CN116621946B - Application of polypeptide circ1946-109aa as esophageal squamous carcinoma prognosis marker - Google Patents
Application of polypeptide circ1946-109aa as esophageal squamous carcinoma prognosis marker Download PDFInfo
- Publication number
- CN116621946B CN116621946B CN202310677725.3A CN202310677725A CN116621946B CN 116621946 B CN116621946 B CN 116621946B CN 202310677725 A CN202310677725 A CN 202310677725A CN 116621946 B CN116621946 B CN 116621946B
- Authority
- CN
- China
- Prior art keywords
- circ1946
- polypeptide
- esophageal squamous
- squamous carcinoma
- expression
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 46
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 41
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 41
- 206010041823 squamous cell carcinoma Diseases 0.000 title claims abstract description 31
- 238000004393 prognosis Methods 0.000 title claims abstract description 9
- 239000003550 marker Substances 0.000 title abstract description 8
- 108020004707 nucleic acids Proteins 0.000 claims description 6
- 102000039446 nucleic acids Human genes 0.000 claims description 6
- 150000007523 nucleic acids Chemical class 0.000 claims description 6
- 239000008194 pharmaceutical composition Substances 0.000 claims description 6
- 238000002360 preparation method Methods 0.000 claims description 5
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 3
- 239000003814 drug Substances 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 1
- 230000014509 gene expression Effects 0.000 abstract description 13
- 238000011160 research Methods 0.000 abstract description 11
- 102000037982 Immune checkpoint proteins Human genes 0.000 abstract description 8
- 108091008036 Immune checkpoint proteins Proteins 0.000 abstract description 8
- 230000035755 proliferation Effects 0.000 abstract description 7
- 238000013508 migration Methods 0.000 abstract description 5
- 230000005012 migration Effects 0.000 abstract description 5
- 229940126546 immune checkpoint molecule Drugs 0.000 abstract description 4
- 238000009169 immunotherapy Methods 0.000 abstract description 2
- 230000002829 reductive effect Effects 0.000 abstract description 2
- 210000004027 cell Anatomy 0.000 description 28
- 239000013612 plasmid Substances 0.000 description 19
- 108090000623 proteins and genes Proteins 0.000 description 15
- 102000004169 proteins and genes Human genes 0.000 description 14
- 239000000047 product Substances 0.000 description 13
- 235000018102 proteins Nutrition 0.000 description 13
- 238000000034 method Methods 0.000 description 12
- 239000013598 vector Substances 0.000 description 12
- 150000001413 amino acids Chemical group 0.000 description 10
- 206010061534 Oesophageal squamous cell carcinoma Diseases 0.000 description 9
- 208000036765 Squamous cell carcinoma of the esophagus Diseases 0.000 description 9
- 208000007276 esophageal squamous cell carcinoma Diseases 0.000 description 9
- 238000002474 experimental method Methods 0.000 description 9
- 230000006870 function Effects 0.000 description 9
- 230000002018 overexpression Effects 0.000 description 8
- 238000012795 verification Methods 0.000 description 8
- 108700026244 Open Reading Frames Proteins 0.000 description 7
- 238000001514 detection method Methods 0.000 description 7
- 102000037865 fusion proteins Human genes 0.000 description 7
- 108020001507 fusion proteins Proteins 0.000 description 7
- 238000012163 sequencing technique Methods 0.000 description 7
- 206010028980 Neoplasm Diseases 0.000 description 6
- 238000010276 construction Methods 0.000 description 6
- 239000012634 fragment Substances 0.000 description 6
- 230000004048 modification Effects 0.000 description 6
- 238000012986 modification Methods 0.000 description 6
- 206010027476 Metastases Diseases 0.000 description 5
- 238000011529 RT qPCR Methods 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 239000013604 expression vector Substances 0.000 description 5
- 230000002401 inhibitory effect Effects 0.000 description 5
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 4
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 4
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 4
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 4
- 235000001014 amino acid Nutrition 0.000 description 4
- 201000011510 cancer Diseases 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 238000010586 diagram Methods 0.000 description 4
- 201000010099 disease Diseases 0.000 description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 4
- 239000012636 effector Substances 0.000 description 4
- 230000009401 metastasis Effects 0.000 description 4
- 230000004083 survival effect Effects 0.000 description 4
- 238000001262 western blot Methods 0.000 description 4
- 108010075254 C-Peptide Proteins 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 102000007562 Serum Albumin Human genes 0.000 description 3
- 108010071390 Serum Albumin Proteins 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 239000012535 impurity Substances 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 210000004881 tumor cell Anatomy 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 230000006820 DNA synthesis Effects 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 108010026552 Proteome Proteins 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 230000004888 barrier function Effects 0.000 description 2
- 238000010804 cDNA synthesis Methods 0.000 description 2
- 238000010609 cell counting kit-8 assay Methods 0.000 description 2
- 230000004709 cell invasion Effects 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 238000001516 cell proliferation assay Methods 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000013211 curve analysis Methods 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- 230000017188 evasion or tolerance of host immune response Effects 0.000 description 2
