DE102017115966A1 - Polypeptide molecule with improved dual specificity - Google Patents
Polypeptide molecule with improved dual specificity Download PDFInfo
- Publication number
- DE102017115966A1 DE102017115966A1 DE102017115966.5A DE102017115966A DE102017115966A1 DE 102017115966 A1 DE102017115966 A1 DE 102017115966A1 DE 102017115966 A DE102017115966 A DE 102017115966A DE 102017115966 A1 DE102017115966 A1 DE 102017115966A1
- Authority
- DE
- Germany
- Prior art keywords
- polypeptide
- molecule
- dual specificity
- cell
- binding
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 181
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 150
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 140
- 230000009977 dual effect Effects 0.000 title claims description 61
- 210000004027 cell Anatomy 0.000 claims abstract description 114
- 241000282414 Homo sapiens Species 0.000 claims abstract description 85
- 230000027455 binding Effects 0.000 claims abstract description 78
- 238000000034 method Methods 0.000 claims abstract description 33
- 239000000427 antigen Substances 0.000 claims abstract description 32
- 108091007433 antigens Proteins 0.000 claims abstract description 32
- 102000036639 antigens Human genes 0.000 claims abstract description 32
- 229940121354 immunomodulator Drugs 0.000 claims abstract description 18
- 239000012642 immune effector Substances 0.000 claims abstract description 17
- 150000007523 nucleic acids Chemical class 0.000 claims description 44
- 206010028980 Neoplasm Diseases 0.000 claims description 41
- 108020004707 nucleic acids Proteins 0.000 claims description 35
- 102000039446 nucleic acids Human genes 0.000 claims description 35
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 25
- 230000035772 mutation Effects 0.000 claims description 25
- 239000013604 expression vector Substances 0.000 claims description 22
- 239000008194 pharmaceutical composition Substances 0.000 claims description 22
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 claims description 16
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 claims description 16
- 201000011510 cancer Diseases 0.000 claims description 16
- 201000010099 disease Diseases 0.000 claims description 16
- 238000011282 treatment Methods 0.000 claims description 12
- 239000013598 vector Substances 0.000 claims description 11
- 239000003814 drug Substances 0.000 claims description 10
- 208000035475 disorder Diseases 0.000 claims description 9
- 239000003937 drug carrier Substances 0.000 claims description 9
- 239000012636 effector Substances 0.000 claims description 8
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 claims description 7
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 7
- 208000035473 Communicable disease Diseases 0.000 claims description 6
- 230000004913 activation Effects 0.000 claims description 6
- 230000015572 biosynthetic process Effects 0.000 claims description 6
- 235000018417 cysteine Nutrition 0.000 claims description 5
- 210000002865 immune cell Anatomy 0.000 claims description 4
- 230000028993 immune response Effects 0.000 claims description 4
- 230000002265 prevention Effects 0.000 claims description 4
- 101000946860 Homo sapiens T-cell surface glycoprotein CD3 epsilon chain Proteins 0.000 claims description 3
- 102100035794 T-cell surface glycoprotein CD3 epsilon chain Human genes 0.000 claims description 3
- 208000026278 immune system disease Diseases 0.000 claims description 3
- 102000006354 HLA-DR Antigens Human genes 0.000 claims description 2
- 108010058597 HLA-DR Antigens Proteins 0.000 claims description 2
- 108091008874 T cell receptors Proteins 0.000 abstract description 97
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 abstract description 92
- 108700018351 Major Histocompatibility Complex Proteins 0.000 abstract description 25
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 abstract description 25
- 108090000623 proteins and genes Proteins 0.000 description 31
- 235000018102 proteins Nutrition 0.000 description 28
- 102000004169 proteins and genes Human genes 0.000 description 28
- 230000014509 gene expression Effects 0.000 description 23
- 210000001744 T-lymphocyte Anatomy 0.000 description 22
- 239000000203 mixture Substances 0.000 description 15
- 230000006044 T cell activation Effects 0.000 description 14
- 238000011161 development Methods 0.000 description 13
- 150000003839 salts Chemical class 0.000 description 13
- 230000001225 therapeutic effect Effects 0.000 description 13
- 241000700605 Viruses Species 0.000 description 12
- 108020004414 DNA Proteins 0.000 description 11
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 11
- 238000003556 assay Methods 0.000 description 11
- 238000000746 purification Methods 0.000 description 11
- 238000004519 manufacturing process Methods 0.000 description 10
- 239000012634 fragment Substances 0.000 description 9
- 125000005647 linker group Chemical group 0.000 description 9
- 150000001413 amino acids Chemical class 0.000 description 8
- 230000000694 effects Effects 0.000 description 8
- 238000001727 in vivo Methods 0.000 description 8
- 230000001965 increasing effect Effects 0.000 description 8
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 7
- 241000894006 Bacteria Species 0.000 description 7
- 235000001014 amino acid Nutrition 0.000 description 7
- 229940024606 amino acid Drugs 0.000 description 7
- 238000005734 heterodimerization reaction Methods 0.000 description 7
- 239000011780 sodium chloride Substances 0.000 description 7
- 102100039510 Cancer/testis antigen 2 Human genes 0.000 description 6
- 229910020366 ClO 4 Inorganic materials 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 101000889345 Homo sapiens Cancer/testis antigen 2 Proteins 0.000 description 6
- 230000001419 dependent effect Effects 0.000 description 6
- 238000005516 engineering process Methods 0.000 description 6
- 108010007811 human immunodeficiency virus p17 gag peptide Proteins 0.000 description 6
- 239000011734 sodium Substances 0.000 description 6
- 230000003612 virological effect Effects 0.000 description 6
- 241000725303 Human immunodeficiency virus Species 0.000 description 5
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 5
- 208000032839 leukemia Diseases 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 238000003860 storage Methods 0.000 description 5
- 230000008685 targeting Effects 0.000 description 5
- 230000009258 tissue cross reactivity Effects 0.000 description 5
- 210000004881 tumor cell Anatomy 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- 208000003950 B-cell lymphoma Diseases 0.000 description 4
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 4
- 241000588724 Escherichia coli Species 0.000 description 4
- 108010087819 Fc receptors Proteins 0.000 description 4
- 102000009109 Fc receptors Human genes 0.000 description 4
- 102000025850 HLA-A2 Antigen Human genes 0.000 description 4
- 108010074032 HLA-A2 Antigen Proteins 0.000 description 4
- 108060003951 Immunoglobulin Proteins 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- 230000009471 action Effects 0.000 description 4
- 239000004480 active ingredient Substances 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 230000000890 antigenic effect Effects 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 4
- 229940127089 cytotoxic agent Drugs 0.000 description 4
- 231100000599 cytotoxic agent Toxicity 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 102000018358 immunoglobulin Human genes 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 201000001441 melanoma Diseases 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 230000011664 signaling Effects 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 230000006641 stabilisation Effects 0.000 description 4
- 238000011105 stabilization Methods 0.000 description 4
- 230000001960 triggered effect Effects 0.000 description 4
- -1 CD11c Proteins 0.000 description 3
- 108010041884 CD4 Immunoadhesins Proteins 0.000 description 3
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 3
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 3
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 3
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 3
- 102000043129 MHC class I family Human genes 0.000 description 3
- 108091054437 MHC class I family Proteins 0.000 description 3
- 101500027988 Mus musculus ADGRV1 subunit beta Proteins 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 3
- 108010083312 T-Cell Antigen Receptor-CD3 Complex Proteins 0.000 description 3
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 3
- 241000700647 Variola virus Species 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 238000001042 affinity chromatography Methods 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 210000000481 breast Anatomy 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 239000002254 cytotoxic agent Substances 0.000 description 3
- 238000013461 design Methods 0.000 description 3
- PQYUGUXEJHLOIL-UHFFFAOYSA-N diethoxysilyl triethyl silicate Chemical compound C(C)O[SiH](O[Si](OCC)(OCC)OCC)OCC PQYUGUXEJHLOIL-UHFFFAOYSA-N 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 208000006454 hepatitis Diseases 0.000 description 3
- 231100000283 hepatitis Toxicity 0.000 description 3
- 239000000833 heterodimer Substances 0.000 description 3
- 238000009169 immunotherapy Methods 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 210000001503 joint Anatomy 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 210000001672 ovary Anatomy 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 108091033319 polynucleotide Proteins 0.000 description 3
- 102000040430 polynucleotide Human genes 0.000 description 3
- 239000002157 polynucleotide Substances 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 238000001542 size-exclusion chromatography Methods 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 2
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 2
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 2
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 2
- 208000023275 Autoimmune disease Diseases 0.000 description 2
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 2
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 2
- 241000724653 Borna disease virus Species 0.000 description 2
- 102100024167 C-C chemokine receptor type 3 Human genes 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 241000606161 Chlamydia Species 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 2
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 241000709714 Echovirus E11 Species 0.000 description 2
- 241000709661 Enterovirus Species 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- 241000233866 Fungi Species 0.000 description 2
- 208000032612 Glial tumor Diseases 0.000 description 2
- 206010018338 Glioma Diseases 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 208000009889 Herpes Simplex Diseases 0.000 description 2
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 2
- 101000980744 Homo sapiens C-C chemokine receptor type 3 Proteins 0.000 description 2
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 2
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 2
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 2
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 2
- 108091092195 Intron Proteins 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- 241000589248 Legionella Species 0.000 description 2
- 208000007764 Legionnaires' Disease Diseases 0.000 description 2
- 241000712079 Measles morbillivirus Species 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 241000711466 Murine hepatitis virus Species 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 241000186359 Mycobacterium Species 0.000 description 2
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 2
- 230000004988 N-glycosylation Effects 0.000 description 2
- 206010029260 Neuroblastoma Diseases 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 101710160107 Outer membrane protein A Proteins 0.000 description 2
- 102000002508 Peptide Elongation Factors Human genes 0.000 description 2
- 108010068204 Peptide Elongation Factors Proteins 0.000 description 2
- KHGNFPUMBJSZSM-UHFFFAOYSA-N Perforine Natural products COC1=C2CCC(O)C(CCC(C)(C)O)(OC)C2=NC2=C1C=CO2 KHGNFPUMBJSZSM-UHFFFAOYSA-N 0.000 description 2
- 102000011755 Phosphoglycerate Kinase Human genes 0.000 description 2
- 241000224016 Plasmodium Species 0.000 description 2
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 2
- 241000589516 Pseudomonas Species 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 241000606701 Rickettsia Species 0.000 description 2
- 241000702670 Rotavirus Species 0.000 description 2
- 201000010208 Seminoma Diseases 0.000 description 2
- 241000649053 Spinach curly top Arizona virus Species 0.000 description 2
- 241000191940 Staphylococcus Species 0.000 description 2
- 206010043376 Tetanus Diseases 0.000 description 2
- 101001099217 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) Triosephosphate isomerase Proteins 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- PAAZCQANMCYGAW-UHFFFAOYSA-N acetic acid;2,2,2-trifluoroacetic acid Chemical class CC(O)=O.OC(=O)C(F)(F)F PAAZCQANMCYGAW-UHFFFAOYSA-N 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 230000009824 affinity maturation Effects 0.000 description 2
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 230000001588 bifunctional effect Effects 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- LYQFWZFBNBDLEO-UHFFFAOYSA-M caesium bromide Chemical compound [Br-].[Cs+] LYQFWZFBNBDLEO-UHFFFAOYSA-M 0.000 description 2
- AIYUHDOJVYHVIT-UHFFFAOYSA-M caesium chloride Chemical compound [Cl-].[Cs+] AIYUHDOJVYHVIT-UHFFFAOYSA-M 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 2
- 229960004316 cisplatin Drugs 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 201000005787 hematologic cancer Diseases 0.000 description 2
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 2
- 239000013628 high molecular weight specie Substances 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 230000016784 immunoglobulin production Effects 0.000 description 2
- 239000002955 immunomodulating agent Substances 0.000 description 2
- 239000012678 infectious agent Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 230000035987 intoxication Effects 0.000 description 2
- 231100000566 intoxication Toxicity 0.000 description 2
- 229910052740 iodine Inorganic materials 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- AMXOYNBUYSYVKV-UHFFFAOYSA-M lithium bromide Chemical compound [Li+].[Br-] AMXOYNBUYSYVKV-UHFFFAOYSA-M 0.000 description 2
- KWGKDLIKAYFUFQ-UHFFFAOYSA-M lithium chloride Chemical compound [Li+].[Cl-] KWGKDLIKAYFUFQ-UHFFFAOYSA-M 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 230000036210 malignancy Effects 0.000 description 2
- 230000000813 microbial effect Effects 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 238000011275 oncology therapy Methods 0.000 description 2
- 210000000496 pancreas Anatomy 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 229930192851 perforin Natural products 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 210000002307 prostate Anatomy 0.000 description 2
- 108020001580 protein domains Proteins 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 229940051173 recombinant immunotoxin Drugs 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 230000001177 retroviral effect Effects 0.000 description 2
- 230000002000 scavenging effect Effects 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 210000003491 skin Anatomy 0.000 description 2
- JHJLBTNAGRQEKS-UHFFFAOYSA-M sodium bromide Chemical compound [Na+].[Br-] JHJLBTNAGRQEKS-UHFFFAOYSA-M 0.000 description 2
- 229910000162 sodium phosphate Inorganic materials 0.000 description 2
- 239000001488 sodium phosphate Substances 0.000 description 2
- 210000000952 spleen Anatomy 0.000 description 2
- 230000000087 stabilizing effect Effects 0.000 description 2
- 239000008223 sterile water Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 208000001608 teratocarcinoma Diseases 0.000 description 2
- SRVJKTDHMYAMHA-WUXMJOGZSA-N thioacetazone Chemical compound CC(=O)NC1=CC=C(\C=N\NC(N)=S)C=C1 SRVJKTDHMYAMHA-WUXMJOGZSA-N 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- 230000009385 viral infection Effects 0.000 description 2
- BUHVIAUBTBOHAG-FOYDDCNASA-N (2r,3r,4s,5r)-2-[6-[[2-(3,5-dimethoxyphenyl)-2-(2-methylphenyl)ethyl]amino]purin-9-yl]-5-(hydroxymethyl)oxolane-3,4-diol Chemical compound COC1=CC(OC)=CC(C(CNC=2C=3N=CN(C=3N=CN=2)[C@H]2[C@@H]([C@H](O)[C@@H](CO)O2)O)C=2C(=CC=CC=2)C)=C1 BUHVIAUBTBOHAG-FOYDDCNASA-N 0.000 description 1
- WOWDZACBATWTAU-FEFUEGSOSA-N (2s)-2-[[(2s)-2-(dimethylamino)-3-methylbutanoyl]amino]-n-[(3r,4s,5s)-1-[(2s)-2-[(1r,2r)-3-[[(1s,2r)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-n,3-dimethylbutanamide Chemical compound CC(C)[C@H](N(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)C1=CC=CC=C1 WOWDZACBATWTAU-FEFUEGSOSA-N 0.000 description 1
- PNDPGZBMCMUPRI-HVTJNCQCSA-N 10043-66-0 Chemical compound [131I][131I] PNDPGZBMCMUPRI-HVTJNCQCSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 208000036762 Acute promyelocytic leukaemia Diseases 0.000 description 1
- MQIGTEQXYCRLGK-BQBZGAKWSA-N Ala-Gly-Pro Chemical compound C[C@H](N)C(=O)NCC(=O)N1CCC[C@H]1C(O)=O MQIGTEQXYCRLGK-BQBZGAKWSA-N 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 206010003571 Astrocytoma Diseases 0.000 description 1
- 241000711404 Avian avulavirus 1 Species 0.000 description 1
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 1
- 241001289141 Babr Species 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 241000193738 Bacillus anthracis Species 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 108010077805 Bacterial Proteins Proteins 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 208000020084 Bone disease Diseases 0.000 description 1
- 241000588832 Bordetella pertussis Species 0.000 description 1
- 241000589969 Borreliella burgdorferi Species 0.000 description 1
- 241000711443 Bovine coronavirus Species 0.000 description 1
- 102100032912 CD44 antigen Human genes 0.000 description 1
- 241000222122 Candida albicans Species 0.000 description 1
- 101100112922 Candida albicans CDR3 gene Proteins 0.000 description 1
- 208000014912 Central Nervous System Infections Diseases 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 206010008631 Cholera Diseases 0.000 description 1
- 235000008733 Citrus aurantifolia Nutrition 0.000 description 1
- 102100026735 Coagulation factor VIII Human genes 0.000 description 1
- 102000000989 Complement System Proteins Human genes 0.000 description 1
- 108010069112 Complement System Proteins Proteins 0.000 description 1
- 102100025680 Complement decay-accelerating factor Human genes 0.000 description 1
- 206010010356 Congenital anomaly Diseases 0.000 description 1
- 241000709687 Coxsackievirus Species 0.000 description 1
- OABOXRPGTFRBFZ-IMJSIDKUSA-N Cys-Cys Chemical compound SC[C@H](N)C(=O)N[C@@H](CS)C(O)=O OABOXRPGTFRBFZ-IMJSIDKUSA-N 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- AEMOLEFTQBMNLQ-AQKNRBDQSA-N D-glucopyranuronic acid Chemical compound OC1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O AEMOLEFTQBMNLQ-AQKNRBDQSA-N 0.000 description 1
- 208000001490 Dengue Diseases 0.000 description 1
- 206010012310 Dengue fever Diseases 0.000 description 1
- 241000725619 Dengue virus Species 0.000 description 1
- 102000016911 Deoxyribonucleases Human genes 0.000 description 1
- 108010053770 Deoxyribonucleases Proteins 0.000 description 1
- 206010058314 Dysplasia Diseases 0.000 description 1
- 201000011001 Ebola Hemorrhagic Fever Diseases 0.000 description 1
- 241001466953 Echovirus Species 0.000 description 1
- 241000204855 Echovirus E1 Species 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 241000305071 Enterobacterales Species 0.000 description 1
- 241000194032 Enterococcus faecalis Species 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 101710082714 Exotoxin A Proteins 0.000 description 1
