TTR is one of at least 30 different human proteins whose extracellular misfolding and / or misassociation (amyloid formation) into various aggregate structures is thought to cause a degenerative disease called amyloid disease. One. TTR becomes amyloidogenic after undergoing a conformational change. Partial unfolding exposes a stretch of conformation that is largely uncharged and hydrophobic, which efficiently misassociates into a nearly amorphous spherical aggregate, eventually The three-dimensional structure is converted into a crossbeta sheet amyloid structure.

  Unless the context clearly indicates otherwise, references to transthyretin (TTR) or fragments or domains thereof include natural human amino acid sequences, including isoforms, variants, and allelic variants. Exemplary TTR polypeptide sequences are represented by accession numbers P027666.1 (UniProt), AAB35639.1 (GenBank), AAB356640.1 (GenBank), and ABI63351.1 (GenBank) (SEQ ID NOs: 109-112, respectively). Is done. Residues are numbered according to Swiss Prot P02766.1 and the first amino acid of the mature protein (ie not including the 20 amino acid signal sequence) is designated as residue 1. For any other TTR protein, the residues are numbered according to the corresponding residues in P02766.1 in the maximum alignment.

III. Transthyretin amyloidosis Transthyretin (TTR) amyloidosis is a systemic disorder characterized by extracellular deposition of amyloid fibrils consisting of pathogenic misfolded TTR and TTR. TTR amyloidosis is commonly caused by destabilization of the natural TTR tetrameric form (due to environmental or genetic conditions), resulting in TTR dissociation, misfolding, and aggregation into amyloid fibrils, which can result in various organs and Accumulate in tissues and cause progressive dysfunction. See, for example, Almeida and Saraiva, FEBS Letters 586: 2891-2896 (2012); Ando et al., Orphanet Journal of Rare Diseases 8:31 (2013).

  In humans, both wild-type TTR tetramers and mixed tetramers composed of mutant and wild-type subunits are dissociated, misfolded during the process of amyloid formation leading to degeneration of mitotic tissues. And can aggregate. Thus, TTR amyloidosis includes diseases caused by pathogenic misfolded TTR caused by misfolded or unmutated TTR caused by mutations in TTR.

  For example, senile systemic amyloidosis (SSA) and senile cardiac amyloidosis (SCA) are aging-related types of amyloidosis, which are caused by the deposition of wild-type TTR amyloid outside and inside the heart's cardiomyocytes. TTR amyloidosis is also the most common form of hereditary (familial) amyloidosis, caused by mutations that destabilize the TTR protein. TTR amyloidosis associated with point mutations in the TTR gene includes familial amyloid neuropathy (FAP), familial amyloid cardiomyopathy (FAC), and rare central nervous system selective amyloidosis (CNSA). Patients with hereditary (familial) TTR amyloidosis are almost exclusively heterozygous, which means that mutant TTR subunits and / or wild-type TTR subunits in which the TTR tetramers are generally statistically distributed. Means that it consists of Hereditary (familial) TTR amyloidosis is generally autosomal dominant and usually develops earlier than sporadic diseases (SSA and SCA).

  More than 100 mutations in the gene encoding TTR are thought to be involved in autosomal dominant disorder FAP and FAC. See, for example, US Patent Application Publication No. 2014/0056904; Saraiva, Hum. Mutat. 17 (6): 493-503 (2001); Damas and Saraiva, J. et al. Struct. Biol. 130: 290-299; Dwlet and Benson, Biochem. Biophys. Res. Commun. 114: 657-662 (1983). These amyloidogenic mutations are distributed throughout the TTR molecule. In general, the more the mutant subunit destabilizes the tetrameric structure of TTR, the faster the onset of amyloid disease. The likelihood of a TTR variant becoming pathogenic is generally determined by a combination of its instability and cell secretion efficiency. The initial pathology caused by a TTR variant may be due to the selective destruction of cardiac tissue by the TTR variant, or may be due to damage to the peripheral and autonomic nervous systems by the TTR variant. The tissue damage caused by TTR amyloid formation appears to be mostly due to the toxicity of small diffusible TTR aggregates, but may be due to the accumulation of extracellular amyloid, in which case TTR amyloidosis Later, the organ structure is almost certainly damaged.

  There are many different forms of TTR amyloidosis, with considerable individual and regional differences in phenotype. For example, TTR amyloidosis may be seen as a progressive axonal sensory autonomic motor neuropathy. TTR amyloidosis may also be seen as invasive cardiomyopathy.

  The age at which disease-related symptoms appear varies between teens and 80s, and there is a large variation between populations. The fact that TTR amyloidosis extends to multiple strains is one of the clues for the diagnosis. For example, a diagnosis of TTR amyloidosis is considered if one or more of the following is present: (1) Family history of neuropathic disease, particularly related to heart failure; (2) Neuropathic pain of unknown cause Or progressive sensory impairment; (3) Carpal tunnel syndrome with unclear cause, especially bilateral and requiring surgical opening; (4) Unexplained gastrointestinal motility disorder or autonomic dysfunction (eg, erection Failure, orthostatic hypotension, neurogenic bladder); (5) heart disease without hypertension and characterized by ventricular wall thickening; (6) advanced atrioventricular block with unknown cause, especially with cardiac hypertrophy And (6) a cotton-like vitreous inclusion body. See Ando et al., Orphanet Journal of Rare Diseases 8:31 (2013). Other symptoms include, for example, polyneuropathy, interval loss, pain, lower extremity weakness, sweating abnormalities, diarrhea, constipation, weight loss, and urinary incontinence / urinary retention.

  Diagnosis of TTR amyloidosis usually relies on biopsy of the target organ, and then the extracted tissue is histologically stained with Congo red, an amyloid-specific dye. If the test result is positive for amyloid, then TTR immunohistochemical staining is performed to confirm that the precursor protein responsible for amyloid formation is actually TTR. In familial diseases, it is then necessary to make a diagnosis after revealing that there is a mutation in the gene encoding TTR. This can be accomplished, for example, by isoelectric focusing, polymerase chain reaction, or laser analysis / liquid chromatography-tandem mass spectrometry. See, for example, US Patent Application Publication No. 2014/0056904; Ruberg and Berk, Circulation 126: 1286-1300 (2012); Ando et al., Orphanet Journal of Rare Diseases 8:31 (2013).

IV. Antibody A. Binding Specificity and Functional Properties The present invention provides monoclonal antibodies that bind to transthyretin (TTR) proteins, and more specifically to an epitope within amino acid residues 89-97 (SEQ ID NO: 113) of TTR. Such epitopes are buried in native TTR tetramers and exposed in monomeric, misfolded, aggregated, or fibrillar forms of TTR.

  The antibodies designated 9D5 and 14G8 are two examples of such murine antibodies. Reference to 9D5 or 14G8 should be understood to refer to any of the above antibodies, murine, chimeric, veneered, and humanized, unless the context clearly indicates otherwise. . These antibodies specifically bind within amino acid residues 89-97 (SEQ ID NO: 113) of TTR. These antibodies are further characterized by the ability to bind to the monomeric, misfolded, aggregated, or fibrillar forms of TTR, but not to the native tetrameric form of TTR. Furthermore, these antibodies are characterized by showing an immune response against heart tissue of TTR-mediated amyloidosis, but not showing an immune response against healthy heart tissue. The ability to bind to a particular protein or fragment thereof can be demonstrated using the exemplary assay format described in the Examples.

  Some antibodies bind to the same or overlapping epitope as the antibody designated 9D5 or 14G8. The heavy chain mature variable region and light chain mature variable region sequences of these antibodies are referred to as SEQ ID NOs: 1 and 16 (9D5) and SEQ ID NOs: 61 and 70 (14G8), respectively. Other antibodies with such binding specificity include immunizing mice with TTR or a portion of TTR containing the desired epitope (eg, SEQ ID NO: 113), and using the resulting antibody with monomeric TTR or SEQ ID NO: 113. Whether or not it binds to the containing peptide can be generated by optionally competing with an antibody (IgG1 kappa) having the variable region of mouse 9D5 or 14G8 and screening. Fragments of TTR containing the desired epitope may be linked to a carrier that facilitates eliciting an antibody response to the fragment and / or combined with an adjuvant that facilitates eliciting such a response. Such antibodies can be screened for differential binding to wild-type TTR, monomeric TTR, or a fragment thereof (eg, SEQ ID NO: 113) compared to a specific residue variant. Screening for such variants reveals more precisely the binding specificity, antibodies whose binding may be inhibited by mutagenesis of specific residues and have the same functional properties as other exemplary antibodies Enables identification. Mutations are systematically by alanine (or serine if already present), performed one residue at a time, or even more spaced apart, throughout the target or throughout the compartment where the epitope is known to exist. It can be a substitution. If the binding of two antibodies is significantly reduced by the same set of mutations, the two antibodies bind the same epitope.

Antibodies with the binding specificity of selected mouse antibodies (eg, 9D5 or 14G8) can also be generated using a variation of the phage display method. See Winter, WO 92/20791. This method is particularly suitable for the production of human antibodies. In this method, either the heavy chain variable region or the light chain variable region of the selected mouse antibody is used as a starting material. For example, if a light chain variable region is selected as the starting material, a phage library is constructed in which members display the same light chain variable region (ie, mouse starting material) and different heavy chain variable regions. The heavy chain variable region can be obtained, for example, from a library of rearranged human heavy chain variable regions. A phage is selected that exhibits strong specific binding (eg, at least 10 ⁸ M ⁻¹ , preferably at least 10 ⁹ M ⁻¹ ) to monomeric TTR or a fragment thereof (eg, amino acid residues 89-97). The heavy chain variable region obtained from this phage is then the starting material for the construction of further phage libraries. In this library, each phage displays the same heavy chain variable region (ie, the region specified in the original display library) and a different light chain variable region. The light chain variable region can be obtained, for example, from a library of rearranged human variable light chain regions. Similarly, phages that show strong specific binding to monomeric TTR or fragments thereof (eg, amino acid residues 89-97) are selected. The resulting antibody usually has the same or similar epitope specificity as the mouse starting material. The Kabat CDRs of the 9D5 heavy chain are represented by SEQ ID NOs: 13-15, respectively, and the Kabat CDRs of the 9D5 light chain are represented by SEQ ID NOs: 24-26, respectively. The 9D5 Chothia-Kabat CDR-H1 complex is represented by SEQ ID NO: 117. The Kabat CDR of the heavy chain of 14G8 is represented by SEQ ID NOs: 67 to 69, respectively, and the Kabat CDR of the light chain of 14G8 is represented by SEQ ID NOs: 77 to 79, respectively. The 14G8 Chothia-Kabat CDR-H1 complex is represented by SEQ ID NO: 118. The variant of CDR-L1 of 14G8 is represented by SEQ ID NO: 80.

  Other antibodies can be obtained by mutagenesis of cDNA encoding the heavy and light chains of exemplary antibodies such as 9D5 or 14G8. Is at least 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% identical to 9D5 or 14G8 in the amino acid sequence of the mature heavy chain variable region and / or mature light chain variable region; Monoclonal antibodies that differ from each antibody in that they retain their functional properties and / or have a few functionally insignificant amino acid substitutions (eg, conservative substitutions), deletions, or insertions are also included in the invention It is. Has at least one or six CDRs defined by any conventional definition (but preferably Kabat) and is 90%, 95%, 99% or 100% identical to the corresponding CDR of 9D5 or 14G8 Monoclonal antibodies are also included.

  The invention also provides antibodies having some or all (eg, 3, 4, 5, and 6) CDRs derived entirely or substantially from 9D5 or 14G8. Such antibodies may be present in a heavy chain variable region having two, usually three, CDRs that are completely or substantially derived from a 9D5 or 14G8 heavy chain variable region and / or a 9D5 or 14G8 light chain variable region. It may comprise a light chain variable region having at least two, usually three, of fully or substantially derived CDRs. An antibody can contain both heavy and light chains. A CDR is substantially derived from the corresponding 9D5 or 14G8 CDR when it contains no more than 4, no more than 3, no more than 2, or no more than one substitution, insertion, or deletion, provided that CDR- H2 (as defined by Kabat) may have no more than 6, no more than 5, no more than 4, no more than 3, no more than 2, or no more than one substitution, insertion, or deletion. Such antibodies have at least 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 9D5 or 14G8 amino acid sequence in the mature heavy chain variable region and / or mature light chain variable region, or 9D5 in that it has 99% identity, maintains their functional properties, and / or has a few functionally unimportant amino acid substitutions (eg, conservative substitutions), deletions, or insertions Or it may be different from 14G8.

  Some antibodies identified by assays such as those described above can bind to monomeric, misfolded, aggregated, or fibrillar forms of TTR, as described in the Examples section. However, it cannot bind to the natural tetrameric form of TTR. Similarly, some antibodies show an immune response against TTR-mediated amyloidosis tissue but not an immune response against healthy tissue.

  Some antibodies inhibit or reduce TTR aggregation in animal models or clinical trials, inhibit or reduce TTR fibril formation, reduce or eliminate TTR deposits or aggregated TTR, or non-toxicity of TTR The three-dimensional structure can be stabilized. Some antibodies may treat or prevent TTR amyloidosis or delay the onset of TTR amyloidosis, as shown in animal models or clinical trials. Exemplary animal models for studying activity against TTR amyloidosis include Kohno et al., Am. J. et al. Path. 150 (4): 1497-1508 (1997); Teng et al., Laboratory Investigations 81: 385-396 (2001); Wakasugi et al., Proc. Japan Acad. 63B: 344-347 (1987); Shimada et al., Mol. Biol. Med. 6: 333-343 (1989); Nagata et al., J. Biol. Biochem. 117: 169-175 (1995); Sousa et al., Am. J. et al. Path. 161: 1935-1948 (2002); and Santos et al., Neurobiology of Aging 31: 280-289 (2010).

B. Non-human antibodies Production of other non-human antibodies to monomeric TTR or fragments thereof (e.g., amino acid residues 89-97), e.g., murine antibodies, guinea pig antibodies, primate antibodies, rabbit antibodies or rat antibodies, for example, This can be accomplished by immunizing the animal with TTR or a fragment thereof. See Harlow and Lane, Antibodies, A Laboratory Manual (CSHP NY, 1988), incorporated by reference for all purposes. Such immunogens can be obtained from natural sources, by peptide synthesis, or by recombinant expression. Optionally, the immunogen may be complexed with the carrier protein and administered by methods including fusion. Optionally, the immunogen may be administered with an adjuvant. Several types of adjuvants can be used, as will be described later. Freund's complete adjuvant and then incomplete adjuvant are preferred for immunization of experimental animals. Rabbits or guinea pigs are usually used for the production of polyclonal antibodies. A mouse is usually used for production of a monoclonal antibody. Antibodies that specifically bind to monomeric TTR or an epitope within TTR (eg, an epitope comprising one or more of amino acid residues 89-97) are screened. Such screening determines the binding of the antibody to a collection such as a monomeric TTR variant, eg, a TTR variant having amino acid residues 89-97 or having a mutation in that residue, to which TTR This can be accomplished by determining whether the variant antibody binds. Binding can be assessed, for example, by Western blot, FACS or ELISA.

C. Humanized antibodies Humanized antibodies are antibodies in which the CDRs of a non-human “donor” antibody are genetically engineered into a human “acceptor” antibody sequence (see, eg, Queen, US Pat. Nos. 5,530,101 and Winter, US Pat. No. 5,225,539; Carter, US Pat. No. 6,407,213; Adair, US Pat. No. 5,859,205; and US Pat. No. 6,881. , 557). The acceptor antibody sequence can be, for example, a mature human antibody sequence, a complex of such sequences, a consensus sequence of human antibody sequences, or a germline region sequence. Thus, a humanized antibody is derived from at least 3, 4, 5, or all CDRs from a fully or substantially donor antibody as well as, if present, completely or substantially from a human antibody sequence. An antibody having a variable region framework sequence and a constant region. Similarly, a humanized heavy chain comprises at least one, two, usually all three CDRs from a fully or substantially donor antibody heavy chain, and, if present, substantially human heavy chain. It has a heavy chain variable region framework sequence and a heavy chain constant region derived from a variable region framework sequence and a constant region sequence. Similarly, a humanized light chain has at least one, two, usually all three CDRs from a fully or substantially donor antibody light chain, as well as substantially human light chains, if present. It has a light chain variable region framework sequence and a light chain constant region derived from a variable region framework sequence and a constant region sequence. In addition to Nanobodies and dAbs, humanized antibodies include humanized heavy chains and humanized light chains. The CDRs of a humanized antibody are non-reactive if at least 85%, 90%, 95% or 100% of the corresponding residues (any conventional definition, preferably defined by Kabat) match between each CDR. Derived substantially from the corresponding CDR in a human antibody. The variable region framework sequence of an antibody chain or the constant region of an antibody chain is identical in any conventional definition, preferably at least 85%, 90%, 95% or 100% of the corresponding residues as defined by Kabat In some cases substantially derived from human variable region framework sequences or human constant regions, respectively.

  Humanized antibodies often incorporate all six CDRs from mouse antibodies (any conventional definition, preferably defined by Kabat), but less than all CDRs from mouse antibodies (eg, CDRs Humanized antibodies can also be made (eg, at least 3, 4 or 5) (eg, Pascalis et al., J. Immunol. 169: 3076, 2002; Vajdos et al., J. of Mol. Biol., 320: 415-428, 2002; Iwahashi et al., Mol. Immunol. 36: 1079-1091, 1999; Tamura et al., J. Immunol., 164: 1432-1441, 2000).

  For some antibodies, only a portion of the CDRs are required to retain binding with the humanized antibody, ie a subset of the CDR residues required for binding, called SDR. CDR residues that do not contact the antigen and are not present in the SDR can be determined based on previous studies, molecular modeling and / or empirically, or in Gonzales et al., Mol. Immunol. 41: 863, 2004, which can be distinguished from the region of Kabat CDRs present outside the Chothia hypervariable loop (Chothia, J. Mol. Biol. 196: 901, 1987) (eg, CDRH2 Residues H60-H65 are often not needed). In such humanized antibodies, the amino acid occupying this position is the corresponding position in the acceptor antibody sequence (Kabat) at a position where one or more donor CDR residues are not present or where the entire donor CDR has been removed. Amino acids occupying the numbering). The number of such donor amino acid to acceptor amino acid substitutions to be included in the CDR reflects a balance of incompatible considerations. Such substitutions may be advantageous in reducing the number of mouse amino acids in the humanized antibody and consequently reducing the potential immunogenicity. However, the affinity may be changed by substitution, and it is preferable to avoid a significant decrease in affinity. The position of substitution in the CDR and the amino acid to be substituted can also be selected empirically.

  The human acceptor antibody sequence is optional and has high sequence identity (eg, 65-85% identity) between the variable region framework of the human acceptor sequence and the corresponding variable region framework of the donor antibody chain. You can choose from a number of known human antibody sequences to obtain.

  Examples of heavy chain acceptor sequences are the human mature heavy chain variable region of NCBI accession codes BAC02114 and AAX82494.1 (SEQ ID NOs: 3 and 4) and the heavy chain variable region of human Kabat subgroup 3. BAC02114 has the same canonical form as mouse 9D5 heavy chain. Other examples of heavy chain acceptor sequences are the human mature heavy chain variable region of NCBI accession codes AAD30410.1 and AAX82494.1 (SEQ ID NOs: 63 and 4, respectively) and the heavy chain variable region of human Kabat subgroup 1 . AAD30410.1 and AAX82494.1 contain two CDRs with the same canonical form as the mouse 14G8 heavy chain. Examples of light chain acceptor sequences are the human mature light chain variable region of NCBI accession code ABC66952 (SEQ ID NO: 18) and the light chain variable region of human Kabat subgroup 3. ABC66952 contains two CDRs with the same canonical form as the mouse 9D5 light chain. Other examples of light chain acceptor sequences are the human mature light chain variable region of NCBI accession codes ABA71374.1 and ABC669952.1 (SEQ ID NOs: 72 and 73, respectively) and the light chain variable region of human Kabat subgroup 2 . ABA71374.1 and ABC669952.1 have the same canonical form as the mouse 14G8 light chain.

  When selecting two or more human acceptor antibody sequences, a complex or hybrid of those acceptors can be used, and any amino acid used at various positions in the humanized light chain variable region and the heavy chain variable region. From the human acceptor antibody sequence. For example, the human mature heavy chain variable region of NCBI accession codes BAC02114 and AAX82494.1 (SEQ ID NOs: 3 and 4) were used as acceptor sequences for humanization of the 9D5 mature heavy chain variable region. Examples of positions where these two acceptors are different include H19 position (R or K), H40 position (A or T), H44 position (G or R), H49 position (S or A), H77 position ( S or T), H82a position (N or S), H83 position (R or K), H84 position (A or S), and H89 position (V or M). The humanized 9D5 heavy chain variable region may comprise any amino acid at any of the above positions. Similarly, the human mature heavy chain variable regions of NCBI accession codes AAD30410.1 and AAX82494.1 (SEQ ID NOs: 63 and 4, respectively) were used as acceptor sequences for humanization of the 14G8 mature heavy chain variable region. Examples of positions where these two acceptors differ are H82a position (N or S), H83 position (R or K), H84 position (A or S), and H89 position (V or M). . The humanized 14G8 heavy chain variable region may contain any amino acid at any of the above positions. Similarly, the human mature light chain variable regions of NCBI accession codes ABA71374.1 and ABC669952.1 (SEQ ID NOs: 72 and 73, respectively) were used as acceptor sequences for humanization of the 14G8 mature light chain variable region. Examples of positions where these two acceptors are different include the L18 position (S or P). The humanized 14G8 light chain variable region may contain any amino acid at this position.

  Specific amino acids from human variable region framework residues can be selected based on their predicted effect on CDR conformation and / or binding to antigen. Investigation of such expected effects is by modeling, examining amino acid characteristics at specific positions, or empirical observation of the effects of substitution or mutagenesis of specific amino acids.

For example, if an amino acid differs between a mouse variable region framework residue and a selected human variable region framework residue, the amino acid of the human framework can be replaced with an amino acid of the equivalent framework from a mouse antibody Where the amino acid is
(1) non-covalently bound directly to the antigen;
(2) adjacent to or within the CDR region defined by Chothia, not Kabat;
(3) modeling the light chain or heavy chain on a structure revealed by a CDR region (eg, within about 6 cm of the CDR region), (eg, homologous known immunoglobulin chain) in another way. (4) is reasonably expected to be a residue involved in the VL-VH interface.

  Framework residues of classes (1)-(3) as defined by Queen US Pat. No. 5,530,101 are sometimes referred to as canonical and vernier residues. Framework residues that help define the conformation of the CDR loop are sometimes referred to as canonical residues (Cothia and Lesk, J. Mol. Biol. 196: 901-917 (1987); Thornton and Martin, J Mol.Biol.263: 800-815 (1996)). Framework residues that support the conformation of the antigen binding loop and play some role in fine-tuning the fit of the antibody to the antigen are sometimes referred to as vernier residues (Foote and Winter, J. Mol. Biol 224: 487-499 (1992)).