- 239000013613 expression plasmid Substances 0.000 description 2
- 230000009545 invasion Effects 0.000 description 2
- 238000004949 mass spectrometry Methods 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 1
- 229920002799 BoPET Polymers 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 102400000888 Cholecystokinin-8 Human genes 0.000 description 1
- 101800005151 Cholecystokinin-8 Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 208000019505 Deglutition disease Diseases 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 229940123309 Immune checkpoint modulator Drugs 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- YPVKITSUWLOZAL-REOHCLBHSA-N N(C(=O)N)N[C@@H](CS)C(=O)O Chemical compound N(C(=O)N)N[C@@H](CS)C(=O)O YPVKITSUWLOZAL-REOHCLBHSA-N 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- 238000010818 SYBR green PCR Master Mix Methods 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- GLNADSQYFUSGOU-GPTZEZBUSA-J Trypan blue Chemical compound [Na+].[Na+].[Na+].[Na+].C1=C(S([O-])(=O)=O)C=C2C=C(S([O-])(=O)=O)C(/N=N/C3=CC=C(C=C3C)C=3C=C(C(=CC=3)\N=N\C=3C(=CC4=CC(=CC(N)=C4C=3O)S([O-])(=O)=O)S([O-])(=O)=O)C)=C(O)C2=C1N GLNADSQYFUSGOU-GPTZEZBUSA-J 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 238000007792 addition Methods 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 229940034982 antineoplastic agent Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 238000012098 association analyses Methods 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 239000003899 bactericide agent Substances 0.000 description 1
- 238000010009 beating Methods 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000004791 biological behavior Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 210000002798 bone marrow cell Anatomy 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 108091092328 cellular RNA Proteins 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 239000012295 chemical reaction liquid Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 239000011243 crosslinked material Substances 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 210000002249 digestive system Anatomy 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 230000009109 downstream regulation Effects 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 238000004043 dyeing Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 230000002055 immunohistochemical effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 238000001819 mass spectrum Methods 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 108091070501 miRNA Proteins 0.000 description 1
- 239000002679 microRNA Substances 0.000 description 1
- 238000002493 microarray Methods 0.000 description 1
- 238000010232 migration assay Methods 0.000 description 1
- 230000009456 molecular mechanism Effects 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- -1 polyethylene Polymers 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 238000010837 poor prognosis Methods 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 230000001376 precipitating effect Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 102000021501 regulatory RNA binding proteins Human genes 0.000 description 1
- 108091011116 regulatory RNA binding proteins Proteins 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000003938 response to stress Effects 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- IZTQOLKUZKXIRV-YRVFCXMDSA-N sincalide Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](N)CC(O)=O)C1=CC=C(OS(O)(=O)=O)C=C1 IZTQOLKUZKXIRV-YRVFCXMDSA-N 0.000 description 1
- 238000002791 soaking Methods 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000011287 therapeutic dose Methods 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 230000009107 upstream regulation Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57407—Specifically defined cancers
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Organic Chemistry (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Animal Behavior & Ethology (AREA)
- Gastroenterology & Hepatology (AREA)
- Oncology (AREA)
- Biophysics (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Hospice & Palliative Care (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Cell Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Microbiology (AREA)
- Genetics & Genomics (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention relates to application of a polypeptide circ1946-109aa as an esophageal squamous carcinoma prognosis marker. The research of the invention finds that hsa_circ_0001946 can code for a polypeptide with the length of 109aa, and the polypeptide is named circ1946-109aa. The polypeptide can be used as a marker for prognosis of esophageal squamous carcinoma patients. Meanwhile, the expression of immune checkpoint molecules B7-H3 on the surface of esophageal squamous carcinoma cells and the proliferation and migration capacity of a cell line are obviously reduced after the circ1946-109aa is overexpressed, so that the circ1946-109aa has the potential of being applied to clinical esophageal squamous carcinoma RNA immunotherapy.
Description
Technical Field
The invention belongs to the technical field of esophageal squamous carcinoma markers, and particularly relates to a polypeptide circ1946-109aa, a fusion protein of the polypeptide, a pharmaceutical composition containing the circ1946-109aa and application of the polypeptide as an esophageal squamous carcinoma prognosis marker and an immune checkpoint regulator.
Background
The disclosure of this background section is only intended to increase the understanding of the general background of the invention and is not necessarily to be construed as an admission or any form of suggestion that this information forms the prior art already known to those of ordinary skill in the art.