- 108010054218 Factor VIII Proteins 0.000 description 1
- 102000001690 Factor VIII Human genes 0.000 description 1
- 201000003542 Factor VIII deficiency Diseases 0.000 description 1
- 241000714165 Feline leukemia virus Species 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 241000710198 Foot-and-mouth disease virus Species 0.000 description 1
- 241001663880 Gammaretrovirus Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 241000713813 Gibbon ape leukemia virus Species 0.000 description 1
- 102100035716 Glycophorin-A Human genes 0.000 description 1
- 102000001398 Granzyme Human genes 0.000 description 1
- 108060005986 Granzyme Proteins 0.000 description 1
- 208000031886 HIV Infections Diseases 0.000 description 1
- 108010075704 HLA-A Antigens Proteins 0.000 description 1
- 102000011786 HLA-A Antigens Human genes 0.000 description 1
- 241000589989 Helicobacter Species 0.000 description 1
- 208000009292 Hemophilia A Diseases 0.000 description 1
- 241000700721 Hepatitis B virus Species 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 1
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 1
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 1
- 101000911390 Homo sapiens Coagulation factor VIII Proteins 0.000 description 1
- 101000856022 Homo sapiens Complement decay-accelerating factor Proteins 0.000 description 1
- 101001074244 Homo sapiens Glycophorin-A Proteins 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101001042104 Homo sapiens Inducible T-cell costimulator Proteins 0.000 description 1
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 1
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 1
- 101001015004 Homo sapiens Integrin beta-3 Proteins 0.000 description 1
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 1
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 1
- 101000998120 Homo sapiens Interleukin-3 receptor subunit alpha Proteins 0.000 description 1
- 101000960936 Homo sapiens Interleukin-5 receptor subunit alpha Proteins 0.000 description 1
- 101000608935 Homo sapiens Leukosialin Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- 101000934372 Homo sapiens Macrosialin Proteins 0.000 description 1
- 101001008874 Homo sapiens Mast/stem cell growth factor receptor Kit Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 1
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 description 1
- 101000971513 Homo sapiens Natural killer cells antigen CD94 Proteins 0.000 description 1
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 1
- 101000897042 Homo sapiens Nucleotide pyrophosphatase Proteins 0.000 description 1
- 101001071312 Homo sapiens Platelet glycoprotein IX Proteins 0.000 description 1
- 101001070790 Homo sapiens Platelet glycoprotein Ib alpha chain Proteins 0.000 description 1
- 101000611936 Homo sapiens Programmed cell death protein 1 Proteins 0.000 description 1
- 101000914496 Homo sapiens T-cell antigen CD7 Proteins 0.000 description 1
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 1
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 1
- 101000800116 Homo sapiens Thy-1 membrane glycoprotein Proteins 0.000 description 1
- 101000638255 Homo sapiens Tumor necrosis factor ligand superfamily member 8 Proteins 0.000 description 1
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 1
- 101000679851 Homo sapiens Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 1
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 241000702617 Human parvovirus B19 Species 0.000 description 1
- 241000282620 Hylobates sp. Species 0.000 description 1
- 108010073816 IgE Receptors Proteins 0.000 description 1
- 102000009438 IgE Receptors Human genes 0.000 description 1
- 108010073807 IgG Receptors Proteins 0.000 description 1
- 102000009490 IgG Receptors Human genes 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 102100021317 Inducible T-cell costimulator Human genes 0.000 description 1
- 102100022338 Integrin alpha-M Human genes 0.000 description 1
- 102100022297 Integrin alpha-X Human genes 0.000 description 1
- 102100025390 Integrin beta-2 Human genes 0.000 description 1
- 102100032999 Integrin beta-3 Human genes 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 1
- 102100033493 Interleukin-3 receptor subunit alpha Human genes 0.000 description 1
- 102100039881 Interleukin-5 receptor subunit alpha Human genes 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- 206010023347 Keratoacanthoma Diseases 0.000 description 1
- 241000588747 Klebsiella pneumoniae Species 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 241000222734 Leishmania mexicana Species 0.000 description 1
- 208000004554 Leishmaniasis Diseases 0.000 description 1
- 241000713666 Lentivirus Species 0.000 description 1
- LESXFEZIFXFIQR-LURJTMIESA-N Leu-Gly Chemical compound CC(C)C[C@H](N)C(=O)NCC(O)=O LESXFEZIFXFIQR-LURJTMIESA-N 0.000 description 1
- 102100039564 Leukosialin Human genes 0.000 description 1
- 229910018119 Li 3 PO 4 Inorganic materials 0.000 description 1
- 229910013684 LiClO 4 Inorganic materials 0.000 description 1
- 229910013553 LiNO Inorganic materials 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 208000016604 Lyme disease Diseases 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 102000043131 MHC class II family Human genes 0.000 description 1
- 108091054438 MHC class II family Proteins 0.000 description 1
- 102100025136 Macrosialin Human genes 0.000 description 1
- 241000283923 Marmota monax Species 0.000 description 1
- 102100027754 Mast/stem cell growth factor receptor Kit Human genes 0.000 description 1
- 206010027260 Meningitis viral Diseases 0.000 description 1
- 206010054949 Metaplasia Diseases 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 241000712045 Morbillivirus Species 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- 241000714177 Murine leukemia virus Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 241000204031 Mycoplasma Species 0.000 description 1
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 1
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 1
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 description 1
- 102100021462 Natural killer cells antigen CD94 Human genes 0.000 description 1
- 241000588653 Neisseria Species 0.000 description 1
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 1
- 102000003729 Neprilysin Human genes 0.000 description 1
- 108090000028 Neprilysin Proteins 0.000 description 1
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 102100021969 Nucleotide pyrophosphatase Human genes 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 241000150452 Orthohantavirus Species 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 208000030852 Parasitic disease Diseases 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 201000005702 Pertussis Diseases 0.000 description 1
- 206010035148 Plague Diseases 0.000 description 1
- 241000223960 Plasmodium falciparum Species 0.000 description 1
- 102000004211 Platelet factor 4 Human genes 0.000 description 1
- 108090000778 Platelet factor 4 Proteins 0.000 description 1
- 102100036851 Platelet glycoprotein IX Human genes 0.000 description 1
- 102100034173 Platelet glycoprotein Ib alpha chain Human genes 0.000 description 1
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 1
- 241000588767 Proteus vulgaris Species 0.000 description 1
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- 108091027981 Response element Proteins 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 208000006257 Rinderpest Diseases 0.000 description 1
- 241000710799 Rubella virus Species 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 241000607768 Shigella Species 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 241000194017 Streptococcus Species 0.000 description 1
- 241000193998 Streptococcus pneumoniae Species 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- 239000012505 Superdex™ Substances 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 102100027208 T-cell antigen CD7 Human genes 0.000 description 1
- 206010042971 T-cell lymphoma Diseases 0.000 description 1
- 208000027585 T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 1
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical group OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 1
- 102100033523 Thy-1 membrane glycoprotein Human genes 0.000 description 1
- 208000033781 Thyroid carcinoma Diseases 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 235000011941 Tilia x europaea Nutrition 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 241000223104 Trypanosoma Species 0.000 description 1
- 102100032100 Tumor necrosis factor ligand superfamily member 8 Human genes 0.000 description 1
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 1
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 1
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 description 1
- 229940127174 UCHT1 Drugs 0.000 description 1
- 108090000848 Ubiquitin Proteins 0.000 description 1
- 102000044159 Ubiquitin Human genes 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 102100022748 Wilms tumor protein Human genes 0.000 description 1
- 101710127857 Wilms tumor protein Proteins 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- VWQVUPCCIRVNHF-OUBTZVSYSA-N Yttrium-90 Chemical compound [90Y] VWQVUPCCIRVNHF-OUBTZVSYSA-N 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- QQINRWTZWGJFDB-YPZZEJLDSA-N actinium-225 Chemical compound [225Ac] QQINRWTZWGJFDB-YPZZEJLDSA-N 0.000 description 1
- 229940125666 actinium-225 Drugs 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 230000000735 allogeneic effect Effects 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 239000003708 ampul Substances 0.000 description 1
- 239000004037 angiogenesis inhibitor Substances 0.000 description 1
- 229940121369 angiogenesis inhibitor Drugs 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 239000002260 anti-inflammatory agent Substances 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 229910052789 astatine Inorganic materials 0.000 description 1
- RYXHOMYVWAEKHL-UHFFFAOYSA-N astatine atom Chemical compound [At] RYXHOMYVWAEKHL-UHFFFAOYSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000008033 biological extinction Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- JCXGWMGPZLAOME-OUBTZVSYSA-N bismuth-210 Chemical compound [210Bi] JCXGWMGPZLAOME-OUBTZVSYSA-N 0.000 description 1
- JCXGWMGPZLAOME-RNFDNDRNSA-N bismuth-213 Chemical compound [213Bi] JCXGWMGPZLAOME-RNFDNDRNSA-N 0.000 description 1
- 229960003008 blinatumomab Drugs 0.000 description 1
- 229940101815 blincyto Drugs 0.000 description 1
- 229930195731 calicheamicin Natural products 0.000 description 1
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 1
- 238000002619 cancer immunotherapy Methods 0.000 description 1
- 229940095731 candida albicans Drugs 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 208000015114 central nervous system disease Diseases 0.000 description 1
- 208000025222 central nervous system infectious disease Diseases 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 210000003679 cervix uteri Anatomy 0.000 description 1
- QUPYHCHUQVNFJW-UHFFFAOYSA-M cesium;thiocyanate Chemical compound [Cs+].[S-]C#N QUPYHCHUQVNFJW-UHFFFAOYSA-M 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 208000029664 classic familial adenomatous polyposis Diseases 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 230000004154 complement system Effects 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 230000001143 conditioned effect Effects 0.000 description 1
- 239000002872 contrast media Substances 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 108010004073 cysteinylcysteine Proteins 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 239000002619 cytotoxin Substances 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 208000025729 dengue disease Diseases 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 238000000375 direct analysis in real time Methods 0.000 description 1
- 208000037765 diseases and disorders Diseases 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 238000012063 dual-affinity re-targeting Methods 0.000 description 1
- 210000003162 effector t lymphocyte Anatomy 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 230000001804 emulsifying effect Effects 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 206010014599 encephalitis Diseases 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 229940032049 enterococcus faecalis Drugs 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 229960000301 factor viii Drugs 0.000 description 1
- 239000012527 feed solution Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 235000013312 flour Nutrition 0.000 description 1
- 201000003444 follicular lymphoma Diseases 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229940097042 glucuronate Drugs 0.000 description 1
- YQEMORVAKMFKLG-UHFFFAOYSA-N glycerine monostearate Natural products CCCCCCCCCCCCCCCCCC(=O)OC(CO)CO YQEMORVAKMFKLG-UHFFFAOYSA-N 0.000 description 1
- SVUQHVRAGMNPLW-UHFFFAOYSA-N glycerol monostearate Natural products CCCCCCCCCCCCCCCCC(=O)OCC(O)CO SVUQHVRAGMNPLW-UHFFFAOYSA-N 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 108010050848 glycylleucine Proteins 0.000 description 1
- 208000005252 hepatitis A Diseases 0.000 description 1
- 229960002885 histidine Drugs 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 230000003463 hyperproliferative effect Effects 0.000 description 1
- 229960001101 ifosfamide Drugs 0.000 description 1
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 210000000428 immunological synapse Anatomy 0.000 description 1
- 239000003022 immunostimulating agent Substances 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- APFVFJFRJDLVQX-AHCXROLUSA-N indium-111 Chemical compound [111In] APFVFJFRJDLVQX-AHCXROLUSA-N 0.000 description 1
- 229940055742 indium-111 Drugs 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 208000037797 influenza A Diseases 0.000 description 1
- 208000037798 influenza B Diseases 0.000 description 1
- 208000037799 influenza C Diseases 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 239000004571 lime Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- WKPWGQKGSOKKOO-RSFHAFMBSA-N maytansine Chemical class CO[C@@H]([C@@]1(O)C[C@](OC(=O)N1)([C@H]([C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(C)=O)CC(=O)N1C)C)[H])\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 WKPWGQKGSOKKOO-RSFHAFMBSA-N 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 230000015689 metaplastic ossification Effects 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 229960001156 mitoxantrone Drugs 0.000 description 1
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 108010068617 neonatal Fc receptor Proteins 0.000 description 1
- 208000007538 neurilemmoma Diseases 0.000 description 1
- 230000005937 nuclear translocation Effects 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 238000012634 optical imaging Methods 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 230000005298 paramagnetic effect Effects 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 210000001428 peripheral nervous system Anatomy 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- 210000004214 philadelphia chromosome Anatomy 0.000 description 1
- 229940109328 photofrin Drugs 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 230000001124 posttranscriptional effect Effects 0.000 description 1
- ZNNZYHKDIALBAK-UHFFFAOYSA-M potassium thiocyanate Chemical compound [K+].[S-]C#N ZNNZYHKDIALBAK-UHFFFAOYSA-M 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- QQONPFPTGQHPMA-UHFFFAOYSA-N propylene Natural products CC=C QQONPFPTGQHPMA-UHFFFAOYSA-N 0.000 description 1
- 125000004805 propylene group Chemical group [H]C([H])([H])C([H])([*:1])C([H])([H])[*:2] 0.000 description 1
- 229940007042 proteus vulgaris Drugs 0.000 description 1
- UOWVMDUEMSNCAV-WYENRQIDSA-N rachelmycin Chemical compound C1([C@]23C[C@@H]2CN1C(=O)C=1NC=2C(OC)=C(O)C4=C(C=2C=1)CCN4C(=O)C1=CC=2C=4CCN(C=4C(O)=C(C=2N1)OC)C(N)=O)=CC(=O)C1=C3C(C)=CN1 UOWVMDUEMSNCAV-WYENRQIDSA-N 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000007634 remodeling Methods 0.000 description 1
- 231100000205 reproductive and developmental toxicity Toxicity 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- WUAPFZMCVAUBPE-IGMARMGPSA-N rhenium-186 Chemical compound [186Re] WUAPFZMCVAUBPE-IGMARMGPSA-N 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 239000000741 silica gel Substances 0.000 description 1
- 229910002027 silica gel Inorganic materials 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- SUKJFIGYRHOWBL-UHFFFAOYSA-N sodium hypochlorite Chemical compound [Na+].Cl[O-] SUKJFIGYRHOWBL-UHFFFAOYSA-N 0.000 description 1
- RYYKJJJTJZKILX-UHFFFAOYSA-M sodium octadecanoate Chemical compound [Na+].CCCCCCCCCCCCCCCCCC([O-])=O RYYKJJJTJZKILX-UHFFFAOYSA-M 0.000 description 1
- VGTPCRGMBIAPIM-UHFFFAOYSA-M sodium thiocyanate Chemical compound [Na+].[S-]C#N VGTPCRGMBIAPIM-UHFFFAOYSA-M 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 206010041823 squamous cell carcinoma Diseases 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 229940031000 streptococcus pneumoniae Drugs 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 230000000153 supplemental effect Effects 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 229960004964 temozolomide Drugs 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- 208000013077 thyroid gland carcinoma Diseases 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000012250 transgenic expression Methods 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 231100000588 tumorigenic Toxicity 0.000 description 1
- 230000000381 tumorigenic effect Effects 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241000007181 unidentified human coronavirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 201000010044 viral meningitis Diseases 0.000 description 1
- 244000052613 viral pathogen Species 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1036—Retroviridae, e.g. leukemia viruses
- C07K16/1045—Lentiviridae, e.g. HIV, FIV, SIV
- C07K16/1054—Lentiviridae, e.g. HIV, FIV, SIV gag-pol, e.g. p17, p24
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2833—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/32—Immunoglobulins specific features characterized by aspects of specificity or valency specific for a neo-epitope on a complex, e.g. antibody-antigen or ligand-receptor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/64—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Virology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- AIDS & HIV (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Communicable Diseases (AREA)
- Cell Biology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Hematology (AREA)
- Peptides Or Proteins (AREA)
Abstract
Die vorliegende Erfindung bezieht sich auf ein bispezifisches Polypeptidmolekül, das eine erste Polypeptidkette und eine zweite Polypeptidkette umfasst, welche eine Bindungsregion bereitstellen, die von einem T-Zell-Rezeptor (TCR) stammt, der für ein Peptidepitop, das an einen Haupthistokompatibilitätskomplex (MHC) gebunden ist, spezifisch ist und auf eine Bindungsregion, die von einem Antikörper stammt, der in der Lage ist, humane Immuneffektorzellen zu rekrutieren, indem er spezifisch an ein Oberflächenantigen dieser Zellen bindet, sowie Verfahren zur Erzeugung des bispezifischen Polypeptidmoleküls und deren Verwendung.The present invention relates to a bispecific polypeptide molecule comprising a first polypeptide chain and a second polypeptide chain which provide a binding region derived from a T cell receptor (TCR) that is responsible for a peptide epitope attached to a major histocompatibility complex (MHC). is bound to a binding region derived from an antibody capable of recruiting human immune effector cells by binding specifically to a surface antigen of these cells, as well as methods for producing the bispecific polypeptide molecule and their use.