  Other framework residues that are candidates for substitution are those that form potential glycosylation sites. Another candidate for substitution is an acceptor human framework amino acid that is not normally found at that position in human immunoglobulins. These amino acids can be substituted with amino acids from the equivalent position of the mouse donor antibody or amino acids from the equivalent position of more typical human immunoglobulins.

  An exemplary humanized antibody is the humanized mouse 9D5 antibody or 14G8 antibody, referred to as Hu9D5 or Hu14G8, respectively. The mouse 9D5 antibody comprises a mature heavy chain variable region and a mature light chain variable region having amino acid sequences comprising SEQ ID NO: 1 and SEQ ID NO: 16, respectively. The present invention provides eight exemplary humanized mature heavy chain variable regions, namely Hu9D5VHv1, Hu9D5VHv2, Hu9D5VHv2b, Hu9D5VHv3, Hu9D5VHv3b, Hu9D5VHv4, Hu9D5VHv4b, and Hu9V5V5V5 and Hu9V5. The present invention further provides five exemplary human mature light chain variable regions, namely Hu9D5VLv1, Hu9D5VLv2, Hu9D5VLv3, Hu9D5VLv4, and Hu9D5VLv5 (SEQ ID NOs: 19-23, respectively). FIG. 1 shows an alignment of 9D5, mouse model antibody, human acceptor antibody, and various humanized antibodies.

  The mouse 14G8 antibody comprises a mature heavy chain variable region and a mature light chain variable region having amino acid sequences comprising SEQ ID NO: 61 and SEQ ID NO: 70, respectively. The present invention provides three exemplary humanized mature heavy chain variable regions, namely Hu14G8VHv1, Hu14G8VHv2, and Hu14G8VHv3 (SEQ ID NOs: 64-66, respectively). The present invention further provides three exemplary human mature light chain variable regions: Hu14G8VLv1, Hu14G8VLv2, and Hu14G8VLv3 (SEQ ID NOs: 74-76, respectively). FIG. 2 shows an alignment of 14G8, mouse model antibody, human acceptor antibody, and various humanized antibodies.

  Anticipated effects on CDR conformation and / or antigen binding, mediating interaction between heavy and light chain, interaction with constant region, desirable post-translational modification or undesirable post-translational modification Carried out due to the fact that it is a site of, a residue that is not normally found at that position in the human variable region sequence, and thus may be an immunogen, acquire aggregating ability, and other reasons The following 15 variable region framework positions, further specified in the examples, were considered as candidates for substitution in the eight exemplified Hu9D5 mature heavy chain variable regions and the five exemplified Hu9D5 mature light chain variable regions: : H42 (G42E), H47 (W47L), H69 (I69F), H82 (M82S), H82b (S82 (b) L), H108 (T108L), L8 (P A), L9 (L9P), L18 (P18S), L19 (A19V), L36 (Y36F), L39 (K39R), L60 (D60S), L70 (D70A), and L74 (K74R). Similarly, the following 11 variable region framework positions further specified in the examples are replaced with three exemplary Hu14G8 mature heavy chain variable regions and three exemplary Hu14G8 mature light chain variable regions: H1 (Q1E), H3 (Q3K), H47 (W47L), H105 (Q105T), L8 (P8A), L9 (L9P), L19 (A19V), L26 (N26S), L36 (Y36F) , L60 (D60S), and L70 (D70A).

  Here as well elsewhere, the first described residue is the human acceptor framework (eg, complex or hybrid human acceptor, in the case of Kabat CDR or CDR-H1 the Chothia-Kabat CDR complex. The residues of the humanized antibody that are formed by grafting into the framework), the second listed residues are those that are considered to replace such residues. Thus, within the variable region framework, the first listed residue is a human residue, and within the CDR, the first listed residue is a mouse residue.

  The exemplified Hu9D5 antibody can be any permutation or combination of the exemplified mature heavy chain variable region and light chain variable region (eg, VHv1 / VLv1 or H1L1, VHv1 / VLv2 or H1L2, VHv1 / VLv3 or H1L3, VHv1 / VLv4). Or H1L4, VHv1 / VLv5 or H1L5, VHv2 / VLv1 or H2L1, VHv2 / VLv2 or H2L2, VHv2 / VLv3 or H2L3, VHv2 / VLv4 or H2L4, VHv2 / VLv5 or H2L5, V2 or H2L5 VHv2b / VLv3 or H2bL3, VHv2b / VLv4 or H2bL4, VHv2b / VLv5 or H2bL5, VHv3 / VLv1 or H3L1, Hv3 / VLv2 or H3L2, VHv3 / VLv3 or H3L3, VHv3 / VLv4 or H3L4, VHv3 / VLv5 or H3L5, VHv3b / VLv1 or H3bL1, VHv3b / VLv3 or H3bL, VHv3 or H3bL, VHv3 VLv5 or H3bL5, VHv4 / VLv1 or H4L1, VHv4 / VLv2 or H4L2, VHv4 / VLv3 or H4L3, VHv4 / VLv4 or H4L4, VHv4 / VLv5 or H4L5, VHv4b / V2 or H4L5 H4bL3, VHv4b / VLv4 or H4bL4, VHv4b / VLv Or a H4bL5, VHv5 / VLv1 or H5L1, VHv5 / VLv2 or H5L2, VHv5 / VLv3 or H5L3, VHv5 / VLv4 or H5L4, and VHv5 / VLv5 or H5L5 a).

  The present invention provides that the humanized mature heavy chain variable region exhibits at least 90%, 95%, 96%, 97%, 98%, or 99% identity to humanized Hu9D5VHv4b (SEQ ID NO: 11) and humanized maturation A variant of a humanized 9D5 antibody is provided wherein the light chain variable region exhibits at least 90%, 95%, 96%, 97%, 98%, or 99% identity to Hu9D5VLv1 (SEQ ID NO: 19). In some such antibodies, at least one, two, or all three of the Hu9D5 H4bL1 reversion or other mutations are retained. The invention also provides other exemplary humanized 9D5 antibody variants. Such variants are exemplified by the humanized antibodies 9D5 H1L1, H1L2, H1L3, H1L4, H1L5, H2L1, H2L2, H2L3, H2L4, H2L5, H2bL1, H2bL2, H2bL3, H2bL3H, H2bL3H4L3H4 , H3L5, H3bL1, Hb3L2, H3bL3, Hb3L4, H3bL5, H4L1, H4L2, H4L3, H4L4, H4L5, H4bL1, H4bL2, H4bL3, H4bL4, H4bL5, H4bL5, H5L1 The mature heavy chain variable region has a mature light chain variable region and a mature heavy chain variable region that exhibit at least 90%, 95%, 96%, 97%, 98%, or 99% sequence identity.

  In some antibodies, E, L, F, S, L, and L occupy at least one of positions H42, H47, H69, H82, H82b, and H108, respectively, in the Vh region. In some antibodies, L, F, and S occupy positions H47, H69, and H82, respectively, in the Vh region, as in Hu9D5VHv1. In some antibodies, as in Hu9D5VHv2, L, F, S, and L occupy positions H47, H69, H82, and H82b, respectively, in the Vh region. In some antibodies, E, L, and L occupy positions H42, H47, and H108, respectively, in the Vh region, as in Hu9D5VHv2b. In some antibodies, as in Hu9D5VHv3, F, S, and L occupy positions H69, H82, and H82b, respectively, in the Vh region. In some antibodies, L occupies positions H47 and H108, respectively, in the Vh region, as in Hu9D5VHv3b and Hu9D5Vhv4b. In some antibodies, S and L occupy positions H82 and H82b, respectively, in the Vh region, as in Hu9D5VHv4. In some antibodies, E, L, and L occupy positions H42, H47, and H82b, respectively, in the Vh region, as in Hu9D5VHv5. In some antibodies, at least one of L8, L9, L18, L19, L36, L39, L60, L70, and L74 in the Vk region is assigned to A, P, S, V, F, R, S, A, and R occupy. In some antibodies, F occupies position L36 in the Vk region, as in Hu9D5VLv1. In some antibodies, S occupies position L60 in the Vk region, as in Hu9D5VLv3. In some antibodies, as in Hu9D5VLv4, positions L8, L9, L19, L36, L39, L60, L70, and L74 in the Vk region are respectively A, P, V, F, R, S, A, and R occupy. In some antibodies, as in Hu9D5VLv5, positions L8, L9, L18, L19, L36, L39, L60, L70 and L74 in the Vk region are respectively A, P, S , V, F, R, S, A, and R. The CDR region of such a humanized antibody can be the same or substantially the same as the CDR region of a 9D5 mouse donor antibody or any of the humanized 9D5 antibodies exemplified above. A CDR region can be defined by any conventional definition (eg, Chothia or a complex of Chothia and Kabat), but is preferably defined by Kabat.

  The location of the variable region framework follows Kabat numbering unless otherwise specified. Other such variants are typically exemplified by a small number of substitutions, deletions or insertions (eg, usually no more than 1, no more than 2, no more than 3, no more than 5, no more than 10, or no more than 15). Different from the Hu9D5 heavy and light chain sequences. Such differences are usually found within the framework, but can also be found in the CDRs.

  The exemplified Hu14G8 antibody can be any permutation or combination of the exemplified mature heavy chain variable region and mature light chain variable region (eg, VHv1 / VLv1 or H1L1, VHv1 / VLv2 or H1L2, VHv1 / VLv3 or H1L3, VHv2 / VLv1 or H2L1, VHv2 / VLv2 or H2L2, VHv2 / VLv3 or H2L3, VHv3 / VLv1 or H3L1, VHv3 / VLv2 or H3L2, and VHv3 / VLv3 or H3L3).

  The present invention provides that the humanized mature heavy chain variable region exhibits at least 90%, 95%, 96%, 97%, 98%, or 99% identity to Hu14G8VHv2 (Hu14G8 H2) (SEQ ID NO: 65) and human A variant of a humanized 14G8 antibody wherein the matured light chain variable region exhibits at least 90%, 95%, 96%, 97%, 98%, or 99% identity to Hu14G8VLv3 (Hu14G8 L3) (SEQ ID NO: 76) provide. In some such antibodies, at least one, two, three, four, or all five of the Hu14G8 H2L3 back-mutation or other mutations are retained. The invention also provides other exemplary humanized 14G8 antibody variants. Such variants are at least 90%, 95% in the mature light chain variable region and mature heavy chain variable region of the exemplified humanized antibody 14G8 H1L1, H1L2, H1L3, H2L1, H2L2, H2L3, H3L1, H3L2, or H3L3. , 96%, 97%, 98%, or 99% sequence identity with a mature light chain variable region and a mature heavy chain variable region.

  In some antibodies, E and L occupy at least one of positions H1 and H47 in the Vh region, respectively. In some antibodies, E and L occupy positions H1 and H47 in the Vh region, respectively, as in Hu14G8VHv2 and Hu14G8VHv3. In some antibodies, K and T each occupy at least one of positions H3 and H105 in the Vh region. In some antibodies, K and T occupy positions H3 and H105, respectively, in the Vh region, as in Hu14G8VHv1. In some antibodies, F occupies position L36 in the Vk region, as in Hu14G8VLv2. In some antibodies, A, P, V, S, S, and A each occupy at least one of positions L8, L9, L19, L26, L60, and L70 in the Vk region. In some antibodies, A, P, V, and A occupy positions L8, L9, L19, and L70, respectively, in the Vk region, as in Hu14G8VLv1. In some antibodies, S occupies positions L26 and L60, respectively, in the Vk region, as in Hu14G8VLv3. The CDR region of such a humanized antibody can be the same or substantially the same as the CDR region of the 14G8 mouse donor antibody. A CDR region can be defined by any conventional definition (eg, Chothia or a complex of Chothia and Kabat), but is preferably defined by Kabat.

  The location of the variable region framework follows Kabat numbering unless otherwise specified. Other such variants are typically exemplified by a small number of substitutions, deletions or insertions (eg, usually no more than 1, no more than 2, no more than 3, no more than 5, no more than 10, or no more than 15). It differs from the Hu14G8 heavy and light chain sequences. Such differences are usually found in the framework, but may also be found in the CDR.

  Possible additional mutations in humanized 9D5 or 14G8 are additional backmutations in the variable region framework. Many of the framework residues that are not in contact with the CDRs in the humanized mAb can accept amino acid substitutions from the corresponding position of the donor mouse mAb or other mouse or human antibody, and many potential CDR contacts Residues are also suitable for substitution. Even amino acids within the CDRs can be modified, for example, at residues found at corresponding positions in the human acceptor sequence used to provide the variable region framework. In addition, alternative human acceptor sequences can be used, for example, for heavy and / or light chains. When using different acceptor sequences, one or more of the backmutations recommended above are not performed because the corresponding donor and acceptor residues are already the same even without the backmutation.

  Preferably, substitutions or backmutations (whether conservative or not) in humanized 9D5 or 14G8 variants bind to the binding affinity or titer of the humanized mAb, ie, bind to monomeric TTR. The titer in some or all of the assays described in the examples of the invention of variant humanized 9D5 antibody or 14G8 antibody is not significantly affected by its ability to Substantially the same as the titer of the antibody, ie within experimental error).

D. Chimeric Antibodies and Veneered Antibodies The present invention further provides chimeric and veneered non-human antibodies, specifically the 9D5 or 14G8 antibodies of the Examples.

  A chimeric antibody is an antibody in which the light and heavy chain mature variable regions of a non-human antibody (eg, murine antibody) are combined with the light and heavy chain constant regions of a human antibody. Such antibodies retain substantially or completely the binding specificity of the murine antibody, with about two thirds being human sequences.

  A veneered antibody is a type of humanized antibody that retains some, usually all of the CDRs and non-human variable region framework residues of non-human antibodies, but a B cell epitope. Or other variable region framework residues that may contribute to the T cell epitope, eg, exposed residues (Padlan, Mol. Immunol. 28: 489, 1991) are replaced with residues from the corresponding position in the human antibody sequence. . As a result, the CDRs are fully or substantially derived from non-human antibodies, and the variable region framework of the non-human antibodies is further rendered human-like by substitution. The present invention includes veneered 9D5 or 14G8 antibodies.

E. Human Antibodies Human antibodies against monomeric TTR or fragments thereof (eg, amino acid residues 89-97 of TTR (SEQ ID NO: 113)) are obtained by various techniques described below. Some human antibodies are selected by Winter's phage display method using the competitive binding experiments described above to have the same epitope specificity as a particular mouse antibody, such as one of the mouse monoclonal antibodies described in the Examples. Is done. Human antibodies can also be used by using only fragments of TTR, such as TTR variants containing only amino acid residues 89-97 of TTR, as target antigens and / or collections of TTR variants, such as amino acid residues 89 of TTR. It can be screened for specific epitope specificity by screening antibodies against such as TTR variants with various mutations within ~ 97.

  Methods for making human antibodies include the trioma method of Oestberg et al., Hybridoma 2: 361-367 (1983); Oestberg, US Pat. No. 4,634,664; and Engleman et al., US Pat. No. 4,634,666. Use of transgenic mice containing human immunoglobulin genes (eg, Lonberg et al., WO 93/12227 (1993); US Pat. Nos. 5,877,397; 5,874,299; No. 5,814,318; No. 5,789,650; No. 5,770,429; No. 5,661,016; No. 5,633,425; No. 5,625,126 No. 5,569,825; No. 5,545,806; Neuberger, Nat. Biotechn 14: 826 (1996); and Kucherlapati, WO 91/10741 (1991)) and phage display methods (eg, Dower et al., WO 91/17271; McCafferty et al., WO No. 92/01047; US Pat. No. 5,877,218; No. 5,871,907; No. 5,858,657; No. 5,837,242; No. 5,733,743 No .; and 5,565,332).

F. Selection of Constant Regions The heavy chain variable region and light chain variable region of a chimeric, veneered or humanized antibody can be linked to at least a portion of a human constant region. The choice of constant region will depend, in part, on whether antibody-dependent cell-mediated cytotoxicity, antibody-dependent cellular phagocytosis and / or complement-dependent cytotoxicity is desired. For example, the human isotopes IgG1 and IgG3 have complement-dependent cytotoxicity, and the human isotypes IgG2 and IgG4 do not. Human IgG1 and IgG3 also induce stronger cell-mediated effector functions than human IgG2 and IgG4. The light chain constant region can be lambda or kappa.

  One or more amino acids at the amino or carboxy terminus of the light and / or heavy chain, for example the C-terminal lysine of the heavy chain, may be missing or derivatized in part or all of the molecule. Substitutions may be made in the constant region to reduce or increase effector functions such as complement-mediated cytotoxicity or ADCC (eg, Winter et al., US Pat. No. 5,624,821; Tso et al., US Pat. No. 5 , 834, 597; and Lazar et al., Proc. Natl. Acad. Sci. USA 103: 4005, 2006), increasing the half-life in humans (eg, Hinton et al., J. Biol. Chem). 279: 6213, 2004). Exemplary substitutions include Gln at position 250 and / or Leu at position 428 to increase antibody half-life (EU numbering is used in the constant region in this paragraph). Substitutions at any or all of positions 234, 235, 236 and / or 237 reduce the affinity for Fcγ receptors, particularly FcγRI receptors (see, eg, US Pat. No. 6,624,821). See) To reduce effector function, alanine substitutions at positions 234, 235 and 237 of human IgG1 can be used. Some antibodies have alanine substitutions at positions 234, 235 and 237 of human IgG1 to reduce effector function. Optionally, human IgG2 positions 234, 236 and / or 237 are replaced with alanine and position 235 is replaced with glutamine (see, eg, US Pat. No. 5,624,821). For some antibodies, human IgG1 mutations at one or more of positions 241, 264, 265, 270, 296, 297, 322, 329, and 331 according to EU numbering Is used. Some antibodies use mutations at one or more of positions 318, 320, and 322 according to the EU numbering of human IgG1. In some antibodies, positions 234 and / or 235 are replaced with alanine and / or position 329 is replaced with glycine. In some antibodies, positions 234 and 235 are replaced with alanine, as in SEQ ID NO: 102. For some antibodies, the isotype is human IgG2 or IgG4.

  An exemplary human light chain kappa constant region has the amino acid sequence of SEQ ID NO: 104. The N-terminal arginine of SEQ ID NO: 104 may be removed, in which case the light chain kappa constant region has the amino acid sequence of SEQ ID NO: 105. An exemplary human IgG1 heavy chain constant region has the amino acid sequence of SEQ ID NO: 101 (with or without a C-terminal lysine). An antibody can be a tetramer comprising two light chains and two heavy chains, as a separated heavy chain, as a light chain, as Fab, Fab ′, F (ab ′) 2, and Fv, or as a heavy chain It may be expressed as a single chain antibody in which the mature variable domains of the light chain are linked via a spacer.

  Human constant regions exhibit allotypic and isoallotypic variations between individuals, that is, the constant regions can vary from individual to individual at one or more polymorphic positions. Isoallotypes differ from allotypes in that sera that recognize isoallotypes bind to non-polymorphic regions of one or more other isotypes. Thus, for example, another heavy chain constant region is of the IgG1 G1m3 allotype and has the amino acid sequence of SEQ ID NO: 103. Another heavy chain constant region of the IgG1 G1m3 allotype has the amino acid sequence of SEQ ID NO: 102 (with or without a C-terminal lysine). Reference to a human constant region includes any permutation of residues occupying positions of any natural allotype or natural allotype.

G. Expression of Recombinant Antibodies Many methods are known for producing chimeric and humanized antibodies using antibody-expressing cell lines (eg, hybridomas). For example, antibody immunoglobulin variable regions can be cloned and sequenced using well-known methods. In one method, the heavy chain variable VH region is cloned by RT-PCR using mRNA prepared from hybridoma cells. For a VH region leader peptide containing a translation initiation codon, a consensus primer is used as a 5 ′ primer and a g2b constant region specific 3 ′ primer. Exemplary primers are described in US Patent Publication No. 2005/0009150 (hereinafter “Schenk”) by Schenk. The sequences of multiple clones obtained separately can be compared to ensure that no changes are introduced during amplification. The sequence of the VH region can also be determined or confirmed by sequencing the sequence of the VH fragment obtained by the 5'RACE RT-PCR method and 3'g2b specific primers.

  The light chain variable VL region can be cloned in the same way. In one method, consensus for amplification of the VL region using a 5 ′ primer designed to hybridize to the VL region containing the translation initiation codon and a 3 ′ primer specific for the Ck region downstream of the VJ ligation region. Design primer sets. In the second method, cDNA encoding VL is cloned using the 5'RACE RT-PCR method. Exemplary primers are described in Schenk above. The cloned sequence is then combined with a sequence encoding a human (and non-human species) constant region. Exemplary sequences encoding the human constant region include SEQ ID NO: 106 encoding the human IgG1 constant region (SEQ ID NO: 103), and SEQ ID NO: 107 encoding the human kappa light chain constant region (SEQ ID NOs: 104 and 105, respectively) and 108.

  In one method, the heavy chain variable region and the light chain variable region are redesigned to encode a splice donor sequence downstream of the respective VDJ junction or VJ junction, eg, in a mammalian expression vector, the heavy chain is In pCMV-hγ1, the light chain is cloned into pCMV-Mcl. These vectors encode human γ1 and Ck constant regions as exon fragments downstream of the inserted variable region cassette. After sequence verification, heavy and light chain expression vectors can be co-transfected into CHO cells to produce chimeric antibodies. Conditioned media is collected 48 hours after transfection and assayed for antibody production by Western blot analysis or assayed for antigen binding by ELISA. Chimeric antibodies are humanized as described above.

  Chimeric, veneered, humanized, and human antibodies are usually produced by recombinant expression. Recombinant polynucleotide constructs typically include an expression control sequence operably linked to the coding sequence of the antibody chain, including naturally associated expression control elements such as promoters or heterologous expression control elements. An expression control sequence can be a promoter system in a vector that can transform or transfect a eukaryotic or prokaryotic host cell. After the vector is incorporated into the appropriate host, the host is maintained under conditions suitable for high level expression of nucleotide sequences and collection and purification of cross-reacting antibodies.

  The above expression vectors can usually replicate in the host organism as episomes or as an integral part of the host chromosomal DNA. Expression vectors usually contain a selectable marker such as ampicillin resistance or hygromycin resistance so that cells transformed with the desired DNA sequence can be detected.

  E. coli is one prokaryotic host useful for the expression of antibodies, particularly antibody fragments. Microorganisms such as yeast are also useful for expression. Saccharomyces is one of the yeast hosts that have appropriate vectors with expression control sequences, origins of replication, termination sequences, etc. as desired. Typical promoters include glycolytic enzymes such as 3-phosphoglycerate kinase. Inducible yeast promoters include, among others, promoters derived from alcohol dehydrogenase, isocytochrome C, and enzymes responsible for the utilization of maltose and galactose.