Esophageal squamous cell carcinoma is a malignant tumor with a pathological type of squamous cells, belongs to one of malignant tumors common in digestive systems, and accounts for 90% of people suffering from esophageal cancer. The most common clinical symptoms of esophageal squamous carcinoma are progressively aggravated dysphagia, and as the condition progresses, the patient also develops clinical symptoms associated with metastases, which in severe cases can be life-threatening. At present, the research on molecular mechanisms of the occurrence and the development of esophageal squamous carcinoma is relatively lagged, and no effective screening method exists.
The prior researches prove that the circRNA is closely related to the aspects of growth and development of organisms, stress response and occurrence and development of diseases, and the circRNA has related reports as a marker of esophageal squamous cell carcinoma. There is still a large unknown portion of the biological function of circRNA at present, and it is generally thought that circRNA may regulate protein transcription by means of miRNA "sponges", regulatory RNA binding proteins or RNA polymerases. With the verification of the coding potential and the research of functions of the circRNA, part of the circRNA coding products are also proved to exert certain physiological activities. At present, the effect of the coding circRNA and the coding product thereof on tumors such as glioma and the like is initially explored, and the coding product of the circRNA can interfere the biological behaviors such as proliferation, metastasis and the like of tumor cells and influence the occurrence and development of the tumors. However, the role of the encoded product from circRNA in esophageal squamous carcinoma has not been reported.
B7-H3, also known as CD276, is an important immune checkpoint that protects tumor cells from attack and killing by human T cells, and has become a novel target for immunotherapy, but its role in esophageal squamous cell carcinoma is yet to be studied further. In addition, the previous research focuses on the T cell inhibition function and downstream regulation mechanism of B7-H3, and the work on the aspect of the upstream regulation mechanism of B7-H3 is relatively deficient at home and abroad.
Disclosure of Invention
According to the research of the invention, hsa_circ_0001946 can encode and obtain a polypeptide sequence with the length of 109aa, and the invention verifies the true existence of the polypeptide sequence through experimental methods such as mass spectrum detection, western blot, ribosome association analysis and the like. As hsa_circ_0001946 is related to the expression of immune checkpoint molecules B7-H3, the invention researches the relativity of the polypeptide and B7-H3, and proves that the polypeptide can reduce the expression of B7-H3 at RNA level so as to regulate and control the immune escape of esophageal squamous cell carcinoma, on the other hand, cell scratch and transwell experiments show that over-expression of the polypeptide is favorable for inhibiting the metastasis of esophageal squamous cell carcinoma and can be used as a potential therapeutic target.
Based on the research results, the invention provides the following technical scheme:
in a first aspect, there is provided a polypeptide having the sequence:
(1) A polypeptide having an amino acid sequence as shown in SEQ ID NO. 1;
(2) And a derivative polypeptide formed by adding, substituting or deleting one or more amino acids to the amino acid sequence shown in SEQ ID NO. 1, wherein the derivative polypeptide still has the same or basically the same function as the polypeptide.
In one embodiment of the verification of the invention, the hsa_circ_0001946 encoded polypeptide has an amino acid sequence shown in SEQ ID NO. 1 and is named circ1946-109aa; proved by verification, the circ1946-109aa is expressed in a patient with esophageal squamous carcinoma and can be used as a prognosis marker of esophageal squamous carcinoma. Furthermore, it has been found by the present invention that circ1946-109aa is capable of inhibiting the expression of immune checkpoint B7-H3. B7-H3 is expressed in cancer cells and bone marrow cells, including T cells and B cells, monocytes/macrophages and dendritic cells, and has dual role as a co-stimulatory/co-inhibitory immune checkpoint molecule, closely related to tumor growth, metastasis, recurrence and poor prognosis. The findings provide application of circ1946-109aa as an immunopoint tumor inhibitor and an esophageal squamous carcinoma therapeutic active ingredient.
In the above aspect (2), the one or more may be 1 to 50, 1 to 30, 1 to 20, 1 to 10, 1 to 5 or 1 to 3, and the addition, deletion or substitution may occur at the N-terminal and/or C-terminal or sequence of the amino acid sequence shown in SEQ ID NO. 1; further, the sequence of the derivative polypeptide has 90% or more similarity with the amino acid sequence shown in SEQ ID NO. 1; still further, the similarity is at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%; the amino acid sequences may be aligned for similarity using methods commonly used in the art, such as the Blast method. The derivative polypeptide still has the same or basically the same functions as circ1946-109aa, and the functions mainly comprise functions of inhibiting B7-H3 expression, regulating immune escape of esophageal squamous cell carcinoma, inhibiting metastasis of esophageal squamous cell carcinoma and the like.
In addition, the derivative polypeptide also broadly comprises a polypeptide product formed by chemically or genetically modifying circ1946-109aa; modifications common in the art include streptavidin, modifications of various molecules (e.g., biotin, radioisotopes, fluorescers, enzymes, cytotoxic substances, antineoplastic agents, etc.), and the like; also included are immobilized products of circ1946-109aa, such as products employing physical adsorption, carriers, resin cross-linked materials, and the like to immobilize or modify the polypeptides described above.