Description
Die vorliegende Erfindung bezieht sich auf ein bispezifisches Polypeptidmolekül, das eine erste Polypeptidkette und eine zweite Polypeptidkette umfasst, welche eine Bindungsregion bereitstellen, die von einem T-Zell-Rezeptor (
Hintergrund der ErfindungBackground of the invention
Durch die Entwicklung der molekularen Klontechnik und dem tiefgehenden Verständnis der Antikörperherstellung stehen verschiedene bispezifische Antikörperformate zur Verfügung, unter denen man wählen kann, um eine optimale biologische Wirkung zu erzielen und das medizinische Ziel zu erreichen. Bei der Krebstherapie wurden bispezifische Antikörper mit dem Ziel entwickelt, die Aktivität der Immuneffektorzellen durch eine erste Bindungsdomäne, die spezifisch für ein Epitop auf Tumorzellen ist und eine zweite Bindungsdomäne, die spezifisch für ein Epitop auf den Immuneffektorzellen ist, auf den Ort des Tumors neu auszurichten. Bispezifische Antikörper für das Retargeting von Immuneffektorzellen wurden in verschiedenen Formaten entwickelt, einschließlich Formaten ohne eine Fragment-kristallisierbare (Fc) Region und von IgG stammenden Formaten mit einem symmetrischen oder asymmetrischen Aufbau. Neben dem Retargeting von Effektorzellen zu dem Krebsort wurden neue Anwendungen für bispezifische Antikörper eingeführt. Bispezifische Moleküle, die zwei korrelierende Signalmoleküle zur selben Zeit inhibieren können, können entwickelt werden, um eine angeborene oder erworbene Resistenz zu überwinden und zu wirksameren Angiogenese-Inhibitoren zu werden. Darüber hinaus können bispezifische Antikörper als vielversprechende immunstimulierende Wirkstoffe zur Behandlung von verschiedenen Krankheiten wie zum Beispiel Krebs verwendet werden. Bispezifische Antikörper können auch verwendet werden, um Hämophilie A durch die Nachahmung der Funktionsweise des Faktor VIII zu behandeln. Bispezifische Antikörper haben Aussichten auf eine breite Anwendung bei Knochenkrankheiten und Infektionen und Erkrankungen des zentralen Nervensystems (besprochen in
Seit jeher diente die Entdeckung und Herstellung von variablen, einzelkettigverbundenen Antikörperdomänen (scFvs, beschrieben von Bird u. a. 1988) als ein Hauptantrieb für die Entwicklung von bispezifischen Antikörpern. Dieses Konzept führte schließlich zur Erzeugung von BiTE-Molekülen und deren klinischer Erprobung als wirksames Arzneimittel zur Behandlung von Leukämie (Baeuerle u. a. 2009). Im Falle einer Krebserkrankung lösen bispezifische Antikörper, welche die CD3-Epsilon-Untereinheit und ein Oberflächenantigen auf der Tumorzelle ineinander eingreifen lassen, das T-Zell-vermittelte Töten der Tumorzelle aus, während die Notwendigkeit des direkten Zusammenwirkens des
Stieglmaier J., u. a. (in:
Jedoch hat man herausgefunden, dass kleine, bispezifische Moleküle wie z.B. BiTEs den Nachteil aufweisen, dass sie nur geringe Produktionsausbeuten ergeben, komplizierte Aufreinigungsverfahren erfordern, zur Aggregation neigen und auch eine sehr kurze Serum-Halbwertszeit aufweisen. Um die inhärenten Beschränkungen dieser Klasse von Molekülen zu überwinden, wurden verschiedene bispezifische Formate auf der Grundlage von humanem IgG entwickelt, ausgehend von dem Konzept der rekombinanten bispezifischen Antikörper, die dem Prototyp Immunglobulin (Ig) G ähnlich sind, wie er vor mehr als zwei Jahrzehnten entwickelt wurde, als Morrison und Kollegen flexible Linker-Peptide mit den C-Termini der schweren Ketten von IgG fusionierten, gefolgt von einzelkettigen variablen Domänen mit verschiedenen Bindungsspezifitäten (
Die Entwicklung von auf IgG basierenden bispezifischen Formaten wurde weiterhin durch das Erscheinen und die Einbeziehung von erzeugten Mutationen gefördert, um die Heterodimerisierung von zwei unterschiedlichen CH3-Domänen zu erleichtern und dadurch zwei unterschiedliche Polypeptidketten zu verbinden. Das grundlegende Konzept wurde durch Ridgway JB u. a. (in:
Weitere Konzepte für das Herstellen von heterodimären Molekülen wurden von Muda u. a. 2011 offenbart, PEDS (Therapeutic assessment of SEED: a new engineered antibody platform designed to generate mono- and bispecific antibodies.); Gunasekaran u. a. 2010, J Biol Chem (Enhancing antibody Fc heterodimer formation through electrostatic steering effects: applications to bispecific molecules and monovalent IgG.); Moore u. a. 2011, MAbs (A novel bispecific antibody format enables simultaneous bivalent and monovalent co-engagement of distinct target antigens.); Von Kreudenstein u. a. 2013, MAbs (Improving biophysical properties of a bispecific antibody scaffold to aid developability: quality by molecular design.) Diese Konzepte werden von Ha u. a. 2016, Front Immunol (Immunoglobulin Fc Heterodimer Platform Technology: From Design to Application in Therapeutic Antibodies and Proteins) und Liu u. a. 2017, Front Immunol (Fc Engineering for Developing Therapeutic Bispecific Antibodies and Novel scaffolds) zusammengefasst und überprüft.Other concepts for producing heterodimeric molecules have been described by Muda et al. a. 2011 discloses PEDS (Therapeutic assessment of SEED: a new engineered antibody platform designed to generate mono- and bispecific antibodies.); Gunasekaran u. a. 2010, J Biol Chem (Enhancing antibody Fc heterodimer formation through electrostatic steering effects: applications to bispecific and monovalent IgG.); Moore u. a. 2011, MAbs (A novel bispecific antibody format enabling simultaneous bivalent and monovalent co-engagement of distinct target antigens.); From Kreudenstein u. a. 2013, MAbs (Improving biophysical properties of a bispecific antibody scaffold to aid developability: quality by molecular design.) These concepts are used by Ha u. a. 2016, Front Immunol (Immunoglobulin Fc Heterodimer Platform Technology: From Design to Application in Therapeutic Antibodies and Proteins) and Liu et al. a. 2017, Front Immunol (Fc Engineering for Developing Therapeutic Bispecific Antibodies and Novel scaffolds) reviewed and reviewed.
Mit der Einbeziehung von Fc-Teilen, die aus Gelenken [Hinges],
Morgan u. a. 1995, Immunology (The N-terminal end of the
Dual Affinity Retargeting (DART) Moleküle werden verwendet, um zum Beispiel eine Zerstörung von B-Zell-Lymphomen durch optimal umgelenkte T-Zellen zu erreichen. Dual Affinity Retargeting (DART) molecules are used, for example, to target the destruction of B cell lymphomas by optimally inverted T cells.
Die originale DART-Technologie ist in Moore u. a. beschrieben (in:
Das aßTCR (
Im Unterschied zu dem full-length
McCormack E, u. a. (in:
Es ist eine Aufgabe der vorliegenden Erfindung, verbesserte bispezifische Moleküle bereitzustellen, die in der Lage sind, sich auf Peptid-MHC-Komplexe auszurichten, die einfach hergestellt werden können, eine hohe Stabilität zeigen und darüber hinaus eine hohe Wirksamkeit entfalten, wenn sie sich an die jeweiligen Antigenepitope binden. Andere Aufgaben und Vorteile der vorliegenden Erfindung werden offensichtlich, wenn man die folgende Beschreibung und deren bevorzugte Ausführungsformen sowie die jeweiligen Beispiele untersucht.It is an object of the present invention to provide improved bispecific molecules capable of targeting peptide-MHC complexes which are easily prepared, show high stability, and moreover exhibit high activity when attached bind the respective antigen epitopes. Other objects and advantages of the present invention will become apparent upon examining the following description and preferred embodiments thereof as well as the respective examples.
Unter einem ersten Aspekt der Erfindung wird die oben aufgeführte Aufgabe dadurch gelöst, dass ein Polypeptidmolekül mit zweifacher Spezifität bereitgestellt wird, das eine erste Polypeptidkette und eine zweite Polypeptidkette umfasst, wobei: die erste Polypeptidkette eine erste Bindungsregion einer variablen Domäne (
Bevorzugt bindet das Polypeptidmolekül mit zweifacher Spezifität gemäß der vorliegenden Erfindung mit hoher Spezifität sowohl an das Immuneffektorzellantigen als auch an ein spezifisches Antigenepitop, das als ein Peptid-MHC-Komplex z. B. mit einer Bindungsaffinität (
Das erfindungsgemäße Polypeptidmolekül mit zweifacher Spezifität gemäß der vorliegenden Erfindung wird hier durch ein Polypeptidmolekül mit zweifacher Spezifität dargestellt, das eine erste Polypeptidkette mit SEQ ID No. 16 und eine zweite Polypeptidkette mit SEQ ID No. 17 umfasst, beispielhaft dargestellt.The double specificity polypeptide molecule of the present invention according to the present invention is represented herein by a double specificity polypeptide molecule comprising a first polypeptide chain of SEQ ID NO. 16 and a second polypeptide chain with SEQ ID NO. 17, exemplified.
Unter einem zweiten Aspekt der Erfindung wird die oben dargestellte Aufgabe gelöst, indem eine Nukleinsäure(n) bereitgestellt werden, die für eine erste Polypeptidkette und / oder eine zweite Polypeptidkette kodieren, wie vorliegend offenbart, oder für einen Expressionsvektor(en), die diese Nukleinsäure umfassen, kodieren. Unter einem dritten Aspekt der Erfindung wird die oben dargestellt Aufgabe gelöst, indem eine Wirtszelle, die einen Vektor / Vektoren umfasst, wie vorliegend definiert, bereitgestellt wird.In a second aspect of the invention, the above object is achieved by providing a nucleic acid (s) encoding a first polypeptide chain and / or a second polypeptide chain, as disclosed herein, or an expression vector (s) containing that nucleic acid include, encode. In a third aspect of the invention, the object set forth above is achieved by providing a host cell comprising a vector / vectors as defined herein.
Unter einem vierten Aspekt der Erfindung wird die oben dargestellte Aufgabe gelöst, indem ein Verfahren zur Herstellung eines Polypeptidmoleküls mit zweifacher Spezifität gemäß der vorliegenden Erfindung bereitgestellt wird, welches die geeignete Expression in einer geeigneten Wirtszelle dieses Expressionsvektors / dieser Expressionsvektoren, welche(r), wie offenbart, die Nukleinsäure(n) umfasst / umfassen, und die geeignete Aufreinigung des Moleküls / der Moleküle von der Zelle und/oder deren Medium umfasst.In a fourth aspect of the invention, the above object is achieved by providing a method of producing a dual specificity polypeptide molecule according to the present invention which comprises appropriate expression in a suitable host cell of said expression vector (s), such as which comprises nucleic acid (s), and comprises the appropriate purification of the molecule (s) from the cell and / or its medium.
Unter einem fünften Aspekt der Erfindung wird die oben dargestellte Aufgabe dadurch gelöst, dass eine pharmazeutische Zusammensetzung bereitgestellt wird, welche das Polypeptidmolekül mit zweifacher Spezifität gemäß der Erfindung, die Nukleinsäure oder den / die Expressionsvektor(en) gemäß der Erfindung oder die Zelle gemäß der Erfindung zusammen mit einem oder mehreren pharmazeutisch annehmbaren Träger(n) oder Hilfsstoff(en) umfasst.In a fifth aspect of the invention, the above object is achieved by providing a pharmaceutical composition comprising the double specificity polypeptide molecule according to the invention, the nucleic acid or the expression vector (s) according to the invention or the cell according to the invention together with one or more pharmaceutically acceptable carrier (s) or excipient (s).
Unter einem sechsten Aspekt der Erfindung bezieht sich die Erfindung auf das Polypeptidmolekül mit zweifacher Spezifität gemäß der Erfindung, die Nukleinsäure(n) oder den / die Expressionsvektor(en) gemäß der Erfindung, die Zelle gemäß der Erfindung oder die pharmazeutische Zusammensetzung gemäß der Erfindung zur medizinischen Verwendung.In a sixth aspect of the invention, the invention relates to the polypeptide molecule having dual specificity according to the invention, the nucleic acid (s) or the expression vector (s) according to the invention, the cell according to the invention or the pharmaceutical composition according to the invention medical use.
Unter einem siebten Aspekt der Erfindung bezieht sich die Erfindung auf das Polypeptidmolekül mit zweifacher Spezifität gemäß der Erfindung, die Nukleinsäure oder den / die Expressionsvektor(en) gemäß der Erfindung, die Zelle gemäß der Erfindung oder die pharmazeutische Zusammensetzung gemäß der Erfindung zur Verwendung bei der Behandlung einer Krankheit oder Störung, wie in dieser Patentschrift offenbart, insbesondere ausgewählt unter Krebserkrankungen und infektiösen Erkrankungen.In a seventh aspect of the invention, the invention relates to the polypeptide molecule of dual specificity according to the invention, the nucleic acid or the expression vector (s) according to the invention, the cell according to the invention or the pharmaceutical composition according to the invention for use in the Treatment of a disease or disorder as disclosed in this patent, especially selected from cancers and infectious diseases.
Unter einem achten Aspekt der Erfindung bezieht sich die Erfindung auf ein Verfahren zur Behandlung einer Krankheit oder Störung, welche das Verabreichen einer therapeutisch wirksamen Menge des Polypeptidmoleküls mit zweifacher Spezifität gemäß der Erfindung, der Nukleinsäure oder des / der Expressionsvektor(en) gemäß der Erfindung, der Zelle gemäß der Erfindung oder der pharmazeutischen Zusammensetzung gemäß der Erfindung umfasst.In an eighth aspect of the invention, the invention relates to a method of treating a disease or disorder comprising administering a therapeutically effective amount of the double specificity polypeptide molecule according to the invention, the nucleic acid or the expression vector (s) according to the invention, the cell according to the invention or the pharmaceutical composition according to the invention.
Wie oben erwähnt, stellt die Erfindung neue und verbesserte Polypeptidmoleküle mit zweifacher Spezifität bereit. Die Moleküle umfassen üblicherweise eine erste Polypeptidkette und eine zweite Polypeptidkette, wobei die Ketten gemeinsam eine variable Domäne eines Antikörpers bereitstellen, die für ein Epitop oder ein Immuneffektorzelloberflächenantigen spezifisch ist, und eine variable Domäne eines
Vor dem Hintergrund der vorliegenden Erfindung werden variable Domänen (
Das Polypeptidmolekül mit zweifacher Spezifität gemäß der vorliegenden Erfindung umfasst eine erste Polypeptid- und eine zweite Polypeptidkette, die eine erste (
Vor dem Hintergrund der vorliegenden Erfindung wird das Polypeptidmolekül mit zweifacher Affinität gemäß der Erfindung durch ein Konstrukt beispielhaft dargestellt, welches das SLYNTVATL-Peptid (SEQ ID No. 7) bindet, wenn dies als ein Peptid-MHC-Komplex präsentiert wird. Nichtsdestotrotz ist das Konzept der Erfindung eindeutig nicht auf dieses spezielle Peptid beschränkt und umfasst im Prinzip jedes krankheits- oder störungsbezogene Epitop, das im Zusammenhang mit dem MHC-Molekül präsentiert wird. Dieses Präsentieren kann sowohl in Bezug auf die MHC-Klasse I oder II erfolgen. Moleküle des Haupthistokompatibilitätskomplexes Klasse I (MHC-I) sind auf der Oberfläche von allen kernhaltigen Zellen vorhanden und zeigen eine große Auswahl an Peptidepitopen für die Überwachung durch das CD8+ T-Zell-Repertoire. CD8+ T-Zell-Antworten sind von essentieller Bedeutung für die Steuerung und Befreiung von Virusinfektionen sowie die Eliminierung von transformierten und tumorerzeugenden Zellen. Beispiele für bevorzugte zu erkennende Peptidepitope sind in der entsprechenden Literatur zu finden und umfassen insbesondere die in den Tabellen 1 bis 5 der
Andere geeignete Epitope können von Datenbanken, wie zum Beispiel der Datenbank für Immunepitope (Zugriff unter http://www.iedb.org/), identifiziert werden.Other suitable epitopes can be identified by databases such as the Immunopitope Database (accessed at http://www.iedb.org/).
Der Begriff „humane Immuneffektorzelle(n)“ bezieht sich auf eine Zelle innerhalb des natürlichen Zellrepertoires im humanen Immunsystem, die, wenn sie aktiviert wird, in der Lage ist, eine Änderung der Lebensfähigkeit einer Zielzelle herbeizuführen. Der Ausdruck „Lebensfähigkeit einer Zielzelle“ kann sich innerhalb des Rahmens der Erfindung auf die Fähigkeit der Zielzelle beziehen, zu überleben, proliferieren und / oder mit anderen Zellen zu interagieren. Diese Interaktion kann entweder direkt erfolgen, zum Beispiel wenn die Zielzelle Kontakt zu einer anderen Zelle hat oder indirekt, zum Beispiel wenn die Zielzelle Substanzen sezerniert, welche einen Einfluss auf die Funktionsfähigkeit einer anderen, entfernten Zelle haben. Bei der Zielzelle kann es sich entweder um eine humane native Zelle oder um eine nicht-humane Zelle handeln. Im Falle, dass die Zelle eine humane native Zelle ist, handelt es sich bei der Zielzelle vorteilhafter Weise um eine Zelle, welche sich verändert hat und zu einer malignen Zelle geworden ist. Bei der nativen Zelle kann es sich zusätzlich um eine pathologisch veränderte native Zelle handeln, zum Beispiel eine native Zelle, die mit einem Organismus, wie z. B. einem Virus, einem Plasmodium oder einem Bakterium infiziert ist. Im Falle, dass die Zelle keine humane, sondern eine nicht-humane Zelle ist, handelt es sich bei der Zielzelle vorteilhafterweise um eine eingedrungene pathogene Zelle, zum Beispiel ein eingedrungenes Bakterium oder Plasmodium.The term "human immune effector cell (s)" refers to a cell within the natural cell repertoire in the human immune system which, when activated, is capable of inducing a change in the viability of a target cell. The term "viability of a target cell" may, within the scope of the invention, refer to the ability of the target cell to survive, proliferate and / or interact with other cells. This interaction can occur either directly, for example when the target cell is in contact with another cell or indirectly, for example when the target cell secretes substances, which have an impact on the functioning of another, remote cell. The target cell may be either a human native cell or a nonhuman cell. In case the cell is a human native cell, the target cell is advantageously a cell that has changed and become a malignant cell. The native cell may additionally be a pathologically altered native cell, for example a native cell associated with an organism, such as an organism. B. a virus, a plasmodium or a bacterium is infected. In the case where the cell is not a human but a non-human cell, the target cell is advantageously an invaded pathogenic cell, for example an invaded bacterium or plasmodium.