  Mammalian cells can be used to express nucleotides encoding immunoglobulins or fragments thereof. See Winnacker, From Genes to Clones, (VCH Publishers, NY, 1987). A number of suitable host cell lines capable of secreting intact heterologous proteins have been developed, including CHO cell lines, various COS cell lines, HeLa cells, HEK293 cells, L cells, and non-antibody producing bone marrow including Sp2 / 0 and NS0 Including tumor. The cell may be a non-human cell. Expression vectors used for these cells include expression control sequences such as an origin of replication, promoter and enhancer (Queen et al., Immunol. Rev. 89:49 (1986)), as well as ribosome binding sites, RNA splice sites, polyadenylation sites, and It may contain necessary processing information sites such as transcription terminator sequences. Expression control sequences can include promoters derived from endogenous genes, cytomegalovirus, SV40, adenovirus, bovine papilloma virus, and the like. Co et al. Immunol. 148: 1149 (1992).

  Alternatively, the antibody coding sequence may be incorporated into a transgene and introduced into the transgenic animal's genome and then expressed in the transgenic animal's milk (eg, US Pat. No. 5,741,957; US Pat. No. 5,304,489; and US Pat. No. 5,849,992). Suitable transgenes include light and / or heavy chain coding sequences operably linked to promoters and enhancers from mammary gland specific genes such as casein or beta-lactoglobulin.

  A vector containing the target DNA segment can be introduced into a host cell by a method according to the type of the cell host. For example, calcium chloride transfection is often used for prokaryotic cells, and calcium phosphate treatment, electroporation, lipofection, gene gun, or virus-based transfection can be used for other cellular hosts. Methods used for transformation of mammalian cells include the use of polybrene, protoplast fusion, liposomes, electroporation, and microinjection. For the production of transgenic animals, transgenes can be injected into fertilized oocytes by microinjection or integrated into the genome of embryonic stem cells, and the nuclei of such cells can be transferred into enucleated oocytes.

  After introducing the vector (s) encoding the heavy and light chains of the antibody into the cell culture, the cell pool can be screened for growth potential and product quality in serum-free medium. The most productive cell pool can then be subjected to FACS-based single cell cloning to create a monoclonal system. Specific production amounts of 50 pg / cell or more than 100 pg / cell per day, corresponding to more than 7.5 g per liter of medium can be used. Antibodies produced by single cell clones can be tested for turbidity, filtration properties, PAGE, IEF, UV scan, HP-SEC, carbohydrate-oligosaccharide mapping, mass spectrometry, and binding assays such as ELISA or Biacore. The selected clones are then stored in multiple vials and stored frozen for future use.

  After expression, the antibody can be purified according to standard methods in the art, including protein A capture, HPLC purification, column chromatography, gel electrophoresis, etc. (generally, Scopes, Protein Purification (Springer-Verlag, NY, 1982). )

  Includes codon optimization, promoter selection, transcription element selection, terminator selection, serum-free single cell cloning, cell banking, use of selectable markers for copy number amplification, CHO terminator, or increased protein titer Methodologies for the commercial production of antibodies can be used (eg, US Pat. Nos. 5,786,464; 6,114,148; 6,063,598; 7,569, International Publication No. 2004/050884; No. 2008/012142; No. 2008/012142; No. 2005/019442; No. 2008/107388; No. W02009 / 027471; No. 5,888,809).

H. Antibody Screening Assays Several screens can be performed, including antibody binding assays, functional screens, screening using animal models of disease with TTR deposits, and clinical trials. Binding assays test for specific binding to monomeric TTR or a fragment thereof, and optionally affinity and epitope specificity. For example, by binding assay, amino acid residue 89 of TTR is an epitope that is buried in native TTR tetramer and exposed in monomeric, misfolded, aggregated, or fibrillar TTR. Antibodies that bind to ˜97 (SEQ ID NO: 113) can be screened. Antibodies are also screened for the ability to bind pre-fibrillar, non-natural conformational TTR and TTR amyloid fibrils rather than the native TTR conformation. For example, antibodies are screened for the ability to bind to monomeric TTR resulting from dissociation or disaggregation of natural tetrameric TTR, as described in the Examples and others, and against natural tetrameric TTR. Counter-screened. Similarly, antibodies are also screened for their immunoreactivity against TTR-mediated amyloidosis tissue but not against healthy tissue. Such screening is optionally performed in competition with exemplary antibodies, such as antibodies having a variable region of 9D5 or 14G8 (IgG1 kappa isotype). In such assays, the antibody or TTR target is optionally immobilized.

  Functional assays can be performed in cell models that include cells that naturally express TTR or cells that are transfected with DNA encoding TTR or a fragment thereof. Suitable cells include cells derived from heart tissue or other tissues in which TTR amyloid formation is observed. Cells are either reduced in monomeric, misfolded, aggregated, or fibrillar form of TTR (eg, by Western blotting or immunoprecipitation of cell extracts or supernatants) or in monomeric form, Screened for reduced toxicity due to fold, aggregated, or fibrillar forms of TTR. For example, an antibody has the ability to inhibit or reduce TTR aggregation, the ability to inhibit or reduce TTR fibril formation, the ability to reduce TTR deposits, the ability to remove aggregated TTR, or the non-toxic conformation of TTR. Tested for ability to stabilize.

  Other functional assays can be performed in solution, for example, whether the antibody can interfere with or reduce TTR fibril formation when the monomeric TTR or misfolded TTR intermediate in solution is contacted with the antibody Can be tested. The degree of fibril formation can be examined, for example, by turbidity measurement at 400 nm with an ultraviolet-visible light spectrophotometer equipped with a temperature control unit. Thioflavin T can also be used to assess the degree of amyloid fibril formation. For example, a 5-fold molar excess of thioflavin T can be added to a TTR sample and allowed to stand at room temperature for 30 minutes before measurement. The fluorescence of thioflavin T can be monitored using a fluorometer. See U.S. Patent Application Publication No. 2014/0056904.

  Screening using animal models tests the ability of the antibody to treat or prevent signs or symptoms in animal models that mimic human diseases associated with TTR or TTR deposit accumulation. Such diseases include senile systemic amyloidosis (SSA), senile cardiac amyloidosis (SCA), familial amyloid neuropathy (FAP), familial amyloid cardiomyopathy (FAC), and central nervous system selective amyloidosis (CNSA). ) And other TTR amyloidosis. Appropriate signs or symptoms that can be monitored include the presence and extent of amyloid deposits in various tissues such as the gastrointestinal tract or heart. The degree of amyloid deposit reduction is determined by the amount of TTR amyloid deposits in an appropriate control, eg, a control antibody (eg, an isotype-matched control antibody), a control animal that received a placebo, or a control animal that did not receive any treatment. It can be obtained by comparison with the level. An exemplary animal model for testing activity against TTR amyloidosis is a mouse having a null mutation at the endogenous mouse Ttr locus and a human mutant TTR gene containing a V30M mutation associated with familial amyloid polyneuropathy. It is a model. For example, Kohno et al., Am. J. et al. Path. 150 (4): 1497-1508 (1997); Cardoso and Saraiva, FASEB J 20 (2): 234-239 (2006). Similar models exist and include other models of familial TTR amyloidosis and models of sporadic TTR amyloidosis. For example, Teng et al., Lab. Invest. 81 (3): 385-396 (2001); Regent Advances in Transylation Evolution, Structure, and Biological Functions, pp. See 261-280, Ito and Maeda, Mouse Models of Transtyretin Amyloidosis (2009) (Springer Berlin Heidelberg). The transgenic animal may comprise a human TTR transgene, such as a TTR transgene having a mutation associated with TTR amyloidosis or a wild type TTR transgene. To facilitate testing in animal models, chimeric antibodies with constant regions suitable for animal models can be used (eg, mouse-rat chimeras can be used for testing antibodies in rats). Certain humanized antibodies are effective in animal models for which the corresponding murine or chimeric antibody is appropriate, and the humanized antibody has a similar binding affinity (eg, 1.5-fold, 2-fold or 3 It can be concluded that it is effective.

  Clinical trials test safety and efficacy in humans with diseases associated with TTR amyloidosis.

I. Nucleic acids The invention further provides nucleic acids (eg, SEQ ID NOs: 40, 42, 44-56, 87, 89, 91-96, and 106-108) that encode any of the heavy and light chains described above. Such nucleic acids optionally further encode a signal peptide and are encoded by signal peptides (eg, SEQ ID NOs: 40 and 87 (heavy chain) and SEQ ID NOs: 42 and 89 (light chain), respectively) linked to the constant region. And a signal peptide having the amino acid sequences of SEQ ID NOs: 43 and 90 (heavy chain) and SEQ ID NOs: 43 and 90 (light chain)). In order to ensure expression of the coding sequence, the coding sequence of the nucleic acid can be operably linked to control sequences such as promoters, enhancers, ribosome binding sites, transcription termination signals and the like. Nucleic acids encoding heavy and light chains may be present in isolated form or cloned into one or more vectors. Nucleic acids can be synthesized, for example, by solid phase synthesis or PCR of overlapping oligonucleotides. Nucleic acids encoding heavy and light chains may be linked as one continuous nucleic acid, eg, in an expression vector, or may be cloned and separated, eg, in each expression vector.

J. et al. Conjugate antibodies A conjugate that specifically binds to an antigen that is exposed in the pathogenic form of TTR but not in the native tetrameric form of TTR, such as amino acid residues 89-97 of TTR (SEQ ID NO: 113). Gated antibodies detect the presence of monomeric, misfolded, aggregated, or fibrillar forms of TTR; monitoring and evaluation of the effectiveness of therapeutic agents used to treat patients diagnosed with TTR amyloidosis; Inhibition or reduction of TTR aggregation; inhibition or reduction of TTR fibril formation; reduction or elimination of TTR deposits; stabilization of non-toxic conformation of TTR; or treatment or prevention of TTR amyloidosis in a patient. For example, such an antibody can be conjugated to another therapeutic moiety, another protein, another antibody, and / or a detectable label. See WO 03/057838; US Pat. No. 8,455,622.

  The conjugated therapeutic moiety can be any agent that can be used to treat, address, ameliorate, prevent, or ameliorate an undesirable condition or disease of a patient, such as TTR amyloidosis. The therapeutic moiety includes, for example, an immunomodulator or any biologically active agent that promotes or enhances the activity of the antibody. An immunomodulator can be any agent that stimulates or suppresses the development or maintenance of an immune response. When such a therapeutic moiety is coupled to an antibody specific for a TTR in monomeric, misfolded, aggregated, or fibrillar form, eg, an antibody described herein, the coupled therapeutic moiety Will have a specific affinity for the non-natural pathogenic form of TTR over the natural tetrameric form of TTR. For this reason, administration of the conjugate antibody directly targets tissues containing pathogenic forms of TTR with minimal damage to surrounding normal healthy tissue. This is particularly useful for therapeutic moieties that are too toxic to administer themselves. In addition, a smaller amount of therapeutic part can be used.

  Examples of suitable therapeutic moieties include drugs that reduce TTR levels, drugs that stabilize the natural tetrameric structure of TTR, drugs that inhibit TTR aggregation, drugs that interfere with the formation of TTR fibrils or TTR amyloid Or drugs that counteract cytotoxicity. For example, Almeida and Saraiva, FEBS Letters 586: 2891-2896 (2012); Saraiva, FEBS Letters 498: 201-203 (2001); Ando et al. 126: 1286-1300 (2012); and Johnson et al., J. Biol. Mol. Biol. 421 (2-3): 185-203 (2012). For example, the antibody may be tafamidis, diflunisal, ALN-TTR01, ALNTTR02, ISIS-TTRRx, doxycycline (doxy), tauroursodeoxycholic acid (TUDCA), Doxy-TUDCA, epigallocatechin gallate (EGCG), curcumin, or resvera Can be conjugated to trol (3,5,4'-trihydroxystilbene). Other exemplary therapeutic moieties include TTR amyloidosis or other agents known to be useful in the treatment, management, or amelioration of symptoms of TTR amyloidosis. For example, see Ando et al., Orphanet Journal of Rare Diseases 8:31 (2013) for the common clinical symptoms of TTR amyloidosis and typical agents used to treat the symptoms.

  Antibodies can also be coupled with other proteins. For example, the antibody can be coupled to a finomer. Finomers are small binding proteins (eg 7 kDa) derived from the human Fyn SH3 domain. They are stable and soluble and may lack cysteine residues and disulfide bonds. Phinomers can be designed to bind to target molecules with the same affinity and specificity as antibodies. Phinomers are suitable for the production of antibody-based multispecific fusion proteins. For example, phenomers can be fused to the N-terminus and / or C-terminus of an antibody to create bispecific and trispecific FynomAbs with different structures. Finomers can be selected using the finomer library by screening techniques using FACS, Biacore, and cell-based assays that can efficiently select finomers with optimal properties. Examples of finomers are described in Grabulovski et al. Biol. Chem. 282: 3196-3204 (2007); Bertschinger et al., Protein Eng. Des. Sel. 20: 57-68 (2007); Schlatter et al., MAbs. 4: 497-508 (2011); Banner et al., Acta. Crystallogr. D. Biol. Crystallogr. 69 (Pt6): 1124-1137 (2013); and Black et al., Mol. Cancer Ther. 13: 2030-2039 (2014).

  The antibodies disclosed herein can also be coupled or conjugated to one or more other antibodies (eg, creating an antibody heteroconjugate). Such other antibodies can bind to different epitopes in TTR or a portion thereof, or can bind to different target antigens.

The antibody can also be coupled with a detectable label. Such antibodies can be used, for example, for diagnosis of TTR amyloidosis, monitoring the progression of TTR amyloidosis, and / or evaluating therapeutic effects. Such antibodies are particularly useful in carrying out such determinations in subjects suffering from or susceptible to TTR amyloidosis or in appropriate biological samples taken from such subjects. Exemplary detectable labels that can be coupled or linked to antibodies include various enzymes such as horseradish peroxidase, alkaline phosphatase, β-galactosidase, or acetylcholinesterase; prosthetic molecules such as streptavidin / biotin and avidin / biotin Fluorescent materials such as umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; luminescent materials such as luciferase, luciferin and aequorin; radioactive materials such as yttrium ⁹⁰ (90Y) , radioactive silver-111 radioactive silver -199, bismuth ^213, iodine ^{(131 I, 125 I, 123} I, 121 I), carbon ⁽¹⁴ C), sulfur ⁽⁵ S), tritium ⁽³ H), indium ^{(115 In, 113 In, 112} In, 111 In), technetium ⁽⁹⁹ Tc), thallium ⁽²⁰¹ Ti), gallium ^{(68 Ga,} 67 ^Ga) , Palladium ( ¹⁰³ Pd), molybdenum ( ⁹⁹ Mo), xenon ( ¹³³ Xe), fluorine ( ¹⁸ F), ¹⁵³ Sm, ¹⁷⁷ Lu, ¹⁵⁹ Gd, ¹⁴⁹ Pm, ¹⁴⁰ La, ¹⁷⁵ Yb, ¹⁶⁶ Ho, ⁹⁰ Y, ⁴⁷ Sc, ¹⁸⁶ Re, ¹⁸⁸ Re, ¹⁴² Pr, ¹⁰⁵ Rh, ⁹⁷ Ru, ⁶⁸ Ge, ⁵⁷ Co, ⁶⁵ Zn, ⁸⁵ Sr, ³² P, ¹⁵³ Gd, ¹⁶⁹ Yb, ⁵¹ Cr, ⁵⁴ Mn, ⁷⁵ Se, ¹¹³ Sn, and ¹¹⁷ Tin; release positrons using various positron emission tomography Metal; nonradioactive paramagnetic metal ions; and molecule conjugated to radiolabeled molecules or specific radioisotopes.

  Linking the radioisotope to the antibody can be performed using conventional bifunctional chelates. A sulfur-based linker can be used to link radioactive silver-111 and radioactive silver-199. Hazra et al., Cell Biophys. 24-25: 1-7 (1994). The linkage of the silver radioisotope can include reducing the immunoglobulin with ascorbic acid. For the radioisotopes such as 111In and 90Y, ibritumomab tiuxetan can be used, which reacts with the above isotopes to give 111In-ibritumomab tiuxetan and 90Y-ibritummo, respectively. Mabuchiuxetane is formed. Witzig, Cancer Chemother. Pharmacol. , 48 Suppl 1: S91-S95 (2001).

  Therapeutic moieties, other proteins, other antibodies, and / or detectable labels can be coupled or conjugated directly to the antibodies of the invention, but indirectly through an intervening (eg, linker). Or it may be conjugated. For example, Monoclonal Antibodies And Cancer Therapy, Reisfeld et al. 243-56 (Alan R. Liss, Inc. 1985), Arnon et al., “Monoclonal Antibodies For Immunology Of Drugs In Cancer Therapy, et al., Controlled Drug Delp. 623-53 (Marcel Dekker, Inc. 1987), Hellstrom et al., "Antibodies For Drug Delivery"; Monoclonal Antibodies 84, Biological And Clinical Applications, P. (Principal Applications, P.). 475-506 (1985), Thorpe, “Antibody Carriers of Cytotoxic Agents in Cancer Therapeutics, A Review”; Monoclonal Antibodies for Cancer Detection. 303-16 (Academic Press 1985) "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibiotic In Cancer Therapy." Rev. 62: 119-58 (1982). Suitable linkers include, for example, cleavable linkers and non-cleavable linkers. Various linkers that release coupled therapeutic moieties, proteins, antibodies, and / or detectable labels when exposed to specific proteases under acidic or reducing conditions, or under other defined conditions Can be used.

V. Therapeutic applications The above-described antibodies have or are at least partially mediated by transthyretin (TTR) and in particular by monomeric, misfolded, aggregated, or fibrillar forms of TTR. Can be used to treat or prevent disease in patients at risk of various diseases. Although it is not necessary to understand the mechanism in practice, the following mechanisms are used to treat TTR amyloidosis using the antibodies described above: antibody-mediated inhibition of TTR aggregation and fibril formation, non-toxic conformation of TTR (eg, tetrameric form) ) Antibody-mediated stabilization, or antibody-mediated removal of aggregated TTR, oligomeric TTR, or monomeric TTR is thought to contribute. Antibody-drug conjugates may have additional mechanisms of action that depend on the conjugate moiety.

  The antibody is administered in an effective regimen, i.e., dose, route of administration and frequency of administration that delays onset, reduces severity, reduces further exacerbations, and / or ameliorates at least one sign or symptom of the disorder being treated. Is done. If the patient is already suffering from a disorder, the regimen can be referred to as a therapeutically effective regimen. If a patient has a higher risk of disability than the general population but has not yet seen symptoms, the regimen can be called a prophylactically effective regimen. In some cases, therapeutic or prophylactic efficacy can be observed in individual patients compared to existing controls or previous experience in the same patient. In other cases, therapeutic or prophylactic efficacy can be revealed in preclinical or clinical trials by comparing a treated population of patients with a control population of untreated patients.

  The frequency of administration will depend on, among other factors, the half-life of circulating antibodies, the patient's condition and the route of administration. The frequency can be daily, weekly, monthly, quarterly, or at irregular intervals, depending on the patient's condition or changes in the progression of the disorder being treated. An exemplary frequency of intravenous administration is from once a week to four times a year over successive causes of treatment, although more or less frequent is possible. For subcutaneous administration, an exemplary dosing frequency is daily to monthly, although more or less dosing frequencies are possible.

  The number of doses depends on whether the disorder is acute or chronic and the response to treatment of the disorder. In many cases, 1 to 10 times is sufficient for acute exacerbation of an acute or chronic disorder. A single bolus administration, optionally in divided forms, may be sufficient for acute exacerbations of acute or chronic disorders. Treatment can be repeated for recurrence of acute injury or exacerbation. For chronic disorders, antibodies are administered at regular intervals for at least 1 year, 5 years or 10 years or throughout the life of the patient, eg once a week, every other week, once a month, four times a year, once every six months, Can be administered.

VI. Pharmaceutical compositions and methods of use Described herein are diseases or conditions mediated at least in part by transthyretin (TTR) and in particular by TTR in monomeric, misfolded, aggregated, or fibrillar form. Several methods are provided for diagnosing, monitoring, treating or preventing (eg, TTR amyloidosis). Examples of such diseases include familial amyloid cardiomyopathy (FAC), or cardiomyopathy or cardiac hypertrophy in athletes or others performing extreme aerobic exercise, familial amyloid neuropathy (FAP), Or familial TTR amyloidosis, such as central nervous system selective amyloidosis (CNSA), and sporadic TTR amyloidosis, such as senile systemic amyloidosis (SSA) or senile cardiac amyloidosis (SCA). TTR amyloidosis may also be associated as a cause or result of various diseases and conditions characterized by tissue or organ degeneration or. Accumulation of TTR deposits contributes to organ or tissue dysfunction associated with the disease or condition. An example of such a condition that can be treated or prevented by the agents and methods of the present invention is spinal stenosis (Westermark et al., Upsala J. Medical Sciences 119, 223-238 (2014) and Yanagisawa et al., Modern Pathology 28. 201-207 (2015)). Another disease that can be similarly treated or prevented is osteoarthritis (Takanashi et al., Amyloi 20, 151-155 (2013), Gu et al., Biomed & Biotechnol. 15, 92-99; Takinami et al., Biomarker. Insights 8, 85-95 (2014); Akasaki et al., Arthritis Rheumatol. 67, 2097-2107 (2015)). Another disease that can be similarly treated or prevented is rheumatoid arthritis (Clement et al., JCI Insight 1 publish (2016)). Another disease that can be treated or prevented is juvenile idiopathic arthritis (Sharma et al., PLOSone 9, 1-12 (2014)). Another disease that can be treated or prevented is age-related macular degeneration (wet or dry). Another class of conditions that can be similarly treated or prevented are ligament disorders and tendon disorders, such as disorders of the rotator cuff (Sueoshi et al., Human Pathol. 42, 1259-64 (2011)).

  The above antibodies can be incorporated into a pharmaceutical composition for use in the treatment or prevention of any of the above diseases and conditions. Generally, the antibody or pharmaceutical composition containing the antibody is administered to a subject in need thereof. Patients suitable for treatment include individuals at risk for TTR amyloidosis but not symptomatic as well as patients presently symptomatic. Some patients can be treated during the progenitor stage of TTR amyloidosis.

  Individuals suffering from TTR amyloidosis are: (1) a family history of neuropathic disease, particularly related to heart failure; (2) neuropathic pain or progressive sensory impairment of unknown cause; (3) cause unclear Carpal tunnel syndrome, particularly bilateral and requiring surgical opening; (4) unexplained gastrointestinal dysmotility or autonomic dysfunction (eg erectile dysfunction, orthostatic hypotension, neurogenic bladder); (5) Heart disease characterized by ventricular wall thickening without hypertension; (6) Advanced atrioventricular block with unknown cause, especially with cardiac hypertrophy; and (6) Cotton-like vitreous inclusion 1 It may be recognized from clinical symptoms of TTR amyloidosis, including one or more. See Ando et al., Orphanet Journal of Rare Diseases 8:31 (2013). However, a definitive diagnosis of TTR amyloidosis usually relies on a biopsy of the target organ and then the deposited tissue is histologically stained with Congo red, an amyloid-specific dye. If the test result is positive for amyloid, then TTR immunohistochemical staining is performed to confirm that the precursor protein responsible for amyloid formation is actually TTR. In familial diseases, it is then necessary to make a diagnosis after revealing that there is a mutation in the gene encoding TTR.

