1. CLAIMS A method for mRNA identification the method comprising: (a) providing a protein synthesis monitoring (PSM) system, wherein the PSM system comprises: (i) at least one marker detectable through detection of electromagnetic radiation, the at least one marker comprising a pair of interacting labeling moieties, wherein the first moiety being bound to a ribosome or a fragment thereof, the ribosome or the fragment thereof being attached to a solid substrate, and the second moiety being bound to an entity selected from the group consisting of: the ribosome or the labeled fragment thereof, tRNA and amino acid, wherein the marker is capable of emitting electromagnetic radiation in response to translation activity; (ii) at least one translation component selected from the group consisting of: aminoacyl-tRNA synthetases, initiation factors, elongation factors, termination factors, energy sources and energy regenerating molecules; and (iii) detection means adapted to measure emitted radiation from the PSM system; (b) introducing at least one mRNA molecule into the PSM system; and (c) detecting electromagnetic radiation signals obtained in response to translation activity. The method of claim 1 , comprising introducing a plurality of mRNA molecules into the PSM system. The method according to claim 1, wherein the solid substrate is selected from the group consisting of: glass, glass slide adapted for microscope means and a solid substrate having a mica surface. 4. The method of claim 1, further comprising: identifying the ribonucleotide sequence of the at least one mRNA molecule. 27 The method according to claim 4, wherein the step of identifying the ribonucleotide sequence of the at least one mRNA molecule comprises: performing PSM database interrogation, thereby assigning at least one signal sequence to at least one particular mRNA. The method according to claim 5, wherein identifying the ribonucleotide sequence of at least one mRNA molecule further comprises storing the at least one signal sequence in a PSM database. The method according to claim 5, wherein the step of performing PSM database interrogation comprises: . determining the probability of an mRNA molecule in the PSM database to generate said at least one signal sequence; and selecting one or more mRNA molecules having the highest scoring function value, thereby assigning the one or more mRNA molecules to said at least one signal sequence. The method according to claim 5, wherein the at least one signal sequence is composed of one or more values selected from the group consisting of: time, spatial coordinates, signal type and signal intensity. The method according to claim 1, wherein the signals are obtained by energy transfer between the pair of interacting labeling moieties. The method according to claim 9, wherein the signals are selected from the group consisting of: FRET signals, quenching signals and fluorescent signals. The method according to claim 1 , wherein the marker comprises a label selected from the group consisting of: a fluorescent dye, a fluorescent amino acid, a fluorescent peptide or protein, a fluorescent nucleotide, a quantum dot, a luminescent substance, a donor-quencher pair and a fluorescent donor-acceptor pair. 28 The method of claim 1 , wherein the second labeling moiety is a fluorescent amino acid. 13. The method according to claim 1 , wherein the ribosomal fragment is selected from the group consisting of: ribosomal RNA, a ribosomal protein, ribosomal protein LI, ribosomal protein LI 1, ribosomal protein SI and fragments thereof. 14. The method according to claim 13, wherein the ribosomal fragment is located near a ribosomal site selected from the group consisting of: ribosomal A site, ribosomal P site, ribosomal E site, peptide exit channel site, LI arm, and L7/L12 arm. 5. The method according to claim 1, wherein the PSM system comprises: a plurality of markers detectable through detection of electromagnetic radiation, wherein each marker comprises a pair of interacting labeling moieties, wherein the first moiety being bound to a ribosome or a labeled fragment thereof, the ribosome or the fragment thereof being attached to a solid substrate, and the second moiety being bound to an entity selected from the group consisting of: the ribosome or the fragment thereof, tRNA and amino acid, wherein the marker is capable of emitting electromagnetic radiation in response to translation activity. 16. The method according to claim 15, wherein distinct tRNAs or amino acids are bound to distinct markers. 17. The method of claim 15, the marker being one of two distinct colors. Webb & Associates ANM/002 IL 29 FIGURE 1 2/2 οο· o o ·# FIGURE 2 301. VGSD CTTIHYNYMCNRSSCMGQLKK VDSTPKPPGT RVRKAMAIYQSRRQHMTEWSVTKCTYSPALNVQLV ESGGGRLVQPGGSLR 302. SCAASGYTFTNYG NWVRQQDQPMREEEEVETFAFQA EIAQLMSLIINTFYSNKEIFLRENSSDALDKTIAKSG TKAFME 303 . KRKKKRRKRRKK 304 . R RRKK FIGURE 3