Bevorzugt ist das Polypeptidmolekül mit zweifacher Spezifität gemäß der Erfindung, wobei diese ersten und zweiten Polypeptidketten weiterhin mindestens eine Gelenkdomäne (Hingedomäne) und / oder eine Fc-Domäne oder einen Teil davon umfassen. In Antikörpern bezieht sich das „Gelenk“ oder die „Gelenkregion“ oder die „Gelenkdomäne“ auf den flexiblen Teil einer schweren Kette, die sich zwischen der CH1-Domäne und der CH2-Domäne befindet. Sie ist ungefähr 25 Aminosäuren lang und ist in ein „oberes Gelenk“, ein „mittleres Gelenk“ oder ein „Kerngelenk“ und ein „unteres Gelenk“ unterteilt. Eine „Gelenkunterdomäne“ bezieht sich auf das obere Gelenk, das mittlere (oder Kern-) Gelenk oder das untere Gelenk. Die Aminosäuresequenzen der Gelenke eines
IgG3: ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPE216PKSCDTPPPCPRCPAPELLG (SEQ ID No. 3)Preferred is the polypeptide molecule having dual specificity according to the invention, said first and second polypeptide chains further comprising at least one hinge domain (Hingdomäne) and / or an Fc domain or a part thereof. In antibodies, the "hinge" or "hinge region" or "hinge domain" refers to the flexible part of a heavy chain located between the CH1 domain and the CH2 domain. It is about 25 amino acids long and is divided into an "upper joint", a "middle joint" or a "core joint" and a "lower joint". An "articular subdomain" refers to the upper joint, the middle (or core) joint, or the lower joint. The amino acid sequences of the joints of a
IgG3: ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPE216PKSCDTPPPCPRCPAPELLG (SEQ ID No. 3)
Die Kerngelenkregion enthält für gewöhnlich mindestens eine Cysteinbrücke, welche die zwei schweren Ketten verbindet. Darüber hinaus können Mutationen in der unteren Gelenkregion ausgelöst werden, um die unerwünschte antikörperabhängige zellvermittelte Zytotoxizität (
Bevorzugt ist ein Polypeptidmolekül mit zweifacher Spezifität gemäß der vorliegenden Erfindung, das mindestens eine IgG-Domäne mit einem kristallisierbaren Fragment (
In den Polypeptidmolekülen mit zweifacher Spezifität der Erfindung kann diese
Beispiele von bevorzugten zu verwendenden CH2-Teilsequenzen können (vollständig oder teilweise) wie folgt lauten:
231- APPVA-GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYQSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPASIEK- 334 (SEQ ID No. 5);und
231- APPVA-GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPASIEK- 334 (SEQ ID No. 6)mit unterstrichenen Änderungen, die an Position
231- APPVA-GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYQSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPASIEK- 334 (SEQ ID No. 5);and
231- APPVA-GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPASIEK- 334 (SEQ ID No. 6)with underlined changes in position
In den Polypeptidmolekülen mit zweifacher Spezifität der Erfindung kann diese Fc-Domäne eine CH3-Domäne umfassen, die mindestens eine Mutation enthält, welche die Bildung von Heterodimeren erleichtert. Um die Ausbeute des gewünschten heterodimären Fc-Proteins mit zweifacher Spezifität zu maximieren und die Aufreinigung zu vereinfachen, können in der Fc-Domäne „Knobs-into-holes“ Mutationen erzeugt werden. Fc-Domänen, die diese Struktur aufweisen, werden dazu bewegt, Heterodimere anstelle von den für sie normalen Homodimeren zu bilden, indem vorstehende, sperrige, hydrophobe Reste („knobs“) an einer Kette und komplementäre hydrophobe Taschen („holes“) an der anderen Kette erzeugt werden. Die ,knob‘-Variante kann durch das Ersetzen einer kleinen Aminosäure mit einer größeren für das Einführen in ein hole in der gegenüberliegenden Domäne erhalten werden, das durch das zweckdienliche Ersetzen eines großen Rests mit einem kleineren erzeugt wurde (Ridgway, J.B.B.; Presta, L.G.; Carter, P. „Knobs-into-holes“ engineering of antibody CH3 domains for heavy chain heterodimerization. Protein Eng. 1996, 9, 617-621;
Bevorzugt wird ein Polypeptidmolekül mit zweifacher Spezifität gemäß der Erfindung, wobei diese „Knob-into-hole“-Mutation aus T366W als knob und T366'S, L368'A und Y407'V als hole in der CH3-Domäne ausgewählt wird (siehe, z. B.
Die Polypeptidmoleküle mit zweifacher Spezifität der Erfindung können weiterhin künstlich eingeführte Cysteinbrücken zwischen mindestens einem Cysteinrest an der ersten Polypeptidkette und mindestens einem Cysteinrest an der zweiten Polypeptidkette umfassen, um die Stabilität der Moleküle zu verbessern, optimalerweise ohne die Bindungseigenschaften der bivalenten Moleküle zu beeinträchtigen, und / oder um eine verbesserte Heterodimerisierung zu erreichen. Um zusätzliche Stabilität zu erreichen, kann durch die Hinzufügung eines einzelnen Cysteins in die CH3-Domäne von sowohl den knob- als auch den hole-Ketten eine Disulfidbindung eingeführt werden. Bevorzugt wird ein Polypeptidmolekül mit zweifacher Spezifität gemäß der Erfindung, wobei die Fc-Domäne eine CH3-Domäne umfasst, die mindestens einen zusätzlichen Cysteinrest umfasst, zum Beispiel S354C und / oder Y349C.The dual specificity polypeptide molecules of the invention may further comprise artificially introduced cysteine bridges between at least one cysteine residue on the first polypeptide chain and at least one cysteine residue on the second polypeptide chain to improve the stability of the molecules, optimally without affecting the binding properties of the bivalent molecules, and / or to achieve improved heterodimerization. For additional stability, the addition of a single cysteine to the CH3 domain of both the knob and hole chains can introduce a disulfide bond. Preferred is a polypeptide molecule having dual specificity according to the invention, wherein the Fc domain comprises a CH3 domain comprising at least one additional cysteine residue, for example S354C and / or Y349C.
Bevorzugt wird ein Polypeptidmolekül mit zweifacher Spezifität gemäß der Erfindung, wobei dieses CD-Molekül aus der Gruppe von auf die Immunantwort bezogenen CD-Molekülen CD3 wie z. B. die CD3y, CD3δ und CD3ε-Ketten, CD4, CD7, CD8, CD10, CD11b, CD11c, CD14, CD16, CD18, CD22, CD25, CD28, CD32a, CD32b, CD33, CD41, CD41b, CD42a, CD42b, CD44, CD45RA, CD49, CD55, CD56, CD61, CD64, CD68, CD94, CD90, CD117, CD123, CD125, CD134, CD137, CD152, CD163, CD193, CD203c, CD235a, CD278, CD279, CD287, Nkp46, NKG2D, GITR, FcεRI, TCRalpha/beta, TCRgamma/delta und HLA-DR ausgewählt wird. In Abhängigkeit von der Kombination der zwei antigenbindenden Einheiten des Polypeptidmoleküls mit zweifacher Spezifität gemäß der Erfindung können spezifische Vorteile in Bezug auf die Funktionsweise des Moleküls, insbesondere eine erhöhte Wirksamkeit, erreicht werden.Preference is given to a polypeptide molecule with dual specificity according to the invention, this CD molecule being selected from the group of CD3 CD3 molecules related to the immune response, such as e.g. CD3y, CD3δ and CD3ε chains, CD4, CD7, CD8, CD10, CD11b, CD11c, CD14, CD16, CD18, CD22, CD25, CD28, CD32a, CD32b, CD33, CD41b, CD41b, CD42a, CD42b, CD44, CD45a, CD49, CD55, CD56, CD61, CD64, CD68, CD94, CD90, CD117, CD123, CD125, CD134, CD137, CD153, CD193, CD193, CD203c, CD235a, CD278, CD279, CD287, Nkp46, NKG2D, GITR, FcεRI, TCRalpha / beta, TCRgamma / delta and HLA-DR. Depending on the combination of the two antigen-binding moieties of the dual specificity polypeptide molecule of the invention, specific advantages in terms of the functionality of the molecule, in particular increased efficacy, may be achieved.
Bevorzugt ist das beispielhafte Polypeptidmolekül mit zweifacher Spezifität gemäß der Erfindung, wobei die Regionen in der ersten Polypeptidkette SEQ ID No. 28 für
Bevorzugt ist weiterhin das beispielhafte Polypeptidmolekül mit zweifacher Spezifität gemäß der Erfindung, wobei die FC-Region in der ersten Polypeptidkette SEQ ID No. 26 (
Weiterhin bevorzugt ist das beispielhafte Polypeptidmolekül mit zweifacher Spezifität gemäß der Erfindung, das eine erste Polypeptidkette mit SEQ ID No. 16 (
Noch weiter bevorzugt ist das beispielhafte Polypeptidmolekül mit zweifacher Spezifität gemäß der Erfindung, wobei diese erste Bindungsstelle (
Humanisierte Antikörper sind Antikörper (oder Teile davon) von einer nicht-humanen Spezies, deren Proteinsequenzen modifiziert wurden, um ihre Ähnlichkeit mit Antikörpervarianten zu erhöhen, die unter natürlichen Bedingungen in Menschen produziert werden. Der Prozess der „Humanisierung“ wird für gewöhnlich auf monoklonale Antikörper angewendet, die für die Verabreichung an Menschen entwickelt wurden (zum Beispiel Antikörper, die als Krebsmedikamente entwickelt wurden). Geeignete Verfahren für die Humanisierung sind aus der Literatur bekannt, und werden zum Beispiel in
Im Allgemeinen kann die Affinitätsreifung von
Die Bindungsstellen (
In einer anderen bevorzugten Ausführungsform des Polypeptidmoleküls mit zweifacher Spezifität gemäß der Erfindung trägt dieses Molekül einen Wirkstoff oder einen Teil davon, der mit dem Molekül gekoppelt oder mit diesem konjugiert ist. Dieser Wirkstoff kann aus der Gruppe ausgewählt werden, die aus einer auffindbaren Markierung, einem immunstimulierenden Molekül und einem Therapeutikum besteht.In another preferred embodiment of the dual specificity polypeptide molecule of the invention, said molecule carries an active agent or a portion thereof coupled to or conjugated to the molecule. This agent can be selected from the group consisting of a detectable label, an immunostimulating molecule and a therapeutic.
Die auffindbare Markierung kann aus der Gruppe ausgewählt werden, die aus Biotin, Streptavidin, einem Enzym oder dessen katalytisch aktiven Fragmenten, einem Radionuklid, einem Nanopartikel, einem paramagnetischen Metallion oder einem fluoreszierenden, phosphoreszierenden oder chemilumineszierenden Molekül besteht. Auffindbare Markierungen für diagnostische Zwecke umfassen beispielsweise fluoreszierende Markierungen, Radiomarkierungen, Enzyme, Nukleinsäuresonden und Kontrastmittel.The detectable label may be selected from the group consisting of biotin, streptavidin, an enzyme or its catalytically active fragments, a radionuclide, a nanoparticle, a paramagnetic metal ion or a fluorescent, phosphorescent or chemiluminescent molecule. Detectable labels for diagnostic purposes include, for example, fluorescent labels, radiolabels, enzymes, nucleic acid probes, and contrast agents.
Therapeutika, welche mit den Molekülen der Erfindung in Verbindung gebracht werden können, umfassen Immunmodulatoren, radioaktive Verbindungen, Enzyme (zum Beispiel Perforin), Chemotherapeutika (zum Beispiel Cisplatin) oder ein Toxin. Andere geeignete Therapeutika umfassen niedermolekulare zytotoxische Wirkstoffe, d. h. Verbindungen mit der Fähigkeit, Säugetierzellen zu töten, welche ein Molekulargewicht von weniger als 700 Dalton aufweisen. Solche Verbindungen können auch toxische Metalle enthalten, die eine zytotoxische Wirkung zeigen können. Darüber hinaus wird davon ausgegangen, dass diese niedermolekularen zytotoxischen Wirkstoffe auch Vorstufen enthalten, d. h. Wirkstoffe, die sich zersetzen oder unter physiologischen Bedingungen umgewandelt werden, um zytotoxische Wirkstoffe freizusetzen. Beispiele für solche Wirkstoffe umfassen Cisplatin, Maytansinderivate, Rachelmycin, Calicheamicin, Docetaxel, Etoposid, Gemcitabin, Ifosfamid, Irinotecan, Melphalan, Mitoxantron, Sorfimer Sodiumphotofrin II, Temozolomid, Topotecan, Trimetreat Glucuronat, Auristatin E Vincristin und Doxorubicin; Peptidzytotoxine, d. h. Proteine oder deren Fragmente mit der Fähigkeit, Säugetierzellen abzutöten. Zum Beispiel Ricin, Diphteritoxin, bakterielles Exotoxin A von Pseudomonas, DNase und RNase, Radio-Nuklide, d. h. instabile Isotope von Elementen, welche sich unter gleichzeitiger Aussendung von einem oder mehreren α- oder β-Partikeln oder Gammastrahlen zersetzen. Zum Beispiel können Chelatbildner für Jod
Ein anderer Aspekt der vorliegenden Erfindung bezieht sich dann auf ein Nukleinsäuremolekül, das eine erste Polypeptidkette und / oder eine zweite Polypeptidkette kodiert, wie vorliegend offenbart, oder einen Expressionsvektor, der solch eine Nukleinsäure umfasst. Das Nukleinsäuremolekül kann eine
Die Nukleinsäure (z. B.
Viele Expressionssysteme sind bekannt, einschließlich Bakterien (zum Beispiel E. coli und Bacillus subtilis), Hefen (zum Beispiel Saccharomyces cerevisiae), Fadenpilze (zum Beispiel Aspergillus spec), Pflanzenzellen, Tierzellen und Insektenzellen. Vorzugsweise kann das System aus Säugetierzellen wie z. B. CHO-Zellen bestehen, die bei der ATCC Cell Biology Collection erhältlich sind.Many expression systems are known, including bacteria (for example E. coli and Bacillus subtilis), yeasts (for example Saccharomyces cerevisiae), filamentous fungi (for example Aspergillus spec), plant cells, animal cells and insect cells. Preferably, the system may be of mammalian cells, such as e.g. For example, CHO cells available from the ATCC Cell Biology Collection.
In einer Ausführungsform stellt die Beschreibung ein Verfahren zur Herstellung eines wie vorliegend beschriebenen Moleküls bereit, wobei das Verfahren das Kultivieren einer Wirtszelle umfasst, die in der Lage ist, die Polypeptidkette(n) unter Bedingungen zu exprimieren, die dafür geeignet sind, die Expression dieser Kette(n) zu fördern.In one embodiment, the specification provides a method of producing a molecule as described herein, the method comprising culturing a host cell capable of expressing the polypeptide chain (s) under conditions suitable for expressing them To promote chain (s).
Unter einem Aspekt werden Nukleinsäure-kodierende Polypeptidketten, welche TCR-alpha- und / oder TCR-beta-bindende Domänen umfassen, in Expressionsvektoren geklont, wie zum Beispiel dem Gammaretrovirus oder Lentivirus, um Zellen zu erhalten, welche Moleküle der vorliegenden Beschreibung exprimieren. Unter einem anderen Aspekt werden
Um die Expression zu steigern, können Nukleinsäure-kodierende Ketten der vorliegenden Beschreibung operativ mit starken Promotern verlinkt werden, wie zum Beispiel retroviralen langen terminalen Sequenzwiederholungen (
Die alpha- und beta-bindenden Domänen-Ketten eines Moleküls der vorliegenden Erfindung können durch Nukleinsäuren kodiert werden, die sich in separaten Vektoren befinden oder können durch Polynukleotide kodiert werden, die sich im selben Vektor befinden.The alpha and beta binding domain chains of a molecule of the present invention may be encoded by nucleic acids located in separate vectors or may be encoded by polynucleotides located in the same vector.
In einer Ausführungsform ist eine Wirtszelle dafür konstruiert worden, ein Molekül der vorliegenden Beschreibung zu exprimieren. Wirtszellen der vorliegenden Beschreibung können im Hinblick auf einen zu behandelnden Patienten allogen oder autolog sein. In one embodiment, a host cell has been designed to express a molecule of the present specification. Host cells of the present description may be allogenic or autologous with respect to a patient to be treated.
Noch ein anderer Aspekt der Erfindung bezieht sich auf eine pharmazeutische Zusammensetzung, welche das Polypeptidmolekül mit zweifacher Spezifität gemäß der Erfindung, die Nukleinsäure(n) oder den / die Expressionsvektor(en) gemäß der Erfindung oder die Zelle gemäß der vorliegenden Erfindung zusammen mit einem oder mehreren pharmazeutisch annehmbaren Träger(n) oder Hilfsstoff(en) umfasst. Die Zusammensetzungen der Erfindung umfassen Zusammensetzungen aus der Massenproduktion von Arzneimitteln, die bei der Herstellung von pharmazeutischen Zusammensetzungen (z. B. verunreinigten oder nicht-sterilen Zusammensetzungen) nützlich sind und pharmazeutischen Zusammensetzungen (d. h. Zusammensetzungen, die für die Verabreichung an ein Subjekt oder einen Patienten geeignet sind), welche bei der Herstellung von Dosierungseinheitsformen verwendet werden können. Solche Zusammensetzungen umfassen eine prophylaktisch oder therapeutisch wirksame Menge der prophylaktischen und / oder therapeutischen Polypeptidmoleküle (Wirkstoff) mit zweifacher Spezifität, die vorliegend offenbart werden oder eine Kombination des Wirkstoffs und eines pharmazeutisch annehmbaren Trägers. Bevorzugt umfassen Zusammensetzungen der Erfindung eine prophylaktisch oder therapeutisch wirksame Menge von einem oder mehreren Molekülen der Erfindung und einen pharmazeutisch annehmbaren Träger.Yet another aspect of the invention relates to a pharmaceutical composition comprising the double specificity polypeptide molecule according to the invention, the nucleic acid (s) or expression vector (s) according to the invention or the cell according to the present invention together with one or more a plurality of pharmaceutically acceptable carrier (s) or excipient (s). The compositions of the invention include compositions of the mass production of drugs useful in the preparation of pharmaceutical compositions (e.g., contaminated or non-sterile compositions) and pharmaceutical compositions (ie, compositions suitable for administration to a subject or a patient suitable) which can be used in the preparation of dosage unit forms. Such compositions comprise a prophylactically or therapeutically effective amount of the dual specificity prophylactic and / or therapeutic polypeptide molecules (active ingredient) disclosed herein or a combination of the active ingredient and a pharmaceutically acceptable carrier. Preferably, compositions of the invention comprise a prophylactically or therapeutically effective amount of one or more molecules of the invention and a pharmaceutically acceptable carrier.
Die pharmazeutischen Zusammensetzungen umfassen bevorzugt die Moleküle entweder in freier Form oder als Salz. Vorzugsweise handelt es sich bei den Salzen um pharmazeutisch annehmbare Salze der Moleküle, wie zum Beispiel Chlorid- oder Azetat- (Triflurazetat) Salze. Es muss angemerkt werden, dass die Salze der Moleküle gemäß der vorliegenden Erfindung erheblich von den Molekülen in ihrem Zustand / ihren Zuständen in vivo abweichen, da die Moleküle in vivo nicht als Salze vorliegen.The pharmaceutical compositions preferably comprise the molecules either in free form or as a salt. Preferably, the salts are pharmaceutically acceptable salts of the molecules, such as chloride or acetate (trifluoroacetate) salts. It must be noted that the salts of the molecules according to the present invention deviate significantly from the molecules in their state / conditions in vivo since the molecules are not present as salts in vivo.