  The identification of the subject may be performed at the clinical site or may be performed elsewhere, for example, at the subject's home, for example, the subject himself using a self-test kit. For example, subjects can be identified based on a variety of symptoms such as peripheral neuropathy (sensory and motor neuropathy), autonomic neuropathy, gastrointestinal disorders, cardiomyopathy, renal disorders, or intraocular deposition. See Ando et al., Orphanet Journal of Rare Diseases 8:31 (2013). A subject can also be identified by an increased level of non-native form of TTR in a plasma sample from the subject relative to a control sample, as disclosed in the Examples.

  Once family history, genetic testing, or medical screening supports TTR amyloidosis, treatment can begin at any age (eg, 20, 30, 40, 50, 60, or 70 years). Treatment usually requires repeated administrations over a period of time, assaying the response of antibodies or activated T cells or B cells over time to therapeutic agents (eg, truncated forms of TTR containing amino acid residues 89-97). You can monitor by doing. Additional doses are indicated if response decreases.

  In a prophylactic application, a subject susceptible to or at risk of a disease (eg, TTR amyloidosis) reduces the risk of the disease, reduces the severity of the disease, or at least one sign or symptom of the disease The antibody or pharmaceutical composition thereof is administered in a regimen (dosage, frequency and route of administration) effective to delay the onset of In therapeutic applications, to ameliorate or at least suppress further exacerbation of at least one sign or symptom of a disease in a subject suspected of having the disease (eg, TTR amyloidosis) or already suffering from the disease The antibody or immunogen that induces the antibody is administered in an effective regimen (dose, frequency and route of administration).

  A regimen may or may not be the case when an individual subject who has received treatment achieves a better outcome than an average subject in a control population of equivalent subjects not receiving treatment according to the methods disclosed herein. Subjects treated with the regimen are p <0.05 or p <0.01 over control subjects or animal models in a controlled clinical trial (eg, a phase II, phase II / III or phase III trial). In some cases, a good outcome at a level of p <0.001 is considered therapeutically or prophylactically effective.

  An effective regimen of an antibody, for example, inhibits or reduces TTR aggregation in a subject having or at risk for a condition associated with TTR accumulation; a TTR source in a subject having or at risk for a condition associated with TTR accumulation. Inhibit or reduce fibrosis; reduce or eliminate TTR deposits or aggregate TTR in a subject with or at risk for TTR accumulation; in a subject with or at risk for TTR accumulation Stabilizes the non-toxic conformation of TTR; inhibits the toxic effects of TTR aggregates, fibrils or deposits in subjects with or at risk for TTR accumulation; suspected of having amyloid accumulation Diagnosing the presence or absence of TTR amyloid accumulation in the tissue; detecting the presence or absence of bound antibody in the subject after antibody administration More to determine TTR deposit levels in the subject; to detect the presence of monomeric, misfolded, aggregated, or fibrillar forms of TTR in the subject; to treat patients diagnosed with TTR amyloidosis Monitoring and assessing the efficacy of therapeutic agents used in the treatment; inducing an immune response including antibodies to TTR in the subject; delaying the onset of a condition associated with TTR amyloid accumulation in the subject; or TTR amyloidosis in a patient Can be used to treat or prevent.

  An effective amount is a number of different factors, such as the means of administration, the target site, the subject's physiological condition, whether the subject is a human or animal, other drugs administered, and whether the treatment is prophylactic or therapeutic. It depends on whether there are any.

  Exemplary dose ranges for antibodies are about 0.1-20 mg / kg body weight, or 0.5-5 mg / kg body weight (eg, 0.5 mg / kg, 1 mg / kg, 2 mg / kg, 3 mg / kg, 4 mg / Kg or 5 mg / kg) or 10 to 1500 mg as a fixed dose. The dose depends on, among other factors, the patient's condition and the response to previous treatment, if any, whether the treatment is prophylactic or therapeutic, and whether the disorder is acute or chronic .

  The antibody may be administered at the above doses daily, every other day, once a week, every other week, once a month, four times a year, or according to any other schedule determined by empirical analysis. Exemplary treatments require repeated administration over an extended period of, for example, at least 6 months. Additional exemplary treatment regimes require administration once every two weeks, once a month or once every 3-6 months.

  The antibody can be administered by a peripheral route. Administration routes include topical, intravenous, oral, subcutaneous, intraarterial, intracranial, intrathecal, intraperitoneal, intranasal or intramuscular. The route of administration of the antibody can be intravenous or subcutaneous. Intravenous administration can be by infusion over a period of time, for example, 30-90 minutes. This type of injection is most typically performed in the arm or leg muscles. In some methods, the drug is injected directly into a particular tissue where deposits have accumulated, for example, intracranial.

  Pharmaceutical compositions for parenteral administration can be sterile and substantially isotonic (250-350 mOsm / kg water) and can be manufactured under GMP conditions. The pharmaceutical composition can be provided in unit dosage form (ie, a dose for a single administration). The pharmaceutical composition can be formulated with one or more physiologically acceptable carriers, diluents, excipients or adjuvants. The formulation depends on the route of administration chosen. For injection, the antibody can be formulated in aqueous solutions, for example in physiologically compatible buffers such as Hank's solution, Ringer's solution, physiological saline, or acetate buffer (to reduce discomfort at the injection site). The solution may contain pharmaceutical agents such as suspending, stabilizing and / or dispersing agents. Alternatively, the antibody can be in lyophilized form for construction with a suitable medium, eg, sterile pyrogen-free water, prior to use.

  The regimen can be administered in combination with another agent effective in treating or preventing the disease being treated. Such agents include siRNA that inhibits expression of TTR or Vyndaqel, which is a tetrameric form of TTR stabilizer.

  After treatment, the subject's condition can be evaluated to determine the progress or effectiveness of such treatment. Such a method preferably examines changes in levels of TTR amyloid or non-native forms of TTR. For example, the level of TTR amyloid can be evaluated to determine an improvement relative to the level of the subject's TTR amyloid under comparable conditions prior to treatment. A subject's level of TTR amyloid can also be compared to a control population under comparable circumstances. A control population can be similarly affected (unamong various control subjects) untreated subjects or normal untreated subjects. Similarly, if an improvement is seen compared to an affected untreated subject, or levels are approaching or have reached levels of an untreated normal subject, it indicates a positive response to treatment.

  The level of TTR amyloid can be measured by a number of methods including imaging techniques. Examples of suitable imaging techniques include radiolabeled fragments thereof TTR, TTR antibodies or fragments thereof, Congo red amyloid contrast agents such as PIB (US 2011/0008255), amyloid imaging peptide p31 ( Biodistribution of amyloid-imaging peptide, p31, correlates with amyloid quantification based on congruent tissue staining, PET et al. The level of non-native form of TTR can be determined using, for example, SDS-PAGE / Western blot or Meso Scale using antibodies disclosed herein in plasma samples or biopsy samples from a subject, as described in the Examples. It can be measured by performing a Discovery plate assay and comparing it to a control sample.

A. Methods of diagnosis and monitoring TTR in patients suffering from or susceptible to diseases associated with TTR deposition or pathogenic forms of TTR (eg, monomeric, misfolded, aggregated or fibrillar TTR) Also provided is a method of detecting an immune response against. This method can be used to monitor the progress of therapeutic or prophylactic treatment with the agents provided herein. The antibody profile after passive immunization usually shows a peak immediately following the antibody concentration followed by an exponential decay. Without further administration, the attenuation approaches pre-treatment levels within days to months depending on the half-life of the administered antibody. For example, some human antibodies have a half-life of about 20 days.

  In some methods, the baseline value of an antibody against TTR in a subject is measured prior to administration, a second measurement is performed immediately after administration to determine the peak value of the antibody level, and one more time at intervals. Alternatively, multiple measurements are performed to monitor antibody level decay. An additional dose of antibody is administered when the antibody level falls to a predetermined percentage of the difference between the baseline value or peak value and the baseline value (eg, 50%, 25% or 10%). In some methods, peak values or subsequently measured levels minus background are compared to a pre-determined reference level to establish a prophylactic or therapeutic treatment regimen that is beneficial to other subjects. If the measured antibody level is significantly lower than the reference level (eg, an average of minus one or preferably minus two standard deviations in the population of subjects benefiting from treatment), additional doses of antibody Administration is indicated.

  A monomeric, misfolded, aggregated, or fibrillar form of TTR in a subject, eg, a TTR amyloid or pathogenic form of TTR (eg, monomeric, misfolded form) in a sample from the subject Also provided are methods of detecting by measuring (in aggregated, or fibrillar form of TTR) or by in vivo imaging of TTR in a subject. Such a method is useful for diagnosing or confirming a disease associated with, or susceptible to, the above pathogenic forms of TTR (eg, TTR amyloidosis). This method can also be used on asymptomatic subjects. The presence of monomeric, misfolded, aggregated, or fibrillar forms of TTR indicates that it is susceptible to future symptomatic disease. This method is also useful for monitoring disease progression and / or response to treatment in a subject already diagnosed with TTR amyloidosis.

  A biological sample taken from a subject having, suspected of having, or at risk of having TTR amyloidosis is contacted with an antibody disclosed herein to form a monomeric form, misfolded form, aggregated form, or The presence of fibrillar form of TTR can be assessed. For example, the level of monomeric, misfolded, aggregated, or fibrillar TTR in the subject can be compared to that in a healthy subject. Alternatively, the level of TTR amyloid or pathogenic form of TTR (eg, monomeric, misfolded, aggregated, or fibrillar form of TTR) in the above-mentioned subject undergoing treatment for a disease is expressed as TTR amyloidosis. It may be compared with that of a subject who has not been treated for. Some such tests include a biopsy of tissue taken from the subject. An ELISA assay may also be useful, for example, to assess the level of monomeric, misfolded, aggregated, or fibrillar TTR in a liquid sample. Some such ELISA assays include anti-TTR antibodies that preferentially bind monomeric, misfolded, aggregated, or fibrillar forms of TTR over normal tetrameric forms of TTR. .

  In vivo imaging methods involve administering a reagent, eg, an antibody that binds to a monomeric, misfolded, aggregated, or fibrillar form of a TTR of interest, and then detecting it after the reagent binds. Can be implemented. Such antibodies usually bind to an epitope within residues 89-97 of TTR. If necessary, an ablation response can be avoided by using an antibody fragment lacking a full-length constant region, eg, a Fab. In some methods, the same antibody can serve as both a therapeutic and diagnostic reagent.

  Diagnostic reagents can be administered by intravenous injection into the subject's body or by other routes as deemed appropriate. The dose of the reagent should be within the same range as that of the treatment method. Usually, the reagent is labeled, but in some methods, the primary reagent with affinity for monomeric, misfolded, aggregated, or fibrillar forms of TTR is unlabeled and a secondary labeling agent is added. Used to bind to the primary reagent. The choice of label depends on the detection means. For example, fluorescent labels are suitable for optical detection. The use of paramagnetic labels is suitable for tomographic detection without surgical intervention. Radioactive labels can also be detected using PET or SPECT.

  Diagnosis is performed by comparing the number, size, and / or intensity of the labeled site with the corresponding baseline value. The baseline value can be an average level in a population of unaffected individuals. The baseline value can also be a previously determined level for the same subject. For example, a baseline value in a subject can be determined prior to initiation of treatment, and the measured value can then be compared to the baseline value. A decrease in value relative to the baseline value generally indicates a positive response to treatment.

IX. Kits The present invention further provides kits (eg, containers) comprising the antibodies disclosed herein and materials associated therewith, eg, instructions for use (eg, package inserts). The instructions for use may include, for example, instructions for administration of the antibody and optionally one or more additional agents. The container of antibodies can be a unit dose, a bulk package (eg, a multiple dose package), or a small unit dose.

  The package insert is customarily included in the commercial packaging of the therapeutic product and includes instructions regarding the indications, usage, dosage, administration, contraindications and / or precautions for the use of such therapeutic products Point to.

  The kit can also include a second container containing a pharmaceutically acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate buffered saline, Ringer's solution and glucose solution. It may also include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.

X. Other Applications Antibodies can be used to detect monomeric, misfolded, aggregated, or fibrillar forms of transthyretin (TTR) or fragments thereof in clinical diagnosis, clinical therapy or research. For example, antibodies can be used to detect the presence of monomeric, misfolded, aggregated, or fibrillar forms of TTR in a biological sample as an indication that the biological sample contains TTR amyloid deposits. Antibody binding to the biological sample can be compared to antibody binding to a control sample. The control sample and the biological sample can contain cells originating from the same tissue. Control samples and biological samples can be taken on the same or different occasions from the same or different individuals. As needed, multiple biological samples and multiple control samples are evaluated on multiple occasions to protect against random fluctuations independent of differences between samples. The biological sample (s) and control sample (s) are then directly compared to bind the antibody to the biological sample (s) (ie, monomeric form, misfolded form). The presence of aggregated or fibrillar TTR) is increased, decreased or the same as the binding of the antibody to the control sample (s) . The increased binding of the antibody to the biological sample (s) relative to the control sample (s) indicates that the monomeric form, misfolds in the biological sample (s) The presence of morphological, aggregated, or fibrillar forms of TTR is indicated. In some cases, the increase in antibody binding is statistically significant. Optionally, antibody binding to the biological sample is at least 1.5 times, 2 times, 3 times, 4 times, 5 times, 10 times, 20 times, or 100 times higher than the binding of the antibody to the control sample.

  In addition, antibodies can be used to monitor and evaluate the effectiveness of therapeutic agents used to treat patients diagnosed with TTR amyloidosis, in monomeric forms, misfolded forms, aggregated forms, Alternatively, the presence or absence of fibril form TTR can be detected. Prior to initiating treatment with a therapeutic agent, a biological sample from a patient diagnosed with TTR amyloidosis is evaluated to determine the baseline value of antibody binding to the sample (ie, monomeric, misfolded, Set baseline value when aggregated or fibrillar form of TTR is present. In some cases, multiple biological samples from a patient are evaluated on multiple occasions to set both baseline values and measures of random variation independent of treatment. The therapeutic agent is then administered according to the regimen. The regimen may include repeated administration of the drug over a period of time. Optionally, antibody binding in multiple biological samples from the patient (ie, the presence of monomeric, misfolded, aggregated, or fibrillar TTR) is evaluated on multiple occasions to generate random To measure trends and to identify trends in response to immunotherapy. Various assessments of antibody binding to the biological sample are then compared. If only two assessments are performed, the two assessments are directly compared and antibody binding (ie, presence of monomeric, misfolded, aggregated or fibrillar TTR) You can decide whether it has increased, decreased, or remained the same. When the evaluation is carried out three times or more, the measured value can be analyzed as a change over time starting from the treatment with the therapeutic agent and progressing through the treatment process. In patients with reduced binding of the antibody to the biological sample (ie, the presence of monomeric, misfolded, aggregated, or fibrillar TTR), the therapeutic agent is effective in treating TTR amyloidosis in the patient Can be concluded. The decrease in antibody binding can be statistically significant. Optionally, the binding is at least 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, Decrease by 90% or 100%. Assessment of antibody binding can be performed along with assessment of other signs and symptoms of TTR amyloidosis.

  The hybridoma cell line producing the monoclonal antibody 9D5 was deposited on April 4, 2017, American Type Culture Collection 10801 University Boulevard Manassas, VA 20110 USA, accession number PTA-1224078, which was deposited with the Budapest Treaty.

  A hybridoma cell line producing the monoclonal antibody 14G8 was deposited on April 4, 2017, American Type Culture Collection 10801 University Boulevard Manassas, VA 20110 USA, accession number PTA-124079, which was deposited with the Budapest Treaty.

  The antibodies can also be used as research reagents for research in detecting monomeric, misfolded, aggregated, or fibrillar forms of TTR or fragments thereof. In such applications, the antibody can be labeled with a fluorescent molecule, spin-labeled molecule, enzyme, or radioisotope and provided in the form of a kit containing all reagents necessary to perform a detection assay. The antibody may also be in a monomeric, misfolded, aggregated, or fibrillar form of TTR, or a monomeric, misfolded, aggregated, or fibrillar form of a TTR binding partner, eg, by affinity chromatography. Can be used to purify.

  The antibodies also inhibit or reduce TTR aggregation in biological samples, inhibit or reduce TTR fibril formation, reduce or eliminate TTR deposits or TTR aggregates, or stabilize the non-toxic conformation of TTR. Can be used for. A biological sample can include, for example, blood, serum, plasma, or tissue (eg, tissue from the heart, peripheral nervous system, autonomic nervous system, kidney, eyeball, or gastrointestinal tract). In some cases, TTR aggregation, TTR fibril formation, or TTR deposition is at least 10%, 20%, 25%, 30%, 40%, 50%, or 75% (eg, 10% to 75% or 30% to 70%) is inhibited or reduced. Assays for detecting fibril formation are described elsewhere herein. See also US Patent Application Publication No. 2014/0056904.

  Any patent applications, websites, other publications, accession numbers, etc. cited above or later may be specifically and individually stated that each individual item is incorporated by reference for all purposes. Incorporated as if When associating different versions of a sequence with accession numbers at different times, the versions associated with the accession numbers as of the effective filing date of the present application. The effective filing date means the earlier of the actual filing date or the filing date of the priority application with respect to the corresponding accession number. Similarly, if the publication time of publications, websites, etc. varies from version to version, it shall be the latest version as of the effective filing date of this application, unless otherwise specified. Unless otherwise stated, any feature, step, element, embodiment, or aspect of the invention can be used in combination with any other. So far, the invention has been described in some detail by way of illustration and example for the purpose of clearly illustrating and understanding the invention, but it is understood that any changes and modifications may be made within the scope of the appended claims. It will be clear.

Examples Example 1 Identification of Mis-TTR Monoclonal Antibodies Conformational Specific Monoclonal Antibodies Against Monomeric, Misfolded, Fibrous, or Aggregated Forms of TTR (mis-TTR) as described in Materials and Methods (ad) Were made, screened, expressed and purified. In order to produce a mis-TTR monoclonal antibody, the crystal structure of human tetramer TTR was examined, and the protein region that was buried in the tetramer but exposed when the tetramer was dissociated into monomeric subunits Revealed. The region identified was residues 89-97 (EHAEVVFTA) (SEQ ID NO: 113) located within the F chain of TTR and segregated at the dimer interface of the tetrameric protein. A BLAST search of the protein database was performed, and no other human protein with this sequence was found.

  A peptide containing this sequence (ggEHAEVVFTAggkg) (SEQ ID NO: 114) was synthesized. Uppercase letters represent residues 89-97 of TTR. Lower case letters represent additional linker residues added to increase the solubility of the antigenic peptide and establish a 9 amino acid fragment as an internal sequence. This peptide was linked to a poly-lysine dendritic core to create a multi-antigenic peptide immunogen (TTR-MAP) containing a core of lysine residues and multiple branches linked to the TTR89-97 peptide. The antibodies listed in Table 2 were prepared against TTR-MAP.

  In addition to this multi-antigenic peptide, similar TTR89-97 peptides (Ac-cggEHAEVVFTA-amide (SEQ ID NO: 115) and Ac-EHAEVVFTAcgg-amide (SEQ ID NO: 116)) via N-terminal and C-terminal cysteine residues Were linked to keyhole limpet hemocyanin to generate two additional immunogens containing the same TTR fragment (TTR89-97-N-KLH and TTR89-97-C-KLH).

After generating, screening, expressing and purifying the antibodies, detailed binding kinetic parameters of the lead mis-TTR antibody (SPR) by surface plasmon resonance (SPR) against recombinant human TTR F87M / L110M as shown in Table 2 ( The binding rate (k _a ), dissociation rate (k _d ), and binding affinity constant (K _D )) were determined. Anti-mouse IgG (GE Healthcare) was immobilized on sensor chip C5 (lack of dextran chain) by amine coupling according to the instructions attached to the GE Healthcare anti-mouse kit, and the mis-TTR mAb was analyzed. Capturing was performed to a level where the binding maximum of the object was reliably 30-50 RU. Various concentrations of analyte (recombinant human TTR F87M / L110M) are passed over the ligand captured at 30 μl / min in running buffer (HBS + 0.05% P-20, 1 mg / mL BSA) at 3-fold dilution I let you. For each concentration, the reaction was allowed to proceed for a time such that a higher concentration of analyte reached equilibrium at the time of association and at least 10% of the signal decayed upon dissociation. At least one concentration (not the highest or lowest concentration) was performed in duplicate. Concentration range of the analyte was chosen to over one-tenth of the 10-fold ~K _D of at least K _D based on preliminary experiments.

  The results of SPR analysis of the lead mis-TTR mAb are shown in Table 2 below.

Example 2 Binding of mis-TTR antibody to TTR antigen Four types of lead mis-TTR mAbs (9D5, 14G8, 6C1 and 5A1) were treated with pH 4.0 as a coating antigen at concentrations ranging from 0.31 to 2.5 μg / ml. Assayed by ELISA using both TTR (pH4-TTR) and native TTR. TTR antigen preparation and ELISA protocols are described separately in Materials and Methods (eg).

The resulting binding curves and tabular K _d and B _max values are shown in FIG. 3 and Table 3 below. The results of FIG. 3 are expressed in arbitrary units (au) on the y-axis. All mAbs showed significant binding to pH4-TTR with a _Kd value range of 16 nM (6C1) to 282 nM (9D5). The B _max value for binding to pH4-TTR is a minimum value of 0.65 a. u. It was in the range of (14G8) to the maximum value 2.02 (9D5). In contrast to binding to pH4-TTR, no antibody showed significant binding to native TTR, suggesting that all TTR antibodies generated were specific for the non-native form of TTR.

Example 3 FIG. Analysis of mis-TTR antibodies by SDS-PAGE and native PAGE 9D5 and 14G8 were analyzed by SDS-PAGE / Western to show the binding specificity for monomeric / denatured forms of TTR compared to native TTR. SDS-PAGE, native PAGE, and Western blot protocols are described separately in Methods and Materials (hj).

  Non-denaturing TTR or pH4-TTR was run side by side with heat-denatured TTR and heat-denatured pH4-TTR on an SDS-PAGE gel. After electrophoresis, the gel was Western blotted onto nitrocellulose and stained with TTR mAbs 9D5 and 14G8. Both antibodies recognized only TTR when TTR was treated with pH 4 or when TTR or pH 4-TTR was first heat denatured prior to performing SDS-PAGE. Thus, these 9D5 and 14G8 show specificity for TTR conformers made by denaturing TTR or treating TTR at pH 4.