In a second aspect, there is provided a fusion protein comprising a polypeptide as set out in the first aspect, and further comprising an additional effector fragment.
Such other effector fragments may exert effects such as extending in vivo half-life, improving solubility, or enhancing the ability to penetrate biological barriers;
further, the fragment for extending the in vivo half-life is one of, but not limited to, serum albumin or a fragment thereof, polyethylene glycol, a domain that binds serum albumin (e.g., a single domain antibody against serum albumin), polyethylene glycol-liposome complex.
Further, the effector fragment for improving the permeability of biological barrier, such as a transmembrane peptide, is one of H7R8, HIV-I TAT (48-60), TAT (47-57), TAT (48-57) and R9-TAT.
In other preferred embodiments, a connecting peptide is further provided between the polypeptide and the effector fragment, wherein the connecting peptide is a flexible polypeptide chain composed of alanine (a) and/or serine (S) and/or glycine (G), and the length of the connecting peptide may be 3 to 30 amino acids, more preferably 3 to 9, 9 to 12, 12 to 16, 16 to 20, etc.
In a third aspect, there is provided a nucleic acid material encoding a polypeptide according to the first aspect, a fusion protein according to the second aspect.
In view of codon degeneracy, the nucleic acid material is any nucleic acid encoding the polypeptides and fusion proteins described above, including DNA forms, including cDNA, genomic DNA, or synthetic DNA, which may be single-stranded or double-stranded, and which may be either encoding or non-encoding, in addition to hsa_circ_ 0001946. Methods for isolating such nucleic acid materials should be known to those skilled in the art, e.g., by automated DNA synthesis and/or recombinant DNA techniques, etc., and may be isolated from suitable natural sources.
In a fourth aspect, there is provided a construct comprising the nucleic acid substance of the third aspect.
The construction of the constructs is conventional to the skilled person, e.g. by means of in vitro recombinant DNA techniques, DNA synthesis techniques, in vivo recombinant techniques, etc., and more particularly by insertion of the isolated polynucleotide into the multiple cloning site of the expression vector. Expression vectors in the present invention generally refer to various commercially available expression vectors and the like well known in the art, and may be, for example, bacterial plasmids, phage, yeast plasmids, plant cell viruses, mammalian cell viruses such as adenovirus, retrovirus, or other vectors.
In a fifth aspect, there is provided a pharmaceutical composition comprising a polypeptide according to the first aspect or a fusion protein according to the second aspect, and a pharmaceutically acceptable excipient.
The pharmaceutically acceptable excipients, the dosages of which should be harmless to the subject, may be of the specific classes: buffers, antioxidants, preservatives, bactericides, hydrophilic polymers, carbohydrates, chelating agents, tonicity adjusting agents, surfactants, salt forming counterions, metal complexes and/or nonionic surfactants and the like.
In a sixth aspect, there is provided the use of a polypeptide according to the first aspect as an esophageal squamous carcinoma immune checkpoint modulator.
Specific forms of the above application include, but are not limited to, the following forms:
(1) Application of a detection reagent of circ1946-109aa in preparing esophageal squamous carcinoma prognosis products;
(2) Use of the polypeptide of the first aspect, the fusion protein of the second aspect or the pharmaceutical composition of the fifth aspect for the preparation of a medicament for the treatment of a B7-H3 over-expressed disease;
(3) A method of treating esophageal squamous carcinoma, the method comprising administering to a subject in need of treatment a therapeutic dose of the polypeptide of the first aspect, the fusion protein of the second aspect, or the pharmaceutical composition of the fifth aspect.
In the above (1), the variety of the esophageal squamous carcinoma prognosis judging product includes a reagent and an instrument, and a specific example is a kit.
In the above (2), the B7-H3 over-expression disease is a tumor, which is one of melanoma, leukemia, breast cancer, prostate cancer, and digestive tract cancer, and an example of the present invention is esophageal squamous cell carcinoma.
The beneficial effects of the above technical scheme are that:
at present, research on the coding function of the circRNA is still blank in the field, and there are a plurality of unknown parts on the correlation between the coding product of the circRNA and the activity of the circRNA, so that the identification of the coding product of the circRNA is still difficult. The verification of the invention firstly proves that hsa_circ_0001946 can code novel protein circ1946-109aa, and the research result still has higher innovation. The findings further enrich research data of the coding function and the disease regulation function of the circRNA, provide a feasible esophageal squamous cell carcinoma therapeutic active ingredient and have important application prospects.
Drawings
The accompanying drawings, which are included to provide a further understanding of the invention and are incorporated in and constitute a part of this specification, illustrate embodiments of the invention and together with the description serve to explain the invention.