Eine Ausführungsform der vorliegenden Erfindung bezieht sich daher auf ein Molekül gemäß der Erfindung, das in der Natur nicht vorkommt, welches als ein pharmazeutisch annehmbares Salz synthetisch hergestellt (z. B. synthetisiert) wurde. Verfahren für die synthetische Herstellung von Peptiden und / oder Polypeptiden sind im Stand der Technik wohlbekannt. Die Salze der Moleküle gemäß der vorliegenden Erfindung unterscheiden sich erheblich von den Molekülen in ihrem Zustand / ihren Zuständen in vivo, da die Moleküle, die erzeugt werden, in vivo nicht als Salze vorliegen. Vorzugsweise handelt es sich bei den Salzen um pharmazeutisch annehmbare Salze der Moleküle. Diese Salze gemäß der Erfindung umfassen Alkali- und Erdalkalisalze, wie zum Beispiel Salze der Hofmeister-Reihe, welche folgende Anionen: PO4 3-, SO4 2-, CH3COO-, CI-, Br-, NO3 -, ClO4 -, I-, SCN- und folgende Kationen NH4 +, Rb+, K+, Na+, Cs+, Li+, Zn2+, Mg2+, Ca2+, Mn2+, Cu2+ und Ba2+ umfassen. Insbesondere werden Salze von (NH4)3PO4, (NH4)2HPO4, (NH4)H2PO4, (NH4)2SO4, NH4CH3COO, NH4Cl, NH4Br, NH4NO3, NH4ClO4, NH4I, NH4SCN, Rb3PO4, Rb2HPO4, RbH2PO4, Rb2SO4, Rb4CH3COO, Rb4Cl, Rb4Br, Rb4NO3, Rb4ClO4, Rb4I, Rb4SCN, K3PO4, K2HPO4, KH2PO4, K2SO4, KCH3COO, KCl, KBr, KNO3, KClO4, Kl, KSCN, Na3PO4, Na2HPO4, NaH2PO4, Na2SO4, NaCH3COO, NaCl, NaBr, NaNO3, NaClO4, Nal, NaSCN, ZnCl2 Cs3PO4, Cs2HPO4, CsH2PO4, Cs2SO4, CsCH3COO, CsCl, CsBr, CsNO3, CsClO4, Csl, CsSCN, Li3PO4, Li2HPO4, LiH2PO4, Li2SO4, LiCH3COO, LiCI, LiBr, LiNO3, LiClO4, Lil, LiSCN, Cu2SO4, Mg3(PO4)2, Mg2HPO4, Mg(H2PO4)2, Mg2SO4, Mg(CH3COO)2, MgCl2, MgBr2, Mg(NO3)2, Mg(ClO4)2, MgI2, Mg(SCN)2, MnCl2, Ca3(PO4), Ca2HPO4, Ca(H2PO4)2, CaSO4, Ca(CH3COO)2, CaCl2, CaBr2, Ca(NO3)2, Ca(ClO4)2, CaI2, Ca(SCN)2, Ba3(PO4)2, Ba2HPO4, Ba(H2PO4)2, BaSO4, Ba(CH3COO)2, BaCl2, BaBr2, Ba(NO3)2, Ba(ClO4)2, BaI2, und Ba(SCN)2 ausgewählt. Insbesondere bevorzugt sind NH-Azetat, MgCl2, KH2PO4, Na2SO4, KCl, NaCl und CaCl2, wie zum Beispiel Chlorid- oder Azetat- (Triflurazetat) Salze.One embodiment of the present invention therefore relates to a molecule according to the invention which does not occur in nature which has been synthetically produced (e.g., synthesized) as a pharmaceutically acceptable salt. Methods for the synthetic production of peptides and / or polypeptides are well known in the art. The salts of the molecules according to the present invention differ significantly from the molecules in their state / conditions in vivo, since the molecules that are generated are not present as salts in vivo. Preferably, the salts are pharmaceutically acceptable salts of the molecules. These salts of the invention include alkali and alkaline, such as salts of the Hofmeister series, which the following anions: PO 4 3-, SO 4 2-, CH 3 COO -, Cl -, Br -, NO 3 -, ClO 4 -, I -, SCN - and the following cations NH 4 +, Rb +, K +, Na +, Cs +, Li +, Zn 2+, Mg 2+, Ca 2+, Mn 2+, Cu 2+, and Include Ba 2+ . In particular, salts of (NH 4 ) 3 PO 4 , (NH 4 ) 2 HPO 4 , (NH 4 ) H 2 PO 4 , (NH 4 ) 2 SO 4 , NH 4 CH 3 COO, NH 4 Cl, NH 4 Br , NH 4 NO 3 , NH 4 ClO 4 , NH 4 I, NH 4 SCN, Rb 3 PO 4 , Rb 2 HPO 4 , RbH 2 PO 4 , Rb 2 SO 4 , Rb 4 CH 3 COO, Rb 4 Cl, Rb 4 Br, Rb 4 NO 3 , Rb 4 ClO 4 , Rb 4 I, Rb 4 SCN, K 3 PO 4 , K 2 HPO 4 , KH 2 PO 4 , K 2 SO 4 , KCH 3 COO, KCl, KBr, KNO 3 , KClO 4 , KI, KSCN, Na 3 PO 4 , Na 2 HPO 4 , NaH 2 PO 4 , Na 2 SO 4 , NaCH 3 COO, NaCl, NaBr, NaNO 3 , NaClO 4 , NaI, NaSCN, ZnCl 2 Cs 3 PO 4 , Cs 2 HPO 4 , CsH 2 PO 4 , Cs 2 SO 4 , CsCH 3 COO, CsCl, CsBr, CsNO 3 , CsClO 4 , CsI, CsSCN, Li 3 PO 4 , Li 2 HPO 4 , LiH 2 PO 4 , Li 2 SO 4 , LiCH 3 COO, LiCl, LiBr, LiNO 3 , LiClO 4 , Lil, LiSCN, Cu 2 SO 4 , Mg 3 (PO 4 ) 2 , Mg 2 HPO 4 , Mg (H 2 PO 4 ) 2 , Mg 2 SO 4 , Mg (CH 3 COO) 2 , MgCl 2 , MgBr 2 , Mg (NO 3 ) 2 , Mg (ClO 4 ) 2 , MgI 2 , Mg (SCN) 2 , MnCl 2 , Ca 3 ( PO 4 ), Ca 2 HPO 4 , Ca (H 2 PO 4 ) 2 , CaSO 4 , Ca (CH 3 COO) 2 , CaCl 2 , CaBr 2 , Ca (NO 3 ) 2 , Ca (ClO 4 ) 2 , CaI 2 , Ca (SCN) 2 , Ba 3 (PO 4 ) 2 , Ba 2 HPO 4 , Ba (H 2 PO 4 ) 2 , BaSO 4 , Ba (CH 3 COO) 2 , BaCl 2 , BaBr 2 , Ba ( NO 3 ) 2 , Ba (ClO 4 ) 2 , BaI 2 , and Ba (SCN) 2 . Particularly preferred are NH acetate, MgCl 2 , KH 2 PO 4 , Na 2 SO 4 , KCl, NaCl and CaCl 2 , such as chloride or acetate (trifluoroacetate) salts.
Die Erfindung umfasst auch pharmazeutische Zusammensetzungen, die ein Polypeptidmolekül der Erfindung mit zweifacher Spezifität und einen therapeutischen Antikörper (z. B. einen tumorspezifischen monoklonalen Antikörper), der für ein bestimmtes Krebsantigen spezifisch ist und einen pharmazeutisch annehmbaren Träger umfassen.The invention also encompasses pharmaceutical compositions comprising a polypeptide molecule of the invention having dual specificity and a therapeutic antibody (eg, a tumor-specific monoclonal antibody) specific for a particular cancer antigen and a pharmaceutically acceptable carrier.
In einer spezifischen Ausführungsform bedeutet der Begriff „pharmazeutisch annehmbar“, dass der pharmazeutisch annehmbare Gegenstand von einer Behörde der Regierung des Bundesstaats oder Staats zugelassen wurde oder in dem U.S. Arzneibuch oder einem anderen allgemein anerkannten Arzneibuch zur Verwendung in Tieren oder speziell bei Menschen gelistet ist. Der Begriff „Träger“ bezieht sich auf einen verdünnenden Hilfsstoff oder ein Vehikel, mit welchem das Therapeutikum verabreicht wird. Solche pharmazeutischen Träger können sterile Flüssigkeiten wie zum Beispiel Wasser und Öle, einschließlich Ölen von mineralischem, tierischem, pflanzlichem oder synthetischem Ursprung wie zum Beispiel Erdnussöl, Sojabohnenöl, Mineralöl, Sesamöl und Ähnliche sein. Wasser ist ein bevorzugter Träger, wenn die pharmazeutische Zusammensetzung intravenös verabreicht wird. Salzlösungen und wässrige Dextrose- und Glycerollösungen können ebenfalls als flüssige Träger verwendet werden, insbesondere für injizierbare Lösungen. Geeignete pharmazeutische Hilfsstoffe umfassen Stärke, Glukose, Laktose, Sucrose, Gelatine, Malz, Reis, Mehl, Kalk, Siliziumgel, Natriumstearat, Glycerolmonostearat, Talk, Natriumchlorid, Natriumphosphat, Natriumazetat, L-Histidin, getrocknete Magermilch, Glycerol, Propylen, Glycol, Wasser, Ethanol und Ähnliches. Die Zusammensetzung kann, falls gewünscht, ebenfalls kleinere Mengen von Benetzungsmitteln oder Emulgatoren oder pH-puffernden Mitteln enthalten. Diese Zusammensetzungen können in der Form von Lösungen, Suspensionen, Emulsionen, Tabletten, Pillen, Kapseln, Pulvern, Formulierungen mit verzögerter Freisetzung und Ähnlichem vorliegen. Allgemein werden die Bestandteile von Zusammensetzungen der Erfindung entweder separat zugegeben oder in Dosierungseinheitsform zusammengemischt, zum Beispiel als ein trocken lyophilisiertes Pulver oder wasserfreies Konzentrat in einem hermetisch versiegelten Behälter wie zum Beispiel einer Ampulle oder einem Sachet, auf welchen die Menge des Wirkstoffs angegeben ist. Wenn die Zusammensetzung mittels einer Infusion verabreicht werden soll, kann sie mit einer Infusionsflasche ausgegeben werden, welche steriles Wasser oder sterile Salzlösung pharmazeutischer Qualität enthält. Wenn die Zusammensetzung mittels einer Injektion verabreicht wird, kann eine Ampulle mit sterilem Wasser oder Salzlösung für die Injektion bereitgestellt werden, so dass die Bestandteile vor dem Verabreichen gemischt werden können.In a specific embodiment, the term "pharmaceutically acceptable" means that the pharmaceutically acceptable article has been approved by a state or state government agency or is listed in the US Pharmacopoeia or other generally accepted pharmacopoeia for use in animals or specifically in humans. The term "carrier" refers to a diluent excipient or vehicle with which the therapeutic agent is administered. Such pharmaceutical carriers may be sterile liquids such as water and oils, including oils of mineral, animal, vegetable or synthetic origin such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be used as liquid carriers, especially for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, lime, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, sodium phosphate, sodium acetate, L-histidine, dried skimmed milk, glycerol, propylene, glycol, water , Ethanol and the like. If desired, the composition may also contain minor amounts of wetting or emulsifying or pH buffering agents. These compositions may be in the form of solutions, suspensions, emulsions, tablets, pills, capsules, powders, sustained release formulations, and the like. Generally, the ingredients of compositions of the invention are either added separately or mixed together in dosage unit form, for example as a dry lyophilized powder or anhydrous concentrate in a hermetically sealed container such as an ampoule or sachet, on which the amount of active ingredient is indicated. If the composition is to be infused, it may be dispensed with an infusion bottle containing sterile water or pharmaceutical grade sterile saline. When the composition is administered by injection, a vial of sterile water or saline may be provided for injection so that the components may be mixed prior to administration.
Ein anderer Aspekt der vorliegenden Erfindung bezieht sich dann auf das Polypeptidmolekül mit zweifacher Spezifität gemäß der Erfindung, die Nukleinsäure oder den Expressionsvektor gemäß der Erfindung, die Zelle gemäß der Erfindung oder die pharmazeutische Zusammensetzung gemäß der Erfindung zur medizinischen Verwendung. Im Allgemeinen hängt die Verwendung des Polypeptidmoleküls mit zweifacher Spezifität von dem medizinischen Hintergrund des Peptid-Antigens / der Peptid-Antigene ab, das / die durch dieses Molekül erkannt werden, wie dies auch im Folgenden weiter beschrieben wird.Another aspect of the present invention then relates to the polypeptide molecule of dual specificity according to the invention, the nucleic acid or expression vector according to the invention, the cell according to the invention or the pharmaceutical composition according to the invention for medical use. In general, the use of the double specificity polypeptide molecule will depend on the medical background of the peptide antigen (s) recognized by that molecule, as further described below.
Bevorzugt wird das Polypeptidmolekül mit zweifacher Spezifität gemäß der Erfindung, die Nukleinsäure oder der Expressionsvektor gemäß der Erfindung oder die Zelle gemäß der Erfindung oder die pharmazeutische Zusammensetzung gemäß der Erfindung zur Verwendung bei der Behandlung oder Vorbeugung einer Krankheit oder Störung, die unter immunologischen Störungen, Infektionskrankheiten, Vergiftung und Krebserkrankungen ausgewählt wird, einschließlich der Behandlung oder Vorbeugung einer Vielzahl von Krebserkrankungen oder anderen anormalen proliferativen Erkrankungen, einschließlich (aber nicht beschränkt auf) folgende Erkrankungen: Karzinom, einschließlich der Harnblase, Brust, des Darms, der Niere, Leber, Lunge, Eierstöcke, Bauchspeicheldrüse, des Magens, der Prostata, des Gebärmutterhalses, der Schilddrüse und Haut, einschließlich Plattenepithelkarzinom, hämatopoetischen Tumoren lymphoider Abstammung, einschließlich Leukämie, akute lymphozytische Leukämie, akute lymphoblastische Leukämie, B-Zell-Lymphom, T-Zell-Lymphom, Burketts Lymphom, hämatopoetischen Tumoren myeloider Abstammung, einschließlich akuter und chronischer myeloischer Leukämie und Promyelozytenleukämie, Tumoren mesenchymalen Ursprungs, einschließlich Fibrosarkom und Rhabdomyosarkom, anderen Tumoren einschließlich Melanom, Seminom, Teratokarzinom, Neuroblastom und Gliom, Tumoren des zentralen und peripheren Nervensystems, einschließlich Astrozytom, Neuroblastom, Gliom, Schwannomen und Osteosarkom; und anderen Tumoren, einschließlich Melanom, Xenoderma pigmentosum, Keratoakanthom, Seminom, Schilddrüsenkarzinom und Teratokarzinom. Zusätzliche Krebserkrankungen können follikuläres Lymphom, Karzinome mit p53 Mutationen, hormonabhängige Tumoren der Brust, Prostata und Eierstöcke und prekanzeröse Läsionen wie zum Beispiel familiäre adenomatöse Polyposis und myelodysplastische Syndrome umfassen, sind aber nicht darauf beschränkt. In spezifischen Ausführungsformen werden Änderungen bei der Malignität oder dysproliferative Änderungen (wie zum Beispiel Metaplasie und Dysplasie) oder hyperproliferative Krankheiten durch die Verfahren und Zusammensetzungen der Erfindung in den Eierstöcken, der Harnblase, der Brust, des Darms, der Lunge, der Haut, der Bauchspeicheldrüse oder des Uterus behandelt oder verhindert. In anderen spezifischen Ausführungsformen wird Sarkom, Melanom oder Leukämie mit den Verfahren und Zusammensetzungen der Erfindung behandelt.Preferred is the polypeptide molecule of dual specificity according to the invention, the nucleic acid or expression vector according to the invention or the cell according to the invention or the pharmaceutical composition according to the invention for use in the treatment or prevention of a disease or disorder resulting from immunological disorders, infectious diseases , Intoxication and cancers, including the treatment or prevention of a variety of cancers or other abnormal proliferative disorders, including (but not limited to) the following diseases: carcinoma, including the bladder, breast, bowel, kidney, liver, lung, Ovaries, pancreas, stomach, prostate, cervix, thyroid and skin, including squamous cell carcinoma, hematopoietic tumors of lymphoid lineage, including leukemia, acute lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Burkett's lymphoma, hematopoietic tumors of myeloid lineage, including acute and chronic myelogenous leukemia and promyelocytic leukemia, tumors of mesenchymal origin, including fibrosarcoma and rhabdomyosarcoma, other tumors including melanoma, seminoma, teratocarcinoma, Neuroblastoma and glioma, tumors of the central and peripheral nervous system, including astrocytoma, neuroblastoma, glioma, schwannomas and osteosarcoma; and other tumors, including melanoma, xenoderma pigmentosum, keratoacanthoma, seminoma, thyroid carcinoma and teratocarcinoma. Additional cancers include, but are not limited to, follicular lymphoma, p53 mutant carcinomas, breast hormone-dependent tumors, prostate and ovaries, and precancerous lesions such as familial adenomatous polyposis and myelodysplastic syndromes. In specific embodiments, changes in malignancy or dysproliferative changes (such as metaplasia and dysplasia) or hyperproliferative diseases are presented by the methods and compositions of the invention in the ovaries, bladder, breast, intestine, lung, skin, pancreas or the uterus treated or prevented. In other specific embodiments, sarcoma, melanoma or leukemia are treated with the methods and compositions of the invention.
Die Erfindung stellt auch Verfahren zum Verhindern, Behandeln oder der Linderung von einem oder mehreren Symptomen, die mit einer entzündlichen Erkrankung eines Subjekts verbunden sind, zur Verfügung, weiterhin umfassend das Verabreichen einer therapeutisch oder prophylaktisch wirksamen Menge eines oder mehrerer entzündungshemmender Wirkstoffe gemäß der Erfindung an das Subjekt. Die Erfindung stellt auch Verfahren zum Verhindern, Behandeln oder Linderung von einem oder mehreren Symptomen, die mit einer Autoimmunerkrankung verbunden sind, zur Verfügung, weiterhin umfassend das Verabreichen einer therapeutisch oder prophylaktisch wirksamen Menge eines oder mehrerer immunmodulierenden Wirkstoffe gemäß der Erfindung an das Subjekt. Infektionskrankheiten, die mit den Molekülen der Erfindung behandelt oder verhindert werden können, werden durch Infektionserreger hervorgerufen, einschließlich, aber nicht beschränkt auf: Viren, Bakterien, Fungi, Protozoen und Viren. Viruserkrankungen, die unter Verwendung der Moleküle der Erfindung zusammen mit den Verfahren der vorliegenden Erfindung behandelt oder verhindert werden können umfassen, sind aber nicht beschränkt auf Viruserkrankungen, die durch Hepatitis Typ A, Hepatitis Typ B, Hepatitis Typ C, Grippe, Varicella, Adenovirus, Herpes simplex Typ I (HSV-I), Herpes simplex Typ II (HSV-II), Rinderpest, Rhinovirus, Echovirus, Rotavirus, Respiratorisches Synzytial Virus, Papilloma Virus, Papovavirus, Zytomegalovirus, Echinovirus, Arbovirus, Hantavirus, Coxsackievirus, Mumpsvirus, Masernvirus, Rötelnvirus, Poliovirus, Pocken, Epstein Barr Virus, humanes Immunschwächevirus Typ I (HIV-I), humanes Immunschwächevirus Typ II (HIV-II), und Erreger von Viruserkrankungen, wie zum Beispiel virale Meningitis, Enzephalitis, Denguefieber oder Pocken hervorgerufen werden.The invention also provides methods for preventing, treating or alleviating one or more symptoms associated with an inflammatory disease of a subject, further comprising administering a therapeutically or prophylactically effective amount of one or more anti-inflammatory agents according to the invention the subject. The invention also provides methods of preventing, treating or ameliorating one or more symptoms associated with an autoimmune disease, further comprising administering to the subject a therapeutically or prophylactically effective amount of one or more immunomodulating agents according to the invention. Infectious diseases that can be treated or prevented with the molecules of the invention are caused by infectious agents, including, but not limited to, viruses, bacteria, fungi, protozoa and viruses. Viral diseases that can be treated or prevented using the molecules of the invention in conjunction with the methods of the present invention include, but are not limited to, viral diseases characterized by hepatitis type A, type B hepatitis, Type C hepatitis, influenza, varicella, adenovirus, herpes simplex type I (HSV-I), herpes simplex type II (HSV-II), rinderpest, rhinovirus, echovirus, rotavirus, respiratory syncytial virus, papilloma virus, papovavirus, cytomegalovirus, echinovirus , Arbovirus, hantavirus, coxsackievirus, mumps virus, measles virus, rubella virus, poliovirus, smallpox, Epstein Barr virus, human immunodeficiency virus type I (HIV-I), human immunodeficiency virus type II (HIV-II), and viral pathogens such as viral Meningitis, encephalitis, dengue or smallpox.