  6C1 and 5A1 and all TTR mAbs (7G7, 8C3) and commercially available polyclonal antibodies from Sigma were also analyzed by SDS-PAGE / Western. Each blot contained a stained molecular weight marker, native TTR, and pH4-TTR.

  From the stained SDS-PAGE gel it was found that the major species present in the native TTR sample was a dimer of about 38 kDa. In contrast, the major components present in the pH4-TTR sample migrated as a small dimer consisting of a dimer of about 35 kDa and a monomer of about 15 kDa. This dimer migrates as a slightly smaller protein than the dimer present in the native TTR sample, suggesting that there is a difference in the conformation of these two TTR dimer species.

  From Western blots of TTR and pH4-TTR with four different mis-TTR antibodies, these mAbs do not recognize native TTR, but both denatured monomers and dimers present in pH4-TTR samples. It turns out that they combine. Thus, the four mis-TTR mAbs (9D5, 14G8, 6C1, and 5A1) show similar specificity for the non-natural conformation of TTR when analyzed by SDS-PAGE / Western.

  In contrast to the four mis-TTR mAbs, two TTR control mAbs, 7G7 and 8C3, generated by immunizing mice with intact TTR, are TTR samples and pH4- containing tetrameric TTR species. All TTR species present in the TTR sample were recognized. Thus, unlike mis-TTR mAbs, these control mAbs bind TTR but are not conformational specific. The Sigma polyclonal antibody behaved similarly to the control mAbs 7G7 and 8C3.

  TTR and pH4-TTR were also run on a native gel to confirm whether the four mis-TTR mAbs can exhibit conformational specificity under native gel conditions. On the stained native PAGE gel, TTR migrated as a natural dimer and a small amount of tetramer of about 35 kDa. In contrast, pH4-TTR migrated mainly as a high molecular weight smear and a trace amount of about 35 kDa dimer. Sigma's non-specific polyclonal antibody recognized all TTR species present in both TTR and pH4-TTR samples. In contrast, 9D5 recognized only the high molecular weight TTR species present in the pH4-TTR sample. As observed in SDS-PAGE / Western experiments, 9D5 did not recognize any native TTR species.

  All four mis-TTR mAbs were then analyzed by native PAGE / Western blot. As expected, as with 9D5, other mis-TTR mAbs, namely 14G8, 6C1, and 5A1, specifically bound to the high molecular weight non-natural form of TTR present in the pH4-TTR sample. None of the above antibodies recognized the native TTR dimer of about 35 kDa. The above results suggest that the four types of mis-TTR mAb behave similarly and only recognize non-natural TTR species that differ in conformation from natural TTR.

Example 4 Inhibition of TTR fibril formation by mis-TTR antibody TTR-Y78F is a TTR variant containing a point mutation that destabilizes the TTR tetramer at position 78 in the protein sequence. This TTR variant can dissociate into its monomeric subunits over time and under mildly acidic conditions, and then aggregate to form fibrils that can bind to thioflavin T. Therefore, the degree of fibril formation can be monitored by measuring the fluorescence of thioflavin T at 480 nm. It is considered that introduction of a specific mis-TTR antibody into dissociated TTR monomer or aggregate prevents TTR fiber assembly and reduces thioflavin T fluorescence as compared to antibody-free control reaction. A protocol for studying inhibition of TTR fibril formation is described separately in Materials and Methods (k).

  All four mis-TTR antibodies strongly inhibited the formation of thioflavin T-reactive TTR-Y78F fibrils compared to the isotype control. The results are shown in arbitrary units (au) on the y-axis of FIG. The mis-TTR antibody 5A1 almost completely inhibited fibril formation. These results are consistent with the idea that mis-TTR antibodies bind monomeric and / or aggregated forms of TTR, thereby preventing TTR fiber formation.

Table 4 summarizes the characterization data obtained from a set of four mis-TTR antibodies (9D5, 14G8, 6C1, and 5A1) that showed excellent conformational selectivity to the non-native form of TTR. These antibodies have an affinity (K _D ) range of 14.5 nM (6C1) to 257 nM (9D5) for pH4-TTR and a B _max value range of 0.65 a. u. (14G8) to 2.02 (9D5). None of the antibodies recognized native TTR, but bound to pH4-TTR with SDS-PAGE / Western and bound to high molecular weight TTR aggregates with Native PAGE / Western. The above antibodies also inhibited TTR fibril formation in a fibril formation assay using thio-T as a readout.

TTR-V122I is a TTR variant containing a single point mutation that destabilizes the tetramer at position 122. Fibril formation was associated with increased ThT fluorescence. Increasing 14G8 mAb monotonically decreased ThT fluorescence, suggesting substoichiometric inhibition of TTR fibril formation (IC ₅₀ = 0.028 ± 0.009 mg / mL; n = 3; FIG. 4B and table) 4a). The isotype control mAb did not inhibit TTR fibril formation (FIG. 4C), suggesting the specificity of 14G8-mediated inhibition.

Equivalent substoichiometric IC ₅₀ values (Table 4a) determined for 5A1 and 6C1 suggested a similar fibrillar inhibition mechanism for each of these mis-TTR mAbs. In contrast, 9D5 showed similar specificity and affinity for non-natural TTR, but could not unexpectedly inhibit fibril formation of TTR-V122I. It is necessary to investigate in the future whether 9D5 is more sensitive to the assay conditions used.

Embodiment 5 FIG. Immunohistochemical (IHC) characterization of ATTR tissue using a mis-TTR mAb Read mis-TTR mAb generated against the TTR89-97 fragment of transthyretin protein was obtained fresh from patients with established TTR cardiac amyloidosis. Immunohistochemistry was examined using fresh frozen tissue and paraffin-treated tissue. The collection and preparation of heart tissue samples, immunohistochemistry (IHC), and image analysis protocols are described separately in Materials and Methods (l-o). The antibodies used for IHC are listed in Table 5.

Heart tissue samples were collected from patients with a confirmed diagnosis of ATTR mutation. The background of the cases that underwent immunohistochemistry was summarized in Table 6 below: FAC = familial amyloidosis cardiomyopathy; FAP = familial amyloidosis polyneuropathy; 1 ^o AL = light chain amyloidosis; ATTR = Amyloidosis caused by transthyretin; Unk = unknown

  A murine monoclonal antibody (mis-TTR mAb) raised against the 89-97 fragment of transthyretin protein was purified using immunohistochemistry using fresh frozen tissue and paraffin-treated tissue from patients with established TTR cardiac amyloidosis. Were examined. Each of the mis-TTR antibodies showed strong immunoreactivity against ATTR heart tissue. Dark staining was observed in deposits throughout the myocardium and vasculature. When immunoreactivity was compared to staining with thioflavin T with Congo red, most of the immunoreactivity in the tissues showed high agreement with Congo red birefringence and thioflavin T positive staining. This confirms that the TTR amyloid deposited in this tissue has the properties of a beta pleated sheet. 14G8, 9D5, 6C1, and 5A1 also detected pro-amyloid TTR present in areas of the myocardium that are TTR immunopositive but negative for both Congo red and thioflavin T. Both IgG-isotype control antibody sections and sections omitting the primary antibody were negative for staining across all test tissues. Antibodies that responded to other amyloid proteins (lambda light chain and kappa light chain or amyloid A) did not react to the ATTR heart tissue used in this analysis, and the deposit was inherently specific. This suggests that it was TTR.

  The staining pattern of the mis-TTR antibody was compared to that obtained using a well-characterized commercial TTR reference antibody (Prealbumin, A0002; Dako; Carpinteria, CA). The DAKO reference antibody stained the affected myocardium in the same area as the mis-TTR antibody, but a more scattered staining pattern was obtained. The DAKO reference antibody did not stain Congo red affinity TTR amyloid deposits present in the vasculature as strongly as the mis-TTR antibody.

  The mis-TTR antibody did not stain normal unaffected tissue. Furthermore, as expected, staining with isotype control antibody 6F10 was also negative.

  To elucidate whether the reactivity of the mis-TTR antibodies is specific to TTR deposits, the cross-reactivity of these antibodies to heart tissue from patients diagnosed with primary AL amyloidosis was examined. As expected, no staining of AL amyloid tissue was observed, confirming that TTR antibody reacts specifically with ATTR affected tissue.

  Heart tissue from patients diagnosed with senile systemic amyloidosis or from FAC or patients with confirmed FAP due to point mutations in the TTR gene are also 14G8, 9D5, 6C1, and 5A1. Stained positively. These results suggest that the mis-TTR antibody has the ability to recognize heart tissue TTR deposits regardless of ATTR genotype.

  Other non-cardiac tissues known to express TTR were also examined for staining with the mis-TTR antibody and compared with staining obtained using a DAKO reference antibody. As expected, the liver, pancreas and choroid plexus were all stained positive for TTR using the Dako reference antibody. In contrast, 14G8 stains only pancreatic alpha cells and choroid plexus on the islets of Langerhans, suggesting that some of the TTRs localized in these organs differ in three-dimensional structure from TTR expressed in the liver. . The lack of immunoreactivity of the mis-TTR mAb in the liver suggests that the TTR that is abundantly expressed in the liver is primarily tetrameric native TTR and does not have an exposed mis-TTR epitope. Yes. Similar results were obtained when the same tissue was stained with 9D5, 6C1, and 5A1.

Example 6 Comparative analysis of ATTR human plasma and normal human plasma by SDS-PAGE / Western blot and Meso Scale Discovery (MSD) plate assay Six plasma samples from patients with confirmed V30M ATTR (sample numbers 11, 12, 15, 18, 19, 20) and 6 samples from normal subjects (Nos. 21, 22, 23, 24, 25, 27). Obtained from Mr. Saraiva (University of Porto, Portugal). Sample number C6 is a normal human serum sample obtained from a commercial source (Bioreclamation IVT). Samples were analyzed by SDS-PAGE and Western blot or by MesoScale Discovery (MSD) plate assay. The protocols for these assays are described separately in Materials and Methods (pr). A standard curve for the MSD plate assay was generated using 6C1.

  Western blots using 9D5 mis-TTR mAb and 5A1 mis-TTR mAb were able to detect differences in banding patterns between normal and TTR-V30M affected plasma samples. All plasma samples contained an approximately 14 kDa TTR band that co-migrated with the unnatural TTR monomer present in the pH4-TTR reference sample. Overall, more of this monomeric mis-TTR species was found in plasma samples from TTR-V30M patients (numbers 21, 22, 23, 24, 25 and 27). In addition, the plasma sample from the V30M patient also contained an approximately 30 kDa band that co-migrated with the unnatural TTR dimer present in the pH4-TTR reference sample. In plasma samples from normal individuals, except for sample numbers 12 and 18, this dimeric species was less.

  The Western blot was scanned and the total intensity of 9D5-reactive TTR or 5A1-reactive TTR dimer and monomer bands was plotted for each sample. The results are shown in arbitrary units (au) on the y-axis of FIGS. 5A (9D5) and 5B (5A1). Plasma samples from normal individuals (11, 12, 19 and 20), except plasma sample numbers 15 and 18, were 9D5 and 5A1 reactive dimeric species and samples from V30M patients (21-25 and 27) and Contained less monomeric species.

  Twelve serum samples analyzed by Western blot of 9D5 and 5A1 were also analyzed by MSD plate assay using 6C1 as the mis-TTR capture antibody and Dako-SulfoTag antibody as the detection antibody. The results of these MSD assays are shown in arbitrary units (au) on the y-axis of FIG. Samples 11, 12, 15, 18, 19, and 20 represent normal plasma. Samples 21-25 and 27 represent V30M affected plasma.

  The amount of 6C1-reactive TTR present in plasma samples from normal individuals was less than that observed in plasma from individuals with TTR-V30M, with the exception of plasma sample numbers 15 and 18. The level of 6C1 reactivity measured by the MSD assay correlated very well with the amount of 9D5 reactive dimer and monomer observed above by SDS-PAGE / Western.

  To determine the concentration of reactive TTR species present in the plasma sample, the same sample was re-assayed using 6C1 as the capture antibody and 8C3-SulfoTag as the detection antibody. MSD signals were converted to ng / ml concentrations of reactive TTR species using the TTR F87M / L110M standard curve generated above. Based on this analysis, the average concentration of 6C1 reactive TTR present in the control sample was 271 +/− 185 ng / ml. In contrast, the average concentration of reactive TTR present in V30M diseased plasma samples was higher, 331 +/− 95 ng / ml. Considering the above MSD results, it is suggested that the mis-TTR antibody can distinguish ATTR disease plasma from normal plasma. This is the basis for further development of mis-TTR antibodies for use in diagnostic tests for ATTR diseases.

Example 7 Design of humanized 9D5 antibody The starting point for humanization, the donor antibody, was the murine antibody 9D5. The heavy chain variable amino acid sequence of mature m9D5 is represented by SEQ ID NO: 1. The light chain variable amino acid sequence of mature m9D5 is represented by SEQ ID NO: 16. The amino acid sequences of heavy chain CDR1, CDR2, and CDR3 are represented by SEQ ID NOs: 13-15, respectively (defined by Kabat). The Chothia-Kabat CDR-H1 complex is represented by SEQ ID NO: 117. The amino acid sequences of light chain CDR1, CDR2, and CDR3 are represented by SEQ ID NOs: 24-26, respectively (defined by Kabat). Kabat numbering is used throughout this example.

  The variable kappa (Vk) of m9D5 belongs to mouse Kabat subgroup 2 corresponding to human Kabat subgroup 3. The variable heavy chain (Vh) of m9D5 belongs to mouse Kabat subgroup 3d corresponding to Kabat subgroup 3. Kabat et al., Sequences of Proteins of Immunological Interest, 5th edition. NIH Publication No. See 91-3242, 1991. In Vk, 16-residue CDR-L1 belongs to canonical class 4, 7-residue CDR-L2 belongs to canonical class 1, and 9-residue CDR-L3 belongs to canonical class 1. Martin and Thornton, J.M. Mol. Biol. 263: 800-15, 1996. The 10-residue Chothia-Kabat CDR-H1 complex belongs to canonical class 1 and the 17-residue CDR-H2 belongs to canonical class 1. Martin and Thornton, J Mol. Biol. 263: 800-15, 1996. There is no canonical class in CDR-H3.

  The residue at the interface between the Vk domain and the Vh domain is a commonly found residue, except that Leu is at position 47 of the heavy chain, and Tyr is usually present at the above position. This position is one of the candidates for back mutation.

  In order to find a structure that could be a rough structural model of 9D5, the protein sequence of the PDB database was searched (Deshpande et al., Nucleic Acids Res. 33: D233-7, 2005). Since the structure of Vk is excellent in resolution (1.22A) and the entire sequence is similar to 9D5 Vk and retains the canonical structure of the same loop as 9D5, the crystal structure of antibody fab (pdb code 1MJU) (Ruzheinikov et al., J. Mol. Biol. 332 (2): 423-435, 2003) was used. The structure of Vh is excellent in sequence similarity and resolution (2.0 A), and has the same canonical structure of CDR-H1 and CDR-H2 as that of 9D5 VH. Therefore, the monomeric antibody (Covaceuszach) of pdb coding 1SEQ Et al., Acta Crystallogr.D Biol.Crystallogr.57 (PT9), 1307-1309, 2001). Since the 1 MQK structure has an even better resolution of 1.28 A (Ostermeier et al., Proteins 21 (1): 74-77, 1995), this was also used to model the 9D5 Vh chain. BioLuminate software (licensed by Schrodinger) was used to model the rough structure of 9D5.

  By searching NCBI's non-redundant protein sequence database, a human framework suitable for transplanting mouse CDRs could be selected. For Vh, human Ig heavy chain BAC02114 (GI: 21670209) (SEQ ID NO: 3) was selected (Akahori et al., Construction and charitable of antibiotic ligands: isolation of the therapeutic population. 2001). This heavy chain has the same canonical form as 9D5. It is a member of Kabat human heavy chain subgroup 1. 9D5 Vh had some unique framework residues and none of the human framework acceptors showed very high homology. Therefore, a hybrid acceptor framework is also produced using the second framework, AAX82494 (GI: 62421461) (SEQ ID NO: 4) (Lundquist et al., Infect. Immun. 74 (6), 3222-3231, 2006). did. The human kappa light chain (GI: 84798006) (Shriner et al., Vaccine 24 (49-50): 7159-7166, 2006) with NCBI accession code ABC66952 was selected for Vk (SEQ ID NO: 18). This light chain has the same canonical class of CDR-L1 and CDR-L2 as that of the parent Vk. It is a member of Kabat human kappa subgroup 2.

  Eight humanized heavy chain variable region variants and five humanized light chain variable region variants were constructed containing various permutations (Hu9D5VHv1, 2, 2b, 3, 3b, 4, 4b, and 5 (sequences respectively). No. 5-12) and Hu9D5VLv1-5 (SEQ ID NO: 19-23, respectively)) (Tables 7 and 8). Exemplary humanized Vh and humanized Vk designs with back mutations and other mutations based on the selected human framework are shown in Tables 7 and 8, respectively. The gray shaded areas in the first column in Tables 7 and 8 indicate the CDRs defined by Chothia, and the gray shaded areas in the remaining columns in Tables 7 and 8 are defined by Kabat. Shows the CDRs to be performed. SEQ ID NOs: 5-12 and 19-23 contain back mutations and other mutations as shown in Table 9. Hu9D5VHv1, 2, 2b, 3, 3b, 4, 4b, and 5 and Hu9D5VLv1 to 5 are H42, H47, H69, H82, H82 (b), H108, L8, L9, L18 The amino acids at positions L19, L36, L39, L39, L60, L70, and L74 are listed in Tables 10 and 11.

  Mouse 9D5 Vh sequence (SEQ ID NO: 1) and mouse model sequence (1SEQ_H and 1MQK_H; SEQ ID NO: 2 and 62, respectively), human acceptor sequence (BAC02114 and AAX82494; SEQ ID NO: 3 and 4 respectively), and Hu9D5VHv1, Hu9D5VHv2, Hu9D5VHv2b, The alignment with the Hu9D5VHv3, Hu9D5VHv3b, Hu9D5VHv4, Hu9D5VHv4b, and Hu9D5VHv5 sequences (SEQ ID NOs: 5-12, respectively) is shown in FIG. 1A. The CDR defined by Kabat is surrounded by a square, but the part enclosed by the first square is a complex of Chothia CDR-H1 and Kabat CDR-H1, and the underlined bold part is Kabat CDR. -H1. Positions where canonical, vernier, or interfacial residues differ between the mouse and human acceptor sequences are candidates for substitution. Examples of vernier / CDR base residues include residues 2, 49, 69, 71, 75, 80, and 94 according to Kabat numbering in Table 7. Examples of canonical / CDR interacting residues include residues 24, 48, and 73 according to Kabat numbering in Table 7. Examples of interface / packing (VH + VL) residues include residues 37, 39, 44, 47, 91, 93, and 103 according to Kabat numbering in Table 7.

  Mouse 9D5 Vk sequence (SEQ ID NO: 16) and mouse model sequence (1MJU_L; SEQ ID NO: 17), human acceptor sequence (ABC66952; SEQ ID NO: 18) and Hu9D5VLv1, Hu9D5VLv2, Hu9D5VLv3, Hu9D5VLv4, and Hu9D5VLv5 (sequences 19-19) The alignment with 23) is shown in FIG. 1B. The CDR defined by Kabat is surrounded by a square. The part enclosed by the first square is a complex of CDR-H1 and Kabat CDR-H1, and the underlined bold part is Kabat CDR- H1. Positions where canonical, vernier, or interfacial residues differ between the mouse and human acceptor sequences are candidates for substitution. Examples of vernier / CDR base residues include residues 4, 35, 46, 49, 66, 68, and 69 according to Kabat numbering in Table 8. Examples of canonical / CDR interacting residues include residues 2, 48, 64, and 71 according to Kabat numbering in Table 8. Examples of interface / packing (VH + VL) residues include residues 36, 38, 44, 47, 87, and 98 according to Kabat numbering in Table 8.

  The reason for selecting the position in the light chain variable region shown in Tables 9 and 11 as a candidate for substitution is as follows.

  P8A: In this model, a twist was observed in the loop at this position. Therefore, a reversion to A was attempted to reduce this.

  L9P: In this model, a twist was observed in the loop at this position, so a reverse mutation to P was attempted to reduce this.

  P18S: P is infrequent at this position. Attempts were made to mutate S to reduce loop distortion.

  A19V: A and V have the same frequency at this position. In order to reduce the distortion of the loop, the mutation to V was tried.

  Y36F: This is one of the interface residues, usually Y or F. Y has an extra hydroxyl group that can affect LC + HC packing. The polarity of Y36 may interfere with the placement of residue H95 in heavy chain CRD-H3. The homology model shows that at this position Y can form a de-novo H bond with F100 (g) in H3, thereby limiting the mobility of H3. Both F and Y were used in separate versions.

  K39R: Compared to K, R forms an H bond with an adjacent residue in this loop. To eliminate the effect on loop stability, mutations to R were attempted.

  D60S: The presence of D at this residue increases the rate of exposure to proteolysis. In some versions, this was replaced with S, the most frequent residue at this position in the human germline. This is expected to increase stability.

  D70A: Since D has the possibility of proteolysis, the mutation to A was attempted.

  K74R: Since R seems to stabilize the loop compared to K at this position, we attempted a back mutation to R.

  The grounds for selecting the positions in the heavy chain variable regions shown in Tables 9 and 10 as candidates for substitution are as follows.

  G42E: E shows ionic interaction with R at position 44. In order to eliminate the possible effects of this interaction, several versions attempted backmutation to E.

  W47L: This is one of the interface residues, usually W. In the mouse 9D5 heavy chain this is L, whereas in the human acceptor framework there is a W at this position. Both L and W are non-polar, but the phenolic ring in W may affect light chain: heavy chain packing. W and L were included in separate versions.

  I69F: This is one of the vernier residues and is part of the foundation of CDR-H2. According to the homology model, the aromatic ring of F in the mouse sequence forms a pie stack with the aromatic ring of CRD-H2 residue Y59. At this position the I residue prevents its stacking. I and F were included in separate versions.

  M82S: In the human framework, it is very rare to have M at this position. A or N is more frequent. Changing this residue to the more frequent S would reduce the immunogenicity that would be associated with a rare M at this position. Based on model observations, M may interact with Leu80, the residue of the vernier zone. M and S were included in separate versions.

  S82 (b) L: S is present at this position in both the mouse framework sequence and the human framework sequence, but S is infrequent at this position. Judging from the position in the model where this residue is present, it may contact the antigen. Residues in heavy chain framework region 3 are known to contribute to binding. S and L were included in separate versions.

  Since T108L: L is the most frequently found residue at this position in the human framework, L was tried in several versions.