FIG. 1 is a schematic diagram of the ORF encoding the protein hsa_circ_0001946 described in example 1;
FIG. 2 is the results of the mass spectrometry detection described in example 1;
FIG. 3 is a circular 1946-109aa electrophoresis strip expressed by the vector described in example 1;
FIG. 4 is the overall survival curve analysis results described in example 2;
FIG. 5 is the result of the cell proliferation assay described in example 2;
FIG. 5A shows the proliferation of K30 cells transfected with T0 and T1 plasmids;
FIG. 5B shows the proliferation of K30 cells transfected with T3 and T4 plasmids;
FIG. 5C shows the proliferation of K510 cells transfected with T0 and T1 plasmids;
FIG. 5D shows the proliferation of K510 cells transfected with T3 and T4 plasmids;
FIG. 6 is the result of the cell scratch test described in example 2;
FIG. 6A shows the results of a K30 cell streak assay for the transfection of T0, T1, T3, T4 plasmids, respectively;
FIG. 6B shows the results of a K510 cell streak assay for the transfection of T0, T1, T3, T4 plasmids, respectively;
FIG. 7 is the result of the Transwell assay described in example 2;
FIG. 7A is a graph showing the results of K30 cell invasion experiments by transfecting T0, T1, T3, and T4 plasmids, respectively;
FIG. 7B is a graph showing the results of K510 cell invasion experiments by respectively transfecting T0, T1, T3 and T4 plasmids;
FIG. 8 shows the correlation results of circ1946-109aa and B7-H3 as described in example 3.
Detailed Description
It should be noted that the following detailed description is illustrative and is intended to provide further explanation of the invention. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.
It is noted that the terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting of exemplary embodiments according to the present invention. As used herein, the singular is also intended to include the plural unless the context clearly indicates otherwise, and furthermore, it is to be understood that the terms "comprises" and/or "comprising" when used in this specification are taken to specify the presence of stated features, steps, operations, devices, components, and/or combinations thereof.
In order to enable those skilled in the art to more clearly understand the technical scheme of the present invention, the technical scheme of the present invention will be described in detail with reference to specific embodiments.
Example 1circ1946-109aa protein verification
Verification of the authenticity of the Presence of the circ1946-109aa protein
The sequence of hsa_circ_0001946 contains an Open Reading Frame (ORF), and this example speculates that it may have protein coding capacity (as shown in fig. 1), and in order to verify the presence of the hsa_circ_0001946 encoded product, this example translates the corresponding polypeptide according to the ORF sequence to 109 amino acids in length: MSSNNFKVFHQIQIFQLIHVFQKNLCLPPNPSLPVNLVLPEKSRSSSQSVSSRKK SRSSSQSVSSRKKSRSSSQSVSSRKIYVFHQIQVFQSIHIFRKKSRSSSQYMSS, shown as SEQ ID NO. 1, designated circ1946-109aa, the specific information of this novel protein is shown in the following table:
to verify whether such circ1946-109aa is actually present, this example first performed TMT-tagged quantitative proteome sequencing and small peptide nonstandard proteome sequencing on esophageal squamous carcinoma cell lines (K30, K140, K150, K180, K510, K200, TE1, colo680N, EC8712, TE 10) and searched for the above protein sequences by pFIND software. Raw data generated by mass spectrometry were processed using pFind 3.2.0 and databases were searched using the target protein sequences. Search parameter setting: the precursor mass tolerance was 20ppm and the secondary debris mass tolerance was 0.02Da. Oxidation (methionine) (+ 15.9949 Da) and acetylation (protein N-terminus) (+ 42.0106 Da) as variable modifications, ureido (cysteine) (+ 57.0215 Da) as fixed modifications, and cleavage allowing three trypsin misses. The single peptide only considers the peptide with the length of at least 6 amino acids, so that the False Discovery Rate (FDR) is controlled to be within 1 percent, at least one specific peptide is needed for identifying the protein, and the detection result is shown in figure 2.
Then, hsa_circ_0001946 related T series vectors (circ 1946 overexpressing plasmid empty vector (T0), circ1946 overexpressing plasmid (T1), circ1946-3 x Flag tag plasmid (T2), circ1946-ORF overexpressing plasmid empty vector (T3), circ1946-ORF overexpressing plasmid (T4)) were constructed, and the presence of the authenticity of circ1946-109aa was determined by Western Blot (WB) detection of Flag tag proteins.
The construction and identification flow of the over-expression plasmid is as follows:
t1 is constructed as follows:
the hsa_circ_0001946 (sequence source, circ Bank ID: hsa_circCDR 1_001) full-length 1485bp sequence is amplified by PCR, ecoRI and BamHI are used for double digestion and connected into pLC5-ciR, positive clones are screened, sequencing primers are added, a sequencing peak diagram is normal, no impurity peak or overlapping band exists, and sequence comparison is identical, so that hsa_circ_0001946 is successfully inserted into pLC5-ciR, and the over-expression vector is successfully constructed.