Bakterielle Krankheiten, die unter Verwendung der Moleküle der Erfindung zusammen mit den Verfahren der vorliegenden Erfindung behandelt oder verhindert werden können, die durch Bakterien verursacht werden, umfassen, sind aber nicht beschränkt auf Mycobacteria rickettsia, Mycoplasma, Neisseria, Streptococcus pneumoniae, Borrelia burgdorferi (Borreliose), Bacillus antracis (Anthrax), Tetanus, Streptococcus, Staphylococcus, Mycobacterium, Tetanus, Pertussis, Cholera, Pest, Diphtherie, Chlamydien, S. aureus und Legionellen.Bacterial diseases that can be treated or prevented using the molecules of the invention in association with the methods of the present invention caused by bacteria include, but are not limited to, Mycobacteria rickettsia, Mycoplasma, Neisseria, Streptococcus pneumoniae, Borrelia burgdorferi (Lyme disease ), Bacillus antracis (anthrax), tetanus, streptococcus, staphylococcus, mycobacterium, tetanus, pertussis, cholera, plague, diphtheria, chlamydia, S. aureus and legionella.
Protozoenerkrankungen, die unter Verwendung der Moleküle der Erfindung zusammen mit den Verfahren der vorliegenden Erfindung behandelt oder verhindert werden können, die durch Protozoen verursacht werden, umfassen, sind aber nicht beschränkt auf Leishmaniose; Kokzidioa, Trypanosoma oder Malaria. Parasitäre Krankheiten, die unter Verwendung der Moleküle der Erfindung zusammen mit den Verfahren der vorliegenden Erfindung behandelt oder verhindert werden können, die durch Parasiten verursacht werden, umfassen, sind aber nicht beschränkt auf Chlamydien und Rickettsia.Protozoal diseases which can be treated or prevented using the molecules of the invention together with the methods of the present invention caused by protozoa include, but are not limited to, leishmaniasis; Coccidioa, Trypanosoma or malaria. Parasitic diseases that can be treated or prevented using the molecules of the invention in conjunction with the methods of the present invention caused by parasites include, but are not limited to, chlamydia and rickettsia.
Beispiele für infektiöse Erreger und Infektionskrankheiten umfassen, aber sind nicht beschränkt auf Bakterien (z. B. Escherichia coli, Klebsiella pneumoniae, Staphylococcus aureus, Enterococcus faecalis, Candida albicans, Proteus vulgaris, Staphylococcus viridans und Pseudomonas aeruginosa), ein Pathogen (z. B. Blymphotrophisches Papovavirus (LPV); Bordetella pertussis; Borna Disease Virus (BDV); Bovines Coronavirus; Choriomeningitis Virus; Dengue Virus; a Virus, E. coli; Ebola; Echovirus 1; Echovirus-11 (EV); Endotoxin (LPS); Enterobakterien; Entero Orphan Virus; Enteroviren; Katzenleukämievirus; Maul-und-Klauenseuche-Virus; Gibbonaffenleukämievirus (GALV); Gram-negative Bakterien; Helicobacter pylorii; Hepatitis-B-Virus (HBV); Herpes Simplex Virus; HIV-I; humanes Zytomegalovirus; humanes Coronavirus; Influenza A, B und C; Legionella; Leishmania mexicana; Listeria monocytogenes; Masernvirus; Meningococcus; Morbilliviren; murines Hepatitis-Virus; murines Leukämie-Virus; murines Gamma-Herpesvirus; murines Retrovirus; murines Coronavirus murines Hepatitis-Virus; Mycobacterium avium-M; Neisseria gonorrhoeae; Newcastle Disease Virus; Parvovirus B 19; Plasmodium falciparum; Pockenvirus; Pseudomonas; Rotavirus; Salmonella typhiurium; Shigella; Streptococci; T-Zelllymphotropisches Virus 1; Vacciniavirus).Examples of infectious agents and infectious diseases include, but are not limited to, bacteria (e.g., Escherichia coli, Klebsiella pneumoniae, Staphylococcus aureus, Enterococcus faecalis, Candida albicans, Proteus vulgaris, Staphylococcus viridans and Pseudomonas aeruginosa), a pathogen (e.g. Blymphotrophic papovavirus (LPV); Bordetella pertussis; Borna disease virus (BDV); Bovine coronavirus; Choriomeningitis virus; Dengue virus; a Virus, E. coli; Ebola;
Unter noch einem anderen Aspekt der vorliegenden Erfindung bezieht sich die Erfindung auf ein Verfahren zur Behandlung einer Krankheit oder Störung, welche das Verabreichen einer therapeutisch wirksamen Menge des Moleküls mit zweifacher Spezifität gemäß der Erfindung, der Nukleinsäure oder des Expressionsvektors gemäß der Erfindung, der Zelle gemäß der Erfindung oder der pharmazeutischen Zusammensetzung gemäß der Erfindung umfasst.In yet another aspect of the present invention, the invention relates to a method of treating a disease or disorder comprising administering a therapeutically effective amount of the dual specificity molecule according to the invention, the nucleic acid or the expression vector according to the invention to the cell according to of the invention or the pharmaceutical composition according to the invention.
Das Polypeptidmolekül mit zweifacher Spezifität kann in einem Verfahren für das Verhindern oder Behandeln einer Krankheit oder eines Zustands verwendet werden, die / der durch das Verabreichen des Polypeptidmoleküls mit zweifacher Spezifität verbessert wird. Solche Behandlungen können in einer pharmazeutischen Zusammensetzung zusammen mit einem oder mehreren pharmazeutisch annehmbaren Trägern oder Hilfsstoffen bereitgestellt werden. Therapeutische Polypeptidmoleküle mit zweifacher Spezifität werden für gewöhnlich als ein Teil einer sterilen pharmazeutischen Zusammensetzung bereitgestellt, die normalerweise einen pharmazeutisch annehmbaren Träger umfassen wird. Diese pharmazeutische Zusammensetzung kann in jeder geeigneten Form vorliegen (in Abhängigkeit von dem gewünschten Verfahren ihrer Verabreichung an einen Patienten). Es kann in Dosierungseinheitsform bereitgestellt werden und wird im Allgemeinen in einem versiegelten Behälter bereitgestellt und kann als Teil eines Kits bereitgestellt werden. Dieser Kit würde normalerweise (aber nicht notwendigerweise) Gebrauchsanweisungen umfassen. Er kann eine Vielzahl dieser Dosierungseinheitsformen enthalten. Die pharmazeutische Zusammensetzung kann auf jede geeignete Weise an das Verabreichen angepasst werden, wie zum Beispiel auf parenteralem (einschließlich subkutanem, intramuskulärem oder intravenösem) Weg. Diese Zusammensetzungen können durch jedes im Stand der Technik auf dem Gebiet der Pharmazie bekannte Verfahren hergestellt werden, indem der Wirkstoff mit dem / den Träger(n) oder Hilfsstoff(en) unter sterilen Bedingungen gemischt wird.The dual specificity polypeptide molecule can be used in a method for preventing or treating a disease or condition that is enhanced by administering the polypeptide molecule having dual specificity. Such treatments may be provided in a pharmaceutical composition together with one or more pharmaceutically acceptable carriers or excipients. Therapeutic polypeptide molecules having dual specificity are usually provided as part of a sterile pharmaceutical composition which will normally comprise a pharmaceutically acceptable carrier. This pharmaceutical composition may be in any suitable form (depending on the desired method of administration to a patient). It may be provided in unit dosage form and is generally provided in a sealed container and may be provided as part of a kit. This kit would normally (but not necessarily) include instructions for use. It may contain a variety of these dosage unit forms. The pharmaceutical composition may be adapted for administration in any suitable manner, such as parenteral (including subcutaneous, intramuscular or intravenous) routes. These compositions may be prepared by any method known in the art in the pharmaceutical arts by mixing the active ingredient with the carrier (s) or excipient (s) under sterile conditions.
Dosierungen der Polypeptidmoleküle mit zweifacher Spezifität der vorliegenden Erfindung können innerhalb eines weiten Bereichs variieren, in Abhängigkeit von der zu behandelnden Erkrankung oder Störung, dem Alter und dem Zustand des Individuums, das behandelt werden soll, etc. zum Beispiel kann ein geeigneter Dosierungsbereich für ein Polypeptidmolekül mit zweifacher Spezifität zwischen 25 ng/kg und 50 µg/kg liegen. Ein Arzt wird schließlich die geeigneten zu verabreichenden Dosierungen bestimmen.Doses of the dual specificity polypeptide molecules of the present invention may vary within a wide range, depending on the disease or disorder to be treated, For example, the age and condition of the subject to be treated, etc., for example, a suitable dosage range for a polypeptide molecule with dual specificity may be between 25 ng / kg and 50 μg / kg. A doctor will eventually determine the appropriate dosages to administer.
Pharmazeutische Zusammensetzungen, Vektoren, Nukleinsäuren und Zellen der Erfindung können in einer im Wesentlichen reinen Form bereitgestellt werden, zum Beispiel mit einer Reinheit von mindestens 80%, mindestens 85%, mindestens 90%, mindestens 91%, mindestens 92%, mindestens 93%, mindestens 94%, mindestens 95%, mindestens 96%, mindestens 97%, mindestens 98%, mindestens 99% oder 100%.Pharmaceutical compositions, vectors, nucleic acids and cells of the invention may be provided in a substantially pure form, for example having a purity of at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100%.
Bevorzugte Merkmale von jedem Aspekt der Erfindung gelten mutatis mutandis für jeden anderen Aspekt. Die vorliegend erwähnten Druckschriften werden in vollem Maße, soweit dies gesetzlich erlaubt ist, einbezogen. Obwohl die vorliegende Erfindung und ihre Vorteile im Einzelnen beschrieben wurden, sollte klargestellt werden, dass verschiedene Änderungen, Ersetzungen und Veränderungen vorliegend vorgenommen werden können, ohne von dem Geist und dem Umfang der in den angehängten Ansprüchen definierten Erfindung abzuweichen. Die vorliegende Erfindung wird in den folgenden Beispielen weiter beschrieben, die nur zum Zweck der Veranschaulichung bereitgestellt werden und nicht dafür bestimmt sind, die Erfindung auf irgendeine Art und Weise zu beschränken.Preferred features of each aspect of the invention apply mutatis mutandis to any other aspect. The documents mentioned herein are fully incorporated, to the extent permitted by law. Although the present invention and its advantages have been described in detail, it should be understood that various changes, substitutions and alterations can be made herein without departing from the spirit and scope of the invention as defined by the appended claims. The present invention will be further described in the following examples, which are provided for the purpose of illustration only and are not intended to limit the invention in any way.
BEISPIELEEXAMPLES
BEISPIEL 1EXAMPLE 1
Struktur von Fc-enthaltenden, bispezifischen TCR / mAb Diabodies und Steuerungsmolekülen.Structure of Fc-containing bispecific TCR / mAb diabodies and control molecules.
Fc-enthaltende, bispezifische
Im Falle von Fc-enthaltenden, bispezifischen
Verschiedene Steuerungsmoleküle, welche dieselben Spezifitäten zeigen, wurden konstruiert, Tabelle 2, wobei diese VH, VL, Valpha und Vbeta-Domänen in Kombinationen mit konstanten Domänen, die von
BEISPIEL 2 EXAMPLE 2
Herstellung und Aufreinigung von Fc-enthaltenden, bispezifischen TCR / mAb Diabodies.Preparation and purification of Fc-containing, bispecific TCR / mAb diabodies.
Vektoren für die Expression von rekombinanten Proteinen wurden als monocistronische pUC19-Derivative erschaffen, die durch Promotorelemente gesteuert werden, die von
Der konditionierte Zellüberstand wurde durch Zentrifugation (4000 x g, 30 Minuten) geerntet und durch Filtration (0,22 µm) gereinigt. Bispezifische Moleküle wurden unter Verwendung eines Äkta Pure 25 L FPLC-Systems (GE Lifesciences) aufgereinigt, das dafür ausgerüstet ist, parallel Affinitäts- und Größenausschlusschromatografie durchzuführen. Affinitätschromatografie wurde auf Protein-A-Säulen (GE Lifesciences) unter Befolgung von Standardprotokollen für die Affinitätschromatografie ausgeführt. Direkt nach der Elution (pH 2,8) von der Affinitätssäule, um hochreine monomerische Proteine zu erhalten, wobei unter Verwendung von Standardprotokollen Superdex 200 pg 16/600 Säulen (GE Lifesciences) verwendet wurden, wurde die Größenausschlusschromatografie durchgeführt. Auf einem NanoDrop System (Thermo Scientific) wurden Proteinkonzentrationen bestimmt, wobei berechnete Extinktionskoeffizienten gemäß den vorhergesagten Proteinsequenzen verwendet wurden. Falls notwendig, wurde die Aufkonzentration und der Austausch des Puffers unter Verwendung von Vivaspin-Geräten (Sartorius) durchgeführt. Schließlich wurden aufgereinigte Moleküle in phosphat-gepufferter Salzlösung bei Konzentrationen von ungefähr 1 mg/ml bei Temperaturen von 2-8°C gelagert.The conditioned cell supernatant was harvested by centrifugation (4000 x g, 30 minutes) and purified by filtration (0.22 μm). Bispecific molecules were purified using an Äkta Pure 25 L FPLC system (GE Lifesciences) equipped to perform parallel affinity and size exclusion chromatography. Affinity chromatography was performed on Protein A columns (GE Lifesciences) following standard protocols for affinity chromatography. Immediately after elution (pH 2.8) from the affinity column to obtain high purity monomeric proteins using
Da therapeutische Proteine bei Einwirkung von Säuren eine angemessene Stabilität zeigen sollen, um robuste industrielle Aufreinigungsprozesse zu erleichtern, wurde der Prozentsatz von monomerem Protein, das von der Säule zum Abfangen von Protein A eluiert, ermittelt (Tabelle 3). Es ist offensichtlich, dass die Einführung von stabilisierenden Mutationen in Moleküle sowie die Auswahl von kennzeichnenden Orientierungen von Bindungsdomänen die Stabilität bei der Einwirkung von Säuren deutlich beeinflusst.
Tabelle 3: Fraktion von monomerischem Protein nach einer sauren Elution von der abfangenden Säule:
Nach der Größenausschlusschromatografie zeigten die aufgereinigten bispezifischen Moleküle eine hohe Reinheit (>93% monomerisches Protein), wie durch HPLC-SEC an MabPac SEC-1-Säulen (5 µm, 7,8x300 mm) bestimmt, die in 50 mM NatriumPhosphat, ph 6,8, 300 mM NaCl innerhalb eines Agilent 1100 System enthaltend, durchlaufen (siehe
BEISPIEL 3 EXAMPLE 3
Spezifische und Zielzellen-abhängige T-Zell-Aktivierung, die durch Fc-enthaltende TCR / mAb Diabodies ausgelöst wird.Specific and target cell-dependent T cell activation triggered by Fc-containing TCR / mAb diabodies.
Die Wirksamkeit von Fc-enthaltenden
Repräsentative Ergebnisse des Wirksamkeits-Assays werden jeweils für auf IgG4-basierende (
BEISPIEL 4EXAMPLE 4
Die Entwicklung von Fc-enthaltenden, bispezifischen TCR / mAb Diabodies als eine molekulare PlattformThe development of Fc-containing, bispecific TCR / mAb diabodies as a molecular platform
Die Ergebnisse des Wirksamkeits-Assays zeigten eine Ziel-abhängige Jurkat Reporter-T-Zell-Aktivierung und minimale unspezifische Wirkung gegen unbeladene T2-Zellen sowohl für variable Antikörperdomänen hUCHT1 (Konstrukt ID_1) und hBMA031 (Konstrukte
BEISPIEL 5EXAMPLE 5
Stabilität von Fc-enthaltenden, bispezifischen TCR / mAb DiabodiesStability of Fc-containing bispecific TCR / mAb diabodies
Die Stabilität der bispezifischen
Studien zur Stabilität unter Belastung wurden durch die Lagerung von aufgereinigten Molekülen durchgeführt, die bei 40°C für bis zu zwei Wochen in PBS gelöst wurden. Proben wurden im Hinblick auf die Integrität der Proteine analysiert, wobei HPLC-SEC verwendet wurde und die Wirksamkeit wurde, wie oben beschrieben, unter Verwendung des T-Zell-Aktivierungsassays (Promega) untersucht.Stress stability studies were performed by storing purified molecules that were dissolved in PBS at 40 ° C for up to two weeks. Samples were analyzed for integrity of the proteins using HPLC SEC and efficacy was assayed as described above using the T cell activation assay (Promega).