  Because two human acceptor frameworks (BAC02114 and AAX82494.1 (SEQ ID NOs: 3 and 4)) were used to humanize the 9D5 heavy chain variable region, these two acceptor frameworks have different amino acids There is a specific framework location. The humanized 9D5 heavy chain variable region may include any amino acid at these residues. Examples of residues that differ between the two types of acceptors include H19 position (R or K), H40 position (A or T), H44 position (G or R), H49 position (S or A) according to Kabat numbering, H77 position (S or T), H82a position (N or S), H83 position (R or K), H84 position (A or S), and H89 position (V or M). The basis for selecting one or the other amino acid at these positions is as follows.

  H19 (R or K): Since R and K exist in the two frameworks considered, each residue was tried in a separate version.

  H40 (A or T): Since A and T are present in the two frameworks considered, each residue was tried in a separate version.

  H44 (G or R): Since G and R are present in the two frameworks considered, each residue was tried in a separate version.

  H49 (S or A): This is one of the vernier residues packing under CDR-H2. A in the mouse sequence. Because S is slightly different in size and affinity, it may interfere with the foundation of the CDR. S and A were included in separate versions.

  H77 (S or T): Since S and T exist in the two types of human acceptor frameworks considered, each was tried in a separate version.

  H82a (N or S): N is much less frequent than S at this position. Furthermore, S appears to contribute to antigen binding. Several versions tried to mutate to S.

  H83 (R or K): K in framework region 3 is near the CDR binding surface region. Replacing this K with a bulkier R may hinder antigen placement. At this position in the human framework, R is the most frequent and K is the third most frequent. R and K were included in separate versions.

  H84 (A or S): Since S and A exist in the two frameworks considered, each residue was tried in a separate version.

  H89 (V or M): Since V and M exist in the two frameworks considered, each was tried in a separate version.

  The five humanized light chain variable region variants and the five humanized heavy chain variable region variants are as follows:

Hu9D5VL version 1 (Y36F substitution is shown in lower case):
DIVMTQSPLSLPPVTPGEPASISSCRSSKSLLLHSNGNTLYLYWfLQKPGQSPQLLLIYRVSNLAGSVPDRFSGSGGSDFTLKISRSREAEDVGVYYCMQHLEYPLTFFGQGTKLEIIK (SEQ ID NO: 19)

Hu9D5VL version 2 (no replacement):
DIVMTQSPLSLPPVTPGEPASISSCRSSKSLLLHSNGNTLYLYWYLQKPGQSPQLLLIYRVSNLAGSVPDRFSGSGGSDFTLKISRSREAEDVGVYYCMQHLEYPLTFFGQGTKLEIK (SEQ ID NO: 20)

Hu9D5VL version 3 (D60S substitution is shown in lower case):
DIVMTQSPLSLPPVTPGEPASISSCRSSKSLLLHSNGNTLYLYWYLQKPGQSPQLLLIYRVSNLAGSGVPsRFSGGSGTDFTLKISRVREAEDVGVYYCMQHLEYPLTFGQGTKLEIIK (SEQ ID NO: 21)

Hu9D5VL version 4 (P8A, L9P, A19V, Y36F, K39R, D60S, D70A, and K74R substitutions are shown in lower case):
DIVMTQSapSLPVTPGEPvSISCRSKSKSLLSNGSNTYLYWfLQrPGQSPQLLLIYRVSNLAGVPsRFSGGSGTAFTLrISRRVEAEDVGVYYCMQHLEYPLTFQQTKLEIK (sequence number 22)

Hu9D5VL version 5 (P8A, L9P, P18S, A19V, Y36F, K39R, D60S, D70A, and K74R substitutions are shown in lower case):
DIVMTQSapSLPVTPGEsvSISCRSSKSLLHSNGNTLYLYWfLQrPGQSPQLLLIYRVSNLAGSGVPsRFSGSGSGTaFTTLrISRVEEAEDVGVYYCMQHLEYPLTFQQTKLEIK (sequence number 23)

Hu9D5VH version 1 (W47L, I69F, and M82S substitutions are shown in lower case):
EVQLVESGGGLVQPGGSLRLSCAASGFFTFSSYTMSWVRQAPGKGLE1VAEIISNSGDDTTYYPDTVKRFFTfSRDNAKNSLYLQsNSLKAEDTAVYYCARHYYGGGGYGTGFTVSVGQGTTV

Hu9D5VH version 2 (W47L, I69F, M82S, and S82 (b) L substitutions are shown in lower case):
EVQLVESGGGLVQPGGSLRLSCAASGFFTSSYTMSWVRQAPGKGLElVAEIISNSGDDTTYYPDTVKGRFFTfSRDNAKNSLYLQsNlRAEDTAVYYCARHYYGGGGYGTVTVVGSQGTTV

Hu9D5VH version 2b (G42E, W47L, and T108L substitutions are shown in lower case):
EVQLVESGGGLVQPGGSLKLSCAASGFTFSSYTMSWVRQTPeKRLElVAEIISNSGDTYTYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCARGYYGGGGFDVTVQGTLVTVSS

Hu9D5VH version 3 (I69F, M82S, and S82 (b) L substitutions are shown in lower case):
EVQLVESGGGLVQPGGSLRLSCCAASGFFTSSYTMSWVRQAPGKGLEWVSEISISNSGDTYTYPDTVKGRFFTfSRDNAKNSLYLQsNlRAREDTAVYYCARHYYGGGGYGGWFTVVWGQGTTVSS

Hu9D5VH version 3b (W47L and T108L substitutions are shown in lower case):
EVQLVESGGGLVQPGGSLKLSCAASGFFTSSYTMSWVRQTPGKRLE1VAEIISNSGDDTTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCARHYYGGGGYVGVTG9TV

Hu9D5VH version 4 (M82S and S82 (b) L substitutions are shown in lower case):
EVQLVESGGGLVQPGGSLRLSCAASGFFTFSYTMSWVRQAPGKGLEWVSEIISNSGDTYTYPDTVKGRFTISRDNAKNSLYLQsNlRAREDTAVYYCARHYYGGGGYGGWFTVVWGQGTTVSS

Hu9D5VH version 4b (W47L and T108L substitutions are shown in lower case):
EVQLVESGGGLVQPGGSLKLSCAASGFFTFSSYTMSWVRQAPGKRLElVAEIISNSGDDTTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCARHYYGGGGYGGVTDVTGQGTLVTVSS

Hu9D5VH version 5 (G42E, W47L, and S82 (b) L substitutions are shown in lower case):
EVQLVESGGGLVQPGGSLRLSCCAASGFFTSSYTMSWVRQTPeKRLElVAEIISNSGDTYTYYPDTVKGRFTISRDNAKNTLYLQMNlRAREDTAVYYCARHYYGGGGYGGFFTVVWGQGTTVSS

  Protein characterization and aggregability analysis showed that there was no clear cluster of residues prone to aggregation either in the 9D5 light or heavy chain framework regions or in the CDRs (Wang et al., MAbs 1 ( 3): 254-267, 2009).

Example 8 FIG. Analysis of binding kinetics of humanized 9D5 antibody As shown in Table 12, Biacore characterizes binding kinetics for binding to recombinant human TTR F87M / L110M for all humanized 9D5 variants, mouse 9D5, and chimeric 9D5 antibodies. Revealed. Anti-human (GE Healthcare) was immobilized on sensor chip C5 (devoid of dextran chain) by amine coupling according to the instructions attached to the GE Healthcare anti-human kit, and the mAb was bound to the maximum of the analyte. Was captured to a level that would definitely be 30-50 RU. Various concentrations of analyte (recombinant human TTR F87M / L110M) are passed over the ligand captured at 50 μl / min in running buffer (HBS + 0.05% P-20, 1 mg / mL BSA) at 3-fold dilution. I let you. For each concentration, the reaction was allowed to proceed for a time such that a higher concentration of analyte reached equilibrium at the time of association and at least 10% of the signal decayed upon dissociation. At least one concentration (not the highest or lowest concentration) was performed in duplicate. Concentration range of the analyte was chosen to over one-tenth of the 10-fold ~K _D of at least K _D based on preliminary experiments.

Table 12 shows the binding rate (k _a ), dissociation rate (k _d ), and binding affinity constant (K _D ) of mouse 9D5, chimeric 9D5, and humanized 9D5 variants to recombinant human TTR F87M / L110M determined by Biacore. To summarize.

The results listed above show that the affinity of mouse 9D5 for TTR-F87M / L110M (K _D = 1.82E-08M) is slightly improved with the chimeric 9D5 variant (K _D = 1.35E-09M). Indicates. Furthermore, all fully humanized 9D5 variants have comparable affinity in the low nM range. Of the tested humanized 9D5 variants, Hu9D5 H4L1 has the strongest affinity (K _D = 2.09E-09).

Example 9 Design of humanized 14G8 antibody The starting point for humanization, the donor antibody, was the murine antibody 14G8. The heavy chain variable amino acid sequence of T mature m14G8 is represented by SEQ ID NO: 61. The light chain variable amino acid sequence of mature m14G8 is represented by SEQ ID NO: 70. The amino acid sequences of heavy chain CDR1, CDR2, and CDR3 are represented by SEQ ID NOs: 67-69 (defined by Kabat), respectively. The Chothia-Kabat CDR-H1 complex is represented by SEQ ID NO: 118. The amino acid sequences of light chain CDR1, CDR2, and CDR3 are represented by SEQ ID NOs: 77-79, respectively (defined by Kabat). A variant version of CDR1 is represented by SEQ ID NO: 80. Kabat numbering is used throughout this example.

  The variable kappa (Vk) of m14G8 belongs to mouse Kabat subgroup 2 relative to human Kabat subgroup 2. The variable heavy chain (Vh) of m14G8 belongs to mouse Kabat subgroup 3d for Kabat subgroup 1. Kabat et al., Sequences of Proteins of Immunological Interest, 5th edition. NIH Publication No. See 91-3242, 1991. In Vk, 16-residue CDR-L1 belongs to canonical class 3, 7-residue CDR-L2 belongs to canonical class 1, and 9-residue CDR-L3 belongs to canonical class 1. Martin and Thornton, J.M. Mol. Biol. 263: 800-15, 1996. The 10-residue Chothia-Kabat CDR-H1 complex belongs to canonical class 1 and the 17-residue CDR-H2 belongs to canonical class 1. Martin and Thornton, J Mol. Biol. 263: 800-15, 1996. There is no canonical class in CDR-H3, but Shirai et al., FEBS Lett. According to the law of 455: 188-97 (1999), there may be a base twist in the 15 residue loop.

  Residues at the interface between the Vk and Vh domains are common residues except for L47, and the principal amino acid at this position is usually W.

  In order to find a structure that could be a rough structural model of 14G8, the protein sequence of the PDB database was searched (Deshpande et al., Nucleic Acids Res. 33: D233-7, 2005). As a model of the structure of Vk, a crystal structure of Fab (pdb 1MJU) having esterase activity was used. This is analyzed at a resolution of 1.22A and includes the same canonical structure as CDR-H1 and CDR-H2, and also includes the same length of CDR-H3 with a base twist. Anti-cytochrome C oxidase antibody 7E2 Fv fragment (pdb code 1 MQK_H) was used for the structure of Vh. This has a resolution of 1.28A and retains the same canonical structure of the loop as that of 14G8. BioLuminate software (licensed by Schrodinger) was used for rough structural modeling of 14G8.

  By searching NCBI's non-redundant protein sequence database, a human framework suitable for transplanting mouse CDRs could be selected. For Vh, human Ig heavy chains with NCBI accession codes AAD30410.1 and AAX82494.1 were selected. They share the canonical structure of 14G8 CDR-H1 and CDR-H2, and CDR-H3 of AAD30410.1 is expected to be 15 residues in length and have a base twist. For Vk, two human kappa light chains with NCBI accession codes ABA71374.1 and ABC669952.1 were selected. They have the same LCDR canonical class.

  Three types of humanized heavy chain variable region variants and three types of humanized light chain variable region variants were constructed (Hu14G8VHv1-3 (SEQ ID NOs: 64-66, respectively) and Hu14G8VLv1-3 (respectively SEQ ID NOs: 74-76)) (Tables 13 and 14). Exemplary humanized Vh and Vk designs with back mutations and other mutations based on the selected human framework are shown in Tables 13 and 14, respectively. The gray shaded areas in the first column in Tables 13 and 14 represent the CDRs defined by Chothia, and the gray shaded areas in the remaining columns in Tables 13 and 14 are defined by Kabat. Represents the CDR to be SEQ ID NOs: 64-66 and 74-76 contain back mutations and other mutations as shown in Table 15. The amino acids at positions H1, H3, H47, H105, L8, L9, L19, L26, L36, L60, and L70 of Hu14G8VHv1 to 3 and Hu14G8VLv1 to 3 are described in Tables 16 and 17 To do.

  Mouse 14G8 Vh sequence (SEQ ID NO: 61) and mouse model sequence (1 MQK_H; SEQ ID NO: 62), human acceptor sequences (AAD30410.1 and AAX82494.1; SEQ ID NOs: 63 and 4 respectively), and Hu14G8VHv1, Hu14G8VHv2, and Hu14G8VHv3 sequences The alignment with (SEQ ID NOs: 64-66, respectively) is shown in FIG. 2A. The CDR defined by Kabat is surrounded by a square, but the part enclosed by the first square is a complex of Chothia CDR-H1 and Kabat CDR-H1, and the underlined bold part is Kabat CDR. -H1. Candidates for substitution are positions where canonical, vernier, or interface residues differ between the mouse and human acceptor sequences. Examples of vernier / CDR base residues include residues 2, 49, 69, 71, 75, 80, and 94 according to Kabat numbering in Table 13. Examples of canonical / CDR interacting residues include residues 24, 48, and 73 according to Kabat numbering in Table 13. Examples of interface / packing (VH + VL) residues include residues 37, 39, 44, 47, 91, 93, and 103 according to Kabat numbering in Table 13.

  Mouse 9D5 Vk 14G8 (SEQ ID NO: 70) and mouse model sequence (1MJU_L; SEQ ID NO: 71), human acceptor sequences (ABA713744.1 and ABC669952.1; SEQ ID NOs: 72 and 73, respectively), and Hu14G8VLv1, Hu14G8VLv2, Hu14G8VLv3 sequences ( Each alignment with SEQ ID NOs: 74-76) is shown in FIG. 2B. The CDR defined by Kabat is surrounded by a square, but the part enclosed by the first square is a complex of Chothia CDR-H1 and Kabat CDR-H1, and the underlined bold part is Kabat CDR. -H1. Candidates for substitution are positions where canonical, vernier, or interface residues differ between the mouse and human acceptor sequences. Examples of vernier / CDR base residues include residues 4, 35, 46, 49, 66, 68, and 69 according to Kabat numbering in Table 14. Examples of canonical / CDR interacting residues include residues 2, 48, 64, and 71 according to Kabat numbering in Table 14. Examples of interface / packing (VH + VL) residues include residues 36, 38, 44, 47, 87, and 98 according to Kabat numbering in Table 8.

  The reason for selecting the position of the light chain variable region shown in Tables 15 and 17 as a candidate for substitution is as follows.

  P8A: Proline is crucial for conformation, and deletion or gain of proline can affect the structure. A reverse mutation was designed to avoid “proline gain”. However, since A at this position is rare in the human IgG framework, some versions included P.

  L9P: proline is critical for conformation, and deletion or gain of proline can affect the structure. Back mutations were designed to avoid “proline deletion”. However, since P at this position is rare in the human IgG framework, some versions included L.

  A19V: A and V have almost the same frequency in the human framework. Both residues were included in separate versions.

  N26S: L26 represents the N-glycosylation site in the light chain CDR1. Mutation to S suppresses N-glycosylation, resulting in a more heterogeneous product.

  Y36F: This is one of the interface residues. In some versions, substitutions were made to retain mouse residues at this interface residue position.

  D60S: D and S have approximately the same frequency in the human IgG framework. Since S is used in most commercially available therapeutic antibodies, D was replaced with S in some versions.

  D70A: D is much more frequent than A in the human IgG framework. However, since D can form an ionic bond with R24 in the light chain CDR1, both A and D were included in separate versions.

  The grounds for selecting the positions of the heavy chain variable regions shown in Tables 15 and 16 as substitution candidates are as follows.

  Q1E: Conversion from glutamic acid (E) to pyroglutamic acid (pE) occurs more slowly than conversion from glutamine (Q). Conversion to pE makes the antibody more acidic because the primary amine in glutamine is lost. Incomplete conversion results in heterogeneity in the antibody, which can be observed as multiple peaks using charge-based analytical methods. Differences in heterogeneity can indicate a lack of process control.

  Q3K: Q is more frequent in the human IgG framework. K is less frequent but not uncommon. Both residues were included in separate versions.

  W47L: This is one of the interface residues. In some versions, substitutions were made to retain mouse residues at this interface residue position.

  Q105T: Because T can form hydrogen bonds with K3, some versions included T to maintain the VH conformation.

  Two human acceptor frameworks (ABA 71374.1 and ABC669952.1 (SEQ ID NOs: 72 and 73, respectively)) were used for humanization of the 14G8 light chain variable region, so the two acceptor frameworks differ There are certain framework positions with amino acids. The humanized 14G8 light chain variable region can include any amino acid at these residues. An example of a residue that differs between the two types of acceptors is the L18 position (S or P) according to Kabat numbering. The basis for selecting one or the other amino acid at this position is as follows.

  L18 (S or P): P is less frequent at this position. In order to reduce loop distortion, mutation to S was attempted.

  Since two human acceptor frameworks (AAD30410.1 and AAX82494.1 (SEQ ID NOs: 63 and 4, respectively)) were also used as acceptor sequences for humanization of the 14G8 mature heavy chain variable region, these two acceptors There are certain framework positions that have different amino acids in the framework. The humanized 14G8 heavy chain variable region may contain any amino acid at these residues. Examples of residues that differ between the two acceptors include Kabat numbered positions H82a (N or S), H83 (R or K), H84 (A or S), and H89 (V or M). Is mentioned. The basis for selecting one or the other amino acid at these positions is as follows.

  H82a (N or S): The frequency of N and S in 82a is almost the same. These are also human residues in the two human VH templates. S and N were included in separate versions.

  H83 (R or K): K in framework region 3 is near the CDR binding surface region. Replacing K with R may interfere with antigen placement. At this position in the human framework, R is the most frequent and K is the third most frequent. R and K were included in separate versions.

  H84 (A or S): Since S and A exist in the two frameworks considered, each residue was tried in a separate version.

  H89 (V or M): Since V and M exist in the two frameworks considered, each was tried in a separate version.

  The three humanized light chain variable region variants and the three humanized heavy chain variable region variants are as follows:

Hu14G8VL version 1 (replacement of P8A, L9P, A19V, Y36F, D70A in lower case):
DIVMTQSapSLPVTPGESvSISSCRSNSKLSNGNTLYLYWfLQKPGQSPQLLLIYRVSNLAGSVPDRFSGSGSTaFTLKISRVEAEDVGVYYCMQHLEYPLTFGQGTKLEIIKR (SEQ ID NO: 74)

Hu14G8VL version 2 (L36F substitution is shown in lower case):
DIVMTQSPLSLPPVTPGEPASISSCRSNKSLLLHSNGTYLYWfLQKPGQSPQLLLIYRVSNLAGSVPDRFSGSGSGDFTLKISRSREAEDVGVYYCMQHLEYPLTFFGQGTKLEIIKR (SEQ ID NO: 75)

Hu14G8VL version 3 (N26S, L36F, and D60S substitutions are shown in lower case):
DIVMTQSPLSLPVTPGEPASISSCRSsKSLLLHSNGNTLYLYWfLQKPGQSPQLLLIYRVSNLAGSGVPsRFSGGSGTDFTLKISRVREAEDVGVYYCMQHLEYPLTFFGQGTKLEIIKR (SEQ ID NO: 76)

Hu14G8VH version 1 (Q1E, Q3K, W47L, and Q105T substitutions are shown in lower case):
eVkLVESGGGLVQPGGSLKLSCAASGFFTSSYTMSWVRQTPEKRLLElVAEINNSGDDTTYYPDTVKRFTYISRDNAKNTLYLQMSSLKSEDTAMYYCARHYYGGGGYGTVTVVTGtGTLV

Hu14G8VH version 2 (Q1E and W47L substitutions are shown in lower case):
eVQLVESGGGLVQPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLLElVAEINNSGDDTTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCARHYYGGGGYGGFFVTVQGSLV

Hu14G8VH version 3 (Q1E and W47L substitutions are shown in lower case):
eVQLVESGGGLVQPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLLE1VAEINNSGDDTTYYPDTVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCARHYYGGGGYGGFWFDVWGQGTLVSS

Example 10 Analysis of binding kinetics of humanized 14G8 antibody As shown in Table 18, the characteristics of the binding kinetics of 3 types of humanized 14G8 variants and recombinant mouse 14G8 to recombinant human TTR F87M / L110M were clarified by Biacore. Anti-human (GE Healthcare) was immobilized on sensor chip C5 (devoid of dextran chain) by amine coupling according to the instructions attached to the GE Healthcare anti-human kit, and the mAb was bound to the analyte maximum. Was captured to a level of 30-50 RU. Various concentrations of analyte (recombinant human TTR F87M / L110M) were captured on ligand captured at 50 μl / min in running buffer (HBS + 0.05% P-20, 1 mg / mL BSA) at 3 fold dilution. I let it pass. For each concentration, the reaction was allowed to proceed for a time such that a higher concentration of analyte reached equilibrium at the time of association and at least 10% of the signal decayed upon dissociation. At least one concentration (not the highest or lowest concentration) was performed in duplicate. Concentration range of the analyte was chosen to over one-tenth of the 10-fold ~K _D of at least K _D based on preliminary experiments.

Binding rate (k _a ), dissociation rate (k _d ), and binding affinity constant (K _D ) of mouse 14G8, chimeric-14G8, Hu14G8 H2L1, Hu14G8 H2L2, Hu14G8H2L3, and Hu14G8 H3L1 to recombinant human TTR F87M / L110M Are summarized in Table 18. As shown in Table 18, Hu14G8 antibody and mouse 14G8 have comparable TTR binding affinity.

  Mouse 14G8, chimeric 14G8, and other humanized 14G8 with no change in LCDR1, showed an additional light chain when run on SDS-PAGE under reducing conditions. Sequence analysis revealed an N-glycosylation site at residue 26 by Kabat numbering in LCDR1. This N-glycosylation site can cause heterogeneity problems during manufacture. Mutation of N at residue L26 in Hu14G8VLv2 resulted in Hu14G8VLv3. Humanized antibodies with Hu14G8VLv3 show only one light chain when run on SDS-PAGE under reducing conditions, thereby eliminating the possibility of heterogeneity problems. The antigen binding affinity of Hu14G8 H2L3 is comparable to that of the mouse parent antibody and the chimeric antibody.