Primer sequences are shown in the following table:
t2 is constructed as follows:
the hsa_circ_0001946_011-3xFlag|1563nt full length 1563bp sequence was amplified by PCR and the In-Fusion clone was ligated into pLC5-ciR. T2 construction vector PLL2212 hsa_circ_0001946_011 inserts the 3xFlag expression vector. The sequencing peak diagram is normal, no impurity peak or overlapping band exists, and the sequence comparison is identical, which shows that the target sequence is successfully inserted into pLC5-ciR, and the carrier is successfully constructed.
The primer sequences were as follows:
t4 is constructed as follows:
the circ1946-109aa is combined with a 3xFlag tag to serve as a target sequence, a Kozak sequence (GCCACC) is added before ATG, the full-length sequence is 414bp, the full-length sequence is seamlessly cloned to the PCDH-CMV-MCS-EF1a-GFP-puro vector, the sequencing peak diagram is normal, no impurity peak or overlapping bands exist, the sequence comparison is identical, and the target sequence is successfully inserted into the PCDH-CMV-MCS-EF1a-GFP-puro, and the vector construction is successful.
The primer sequences were as follows:
TABLE 1T series vector and PCR, WB detection results
Note that: circ1946 is hsa_circ_0001946, 109aa is circ1946-109aa, and the ORF is the ORF encoding circ1946-109aa; "+" indicates endogenous expression, "-" indicates endogenous no expression, "+.f" indicates high expression.
T0 is an empty vector, and the construction method is different from that of T1 in that T0 is not inserted into a target sequence. Similarly, T3 was used as an empty vector, and T3 was not inserted into the target sequence compared to the construction of T4. Based on the results of Table 1, it can be seen that circ1946-109aa is actually present as the encoded product of hsa_circ_ 0001946. The results show that circ1946-109aa practically has corresponding expression in esophageal squamous carcinoma cell lines.
2. Preparation of circ1946-109aa specific antibodies
Using recombinant protein as antigen, a circ1946-109aa specific antibody can be prepared as follows:
the ORF sequence is constructed to pET-28a-SUMO carrier expression protein by means of total gene synthesis, and the sequencing identification is correct. After 16 hours of automatic induction culture, the protein is obtained by purifying and identifying the broken bacteria. Separating and obtaining 2 experimental Japanese big ear white rabbits immunized by the recombinant protein, and taking the three-immune serum to obtain the antibody after affinity purification.
Example 2circ1946-109aa verification of esophageal squamous carcinoma correlation
1. Kaplan-Meier (K-M) survival curve analysis
113 esophageal squamous carcinoma tumor tissues are collected, a microarray tissue chip is prepared, the circle 1946-109aa is dyed and read by using an immunohistochemical dyeing method, and the dyed tissue slice is observed and analyzed under a fluorescence microscope.
The Kaplan-Meier (K-M) curve was used for Overall Survival (OS) analysis. The R language is the primary mapping and statistics tool. As shown in FIG. 4, circ1946-109aa was expressed poorly in esophageal squamous carcinoma patients, and overall survival was shorter, demonstrating the ability of circ1946-109aa to serve as a prognostic marker for esophageal squamous carcinoma.
2. Cell proliferation, scratch and Transwell experiments
The effect of circ1946-109aa on the activity, migration and invasiveness of esophageal squamous carcinoma cell lines (K30 and K510) was evaluated using cell proliferation, scoring, transwell experiments, and the specific procedures were as follows:
(1) Cell proliferation assay:
cell counting kit-8 (CCK-8) was used to determine cell viability. T-series plasmids (table 1) of K30 and K510 were inoculated into 96-well plates and stably cultured for 24, 48, 72 hours, CCK8 solution was added to each well of the plates and incubated, and absorbance at 450nm was measured with a microplate reader, and the results are shown in fig. 5.
(2) Cell scratch assay:
scratch tests were used to assess the migration ability of cells. Cells were stably cultured overnight by plating appropriate numbers of T-series plasmids (table 1) into 6-well plates and streaked perpendicular to the cell plane until the cells grew out of the plates. After the scratch was finished, 0 point of the experiment was counted, and then taken out for photographing at 24 hours and 48 hours, respectively. As a result, as shown in FIG. 6, the T4 plasmid transfected cell line showed significantly less number of cells at the streak than the other experimental groups, demonstrating that overexpression of circ1946-109aa inhibited the migration ability of tumor cells.
(3) Transwell experiments:
the Transwell model was used to assess the invasive capacity of cells. A suitable amount of the T-series plasmid (Table 1) stable cell suspension was plated into the transwell upper chamber, 500uL of 20% serum medium was added to the 24-well plate lower chamber, and no air bubbles were present between the lower culture broth and the upper chamber, millions of times. Placing the culture plate into an incubator for continuous culture for 12-48h, sucking and discarding the culture solution of the upper chamber and the lower chamber, washing twice by PBS, soaking the lower surface of the culture plate into methanol solution for fixation, staining with crystal violet or trypan blue, performing microscopic examination, calculating the cell number of the lower surface of the PET film, calculating 5 fields in the middle and four sides, taking an average value, and reducing the invasion capacity of esophageal squamous carcinoma cells over expressing circ1946-109aa as shown in figure 7.