Wie erwartet löste die Lagerung bei 40°C die Bildung von Aggregaten / Spezies mit hohem Molekulargewicht aus, wie durch HPLC-SEC Untersuchungen bestimmt (siehe
SEQUENZPROTOKOLLSEQUENCE LISTING
- <110> Immatics biotechnologies<110> Immatics biotechnologies
- <120> Polypeptidmolekül mit verbesserter zweifacher Spezifität<120> Polypeptide molecule with improved dual specificity
- <130> I33034DE<130> I33034DE
- <160> 42<160> 42
- <170> Patentin version 3.5<170> Patent version 3.5
- <210> 1 <211> 21 <212> PRT <213> Homo sapiens<210> 1 <211> 21 <212> PRT <213> Homo sapiens
- <400> 1 <400> 1
- <210> 2 <211> 19 <212> PRT <213> Homo sapiens<210> 2 <211> 19 <212> PRT <213> Homo sapiens
- <400> 2 <400> 2
- Ala Gly ProAla Gly Pro
- <210> 3 <211> 53 <212> PRT <213> Homo sapiens<210> 3 <211> 53 <212> PRT <213> Homo sapiens
- <400> 3 <400> 3
- <210> 4 <211> 18 <212> PRT <213> Homo sapiens<210> 4 <211> 18 <212> PRT <213> Homo sapiens
- <400> 4 <400> 4
- Leu GlyLeu Gly
- <210> 5 <211> 103 <212> PRT <213> Homo sapiens<210> 5 <211> 103 <212> PRT <213> Homo sapiens
- <400> 5 <400> 5
- <210> 6 <211> 103 <212> PRT <213> Homo sapiens<210> 6 <211> 103 <212> PRT <213> Homo sapiens
- <400> 6 <400> 6
- <210> 7 <211> 9 <212> PRT <213> Homo sapiens<210> 7 <211> 9 <212> PRT <213> Homo sapiens
- <400> 7 <400> 7
- <210> 8 <211> 480 <212> PRT <213> Homo sapiens<210> 8 <211> 480 <212> PRT <213> Homo sapiens
- <400> 8 <400> 8
- <210> 9 <211> 461 <212> PRT <213> Homo sapiens<210> 9 <211> 461 <212> PRT <213> Homo sapiens
- <400> 9 <400> 9
- <210> 10 <211> 478 <212> PRT <213> Homo sapiens<210> 10 <211> 478 <212> PRT <213> Homo sapiens
- <400> 10 <400> 10
- <210> 11 <211> 459 <212> PRT <213> Homo sapiens<210> 11 <211> 459 <212> PRT <213> Homo sapiens
- <400> 11 <400> 11
- <210> 12 <211> 478 <212> PRT <213> Homo sapiens<210> 12 <211> 478 <212> PRT <213> Homo sapiens
- <400> 12 <400> 12
- <210> 13 <211> 459 <212> PRT <213> Homo sapiens<210> 13 <211> 459 <212> PRT <213> Homo sapiens
- <400> 13 <400> 13
- <210> 14 <211> 478 <212> PRT <213> Homo sapiens<210> 14 <211> 478 <212> PRT <213> Homo sapiens
- <400> 14 <400> 14
- <210> 15 <211> 459 <212> PRT <213> Homo sapiens<210> 15 <211> 459 <212> PRT <213> Homo sapiens
- <400> 15 <400> 15
- <210> 16 <211> 474 <212> PRT <213> Homo sapiens<210> 16 <211> 474 <212> PRT <213> Homo sapiens
- <400> 16 <400> 16
- <210> 17 <211> 463 <212> PRT <213> Homo sapiens<210> 17 <211> 463 <212> PRT <213> Homo sapiens
- <400> 17 <400> 17
- <210> 18 <211> 462 <212> PRT <213> Homo sapiens<210> 18 <211> 462 <212> PRT <213> Homo sapiens
- <400> 18 <400> 18
- <210> 19 <211> 472 <212> PRT <213> Homo sapiens<210> 19 <211> 472 <212> PRT <213> Homo sapiens
- <400> 19 <400> 19
- <210> 20 <211> 467 <212> PRT <213> Homo sapiens<210> 20 <211> 467 <212> PRT <213> Homo sapiens
- <400> 20 <400> 20
- <210> 21 <211> 472 <212> PRT <213> Homo sapiens<210> 21 <211> 472 <212> PRT <213> Homo sapiens
- <400> 21 <400> 21
- <210> 22 <211> 462 <212> PRT <213> Homo sapiens<210> 22 <211> 462 <212> PRT <213> Homo sapiens
- <400> 22 <400> 22
- <210> 23 <211> 472 <212> PRT <213> Homo sapiens<210> 23 <211> 472 <212> PRT <213> Homo sapiens
- <400> 23 <400> 23
- <210> 24 <211> 468 <212> PRT <213> Homo sapiens<210> 24 <211> 468 <212> PRT <213> Homo sapiens
- <400> 24 <400> 24
- <210> 25 <211> 472 <212> PRT <213> Homo sapiens<210> 25 <211> 472 <212> PRT <213> Homo sapiens
- <400> 25 <400> 25
- <210> 26 <211> 231 <212> PRT <213> Homo sapiens<210> 26 <211> 231 <212> PRT <213> Homo sapiens
- <400> 26 <400> 26
- <210> 27 <211> 231 <212> PRT <213> Homo sapiens<210> 27 <211> 231 <212> PRT <213> Homo sapiens
- <400> 27 <400> 27
- <210> 28 <211> 113 <212> PRT <213> Homo sapiens<210> 28 <211> 113 <212> PRT <213> Homo sapiens
- <400> 28 <400> 28
- <210> 29 <211> 122 <212> PRT <213> Homo sapiens<210> 29 <211> 122 <212> PRT <213> Homo sapiens
- <400> 29 <400> 29
- <210> 30 <211> 8 <212> PRT <213> Homo sapiens<210> 30 <211> 8 <212> PRT <213> Homo sapiens
- <400> 30 <400> 30
- <210> 31 <211> 117 <212> PRT <213> Homo sapiens <210> 31 <211> 117 <212> PRT <213> Homo sapiens
- <400> 31 <400> 31
- <210> 32 <211> 107 <212> PRT <213> Homo sapiens<210> 32 <211> 107 <212> PRT <213> Homo sapiens
- <400> 32 <400> 32
- <210> 33 <211> 478 <212> PRT <213> Homo sapiens<210> 33 <211> 478 <212> PRT <213> Homo sapiens
- <400> 33 <400> 33
- <210> 34 <211> 451 <212> PRT <213> Homo sapiens<210> 34 <211> 451 <212> PRT <213> Homo sapiens
- <400> 34 <400> 34
- <210> 35 <211> 698 <212> PRT <213> Homo sapiens<210> 35 <211> 698 <212> PRT <213> Homo sapiens
- <400> 35 <400> 35
- <210> 36 <211> 692 <212> PRT <213> Homo sapiens<210> 36 <211> 692 <212> PRT <213> Homo sapiens
- <400> 36 <400> 36
- <210> 37 <211> 698 <212> PRT <213> Homo sapiens<210> 37 <211> 698 <212> PRT <213> Homo sapiens
- <400> 37 <400> 37
- <210> 38 <211> 696 <212> PRT <213> Homo sapiens<210> 38 <211> 696 <212> PRT <213> Homo sapiens
- <400> 38 <400> 38
- <210> 39 <211> 690 <212> PRT <213> Homo sapiens<210> 39 <211> 690 <212> PRT <213> Homo sapiens
- <400> 39 <400> 39
- <210> 40 <211> 428 <212> PRT <213> Homo sapiens<210> 40 <211> 428 <212> PRT <213> Homo sapiens
- <400> 40 <400> 40
- <210> 41 <211> 1392 <212> PRT <213> Homo sapiens<210> 41 <211> 1392 <212> PRT <213> Homo sapiens
- <400> 41 <400> 41
- <210> 42 <211> 214 <212> PRT <213> Homo sapiens<210> 42 <211> 214 <212> PRT <213> Homo sapiens
- <400> 42 <400> 42
ZITATE ENTHALTEN IN DER BESCHREIBUNG QUOTES INCLUDE IN THE DESCRIPTION
Diese Liste der vom Anmelder aufgeführten Dokumente wurde automatisiert erzeugt und ist ausschließlich zur besseren Information des Lesers aufgenommen. Die Liste ist nicht Bestandteil der deutschen Patent- bzw. Gebrauchsmusteranmeldung. Das DPMA übernimmt keinerlei Haftung für etwaige Fehler oder Auslassungen.This list of the documents listed by the applicant has been generated automatically and is included solely for the better information of the reader. The list is not part of the German patent or utility model application. The DPMA assumes no liability for any errors or omissions.
Zitierte PatentliteraturCited patent literature
- EP 1075496 [0010, 0037]EP 1075496 [0010, 0037]
- US 20060166875 [0015]US 20060166875 [0015]
- US 20120252742 [0015]US 20120252742 [0015]
- EP 1868650 [0029]EP 1868650 [0029]
- WO 2016/170139 [0031]WO 2016/170139 [0031]
- WO 2016/102272 [0031]WO 2016/102272 [0031]
- WO 2016/156202 [0031]WO 2016/156202 [0031]
- WO 2016/146751 [0031]WO 2016/146751 [0031]
- WO 2011/113819 [0031]WO 2011/113819 [0031]
- WO 2016/156230 [0031]WO 2016/156230 [0031]
- WO 2016/177784 [0031]WO 2016/177784 [0031]
- WO 2016/202963 [0031]WO 2016/202963 [0031]
- WO 2016/207164 [0031]WO 2016/207164 [0031]
- WO 2017/001491 [0031]WO 2017/001491 [0031]
- WO 2017/005733 [0031]WO 2017/005733 [0031]
- WO 2017/021527 [0031]WO 2017/021527 [0031]
- WO 2017/036936 [0031]WO 2017/036936 [0031]
- EP 2016/073416 PCT [0031]EP 2016/073416 PCT [0031]
- WO 2002/002781 [0039]WO 2002/002781 [0039]
- WO 9850431 [0040]WO 9850431 [0040]
Zitierte Nicht-PatentliteraturCited non-patent literature
- Yang F. u. a. Bispecific Antibodies as a Development Platform for New Concepts and Treatment Strategies. Int J Mol Sci. 28. Dezember 206; 18(1) [0002]Yang F. and others a. Bispecific Antibodies as a Development Platform for New Concepts and Treatment Strategies. Int J Mol Sci. December 28, 206; 18 (1) [0002]
- Baeuerle, P.A.; Reinhardt, C. Bispecific T-cell engaging antibodies for cancer therapy. Cancer Res. 2009, 69, 4941-4944 [0003]Baeuerle, P.A .; Reinhardt, C. Bispecific T-cell participating antibodies for cancer therapy. Cancer Res. 2009, 69, 4941-4944 [0003]
- Utilizing the BiTE (bispecific T-cell engager) platform for immunotherapy of cancer. Expert Opin Biol Ther. 2015;15(8):1093-9 [0004]Utilizing the BiTE (bispecific T-cell engager) platform for immunotherapy of cancer. Expert Opin Biol Ther. 2015; 15 (8): 1093-9 [0004]
- Coloma, M.J. und Morrison, S.L. (1997) Design and production of novel tetravalent bispecific antibodies. Nat. Biotechnol. 15, 159-163 [0005]Coloma, M.J. and Morrison, S.L. (1997) Design and production of novel tetravalent bispecific antibodies. Nat. Biotechnol. 15, 159-163 [0005]
- ,Knobs-into-holes' engineering of antibody CH3 domains for heavy chain heterodimerization Protein Eng. 1996 Jul; 9(7):617-21 [0006]'Knobs-into-holes' engineering of CH3 domains for heavy chain heterodimerization Protein Eng. 1996 Jul; 9 (7): 617-21 [0006]
- Application of dual affinity retargeting molecules to achieve optimal redirected T-cell killing of B-cell lymphoma, Blood. 28. Apr. 2011; 117(17):4542-51 [0012]Application of dual affinity retargeting molecules to achieve optimally redirected T-cell killing of B-cell lymphoma, Blood. Apr. 28, 2011; 117 (17): 4542-51 [0012]
- Piepenbrink u. a., The basis for limited specificity and MHC restriction in a T cell receptor interface, Nat Commun, 2013; 4, 1948 [0013]Piepenbrink u. a., The basis for limited specificity and MHC restriction in a T cell receptor interface, Nat Commun, 2013; 4, 1948 [0013]
- Bi-specific TCR-anti CD3 redirected T-cell targeting of NYESO-1- and LAGE-1-positive tumors. Cancer Immunol Immunother. Apr 2013; 62(4):773-85 [0016]Bi-specific TCR-anti CD3 redirected T-cell targeting of NYESO-1 and LAGE-1-positive tumors. Cancer Immunol Immunother. Apr 2013; 62 (4): 773-85 [0016]
- Olimpieri, Pier Paolo, Paolo Marcatili und Anna Tramontano überprüft. „Tabhu: Tools for Antibody Humanization.“ Bioinformatics 31.3 (2015): 434-435 [0047]Olimpieri, Pier Paolo, Paolo Marcatili and Anna Tramontano checked. "Tabhu: Tools for Antibody Humanization." Bioinformatics 31.3 (2015): 434-435 [0047]
- PMC; Safdari Y1, Farajnia S, Asgharzadeh M, Khalili M. Antibody humanization methods - a review and update. Biotechnol Genet Eng Rev. 2013;29:175-86 [0047]PMC; Safdari Y1, Farajnia S, Asgharzadeh M, Khalili M. Antibody humanization methods - a review and update. Biotechnol Genet Eng Rev. 2013; 29: 175-86 [0047]
- Ahmadzadeh V1, Farajnia S, Feizi MA, Nejad RA. Antibody humanization methods for development of therapeutic applications. Monoclon Antib Immunodiagn Immunother. Apr. 2014; 33(2):67-73 [0047]Ahmadzadeh V1, Farajnia S, Feizi MA, Nejad RA. Antibody humanization methods for development of therapeutic applications. Monoclon Antib Immunodiagn Immunother. Apr. 2014; 33 (2): 67-73 [0047]
- Holler PD, u. a. In vitro evolution of a T cell receptor with high affinity for peptide/MHC. Proc Natl Acad Sci USA. 9. Mai 2000; 97(10):5387-92 [0048]Holler PD, u. a. In vitro evolution of a T cell receptor with high affinity for peptide / MHC. Proc Natl Acad Sci USA. 9 May 2000; 97 (10): 5387-92 [0048]
- Boder ET u. a., Directed evolution of antibody fragments with monovalent femtomolar antigenbinding affinity. Proc Natl Acad Sci USA. 26. Sep 2000; 97(20):10701-5 [0048]Boder ET u. a., Directed evolution of antibody fragments with monovalent femtomolar antigen binding affinity. Proc Natl Acad Sci USA. 26 Sep 2000; 97 (20): 10701-5 [0048]
-
Zhao Q, u. a. Affinity maturation of T-cell receptor-like antibodies for Wilms tumor 1 peptide greatly enhances therapeutic potential. Leukemia. 2015; 29(11):2238-2247 [0048]Zhao Q, u. a. Affinity maturation of T-cell receptor-like antibodies for
Wilms tumor 1 peptide greatly enhances therapeutic potential. Leukemia. 2015; 29 (11): 2238-2247 [0048] - T cell activation. J Immunol, 1995, 155, 1903-1910 [0086]T cell activation. J Immunol, 1995, 155, 1903-1910 [0086]
- Construction, expression and characterization of humanized antibodies directed against the human alpha/beta T cell receptor. J Immunol, 1991, 147, 4366-73 [0086]Construction, expression and characterization of humanized antibodies directed against the human alpha / beta T cell receptor. J Immunol, 1991, 147, 4366-73 [0086]
- Identification and engineering of human variable regions that allow expression of stable single-chain T cell receptors. PEDS, 2011, 24, 361 - 372 [0086]Identification and engineering of human variable regions that allow expression of stable single-chain T cell receptors. PEDS, 2011, 24, 361-372 [0086]
- Stabilization of the Fv Fragments in Recombinant Immunotoxins by Disulfide Bonds Engineered into Conserved Framework Regions. Biochemistry, 1994, 33, 5451 - 5459 [0087]Stabilization of the Fv Fragments in Recombinant Immunotoxins by Disulfide Bonds Engineered into Conserved Framework Regions. Biochemistry, 1994, 33, 5451-5459 [0087]
Claims (21)
Priority Applications (72)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
DE102017115966.5A DE102017115966A1 (en) | 2017-07-14 | 2017-07-14 | Polypeptide molecule with improved dual specificity |
CA3069610A CA3069610A1 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
CN201880046721.2A CN110914307A (en) | 2017-07-14 | 2018-07-13 | Improved bispecific polypeptide molecules |
AU2018298884A AU2018298884A1 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
MA46299A MA46299B1 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
MDE20200533T MD3652215T2 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
MDE20190844T MD3428194T2 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
CR20200013A CR20200013A (en) | 2017-07-14 | 2018-07-13 | POLYPEPTIDE MOLECULE WITH ENHANCED DUAL SPECIFICITY |
ES18740829T ES2871146T3 (en) | 2017-07-14 | 2018-07-13 | Polypeptide molecule with enhanced dual specificity |
US16/035,403 US11905328B2 (en) | 2017-07-14 | 2018-07-13 | Dual specificity polypeptide molecule |
DK18183508.3T DK3428194T3 (en) | 2017-07-14 | 2018-07-13 | IMPROVED POLYPEPTIDE MOLECULE WITH DOUBLE SPECIFICITY |
US16/035,412 US20190016802A1 (en) | 2017-07-14 | 2018-07-13 | Dual specificity polypeptide molecule |
SI201830285T SI3652215T1 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
MA49561A MA49561B1 (en) | 2017-07-14 | 2018-07-13 | Dual-specific enhanced polypeptide molecule |
SG11202000027WA SG11202000027WA (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
PT181835083T PT3428194T (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
RS20210561A RS61817B1 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
CR20200014A CR20200014A (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
PT187408299T PT3652215T (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
EP18183508.3A EP3428194B1 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
LTEP18183508.3T LT3428194T (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
DK18740829.9T DK3652215T3 (en) | 2017-07-14 | 2018-07-13 | IMPROVED DOUBLE SPECIFIC POLYPEPTIME MOLECULE |
KR1020207004219A KR20200026994A (en) | 2017-07-14 | 2018-07-13 | Enhanced Bispecific Polypeptide Molecules |
ARP180101959 AR112228A1 (en) | 2017-07-14 | 2018-07-13 | POLYPEPTIDE MOLECULE WITH ENHANCED DUAL SPECIFICITY |
CN201880046726.5A CN110914308A (en) | 2017-07-14 | 2018-07-13 | Improved bispecific polypeptide molecules |
PE2020000056A PE20200614A1 (en) | 2017-07-14 | 2018-07-13 | POLYPEPTIDE MOLECULE WITH ENHANCED DUAL SPECIFICITY |
EP18740829.9A EP3652215B1 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
PCT/EP2018/069151 WO2019012138A1 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
LTEP18740829.9T LT3652215T (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
HRP20211744TT HRP20211744T1 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
ES18183508T ES2898210T3 (en) | 2017-07-14 | 2018-07-13 | Polypeptide molecule with enhanced dual specificity |
PL18740829T PL3652215T3 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
AU2018298881A AU2018298881A1 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
KR1020207004221A KR20200026995A (en) | 2017-07-14 | 2018-07-13 | Enhanced Bispecific Polypeptide Molecules |
US16/035,420 US20190016803A1 (en) | 2017-07-14 | 2018-07-13 | Dual specificity polypeptide molecule |
RS20211381A RS62544B1 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
HUE18740829A HUE054568T2 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
CA3069842A CA3069842A1 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
BR112020000762-5A BR112020000762A2 (en) | 2017-07-14 | 2018-07-13 | dual specificity antibody, polypeptide molecules, nucleic acid, host cell, pharmaceutical composition and method of treating a disease or condition |
BR112020000769-2A BR112020000769A2 (en) | 2017-07-14 | 2018-07-13 | dual specificity antibody, polypeptide molecules, nucleic acid, host cell, pharmaceutical composition and method of treating a disease or condition |
EP21191794.3A EP3985029A1 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
PE2020000058A PE20200615A1 (en) | 2017-07-14 | 2018-07-13 | POLYPEPTIDE MOLECULE WITH ENHANCED DUAL SPECIFICITY |
SG11202000025SA SG11202000025SA (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
JP2020501174A JP2020530762A (en) | 2017-07-14 | 2018-07-13 | Improved bispecific polypeptide molecule |
PCT/EP2018/069157 WO2019012141A1 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
HUE18183508A HUE057110T2 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
SI201830456T SI3428194T1 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
PL18183508T PL3428194T3 (en) | 2017-07-14 | 2018-07-13 | Improved dual specificity polypeptide molecule |
US16/035,429 US20190016804A1 (en) | 2017-07-14 | 2018-07-13 | Dual specificity polypeptide molecule |
TW110149543A TWI817302B (en) | 2017-07-14 | 2018-07-16 | Improved dual specificity polypeptide molecule |
TW107124492A TWI762677B (en) | 2017-07-14 | 2018-07-16 | Improved dual specificity polypeptide molecule |
JP2018134424A JP6784724B2 (en) | 2017-07-14 | 2018-07-17 | Improved bispecific polypeptide molecule |
CL2020000097A CL2020000097A1 (en) | 2017-07-14 | 2020-01-13 | Polypeptide molecule with enhanced dual specificity. |
CL2020000098A CL2020000098A1 (en) | 2017-07-14 | 2020-01-13 | Polypeptide molecule with enhanced dual specificity. |
IL272046A IL272046A (en) | 2017-07-14 | 2020-01-14 | Improved dual specificity polypeptide molecule |
IL272045A IL272045A (en) | 2017-07-14 | 2020-01-14 | Improved dual specificity polypeptide molecule |
PH12020500095A PH12020500095A1 (en) | 2017-07-14 | 2020-01-14 | Improved dual specific polypeptide molecule |
MX2020011744A MX2020011744A (en) | 2017-07-14 | 2020-01-14 | Improved dual specificity polypeptide molecule. |
PH12020500098A PH12020500098A1 (en) | 2017-07-14 | 2020-01-14 | Improved dual specific polypeptide molecule |
CONC2020/0001029A CO2020001029A2 (en) | 2017-07-14 | 2020-01-28 | Polypeptide molecule with enhanced dual specificity |
ZA2020/00636A ZA202000636B (en) | 2017-07-14 | 2020-01-30 | Improved dual specificity polypeptide molecule |
ZA2020/00842A ZA202000842B (en) | 2017-07-14 | 2020-02-10 | Improved dual specificity polypeptide molecule |
CONC2020/0001491A CO2020001491A2 (en) | 2017-07-14 | 2020-02-11 | Polypeptide molecule with enhanced dual specificity |
JP2020177784A JP2021019626A (en) | 2017-07-14 | 2020-10-23 | Improved bispecific polypeptide molecule |
CY20211100387T CY1124091T1 (en) | 2017-07-14 | 2021-05-06 | IMPROVED DUAL SPECIFICITY POLYPEPTIDE MOLECULE |
HRP20210759TT HRP20210759T1 (en) | 2017-07-14 | 2021-05-12 | Improved dual specificity polypeptide molecule |
CY20211100934T CY1124835T1 (en) | 2017-07-14 | 2021-11-01 | IMPROVED DUAL SPECIFICITY POLYPEPTIDE MOLECULE |
US17/686,358 US20220185888A1 (en) | 2017-07-14 | 2022-03-03 | Dual specificity polypeptide molecule |
US17/693,323 US20220195044A1 (en) | 2017-07-14 | 2022-03-12 | Dual specificity polypeptide molecule |
JP2023083663A JP2023103451A (en) | 2017-07-14 | 2023-05-22 | Improved bispecific polypeptide molecules |
US18/331,556 US20230348598A1 (en) | 2017-07-14 | 2023-06-08 | Improved dual specificity polypeptide molecule |
JP2023198791A JP2024023385A (en) | 2017-07-14 | 2023-11-24 | Improved dual specificity polypeptide molecule |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
DE102017115966.5A DE102017115966A1 (en) | 2017-07-14 | 2017-07-14 | Polypeptide molecule with improved dual specificity |
Publications (1)
Publication Number | Publication Date |
---|---|
DE102017115966A1 true DE102017115966A1 (en) | 2019-01-17 |
Family
ID=64745758
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
DE102017115966.5A Withdrawn DE102017115966A1 (en) | 2017-07-14 | 2017-07-14 | Polypeptide molecule with improved dual specificity |
Country Status (2)
Country | Link |
---|---|
AR (1) | AR112228A1 (en) |
DE (1) | DE102017115966A1 (en) |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DE102019121022A1 (en) * | 2019-08-02 | 2021-02-25 | Immatics Biotechnologies Gmbh | Recruiting agent that also binds an MHC molecule |
CN116650660A (en) * | 2023-07-27 | 2023-08-29 | 上海偌妥生物科技有限公司 | Method for preparing antibody-coupled small molecule drug and application thereof |
WO2024038183A1 (en) * | 2022-08-18 | 2024-02-22 | Immunocore Limited | Multi-domain binding molecules |
Citations (24)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1998050431A2 (en) | 1997-05-02 | 1998-11-12 | Genentech, Inc. | A method for making multispecific antibodies having heteromultimeric and common components |
EP1075496A1 (en) | 1998-05-08 | 2001-02-14 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
WO2002002781A1 (en) | 2000-06-30 | 2002-01-10 | Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw | Heterodimeric fusion proteins |
US6800738B1 (en) * | 1991-06-14 | 2004-10-05 | Genentech, Inc. | Method for making humanized antibodies |
US20060166875A1 (en) | 2002-10-09 | 2006-07-27 | Avidex Limited | Single chain recombinant t cell receptors |
EP1868650A2 (en) | 2005-04-15 | 2007-12-26 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
WO2011044186A1 (en) * | 2009-10-06 | 2011-04-14 | The Board Of Trustees Of The University Of Illinois | Human single-chain t cell receptors |
WO2011113819A2 (en) | 2010-03-19 | 2011-09-22 | Immatics Biotechnologies Gmbh | Novel immunotherapy against several tumors including gastrointestinal and gastric cancer |
WO2014083004A1 (en) * | 2012-11-30 | 2014-06-05 | Roche Glycart Ag | Removal of cancer cells by circulating virus-specific cytotoxic t-cells using cancer cell targeted mhc class i comprising multi-function proteins |
WO2014131711A1 (en) * | 2013-02-26 | 2014-09-04 | Roche Glycart Ag | Bispecific t cell activating antigen binding molecules |
WO2015077891A1 (en) * | 2013-11-27 | 2015-06-04 | Zymeworks Inc. | Bispecific antigen-binding constructs targeting her2 |
EP2985291A1 (en) * | 2005-04-01 | 2016-02-17 | Immunocore Ltd. | High affinity hiv t cell receptors |
WO2016102272A1 (en) | 2014-12-23 | 2016-06-30 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against hepatocellular carcinoma (hcc) and other cancers |
WO2016146751A1 (en) | 2015-03-17 | 2016-09-22 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against pancreatic cancer and other cancers |
WO2016156202A1 (en) | 2015-03-27 | 2016-10-06 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against various tumors |
WO2016156230A1 (en) | 2015-03-31 | 2016-10-06 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides and scaffolds for use in immunotherapy against renal cell carcinoma (rcc) and other cancers |
WO2016170139A1 (en) | 2015-04-24 | 2016-10-27 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against lung cancer, including nsclc and other cancers |
WO2016177784A1 (en) | 2015-05-06 | 2016-11-10 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides and scaffolds thereof for use in immunotherapy against colorectal carcinoma (crc) and other cancers |
WO2016202963A2 (en) | 2015-06-19 | 2016-12-22 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy and methods for generating scaffolds for the use against pancreatic cancer and other cancers |
WO2016207164A2 (en) | 2015-06-25 | 2016-12-29 | Immatics Biotechnologies Gmbh | Novel cell epitopes and combination of cell epitopes for use in the immuno-therapy of myeloma and other cancers |
WO2017001491A2 (en) | 2015-07-01 | 2017-01-05 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against ovarian cancer and other cancers |
WO2017005733A2 (en) | 2015-07-06 | 2017-01-12 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against esophageal cancer and other cancers |
WO2017021527A2 (en) | 2015-08-05 | 2017-02-09 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against prostate cancer and other cancers |
WO2017036936A1 (en) | 2015-08-28 | 2017-03-09 | Immatics Biotechnologies Gmbh | Novel peptides, combination of peptides and scaffolds for use in immunotherapeutic treatment of various cancers |
-
2017
- 2017-07-14 DE DE102017115966.5A patent/DE102017115966A1/en not_active Withdrawn
-
2018
- 2018-07-13 AR ARP180101959 patent/AR112228A1/en unknown
Patent Citations (25)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6800738B1 (en) * | 1991-06-14 | 2004-10-05 | Genentech, Inc. | Method for making humanized antibodies |
WO1998050431A2 (en) | 1997-05-02 | 1998-11-12 | Genentech, Inc. | A method for making multispecific antibodies having heteromultimeric and common components |
EP1075496A1 (en) | 1998-05-08 | 2001-02-14 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
WO2002002781A1 (en) | 2000-06-30 | 2002-01-10 | Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw | Heterodimeric fusion proteins |
US20060166875A1 (en) | 2002-10-09 | 2006-07-27 | Avidex Limited | Single chain recombinant t cell receptors |
EP2985291A1 (en) * | 2005-04-01 | 2016-02-17 | Immunocore Ltd. | High affinity hiv t cell receptors |
EP1868650A2 (en) | 2005-04-15 | 2007-12-26 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
WO2011044186A1 (en) * | 2009-10-06 | 2011-04-14 | The Board Of Trustees Of The University Of Illinois | Human single-chain t cell receptors |
US20120252742A1 (en) | 2009-10-06 | 2012-10-04 | Kranz David M | Human Single-Chain T Cell Receptors |
WO2011113819A2 (en) | 2010-03-19 | 2011-09-22 | Immatics Biotechnologies Gmbh | Novel immunotherapy against several tumors including gastrointestinal and gastric cancer |
WO2014083004A1 (en) * | 2012-11-30 | 2014-06-05 | Roche Glycart Ag | Removal of cancer cells by circulating virus-specific cytotoxic t-cells using cancer cell targeted mhc class i comprising multi-function proteins |
WO2014131711A1 (en) * | 2013-02-26 | 2014-09-04 | Roche Glycart Ag | Bispecific t cell activating antigen binding molecules |
WO2015077891A1 (en) * | 2013-11-27 | 2015-06-04 | Zymeworks Inc. | Bispecific antigen-binding constructs targeting her2 |
WO2016102272A1 (en) | 2014-12-23 | 2016-06-30 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against hepatocellular carcinoma (hcc) and other cancers |
WO2016146751A1 (en) | 2015-03-17 | 2016-09-22 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against pancreatic cancer and other cancers |
WO2016156202A1 (en) | 2015-03-27 | 2016-10-06 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against various tumors |
WO2016156230A1 (en) | 2015-03-31 | 2016-10-06 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides and scaffolds for use in immunotherapy against renal cell carcinoma (rcc) and other cancers |
WO2016170139A1 (en) | 2015-04-24 | 2016-10-27 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against lung cancer, including nsclc and other cancers |
WO2016177784A1 (en) | 2015-05-06 | 2016-11-10 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides and scaffolds thereof for use in immunotherapy against colorectal carcinoma (crc) and other cancers |
WO2016202963A2 (en) | 2015-06-19 | 2016-12-22 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy and methods for generating scaffolds for the use against pancreatic cancer and other cancers |
WO2016207164A2 (en) | 2015-06-25 | 2016-12-29 | Immatics Biotechnologies Gmbh | Novel cell epitopes and combination of cell epitopes for use in the immuno-therapy of myeloma and other cancers |
WO2017001491A2 (en) | 2015-07-01 | 2017-01-05 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against ovarian cancer and other cancers |
WO2017005733A2 (en) | 2015-07-06 | 2017-01-12 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against esophageal cancer and other cancers |
WO2017021527A2 (en) | 2015-08-05 | 2017-02-09 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against prostate cancer and other cancers |
WO2017036936A1 (en) | 2015-08-28 | 2017-03-09 | Immatics Biotechnologies Gmbh | Novel peptides, combination of peptides and scaffolds for use in immunotherapeutic treatment of various cancers |
Non-Patent Citations (18)
Title |
---|
,Knobs-into-holes' engineering of antibody CH3 domains for heavy chain heterodimerization Protein Eng. 1996 Jul; 9(7):617-21 |
Ahmadzadeh V1, Farajnia S, Feizi MA, Nejad RA. Antibody humanization methods for development of therapeutic applications. Monoclon Antib Immunodiagn Immunother. Apr. 2014; 33(2):67-73 |
Application of dual affinity retargeting molecules to achieve optimal redirected T-cell killing of B-cell lymphoma, Blood. 28. Apr. 2011; 117(17):4542-51 |
Baeuerle, P.A.; Reinhardt, C. Bispecific T-cell engaging antibodies for cancer therapy. Cancer Res. 2009, 69, 4941-4944 |
Bi-specific TCR-anti CD3 redirected T-cell targeting of NYESO-1- and LAGE-1-positive tumors. Cancer Immunol Immunother. Apr 2013; 62(4):773-85 |
Boder ET u. a., Directed evolution of antibody fragments with monovalent femtomolar antigenbinding affinity. Proc Natl Acad Sci USA. 26. Sep 2000; 97(20):10701-5 |
Coloma, M.J. und Morrison, S.L. (1997) Design and production of novel tetravalent bispecific antibodies. Nat. Biotechnol. 15, 159-163 |
Construction, expression and characterization of humanized antibodies directed against the human alpha/beta T cell receptor. J Immunol, 1991, 147, 4366-73 |
Holler PD, u. a. In vitro evolution of a T cell receptor with high affinity for peptide/MHC. Proc Natl Acad Sci USA. 9. Mai 2000; 97(10):5387-92 |
Identification and engineering of human variable regions that allow expression of stable single-chain T cell receptors. PEDS, 2011, 24, 361 - 372 |
Olimpieri, Pier Paolo, Paolo Marcatili und Anna Tramontano überprüft. „Tabhu: Tools for Antibody Humanization." Bioinformatics 31.3 (2015): 434-435 |
Piepenbrink u. a., The basis for limited specificity and MHC restriction in a T cell receptor interface, Nat Commun, 2013; 4, 1948 |
PMC; Safdari Y1, Farajnia S, Asgharzadeh M, Khalili M. Antibody humanization methods - a review and update. Biotechnol Genet Eng Rev. 2013;29:175-86 |
Stabilization of the Fv Fragments in Recombinant Immunotoxins by Disulfide Bonds Engineered into Conserved Framework Regions. Biochemistry, 1994, 33, 5451 - 5459 |
T cell activation. J Immunol, 1995, 155, 1903-1910 |
Utilizing the BiTE (bispecific T-cell engager) platform for immunotherapy of cancer. Expert Opin Biol Ther. 2015;15(8):1093-9 |
Yang F. u. a. Bispecific Antibodies as a Development Platform for New Concepts and Treatment Strategies. Int J Mol Sci. 28. Dezember 206; 18(1) |
Zhao Q, u. a. Affinity maturation of T-cell receptor-like antibodies for Wilms tumor 1 peptide greatly enhances therapeutic potential. Leukemia. 2015; 29(11):2238-2247 |
Cited By (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DE102019121022A1 (en) * | 2019-08-02 | 2021-02-25 | Immatics Biotechnologies Gmbh | Recruiting agent that also binds an MHC molecule |
WO2024038183A1 (en) * | 2022-08-18 | 2024-02-22 | Immunocore Limited | Multi-domain binding molecules |
CN116650660A (en) * | 2023-07-27 | 2023-08-29 | 上海偌妥生物科技有限公司 | Method for preparing antibody-coupled small molecule drug and application thereof |
CN116650660B (en) * | 2023-07-27 | 2023-11-03 | 上海偌妥生物科技有限公司 | Method for preparing antibody-coupled small molecule drug and application thereof |
Also Published As
Publication number | Publication date |
---|---|
AR112228A1 (en) | 2019-10-02 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20230348598A1 (en) | Improved dual specificity polypeptide molecule | |
DE60124912T2 (en) | Multimeric, single chain, tandem Fv antibodies | |
DE60127143T2 (en) | Bispecific antibodies against CD19 and CD16 and their use | |
DE69922159T2 (en) | MULTI-PURPOSE ANTIBODY DERIVATIVES | |
CN109715663A (en) | In conjunction with the heterodimeric antibody of somatostatin receptor 2 | |
TW201439117A (en) | Heterodimeric bispecific antibodies | |
JP2001523971A (en) | Method for producing multispecific antibodies having heteromultimers and common components | |
DE102019121007A1 (en) | Antigen binding proteins that specifically bind to MAGE-A | |
DE102017115966A1 (en) | Polypeptide molecule with improved dual specificity | |
EP2726507A1 (en) | Antibodies against prostate-specific stem cell antigen and use thereof | |
EP2600882B1 (en) | ANTIBODIES AGAINST 6-SULFO-LacNAc-POSITIVE HUMAN DENDRITIC CELLS, AND THEIR USE | |
EA043129B1 (en) | IMPROVED POLYPEPTIDE MOLECULE WITH DOUBLE SPECIFICITY | |
JP2021019626A (en) | Improved bispecific polypeptide molecule | |
EA043319B1 (en) | ADVANCED POLYPEPTIDE MOLECULE WITH DOUBLE SPECIFICITY |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
R012 | Request for examination validly filed | ||
R082 | Change of representative |
Representative=s name: ZSP PATENTANWAELTE PARTG MBB, DE Representative=s name: ZWICKER SCHNAPPAUF & PARTNER PATENTANWAELTE PA, DE Representative=s name: BOEHMERT & BOEHMERT ANWALTSPARTNERSCHAFT MBB -, DE |
|
R016 | Response to examination communication | ||
R082 | Change of representative |
Representative=s name: ZSP PATENTANWAELTE PARTG MBB, DE Representative=s name: ZWICKER SCHNAPPAUF & PARTNER PATENTANWAELTE PA, DE |
|
R082 | Change of representative |
Representative=s name: ZWICKER SCHNAPPAUF & PARTNER PATENTANWAELTE PA, DE |
|
R119 | Application deemed withdrawn, or ip right lapsed, due to non-payment of renewal fee |