Example 11 Materials and Methods a. Antibody Production Protocol Mice are treated once weekly with antigenic peptides TTR-MAP, TTR89-97-N-KLH or TTR89-97-C-KLH in RIBI adjuvant, or once monthly with the above antigenic peptides in TiterMax adjuvant. I was immunized. Three to four days prior to fusion, selected mice received a final IV boost with an immunogen in saline. Spleens were prepared by homogenizing the spleen and fused with SP2 / 0 myeloma cells using standard electrofusion protocols. The fused cells in the selective medium were seeded in 96-well plates, and screening was performed after 7 to 10 days.

b. Antibody Screening Protocol Hybridoma selection was based on the following ELISA screening: 96-well ELISA plates were coated with chicken anti-His (1 μg / mL PBS) and incubated for 1 hour. After blocking the plate with 1% BSA / PBS solution (200 μL / well) for 15 minutes, 0.5 μg / mL pH4-TTR (50 μL / well) was added and incubated for 1 hour. pH4-TTR is a TTR that is placed at low pH (50 mM sodium acetate, pH 4.0) to dissociate / aggregate and expose the TTR89-97 epitope. The plate was washed twice with TBS-T. Supernatant from the fusion plate was added at 50 μL / well and incubated for 1 hour. The plate was washed twice with TBS-T. Detection antibody goat anti-mouse (IgG1, IgG2a, IgG2b, IgG3 specific) diluted 1: 5,000 in 0.5% BSA / PBS / TBS-T-HRP at 50 μL / well and incubated for 1 hour . Finally, the plate was washed 5 times with TBS-T and TMB substrate (100 μL / well) was added. After 15 minutes, the development of the substrate was stopped with 2N sulfuric acid (50 μL / well). The plate was read at 450 nm. O. D. Wells with a> 1.0 were selected and cells were transferred to 24-well plates. After growth for 3 days, clones were counter screened by the above assay to confirm binding, and as a negative counter screen, pH4-TTR was replaced with natural TTR, producing non-natural TTR-specific TTR mAb I was able to select the clone to be.

c. Antibody Expression Protocol Light chain and heavy chain plasmids carrying humanized monoclonal antibody sequences and driven by CMV were transfected into CHO-S1 cells (Life Technology). Double selection was performed to create a selection pool. Conditioned medium titers and binding were assayed and analyzed by SDS-PAGE / Western blotting. The selection pool was used for cloning using the Clonepix system (Molecular Devices). The clones were ranked based on antibody titer. Selected clones were expanded and banked.

The highest producing clones were expanded in shake flasks and the cultures were used to inoculate 10-25 L Wave bag cultures. For the shake flask and Wave bag culture, FreeStyle-CHO, CD OptiCHO, and FreeStyle F17 expression medium supplemented with Glutamax (the medium and Glutamax were manufactured by Life Technology) were used. Using a Wave Bioreactor (GE Healthcare), batch culture was performed at 37 ° C. and 7% CO ₂ with constant stirring. Samples were taken periodically to monitor cell number, viability and antibody production. Cell Boost (HyClone) was added as needed. Batch cultures were harvested when cell viability began to decrease below 90% (5-7 days).

d. Antibody Purification Protocol Floating cells were first settled to the bottom of the Wave bag by gravity at 4 ° C., and the cell culture was then collected. The collected medium is clarified with a depth filter (Millistar Pod COHC, Millipore), concentrated 10 times by tangential flow filtration (Pelicon 2PLC 30K, Millipore), and sterilized with a 0.2 μm filter (Opticap XL, Millipore). Filtered. Subsequently, using FPLC (Akta Avant, GE Lifesciences), a conditioned medium concentrated on Protein G Sepharose Fast Flow column (GE Lifesciences) pre-equilibrated with 1 × PBS (pH 7.4) was loaded. Unbound protein was washed from the column with 1 × PBS (pH 7.4) 5-10 times the column volume until OD ₂₈₀ reached baseline. Bound antibody was eluted from the column with twice the column volume IgG Elution Buffer (Thermo Scientific). The eluted fractions were collected and neutralized with 2M Tris (pH 9.0) (60 μL / ml eluate).

  Antibody containing fractions were pooled and dialyzed against 1 × PBS (pH 7.4) overnight at 4 ° C. The dialyzed sample was then sterilized by ultrafiltration through a 0.2 μm PES filter and stored at 4 ° C. The final protein concentration was determined by bicinchoninic acid (BCA) using bovine gamma globulin (Thermo Scientific) as a protein standard.

e. Recombinant TTR Expression and Purification Protocol E. coli (BL21-A1) cells were transformed into pET21a (+) containing a TTR variant with a TTR insert (Met-hTTR- (His) ₆ or F87M / L110M double mutation. Cells were grown in 2YT broth containing 100 μg / ml ampicillin TTR expression was induced overnight at 20 ° C. in the presence of 1 mM IPTG and 005% arabinose.

  Cells were collected by centrifugation at 4000 × g for 10 minutes and stored at −80 ° C. until use. 10-15 g of cell pellet was thawed and dissolved in 50 ml of buffer A (1 × PBS containing 500 mM NaCl, 20 mM imidazole) by treatment with an LV-1 high shear processor (Microfluidics). Lysed cells were centrifuged at 12,000 × g for 15 minutes, filtered through a 0.2 μm PES filter, and purified with a His-Trap HP column (GE Lifesciences). After loading, the column was washed with 10 times the column volume of buffer A and eluted with buffer B (1 × PBS containing 500 mM NaCl, 500 mM imidazole). Peak fractions corresponding to TTR were collected, dialyzed against 1 × PBS, and stored at −80 ° C. until use.

f. Preparation of TTR antigen Native TTR antigen was prepared by diluting a concentrated stock of recombinant TTR-6His with 1 × PBS to a final concentration of 2.5 μg / ml. A pH4-treated TTR was made by incubating the recombinant TTR in 50 mM sodium acetate (pH 3.95) at a concentration of 0.2 mg / ml for 72 hours at room temperature. Under these conditions, TTR dissociates into a mixture of TTR monomers structurally different from native TTR and aggregated forms of TTR. The pH 4-TTR was then diluted with 1 × PBS to a final concentration of 2.5 μg / ml just prior to use in the assay. A 96 well plate (Costar, No. 3690) was coated with 50 μl / well of 1.0 μg / ml chicken anti-his polyclonal antibody (Abcam, No. Ab9107) in 1 × PBS for 1 hour at room temperature. The coating solution was discarded and the plate was blocked with 250 μl / well of 1 × BSA containing blocking buffer (G-Biosciences, # 786-193) diluted in 1 × PBS.

g. ELISA Protocol Coated and blocked 96-well plates were treated with 50 μl / well of 2.5 μg / ml TTR antigen (either native TTR or pH4-TTR) for 1 hour at room temperature. The plates were then washed twice with 250 μl / well wash buffer (1 × Tris buffered saline containing 0.05% Tween-20). The washed plates were then treated with 50 μl / well of appropriate anti-TTR monoclonal antibody at concentrations ranging from 0.31 to 2.5 μg / ml.

Treated plates were washed 3 times with 250 μl / well wash buffer. After washing, the plate was treated with 50 μl / well of detection antibody containing peroxide-conjugated goat anti-mouse (Jackson ImmunoResearch Inc., number 115-035-164) diluted 1: 5,000 in 1 × PBS for 1 hour. The plates were then washed 3 times before adding 100 μl / well TMB substrate (Rockland). After allowing the HRP reaction to proceed for 15 minutes at room temperature, the reaction was stopped with a deposition volume of 50 μl / well 1N H ₂ SO ₄ . Spectral absorbance was measured at a wavelength of 450 nm.

h. SDS-PAGE
Electrophoresis on SDS-polyacrylamide gel was performed as follows. 0.1 to 1 μg TTR or pH 4.0-TTR in 1 × LDS sample buffer (Life Technologies) was loaded onto 10% NuPAGE Bis-Tris gel and electrophoresed in MES buffer at a constant voltage of 90V for 105 minutes. I let you. After electrophoresis, the gel was stained with Instant Blue (Expedon) or transferred to a nitrocellulose filter for Western blot analysis.

i. Native PAGE
Electrophoresis on native Tris-Glycine gel was performed as follows. 0.1 × 1 μg TTR or pH 4.0-TTR in 1 × Tris-Glycine sample buffer (Life Technologies) was loaded onto 10-20% Tris-Glycine gel and 1 × Native Tris-Glycine running buffer Electrophoresis was performed in the liquid at a constant voltage of 120 V for 105 minutes. After electrophoresis, the gel was stained with Instant Blue (Expedon) or transferred to a nitrocellulose filter for Western blot analysis.

j. Western Blot SDS-PAGE gel or native-PAGE gel was blotted onto nitrocellulose filter paper (iBlot, P7 Program) and blocked with blocking buffer (Licor) for 30 minutes. The filters were then incubated in 0.5 μg / ml primary antibody in blocking buffer for 1 hour at room temperature (or overnight at 4 ° C.) and then washed 3 times with 1 × TBS for 10 minutes. The filters were incubated in a 1: 20,000 dilution of IRDye 800CW conjugated goat anti-mouse secondary antibody in block buffer. After incubating the filter in a secondary antibody solution for 1 hour at room temperature, the filter was washed and imaged with an Odyssey CLx infrared imaging device (Licor).

k. Protocol for TTR fibrogenesis assay (Procotol)
A solution of 3.6 μM (0.2 mg / ml) TTR-Y78F in 50 mM sodium acetate (pH 4.8) in the presence of 1.4 μM (0.2 mg / ml) mis-TTR antibody or isotype control. And incubated at 37 ° C. for 72 hours. Following incubation, a 5-fold molar excess of Thioflavin T was added to the mixture and allowed to bind for 30 minutes. The excitation wavelength was set to 440 nm, and the fluorescence quantitative measurement value at an emission wavelength of 480 nm was measured. 0% inhibition was set as fluorescence intensity (83 au) in the presence of isotype control antibody, and 100% inhibition point was set as fluorescence (38 au) in the absence of TTR-Y78F protein.

  TTR-V122I stock solution (approximately 5 mg / mL) at pH 7.2, TTR 0.2 mg / mL, sodium acetate 30 mM, sodium phosphate 5 mM, KCl 100 mM, EDTA 1 mM, sodium azide 0.02% final concentration And diluted in buffer containing various concentrations of monoclonal antibodies. This sample was dialyzed against the same buffer at pH 4.5 for 3 hours at room temperature. The sample was then incubated at 37 ° C. for 72 hours. After incubation, a 5-fold molar excess of thioflavin T was added to the mixture and allowed to bind for 30 minutes. Thioflavin T fluorescence was monitored using a Photon Technology International C60 fluorometer. The amplification factor of the photomultiplier tube was changed, and the slit width for excitation and emission was set to 2 to 4 nm so that the signal to noise ratio was maximized. Fluorescence measurements were performed using 430 nm and 480 nm as excitation and emission wavelengths, respectively.

l. Heart tissue samples Fresh frozen blocks and paraffin-treated blocks of heart tissue with a confirmed diagnosis of ATTR mutations were obtained from Dr. Merrill Benson, University of Indiana. The samples included 8 fresh frozen samples and 6 FFPE samples, each sample diagnosed with either ATTR or some other cardiac amyloidosis. Prior to characterization with TTR antibodies, tissue diagnosis was further supported by performing IHC staining with antibodies against Kappa and lambda light chains and amyloid A at Prothena.

m. Immunohistochemistry Immunohistochemistry was performed on 10 μm frozen and 5 μm paraffin sections lightly fixed with paraformaldehyde and mounted on slides. The immunoperoxidase method was the main detection system, and was performed using a Bond Polymer Refine Detection Kit (DS980, Leica Biosystems) at Leica Bond Rx (Leica Biosystems, Buffalo Grove, Ill.). The primary antibody was incubated for 1 hour (according to the concentration in Table 2) and then incubated with antibody mice and anti-rabbit polymer HRP-linker antibody conjugate. Staining was visualized with DAB dye, which produced a brown deposit. The slides were counterstained with hematoxylin, dehydrated with a rising alcohol series, cleared with xylene, coated with CytoSeal 60 (Richard Allen Scientific; Kalamazoo, Michigan) and covered with a cover glass. Negative controls used non-immune IgG isotype controls or omitted the primary antibody and performed the entire immunohistochemical procedure on adjacent sections.

n. Demonstration of amyloid: Congo red staining and Thioflavin T staining Congo red staining was performed using a kit from American MasterTech (Lodai, Lodi, Calif., CA) to reveal the presence of TTR amyloid in the tissue. Staining was performed according to the manufacturer's procedure. The slides were stained with Congo red solution for 1 hour and then fractionated with 1% sodium hydroxide for about 15 seconds. Next, the slide was washed with running water, dehydrated with a series of alcohols of increasing concentration, clarified by exchanging xylene three times, CytoSeal 60 was applied, and a cover glass was applied.

  The presence of TTR amyloid in the tissues was determined using a modified thioflavin T staining protocol (Schmidt et al., 1995). Briefly, slides were counterstained with Mayer's hematoxylin, washed with running water, and with a filtered solution of 0.015% Thioflavin T (T3516-25G; Sigma-Aldrich, St. Louis, MO) in 50% ethanol. Stained for 10 minutes. The slides were then washed with running water, fractionated with 1% (v / v) acetic acid for 10 minutes, and washed 3 times with water. After the slide was air dried, ProLong Gold (Life Technologies) was applied and a cover glass was applied.

o. Image Analysis Slides were imaged with either an Olympus BX61 microscope, a Hamamatsu Nanozoomer 2.0HT digital slide scanner, or a Leica SPE spectral confocal system. Images were collected and saved as TIFF files.

p. Analysis of human plasma samples by SDS-PAGE / Western 6 plasma samples from patients with confirmed V30M ATTR (sample numbers 11, 12, 15, 18, 19, 20) and 6 samples from normal subjects (number 21) , 22, 23, 24, 25, 27), M. Obtained from Mr. Saraiva (University of Porto, Portugal). Sample number C6 was a normal human serum sample obtained from a commercial source (Bioreclamation IVT). The plasma samples were separated by SDS-PAGE as follows and Western blotted with 9D5 or 5A1. A volume of 1.4 μl of plasma was diluted 1: 8 in 1 × LDS sample buffer (Life Technologies) without reducing agent. Samples were separated by SDS-PAGE as previously described and Western blotted with 0.5 μg / ml 9D5 or 5A1.

q. Analysis of human plasma samples by MesoScale Discovery (MSD) plate assay 96-well MSD plates were coated with monoclonal antibody 6C1 at a concentration of 4 μg / mL in PBS and incubated at room temperature for 2 hours with shaking or overnight at 4 ° C. . The plate was washed 3 times with 1 × TBST and then blocked with 3% MSD Blocker A solution (150 μL / well) for 1 hour with shaking. Human plasma samples were prepared from 0.6% globulin-free bovine serum albumin, 1.5 mM sodium dihydrogen phosphate, 8 mM sodium hydrogen phosphate, 145 mM sodium chloride, 0.05% Triton X-405, 0.05 Dilute 1:10 in sample buffer consisting of% thimerosal and add to the blocked MSD plate at a volume of 30 μl / well for 1 hour. The plate was washed 3 times with 1 × TBST. 1 μg / ml sulfo-tagged detection antibody (8C3 total TTR antibody of either Dako polyclonal antibody) in sample buffer was added in a volume of 50 μl / well and shaken for 1 hour at room temperature. The plate was washed 3 times with 1 × TBST, and 1 × Read Buffer T solution (Meso Scale Discovery) was added at 150 μl / well. The plate was then read with an MSD Sector imager.

r. MSD standard curve generation To quantify the amount of unnatural 6C1-reactive TTR protein present in human plasma samples, MSD standard curves were generated using recombinant TTR-F87M / L110M as 6C1-reactive TTR standard. . This TTR variant contains two amino acid substitutions that prevent tetramer formation and keep the protein in a monomeric state (Jiang et al., (2001) Biochemistry 40, 11442-11492). This TTR variant is therefore recognized by all mis-TTR mAbs and is therefore well suited for use as a reference standard in MSD assays.

  To generate a standard curve, 96 well MSD plates were coated with 4 μg / mL mis-TTR antibody 6C1 in PBS and incubated for 2 hours with shaking at room temperature or overnight at 4 ° C. The plate was washed 3 times with 1 × TBST and then blocked with 3% MSD Blocker A solution (150 μL / well) for 1 hour with shaking. The blocked plates were then treated with 25 μg / mL TTR-F87M / L110M (50 μl / well) for 1 hour, serially diluted 1: 5, with the final dilution being a buffer blank. After the plate was washed 3 times with 1 × TBST, 1 μg / ml SulfoTag-detecting antibody (8C3-SulfoTag or Dako pAb-SulfoTag) was added in a volume of 50 μl / well and shaken for 1 hour at room temperature. Since both 8C3 mAb and Dako antibody bind to all TTRs and are not conformation specific, they could bind to SulfoTag and be used as detection antibodies.

  After treatment with detection antibody, the plate was washed 3 times with a volume of 150 μl / well 1 × TBST, then 1 × Read Buffer T (MSD) was added at 150 μl / well. The plate was read with an MSD Sector imaging device and a TTR F87M / L110M calibration curve was created from the results.

s. Phagocytosis assay 1 mg / mL sample of TTR-F87M / L110M, native TTR or low pH aggregated TTR-V30M, with pHrodo dye and 37 ° C. for 15 minutes at 37 ° C. according to manufacturer's specifications (Thermo Scientific) The amine was bonded at a ratio of about 15: 4. Excess pHrodo label was removed by diafiltration using a centrifugal concentrator (Pierce Thermo) with a molecular weight cut-off 10K, and pHrodo-TTR was resuspended in 1 × PBS.

  THP-1 human monocytes were cultured in cell culture medium (RMPI, 10% low IgG serum, pen / strep). An aliquot of 20 μg / mL pHrodo-labeled TTR was preincubated with 40 μg / mL antibody for 30 minutes at 37 ° C. in cell culture medium, then 5E + 04 THP-1 cells were added at a 1: 1 volume ratio. After incubating the tissue culture (3 hours), the cells were washed 3 times with cell culture medium, incubated for 10 minutes in the culture medium, then washed with FACS buffer (1% FBS in PBS) and placed in the same buffer. Resuspended. Red pHrodo fluorescence intensity was detected using a Texas Red channel filter. The epifluorescence microscope was implemented by the same method. After FACS analysis, the remaining cells were transferred to a glass chamber slide and imaged by inverted microscopy. By calculating the average value of the relative fluorescence intensity of individual cells, the average fluorescence intensity was automatically calculated.

Example 12 Antibody-dependent TTR uptake by THP-1 cells TTR-F87M / L110M was covalently labeled with the pH-sensitive fluorescent dye pHrodo. Although pHrodo tag has minimal fluorescence at physiological pH, it can be seen that tagged particles were taken up into the cells because the fluorescence was enhanced when phagocytosed in the low pH environment of endocytic vesicles. THP-1 monocytes were added to pHrodo tagged TTR (natural or non-natural TTR-F87M / L110M) after treatment with either 14G8 or an isotype control antibody. Low levels of fluorescence were observed both with antibodies incubated with native TTR and after incubation of control antibodies with non-natural TTR. However, fluorescence increased after incubation of 14G8 with non-natural TTR (FIG. 7A), and non-natural TTR is not phagocytosed under basic conditions, but the addition of a mis-TTR antibody reduces the phagocytosis of non-natural TTR. It was suggested to be specifically induced.

  A dose-dependent phagocytosis of large TTR-aggregated fibril particles labeled with pHrodo was also shown for each mis-TTR mAb (FIG. 7B). The maximum value of antibody-dependent uptake varied with each mis-TTR mAb (6C1> 9D5≈14G8> 5A1), reaching a plateau at a mAb concentration of 5-10 μg / mL. The variation in antibody titers appears to reflect the differences in the isotypes of the four mis-TTR mAbs and the associated effector function changes. Controls including untreated cells or cells treated with IgG1 isotype control, respectively, showed no detectable or enhanced fluorescence.

Example 13 Evaluation of mis-TTR antibody in transgenic mouse model Humanized transgenic mouse model V30M hTTR (Inoue et al., (2008) Specific pathogen free conditions pre-transient therapy gene therapy 17 To evaluate the effectiveness of anti-TTR antibodies in binding and removing aggregated hTTR.

  Transgenic mice are bred using standard methods and their circulating hTTR levels are assessed by ELISA. Mice with serum hTTR levels of 200-400 μg / ml are used for subsequent efficacy studies. The first set of studies examines natural hTTR deposition in transgenic mice. Detection of hTTR deposits starts at 12 months of age and then repeats detection every 3-6 months. Efficacy testing begins when an acceptable level of aggregates is seen in the transgenic mice. Mice are divided into 3 treatment groups (n = 10 / group) and treated once a week for 4 weeks with IP administration of vehicle, control antibody (isotype control, 10 mpk) or anti-hTRR antibody (10 mpk). One week after the last treatment, the mice are euthanized, the tissues are harvested and processed, and then stained to assess the number and size of residual TTR deposits. Using quantitative methods and statistics, determine the extent of removal seen between groups.

  In another method, hTTR aggregates are prepared in vitro and then injected into the kidneys of transgenic mice to seed new aggregate deposits. The inventor has shown that injection of the above preparation can promote the deposition of new aggregates in a predictable manner. Based on the above findings, mice are sedated, the left kidney is exposed, and pre-aggregated hTTR substance is injected into the renal cortex. After an appropriate recovery period, the mice were divided into 3 treatment groups (n = 10 / group), once a week with IP administration of vehicle, control antibody (isotype control, 10 mpk) or anti-hTRR antibody (10 mpk), 4-4 Treat for 8 weeks. One week after the last treatment, mice are euthanized, kidneys are harvested and processed, and then stained to assess the number and size of TTR deposits. Determine the degree of change between groups using quantitative methods and statistics.

Example 14 FIG. Evaluation of mis-TTR antibody in Matrigel implantation model The present inventor can suspend and coagulate pre-aggregated hTTR in Matrigel (BD Bioscience, Cat. No. 354263) and then place it subcutaneously in mice. Was revealed. At 4 weeks after transplantation, the Matrigel implants maintained their structure and aggregated hTTR was still present in the implants. Furthermore, the implanted plants were well tolerated by mice, and the anti-hTTR antibody was able to penetrate the Matrigel and bind to aggregates suspended in the Matrigel. Based on the above findings, antibody efficacy studies will be conducted. Mice are sedated and implanted plants containing preaggregated hTTR suspended in Matrigel are placed subcutaneously in the mice. After an appropriate recovery period, the mice were divided into 3 treatment groups (n = 10 / group) and administered weekly with IP administration of vehicle, control antibody (isotype control, 10 mpk) or anti-hTRR antibody (10 mpk). Treat for 4 weeks. After the last treatment, the mice are euthanized, the skin containing the buried plant is harvested and processed, and then the amount of residual TTR deposits is assessed using histological and / or biochemical methods To do. Use quantitative analysis and statistics to determine the extent of removal seen between groups.

Example 15. Electron microscopy and atomic force microscopy Using transmission electron microscopy (TEM) and atomic force microscopy (AFM) with immunogold, between the mis-TTR mAb and both aggregated and fibrillar proteins An image of the interaction was obtained. Isothermal titration calorimetry (ITC) was performed by titrating 14G8 into a solution of aggregated TTR using standard methods. Using TEM, immunogold labeling with 14G8 was observed on TTR-V122I oligomer aggregates and fibril ends (FIG. 8A), whereas immunogold labeling with anti-TTR pA was along the length of the TTR fibers. Binding and binding to oligomer clusters was shown (FIG. 8B). The IgG1 isotype control mAb does not show immunogold labeling (FIG. 8C). TTR-V122I fibers were evaluated using AFM alone and in the presence of 14G8 ± 6 nm colloidal gold conjugate secondary antibody. Gold labeling was observed at the fiber end (FIG. 8D). FIG. 9A shows isothermal titration calorimetry (ITC) data and binding isotherms for 14G8 binding to aggregated TTR variants. FIG. 9B shows binding fitted to a two binding site model with the indicated KD values. TEM, AFM, and ITC analyzes provide evidence that the mis-TTR mAb binds to TTR aggregates and fibrils primarily at two different sites: oligomers and fibril ends.

Example 16: Binding of antibodies to TTR amyloid in the peripheral nerve and gastrointestinal tract of patients with ATTR amyloidosis derived from the TTR-V30M mutation 14G8 and control antibodies were evaluated immunohistochemically to diagnose ATTR amyloidosis from the V30M mutation. We determined their responsiveness to TTR amyloid deposits in nerve and gastrointestinal samples obtained from patients with confirmed. FIGS. 10A-10G show 14G8 immunolabeled TTR amyloid (Panels 1 and 2 in FIG. 10A) present between fibers of nerve bundles in tissues from patients with ATTR amyloidosis, which is shown as Congo red (FIG. Overlapping with staining with 10B panels 1 and 2) and thioflavin T (panels 1 and 2 in FIG. 10C) and immunolabeling with whole TTR antibody (FIG. 10D). No staining was seen with the use of two isotype control antibodies (FIGS. 10E-10F), but axonal degeneration (lack of Schwann cell nuclei) in the region containing TTR amyloid deposits was also observed (FIGS. 10E-10F). [Red area in 10E]). Healthy control peripheral nerves were not labeled using either 14G8 or total TTR antibody (panels 1-3 of FIG. 10G).

  14G8-labeled TTR amyloid deposits throughout the gastrointestinal tract; Meissner plexus and glands in the esophagus (panel 1 in FIGS. 11A and 11B), abundant vascular bed in submucosa (panel 1 in FIG. 11C), And the jejunal intrinsic muscle layer (MP) and mucosal muscle plate (MM) (panel 1 in FIG. 11D) were immunolabeled with 14G8. 14G8 positive TTR amyloid superimposed on Congo red fluorescence staining (panel 2 in FIGS. 11A-11D). ATTR amyloidosis tissue stained with isotype control mAb (panel 3 in FIGS. 119A-119D). 14G8 immunoreactivity was not seen in healthy control tissues (panels 1 to 4 in FIG. 11E).

These observations indicate that MIS-TTR mAb preserves the function of the normal tetrameric form of the protein while maintaining TTR in patients with ATTR amyloidosis regardless of the specific organ (s) affected. Evidence that it may be useful in preventing amyloid accumulation or increasing TTR amyloid removal, or both.

Claims (90)

  An antibody that binds transthyretin and comprises three heavy chain CDRs and three light chain CDRs substantially derived from antibody 14G8.   2. The antibody of claim 1, comprising three Kabat heavy chain CDRs and three Kabat light chain CDRs of the antibody 14G8, with the exception that the H52 and L26 positions can each be N or S.   3. The antibody of claim 1 or 2, comprising three Kabat heavy chain CDRs and three Kabat light chain CDRs of the antibody 14G8.   The antibody according to claim 1, 2 or 3, wherein CDR-H1 is the Kabat-Chothia CDR complex of the antibody 14G8.   The antibody of claim 1 or 2, comprising the three Kabat heavy chain CDRs of antibody 9D5.   6. The antibody according to claim 1, 2 or 5, wherein CDR-H1 is the Kabat-Chothia CDR complex of the antibody 9D5. Binds to the same epitope on transthyretin as 9D5 or 14G8 and comprises three light chain CDRs and three heavy chain CDRs;
(A) each CDR has at least 90% sequence identity to the corresponding CDR from the heavy and light chain variable regions of 9D5, or (b) each CDR has a heavy chain variable region of 14G8 and Have at least 90% sequence identity to the corresponding CDR from the light chain variable region, exceptionally L26 can be N or S;
The antibody of claim 1. (A) the 3D3 heavy chain CDRs and 3 light chain CDRs of the 9D5; or
The antibody of claim 7 comprising (A) the three heavy chain CDRs and three light chain CDRs of 9D5 are SEQ ID NOS: 13-15 and SEQ ID NOs: 24-26, respectively; and (b) the three heavy chain CDRs of 14G8 and three light chain CDRs The chain CDRs are SEQ ID NO: 67-69 and SEQ ID NO: 77-79, respectively, exceptionally the L26 position can be N or S.
The antibody according to claim 7 or 8.   The antibody according to any one of claims 1 to 9, which is a monoclonal antibody.   The antibody according to any one of claims 1 to 10, which is a chimeric antibody, a humanized antibody, a veneered antibody, or a human antibody.   The antibody according to any one of claims 1 to 11, which has a human IgG1 isotype.   The antibody according to any one of claims 1 to 11, which has a human IgG2 isotype or a human IgG4 isotype.   The antibody of claim 1, which is a humanized antibody or chimeric antibody of a mouse antibody that specifically binds to transthyretin, wherein the mouse antibody comprises a mature heavy chain variable region of SEQ ID NO: 61 and SEQ ID NO: 70. Characterized by a mature light chain variable region, exceptionally H52 can be S or N, H69 can be F or I, L26 can be S or N, and R at L107 is optional An antibody.   15. The antibody of claim 14, which is a humanized 9D5 antibody, chimeric 9D5 antibody, humanized 14G8 antibody or chimeric 14G8 antibody that specifically binds to transthyretin, wherein 9D5 is a mature heavy chain variable of SEQ ID NO: 1. A mouse antibody characterized by the region and mature light chain variable region of SEQ ID NO: 16, and 14G8 is a mouse antibody characterized by the mature heavy chain variable region of SEQ ID NO: 61 and the mature light chain variable region of SEQ ID NO: 70 There is an antibody. (A) the humanized mature heavy chain variable region comprising the 9D5 three heavy chain CDRs and the humanized mature light chain variable region comprising the 9D5 three light chain CDRs; or (b) exceptionally the L26 position is N The humanized mature heavy chain variable region comprising the three heavy chain CDRs of the 14G8 and the humanized mature light chain variable region comprising the three light chain CDRs of the 14G8, which can be S or 16. Humanized antibody. (A) the three heavy chain CDRs and three light chain CDRs of 9D5 are SEQ ID NOS: 13-15 and SEQ ID NOs: 24-26, respectively; and (b) the three heavy chain CDRs of 14G8 and three light chain CDRs The chain CDRs are SEQ ID NO: 67-69 and SEQ ID NO: 77-79, respectively, exceptionally the L26 position can be N or S.
The humanized antibody of claim 16.   A humanized mature heavy chain variable region having an amino acid sequence at least 90% identical to any one of SEQ ID NOs: 5-12 and a humanized having an amino acid sequence at least 90% identical to any one of SEQ ID NOs: 19-23 A mature light chain variable region, exceptionally H19 can be R or K, H40 can be A or T, H44 can be G or R, and H49 can be S or A H77 can be S or T, H82a can be N or S, H83 can be R or K, H84 can be A or S, and H89 can be V or M 18. A humanized antibody according to any one of claims 14 to 17, which can be.   At least one of the following positions is occupied by the designated amino acid: H42 is occupied by E, H47 is occupied by L, H69 is occupied by F, and H82 is occupied by S. H82b is occupied by L, H108 is occupied by L, L8 is occupied by A, L9 is occupied by P, L18 is occupied by S, L19 is occupied by V, 19. The L36 position is occupied by F, the L39 position is occupied by R, the L60 position is occupied by S, the L70 position is occupied by A, and the L74 position is occupied by R. The humanized antibody according to Item.   20. The humanized antibody of claim 19, wherein positions H47, H69, and H82 are occupied by L, F, and S, respectively.   20. The humanized antibody of claim 19, wherein positions H47, H69, H82, and H82b are occupied by L, F, S, and L, respectively.   20. The humanized antibody of claim 19, wherein positions H42, H47, and H108 are occupied by E, L, and L, respectively.   20. The humanized antibody of claim 19, wherein positions H69, H82, and H82b are occupied by F, S, and L, respectively.   20. The humanized antibody of claim 19, wherein positions H47 and H108 are each occupied by L.   20. The humanized antibody of claim 19, wherein positions H82 and H82b are occupied by S and L, respectively.   20. The humanized antibody of claim 19, wherein positions H42, H47, and H82b are occupied by E, L, and L, respectively.   20. The humanized antibody of claim 19, wherein position L36 is occupied by F.   20. The humanized antibody of claim 19, wherein position L60 is occupied by S.   L8, L9, L19, L36, L39, L60, L70, and L74 are occupied by A, P, V, F, R, S, A, and R, respectively. Item 20. The humanized antibody according to Item 19.   L8, L9, L18, L19, L36, L39, L60, L70, and L74 are occupied by A, P, S, V, F, R, S, A, and R, respectively. 20. The humanized antibody of claim 19, wherein   A mature heavy chain variable region having an amino acid sequence at least 95% identical to any one of SEQ ID NOs: 5-12 and a mature light chain variable having an amino acid sequence at least 95% identical to any one of SEQ ID NOs: 19-23 The H19 position may be R or K, the H40 position may be A or T, the H44 position may be G or R, the H49 position may be S or A, and the H77 position. Can be S or T, H82a can be N or S, H83 can be R or K, H84 can be A or S, and H89 can be V or M. Item 19. A humanized antibody according to Item 18.   A mature heavy chain variable region having an amino acid sequence at least 98% identical to any one of SEQ ID NOs: 5-12 and a mature light chain variable region having an amino acid sequence at least 98% identical to any one of SEQ ID NOs: 19-23 The H19 position may be R or K, the H40 position may be A or T, the H44 position may be G or R, the H49 position may be S or A, and the H77 position. Can be S or T, H82a can be N or S, H83 can be R or K, H84 can be A or S, and H89 can be V or M. Item 32. The humanized antibody according to Item 31.   24. The mature heavy chain variable region has any one amino acid sequence of SEQ ID NOs: 5-12, and the mature light chain variable region has any one amino acid sequence of SEQ ID NOs: 19-23. 33. A humanized antibody according to 32.   34. The humanized antibody of claim 33, wherein the mature heavy chain variable region has the amino acid sequence of SEQ ID NO: 11, and the mature light chain variable region has the amino acid sequence of SEQ ID NO: 19.   A humanized mature heavy chain variable region having an amino acid sequence at least 90% identical to any one of SEQ ID NOs: 64-66 and a humanized having an amino acid sequence at least 90% identical to any one of SEQ ID NOs: 74-76 A light chain variable region, and exceptionally H82a can be N or S, H83 can be R or K, H84 can be A or S, and H89 can be V or M 18. A humanized antibody according to any one of claims 14 to 17, which is obtained and wherein the L18 position can be S or P.   36. At least one of the following positions is occupied by the designated amino acid: H1 is occupied by E, H47 is occupied by L, and L36 is occupied by F. A humanized antibody according to 1.   37. The humanized antibody of claim 36, wherein positions H1 and H47 are occupied by E and L, respectively.   37. The humanized antibody of claim 36, wherein position L36 is occupied by F.   At least one of the following positions is occupied by the designated amino acid: H3 is occupied by K, H105 is occupied by T, L8 is occupied by A, and L9 is occupied by P. The L19 position is occupied by V, the L26 position is occupied by S, the L60 position is occupied by S, and the L70 position is occupied by A. Humanized antibody.   40. The humanized antibody of claim 39, wherein positions H3 and H105 are occupied by K and T, respectively.   40. The humanized antibody of claim 39, wherein positions L8, L9, L19, and L70 are occupied by A, P, V, and A, respectively.   40. The humanized antibody of claim 39, wherein positions L26 and L60 are each occupied by S.   A mature heavy chain variable region having an amino acid sequence at least 95% identical to any one of SEQ ID NOs: 64-66 and a mature light chain variable region having an amino acid sequence at least 95% identical to any one of SEQ ID NOs: 74-76 The H82a position can be N or S, the H83 position can be R or K, the H84 position can be A or S, the H89 position can be V or M, and the L18 36. The humanized antibody of claim 35, wherein the position can be S or P.   A mature heavy chain variable region having an amino acid sequence at least 98% identical to any one of SEQ ID NOs: 64-66 and a mature heavy chain variable region having an amino acid sequence at least 98% identical to any one of SEQ ID NOs: 74-76 The H82a position can be N or S, the H83 position can be R or K, the H84 position can be A or S, the H89 position can be V or M, and the L18 44. The humanized antibody of claim 43, wherein the position can be S or P.   The mature heavy chain variable region has any one amino acid sequence of SEQ ID NOs: 64-66, and the mature light chain variable region has any one amino acid sequence of SEQ ID NOs: 74-76. 45. The humanized antibody according to 44.   46. The humanized antibody of claim 45, wherein the mature heavy chain variable region has the amino acid sequence of SEQ ID NO: 65, and the mature light chain variable region has the amino acid sequence of SEQ ID NO: 76.   47. The antibody of any one of claims 1-46, which is an intact antibody.   47. The antibody of any one of claims 1-46, which is a binding fragment.   49. The antibody of claim 48, wherein the binding fragment is a single chain antibody fragment, a Fab fragment, or a Fab'2 fragment.   48. The humanized antibody of any one of claims 14 to 47, wherein the mature light chain variable region is fused to a light chain constant region, and the mature heavy chain variable region is fused to a heavy chain constant region. .   51. The humanized antibody of claim 50, wherein the heavy chain constant region is a variant of the natural human heavy chain constant region that has reduced binding to an Fcγ receptor relative to a natural human heavy chain constant region.   52. The humanized antibody of claim 50 or 51, wherein the heavy chain constant region is of the IgG1 isotype.   The mature heavy chain variable region is fused to a heavy chain constant region having the sequence of SEQ ID NO: 103 and / or the mature light chain variable region is fused to the light chain constant region having the sequence of SEQ ID NO: 104 or 105. 51. The humanized antibody of claim 50. A humanized antibody according to any one of claims 14 to 53, comprising:
(A) whether any differences in the CDRs in the mature heavy chain variable region and the mature light chain variable region from SEQ ID NOS: 1 and 16, respectively, are at positions H60-H65;
(B) Any differences in the CDRs in the mature heavy chain variable region and the mature light chain variable region from SEQ ID NOs: 61 and 70, respectively, are at positions H60-H65, with the exception that position L26 is N or S Could be
Humanized anti-antibody.   55. A pharmaceutical composition comprising the antibody according to any one of claims 1 to 54 and a pharmaceutically acceptable carrier.   The nucleic acid which codes the heavy chain and / or light chain of the antibody of any one of Claims 1-54.   57. The nucleic acid of claim 56, having a sequence comprising any one of SEQ ID NOs: 40, 42, 44-56, 87, 89, 91-96, and 106-108.   58. A recombinant expression vector comprising the nucleic acid of claim 56 or 57.   59. A host cell transformed with the recombinant expression vector of claim 58. A method of humanizing an antibody comprising:
(A) selecting one or more acceptor antibodies;
(B) identifying the amino acid residues of the mouse antibody to be retained;
(C) synthesizing a nucleic acid encoding a humanized heavy chain comprising the CDR of the mouse antibody heavy chain and a nucleic acid encoding a humanized light chain comprising the CDR of the mouse antibody light chain;
(D) expressing the nucleic acid in a host cell to produce a humanized antibody, wherein the mouse antibody is 9D5 or 14G8, wherein 9D5 is the mature heavy chain variable region of SEQ ID NO: 1 and SEQ ID NO: A method characterized by 16 mature light chain variable regions and 14G8 is characterized by a mature heavy chain variable region of SEQ ID NO: 61 and a mature light chain variable region of SEQ ID NO: 70. A method of making a humanized antibody, a chimeric antibody, or a veneered antibody, comprising:
(A) culturing cells transformed with nucleic acids encoding the heavy and light chains of the antibody such that the cells secrete the antibody;
(B) purifying the antibody from cell culture medium, wherein the antibody is a humanized, chimeric, or veneered 9D5 or 14G8. A method of making a cell line that produces a humanized antibody, a chimeric antibody, or a veneered antibody, comprising:
(A) introducing into the cell a vector encoding the heavy and light chains of the antibody and a selectable marker;
(B) growing the cells under conditions that select for cells having an increased copy number of the vector;
(C) isolating a single cell from the selected cell;
(D) banking cells cloned from a single cell selected based on the amount of antibody produced, wherein the antibody is humanized, chimeric, or veneered 9D5 or 14G8. Further comprising the method of claim 62 and screening said cells cell lines at least 100 mg / L 10 ⁶ cells per naturally expressed and secreted by selectively be grown under conditions and 24 hours.   55. A method of inhibiting or reducing transthyretin aggregation in a subject having or at risk of developing transthyretin-mediated amyloidosis, wherein the subject is any one of claims 1-54. Carrying out an effective regimen of the antibody, thereby inhibiting or reducing the aggregation of transthyretin in said subject.   55. A method of inhibiting or reducing transthyretin fibril formation in a subject having or at risk of developing transthyretin-mediated amyloidosis, wherein the subject is in any one of claims 1-54. Performing an effective regimen of the described antibody, thereby inhibiting or reducing transthyretin accumulation in said subject.   55. A method of reducing transthyretin deposits in a subject having or at risk of developing transthyretin-mediated amyloidosis, wherein the subject is an antibody according to any one of claims 1 to 54. Carrying out an effective regimen of thereby reducing transthyretin deposits in said subject.   55. A method of removing aggregated transthyretin in a subject having or at risk of developing transthyretin-mediated amyloidosis, wherein the subject is treated with the antibody of any one of claims 1-54. Performing an effective regimen, thereby removing aggregate transthyretin from said subject relative to a subject having or at risk of developing transthyretin-mediated amyloidosis not receiving said antibody ,Method.   56. A method of stabilizing the non-toxic three-dimensional structure of transthyretin in a subject having or at risk of developing transthyretin-mediated amyloidosis, wherein the subject is any one of claims 1-54. Performing an effective regimen of the antibody according to claim 1, thereby stabilizing the non-toxic conformation of transthyretin in said subject.   55. A method of treating or preventing transthyretin-mediated amyloidosis in a subject, comprising administering to said subject an effective regimen of the antibody of any one of claims 1-54.   55. A method of delaying the onset of transthyretin-mediated amyloidosis in a subject, comprising performing an effective regimen of the antibody of any one of claims 1 to 54 on said subject.   The transthyretin-mediated amyloidosis is cardiomyopathy or cardiac hypertrophy, familial amyloid neuropathy, central nervous system selective amyloidosis (CNSA), senile systemic amyloidosis, senile cardiac amyloidosis, spinal canal stenosis, degenerative joint 71. A method according to any one of claims 64 to 70, associated with a pathology selected from one of rheumatoid arthritis, rheumatoid arthritis, juvenile idiopathic arthritis, age related macular degeneration, and ligament or tendon disorder.   Cardiomyopathy or cardiac hypertrophy, familial amyloid neuropathy, central nervous system selective amyloidosis (CNSA), senile systemic amyloidosis, senile cardiac amyloidosis, spinal stenosis, osteoarthritis, rheumatoid arthritis, juvenile idiopathic arthritis 55. A method of treating a subject having, or at risk for, aging macular degeneration and ligament or tendon disorder, wherein the subject is an antibody according to any one of claims 1 to 54 Carrying out an effective regimen of:   55. A method of diagnosing transthyretin-mediated amyloidosis in a subject, comprising contacting a biological sample from said subject with an effective amount of the antibody of any one of claims 1-54. .   74. The method of claim 73, further comprising detecting binding of the antibody to transthyretin, wherein the presence of bound antibody indicates that the subject has transthyretin-mediated amyloidosis.   Further comprising comparing the binding of the antibody to the biological sample with the binding of the antibody to a control sample, whereby increased binding of the antibody to the biological sample relative to the control sample 75. The method of claim 73 or 74, wherein said method has transthyretin mediated amyloidosis.   76. The method of claim 75, wherein the biological sample and the control sample comprise cells of the same tissue origin.   77. The method according to any one of claims 73 to 76, wherein the biological sample and / or the control sample is blood, serum, plasma, or solid tissue. 78. The method of claim 77, wherein the solid tissue is from the heart, peripheral nervous system, autonomic nervous system, kidney, eyeball, or gastrointestinal tract.   79. The method of any one of claims 66 to 78, wherein the transthyretin-mediated amyloidosis is familial transthyretin amyloidosis or sporadic transthyretin amyloidosis.   80. The method of claim 79, wherein the familial transthyretin amyloidosis is familial amyloid cardiomyopathy (FAC), familial amyloid neuropathy (FAP), or central nervous system selective amyloidosis (CNSA).   80. The method of claim 79, wherein the sporadic transthyretin amyloidosis is senile systemic amyloidosis (SSA) or senile cardiac amyloidosis (SCA).   79. Any one of claims 64-78, wherein the transthyretin-mediated amyloidosis is associated with amyloid accumulation in the subject's heart, peripheral nervous system, autonomic nervous system, kidney, eyeball, or gastrointestinal tract. the method of.   55. A method for detecting the presence or absence of a transthyretin deposit in a subject, wherein the subject-derived biological sample suspected of having amyloid accumulation is an effective amount of any one of claims 1-54. Contacting with an antibody.   84. The method of claim 83, further comprising detecting binding of the antibody to transthyretin, wherein detecting the bound antibody indicates the presence of a transthyretin deposit.   Further comprising comparing the binding of the antibody to the biological sample with the binding of the antibody to a control sample, whereby increased binding of the antibody to the biological sample relative to the control sample 85. The method of claim 83 or 84, wherein said method has transthyretin-mediated amyloidosis.   86. The method of claim 85, wherein the biological sample and the control sample comprise cells of the same tissue origin.   87. The method of any one of claims 82 to 86, wherein the biological sample and / or the control sample is blood, serum, plasma, or solid tissue.   88. The method of claim 87, wherein the solid tissue is from the heart, peripheral nervous system, autonomic nervous system, kidney, eyeball, or gastrointestinal tract.   55. A method for determining the level of transthyretin deposits in a subject, comprising administering the antibody of any one of claims 1 to 54 and detecting the presence of bound antibody in the subject. Including a method.   90. The method of claim 89, wherein the presence of bound antibody is determined by positron emission tomography (PET).