According to the above figures 5, 6 and 7, it is shown that the overexpression of circ1946-109aa can inhibit proliferation, migration and invasion of esophageal squamous carcinoma cells.
Example 3 verification of the correlation of circ1946-109aa with the expression of the immune checkpoint molecule B7-H3
The method comprises the following steps of transfecting circ1946-109aa over-expression plasmids into esophageal squamous carcinoma cell lines (K30, K510 and TE-1), using empty vector transfected cells as a control, extracting cellular RNA, and detecting the change of the expression quantity of B7-H3 by using qRT-PCR technology:
(1) RNA extraction
Collecting esophageal squamous carcinoma cells, adding Trizol, and standing at room temperature for 5min to allow full lysis; adding chloroform according to 200ul chloroform/mL Trizol, shaking vigorously for 15s, and standing at room temperature for 5min; centrifuging at 4deg.C for 15min at 12,000Xg; sucking the upper water phase and transferring the upper water phase into another centrifuge tube; adding isopropanol according to 0.5mL isopropanol/mL Trizol, mixing uniformly, and standing at room temperature for 10min; centrifuging at 4deg.C for 10min at 12,000Xg, and discarding supernatant; adding 75% ethanol into 1mL of 75% ethanol/mL Trizol, gently shaking a centrifuge tube, and suspending and precipitating; centrifuging at 4deg.C for 5min at 7,500Xg, and discarding supernatant as much as possible; airing at room temperature for 5-10 min, adding 20 mu L DEPC water to dissolve the precipitate.
(2) RNA quality and integrity detection
OD value was measured to quantify RNA, record A 260/280 Ratio and RNA concentration. 1% agarose gel electrophoresisAfter electrophoresis, the sample is observed under an ultraviolet lamp, photographed and stored.
(3) Reverse transcription
(1) Preparing first strand cDNA synthesis reaction liquid
Note that: gently beating and mixing by a pipette.
(2) The first strand cDNA synthesis reaction was performed under the following conditions
* If the template has a complex secondary structure or a high GC region, the reaction temperature can be increased to 55℃to help increase the yield.
(4) qPCR experiment
(1) Preparation of qPCR reaction system
cDNA (1:10 dilution) 2. Mu.L
Upstream primer (10. Mu.M) 0.4. Mu.L
Downstream primer (10. Mu.M) 0.4. Mu.L 2X SYBR Green PCR Master Mix. Mu.L
ddH 2 O up to 20μL
(2) qPCR reaction program settings
(5) qPCR primers
As shown in FIG. 8, the reduced content of B7-H3 (i.e., CD276 in FIG. 8) in the circ1946-109aa over-expression group suggests that circ1946-109aa is capable of inhibiting the expression of immune checkpoint B7-H3.
The above description is only of the preferred embodiments of the present invention and is not intended to limit the present invention, but various modifications and variations can be made to the present invention by those skilled in the art. Any modification, equivalent replacement, improvement, etc. made within the spirit and principle of the present invention should be included in the protection scope of the present invention.
Claims (5)
1. A polypeptide is characterized in that the amino acid sequence of the polypeptide is shown as SEQ ID NO. 1.
2. A nucleic acid encoding the polypeptide of claim 1.
3. A pharmaceutical composition comprising the polypeptide of claim 1, further comprising a pharmaceutically acceptable excipient.
4. Use of the polypeptide of claim 1 for the preparation of a prognosis product for esophageal squamous carcinoma.
5. Use of the polypeptide of claim 1 or the pharmaceutical composition of claim 3 for the preparation of a medicament for esophageal squamous carcinoma.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN2023106465891 | 2023-05-31 | ||
CN202310646589 | 2023-05-31 |
Publications (2)
Publication Number | Publication Date |
---|---|
CN116621946A CN116621946A (en) | 2023-08-22 |
CN116621946B true CN116621946B (en) | 2024-02-20 |
Family
ID=87617018
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202310677725.3A Active CN116621946B (en) | 2023-05-31 | 2023-06-07 | Application of polypeptide circ1946-109aa as esophageal squamous carcinoma prognosis marker |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN116621946B (en) |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN109082441A (en) * | 2018-08-29 | 2018-12-25 | 广州伯信生物科技有限公司 | A kind of circular rna expression vector and the TRAP method using the expression vector |
CN112626221A (en) * | 2021-01-21 | 2021-04-09 | 郑州大学第一附属医院 | Human esophageal squamous cell carcinoma circular RNA marker and application thereof |
CN112899362A (en) * | 2021-03-19 | 2021-06-04 | 福建医科大学 | CircRNA marker for coronary heart disease risk assessment and diagnosis and detection reagent and kit thereof |
CN114921551A (en) * | 2022-06-13 | 2022-08-19 | 山东大学第二医院 | Application of human Circ-FIRRRE in esophageal squamous cell carcinoma and kit |
WO2023284789A1 (en) * | 2021-07-14 | 2023-01-19 | 郑州大学 | Molecular marker group of human esophageal squamous cell carcinoma and application of molecular marker group |
-
2023
- 2023-06-07 CN CN202310677725.3A patent/CN116621946B/en active Active
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN109082441A (en) * | 2018-08-29 | 2018-12-25 | 广州伯信生物科技有限公司 | A kind of circular rna expression vector and the TRAP method using the expression vector |
CN112626221A (en) * | 2021-01-21 | 2021-04-09 | 郑州大学第一附属医院 | Human esophageal squamous cell carcinoma circular RNA marker and application thereof |
CN112899362A (en) * | 2021-03-19 | 2021-06-04 | 福建医科大学 | CircRNA marker for coronary heart disease risk assessment and diagnosis and detection reagent and kit thereof |
WO2023284789A1 (en) * | 2021-07-14 | 2023-01-19 | 郑州大学 | Molecular marker group of human esophageal squamous cell carcinoma and application of molecular marker group |
CN114921551A (en) * | 2022-06-13 | 2022-08-19 | 山东大学第二医院 | Application of human Circ-FIRRRE in esophageal squamous cell carcinoma and kit |
Non-Patent Citations (2)
Title |
---|
Hsa_circ_0001946/hsa-miR-7-5p/PARP1与冠状动脉粥样硬化性心脏病的发病机制;卢欣栎;《福建医科大学学报》;第56卷(第6期);第516-523页 * |
Identification of a novel circ_0001946/miR-1290/SOX6 ceRNA network in esophageal squamous cell cancer;Jianjun Wang;《Thorac Cancer》;第13卷(第9期);第1299-1310页 * |
Also Published As
Publication number | Publication date |
---|---|
CN116621946A (en) | 2023-08-22 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
ES2279473T3 (en) | TUMOR DIAGNOSIS PROCEDURE. | |
US8404803B2 (en) | Cancer-associated antigen analogue peptides and uses thereof | |
ES2355055T3 (en) | COMPOSITIONS AND PROCEDURES FOR TUMOR TREATMENT. | |
CN110343665B (en) | CAR-T cell and application thereof | |
JP2005531491A (en) | Compositions and methods for the treatment of cancer | |
EP1723970A1 (en) | Medicinal composition containing cxcr3 inhibitor | |
US20200138915A1 (en) | Use of Upstream Open Reading Frame 45aa-uORF Nucleotide Sequence of PTEN Gene and Polypeptide Coded by 45aa-uORF | |
JP2006519774A (en) | Compositions and methods for the treatment of cancer | |
KR20010075418A (en) | Mammaglobin, a secreted mammary-specific breast cancer protein | |
CN106701902B (en) | Application of FOXR2 gene and expression product in diagnosis and treatment of liver cancer | |
WO2011091716A1 (en) | Epidermal growth factor receptor variant | |
CN116621946B (en) | Application of polypeptide circ1946-109aa as esophageal squamous carcinoma prognosis marker | |
Xu et al. | Frizzled-7 promoter is highly active in tumors and promoter-driven Shiga-like toxin I inhibits hepatocellular carcinoma growth | |
CN106701904B (en) | Application of ACSL4 gene and expression product in diagnosis and treatment of gastric cancer | |
CN116622849B (en) | Application of circ0337-122aa detection reagent as esophageal squamous carcinoma prognosis reagent | |
JP4712692B2 (en) | Novel polypeptides useful in cancer diagnosis and treatment | |
CN114702566B (en) | Small peptide encoded by long-chain non-coding RNA LINC01234 and application thereof | |
CN113336853B (en) | Monoclonal antibody aiming at AGR3 protein, preparation method and application thereof | |
Shafaghat et al. | Preparation of proper immunogen by cloning and stable expression of cDNA coding for human hematopoietic stem cell marker CD34 in NIH-3T3 mouse fibroblast cell line | |
KR100861465B1 (en) | A gastric carcinoma gene znf312b, a protein translated from the gene and a diagnostic kit using the same | |
US7303914B2 (en) | Monoclonal antibody against human hepatoma and use thereof | |
CN106699892B (en) | DNAH5 fusion gene in lung squamous cell carcinoma and application thereof | |
CN115820863A (en) | New immune negative regulation oncogene and application of encoding protein thereof | |
CN116004674A (en) | PTEN gene downstream nucleotide sequence and polypeptide encoded by PTEN gene downstream nucleotide sequence | |
CN114149496A (en) | Tumor angiogenesis regulatory protein and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |