CN115991773B - Pharmaceutical composition containing human serum albumin - Google Patents
Pharmaceutical composition containing human serum albumin Download PDFInfo
- Publication number
- CN115991773B CN115991773B CN202210985801.2A CN202210985801A CN115991773B CN 115991773 B CN115991773 B CN 115991773B CN 202210985801 A CN202210985801 A CN 202210985801A CN 115991773 B CN115991773 B CN 115991773B
- Authority
- CN
- China
- Prior art keywords
- endoglin
- cancer
- paclitaxel
- monoclonal antibody
- pharmaceutical composition
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 239000008194 pharmaceutical composition Substances 0.000 title claims abstract description 15
- 108091006905 Human Serum Albumin Proteins 0.000 title claims abstract description 12
- 102000008100 Human Serum Albumin Human genes 0.000 title claims abstract description 12
- 108010036395 Endoglin Proteins 0.000 claims abstract description 37
- 102000012085 Endoglin Human genes 0.000 claims abstract description 37
- 206010009944 Colon cancer Diseases 0.000 claims abstract description 31
- 229960001592 paclitaxel Drugs 0.000 claims abstract description 31
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims abstract description 30
- 229930012538 Paclitaxel Natural products 0.000 claims abstract description 28
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 claims abstract description 28
- 102000009027 Albumins Human genes 0.000 claims abstract description 24
- 108010088751 Albumins Proteins 0.000 claims abstract description 24
- 238000011282 treatment Methods 0.000 claims abstract description 19
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 claims description 18
- 239000000243 solution Substances 0.000 claims description 16
- 239000003814 drug Substances 0.000 claims description 15
- 229940079593 drug Drugs 0.000 claims description 9
- 238000002360 preparation method Methods 0.000 claims description 9
- 238000000034 method Methods 0.000 claims description 8
- 238000003756 stirring Methods 0.000 claims description 6
- 238000011068 loading method Methods 0.000 claims description 5
- 238000002390 rotary evaporation Methods 0.000 claims description 3
- 239000007864 aqueous solution Substances 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 2
- 239000003937 drug carrier Substances 0.000 claims 2
- 206010028980 Neoplasm Diseases 0.000 abstract description 43
- 239000002105 nanoparticle Substances 0.000 abstract description 21
- 230000000694 effects Effects 0.000 abstract description 16
- 230000014509 gene expression Effects 0.000 abstract description 9
- 230000002401 inhibitory effect Effects 0.000 abstract description 7
- 230000035755 proliferation Effects 0.000 abstract description 5
- 102000004887 Transforming Growth Factor beta Human genes 0.000 abstract description 4
- 108090001012 Transforming Growth Factor beta Proteins 0.000 abstract description 4
- 230000005764 inhibitory process Effects 0.000 abstract description 4
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 abstract description 4
- 210000004027 cell Anatomy 0.000 description 49
- 201000011510 cancer Diseases 0.000 description 18
- 239000002504 physiological saline solution Substances 0.000 description 12
- 241000699670 Mus sp. Species 0.000 description 11
- 239000002245 particle Substances 0.000 description 11
- 108090000623 proteins and genes Proteins 0.000 description 11
- 102000004169 proteins and genes Human genes 0.000 description 9
- 239000000203 mixture Substances 0.000 description 7
- 206010003445 Ascites Diseases 0.000 description 6
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 6
- 239000007924 injection Substances 0.000 description 6
- 238000002347 injection Methods 0.000 description 6
- 238000007920 subcutaneous administration Methods 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 5
- 206010027476 Metastases Diseases 0.000 description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 5
- 150000001413 amino acids Chemical group 0.000 description 5
- 102000036639 antigens Human genes 0.000 description 5
- 108091007433 antigens Proteins 0.000 description 5
- 210000004204 blood vessel Anatomy 0.000 description 5
- 239000006285 cell suspension Substances 0.000 description 5
- 238000002649 immunization Methods 0.000 description 5
- 230000003053 immunization Effects 0.000 description 5
- 230000009401 metastasis Effects 0.000 description 5
- 239000013641 positive control Substances 0.000 description 5
- 238000011160 research Methods 0.000 description 5
- 210000002966 serum Anatomy 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- 208000005718 Stomach Neoplasms Diseases 0.000 description 4
- 230000000259 anti-tumor effect Effects 0.000 description 4
- 239000000427 antigen Substances 0.000 description 4
- 229940098773 bovine serum albumin Drugs 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 238000012258 culturing Methods 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 206010017758 gastric cancer Diseases 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- 210000004408 hybridoma Anatomy 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 201000011549 stomach cancer Diseases 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 206010004593 Bile duct cancer Diseases 0.000 description 3
- 206010006187 Breast cancer Diseases 0.000 description 3
- 208000026310 Breast neoplasm Diseases 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 206010039491 Sarcoma Diseases 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 239000002671 adjuvant Substances 0.000 description 3
- 208000026900 bile duct neoplasm Diseases 0.000 description 3
- 238000009739 binding Methods 0.000 description 3
- 208000006990 cholangiocarcinoma Diseases 0.000 description 3
- 208000029742 colonic neoplasm Diseases 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 239000007928 intraperitoneal injection Substances 0.000 description 3
- 201000007270 liver cancer Diseases 0.000 description 3
- 208000014018 liver neoplasm Diseases 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 210000004881 tumor cell Anatomy 0.000 description 3
- 206010005949 Bone cancer Diseases 0.000 description 2
- 208000018084 Bone neoplasm Diseases 0.000 description 2
- 206010008342 Cervix carcinoma Diseases 0.000 description 2
- 208000005243 Chondrosarcoma Diseases 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 208000008051 Hereditary Nonpolyposis Colorectal Neoplasms Diseases 0.000 description 2
- 208000017095 Hereditary nonpolyposis colon cancer Diseases 0.000 description 2
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 2
- 201000005027 Lynch syndrome Diseases 0.000 description 2
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 239000012980 RPMI-1640 medium Substances 0.000 description 2
- 208000015634 Rectal Neoplasms Diseases 0.000 description 2
- 108010087230 Sincalide Proteins 0.000 description 2
- 206010041067 Small cell lung cancer Diseases 0.000 description 2
- 102000016715 Transforming Growth Factor beta Receptors Human genes 0.000 description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 2
- 210000001015 abdomen Anatomy 0.000 description 2
- 230000005856 abnormality Effects 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 229960000397 bevacizumab Drugs 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 238000004364 calculation method Methods 0.000 description 2
- 238000010609 cell counting kit-8 assay Methods 0.000 description 2
- 201000010881 cervical cancer Diseases 0.000 description 2
- 229960005395 cetuximab Drugs 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 229940044683 chemotherapy drug Drugs 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 210000001072 colon Anatomy 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 230000007547 defect Effects 0.000 description 2
- 235000005911 diet Nutrition 0.000 description 2
- MTHSVFCYNBDYFN-UHFFFAOYSA-N diethylene glycol Chemical compound OCCOCCO MTHSVFCYNBDYFN-UHFFFAOYSA-N 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 238000010494 dissociation reaction Methods 0.000 description 2
- 230000005593 dissociations Effects 0.000 description 2
- 229960001484 edetic acid Drugs 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- 210000003236 esophagogastric junction Anatomy 0.000 description 2
- 238000004108 freeze drying Methods 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 201000010536 head and neck cancer Diseases 0.000 description 2
- 208000014829 head and neck neoplasm Diseases 0.000 description 2
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 2
- 238000000265 homogenisation Methods 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 239000010410 layer Substances 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 201000005202 lung cancer Diseases 0.000 description 2
- 208000020816 lung neoplasm Diseases 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 210000004379 membrane Anatomy 0.000 description 2
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 2
- 229960001972 panitumumab Drugs 0.000 description 2
- 230000008506 pathogenesis Effects 0.000 description 2
- 229940049954 penicillin Drugs 0.000 description 2
- 210000004303 peritoneum Anatomy 0.000 description 2
- 239000002244 precipitate Substances 0.000 description 2
- 238000004393 prognosis Methods 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000008439 repair process Effects 0.000 description 2
- 229920006395 saturated elastomer Polymers 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- IZTQOLKUZKXIRV-YRVFCXMDSA-N sincalide Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](N)CC(O)=O)C1=CC=C(OS(O)(=O)=O)C=C1 IZTQOLKUZKXIRV-YRVFCXMDSA-N 0.000 description 2
- 208000000587 small cell lung carcinoma Diseases 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 210000004989 spleen cell Anatomy 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 238000002626 targeted therapy Methods 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 231100000765 toxin Toxicity 0.000 description 2
- 230000005747 tumor angiogenesis Effects 0.000 description 2
- 230000004614 tumor growth Effects 0.000 description 2
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 2
- 208000030507 AIDS Diseases 0.000 description 1
- 208000037540 Alveolar soft tissue sarcoma Diseases 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 206010002329 Aneurysm Diseases 0.000 description 1
- 208000007860 Anus Neoplasms Diseases 0.000 description 1
- 238000011729 BALB/c nude mouse Methods 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010055113 Breast cancer metastatic Diseases 0.000 description 1
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 1
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 241000595586 Coryne Species 0.000 description 1
- 101710099946 DNA mismatch repair protein Msh6 Proteins 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 206010059866 Drug resistance Diseases 0.000 description 1
- 208000001976 Endocrine Gland Neoplasms Diseases 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 206010014967 Ependymoma Diseases 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 201000006107 Familial adenomatous polyposis Diseases 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 1
- 208000021309 Germ cell tumor Diseases 0.000 description 1
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 description 1
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 description 1
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 208000022361 Human papillomavirus infectious disease Diseases 0.000 description 1
- 101710123134 Ice-binding protein Proteins 0.000 description 1
- 101710082837 Ice-structuring protein Proteins 0.000 description 1
- 208000009164 Islet Cell Adenoma Diseases 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- 206010051589 Large intestine polyp Diseases 0.000 description 1
- 206010024612 Lipoma Diseases 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 208000002030 Merkel cell carcinoma Diseases 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 206010051141 Myeloblastoma Diseases 0.000 description 1
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 1
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 206010029266 Neuroendocrine carcinoma of the skin Diseases 0.000 description 1
- 206010052399 Neuroendocrine tumour Diseases 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 206010033701 Papillary thyroid cancer Diseases 0.000 description 1
- 206010033963 Parathyroid tumour Diseases 0.000 description 1
- 208000007913 Pituitary Neoplasms Diseases 0.000 description 1
- 229920001030 Polyethylene Glycol 4000 Polymers 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 1
- 239000006180 TBST buffer Substances 0.000 description 1
- 108091005735 TGF-beta receptors Proteins 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 208000000728 Thymus Neoplasms Diseases 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 108010092867 Transforming Growth Factor beta Receptors Proteins 0.000 description 1
- 101710107540 Type-2 ice-structuring protein Proteins 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 210000000683 abdominal cavity Anatomy 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 201000005188 adrenal gland cancer Diseases 0.000 description 1
- 208000024447 adrenal gland neoplasm Diseases 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000003527 anti-angiogenesis Effects 0.000 description 1
- 201000011165 anus cancer Diseases 0.000 description 1
- 210000001815 ascending colon Anatomy 0.000 description 1
- 210000001099 axilla Anatomy 0.000 description 1
- 238000010009 beating Methods 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 210000005252 bulbus oculi Anatomy 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 230000036952 cancer formation Effects 0.000 description 1
- 230000009400 cancer invasion Effects 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 210000004534 cecum Anatomy 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 208000011654 childhood malignant neoplasm Diseases 0.000 description 1
- 208000029664 classic familial adenomatous polyposis Diseases 0.000 description 1
- 208000009060 clear cell adenocarcinoma Diseases 0.000 description 1
- 201000002758 colorectal adenoma Diseases 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- 238000005336 cracking Methods 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 208000017763 cutaneous neuroendocrine carcinoma Diseases 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 210000001731 descending colon Anatomy 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 230000000378 dietary effect Effects 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000003113 dilution method Methods 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000008298 dragée Substances 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 235000006694 eating habits Nutrition 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 230000001804 emulsifying effect Effects 0.000 description 1
- 201000011523 endocrine gland cancer Diseases 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 210000002615 epidermis Anatomy 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 230000003203 everyday effect Effects 0.000 description 1
- 230000005713 exacerbation Effects 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 210000001508 eye Anatomy 0.000 description 1
- 239000012091 fetal bovine serum Substances 0.000 description 1
- 230000003328 fibroblastic effect Effects 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 210000000232 gallbladder Anatomy 0.000 description 1
- 201000010175 gallbladder cancer Diseases 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- -1 glidants Substances 0.000 description 1
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- 125000005842 heteroatom Chemical group 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 230000008676 import Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000005305 interferometry Methods 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- 201000002529 islet cell tumor Diseases 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 201000003782 large intestine adenoma Diseases 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 230000021633 leukocyte mediated immunity Effects 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 229940057995 liquid paraffin Drugs 0.000 description 1
- 239000012160 loading buffer Substances 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 206010027191 meningioma Diseases 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 208000023833 nerve sheath neoplasm Diseases 0.000 description 1
- 208000016065 neuroendocrine neoplasm Diseases 0.000 description 1
- 201000011519 neuroendocrine tumor Diseases 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 229940126578 oral vaccine Drugs 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 1
- 229960001756 oxaliplatin Drugs 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 208000022102 pancreatic neuroendocrine neoplasm Diseases 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 208000028591 pheochromocytoma Diseases 0.000 description 1
- 208000010916 pituitary tumor Diseases 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920002796 poly[α-(4-aminobutyl)-L-glycolic acid) Polymers 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 208000015768 polyposis Diseases 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 201000002267 posterior uveal melanoma Diseases 0.000 description 1
- 230000001376 precipitating effect Effects 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 238000000751 protein extraction Methods 0.000 description 1
- 239000012521 purified sample Substances 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 210000000664 rectum Anatomy 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000003716 rejuvenation Effects 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 239000000523 sample Substances 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 210000001599 sigmoid colon Anatomy 0.000 description 1
- 239000002356 single layer Substances 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 230000000391 smoking effect Effects 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- UNFWWIHTNXNPBV-WXKVUWSESA-N spectinomycin Chemical compound O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O UNFWWIHTNXNPBV-WXKVUWSESA-N 0.000 description 1
- 201000011096 spinal cancer Diseases 0.000 description 1
- 208000014618 spinal cord cancer Diseases 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 206010041823 squamous cell carcinoma Diseases 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 206010042863 synovial sarcoma Diseases 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 208000008732 thymoma Diseases 0.000 description 1
- 201000009377 thymus cancer Diseases 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 208000030045 thyroid gland papillary carcinoma Diseases 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000007723 transport mechanism Effects 0.000 description 1
- 210000003384 transverse colon Anatomy 0.000 description 1
- 208000017997 tumor of parathyroid gland Diseases 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 230000006444 vascular growth Effects 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Landscapes
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
The application relates to a pharmaceutical composition containing human serum albumin. The application prepares a specific monoclonal antibody aiming at endoglin, which can effectively inhibit proliferation of colorectal cancer cells and can directly regulate expression of TGF-beta 1 at the downstream of endoglin by inhibiting activity of endoglin. The paclitaxel/albumin nanoparticle and the endoglin specific monoclonal antibody are combined, so that the tumor inhibition rate can be effectively improved, and a better treatment effect is achieved.
Description
Technical Field
The application relates to the field of biology, in particular to a pharmaceutical composition containing human serum albumin.
Background
Colorectal cancer is a common malignancy, including colon cancer and rectal cancer. The incidence of colorectal cancer is, in order from high to low, rectum, sigmoid colon, cecum, ascending colon, descending colon, and transverse colon, and in recent years, there is a trend toward the proximal end (right half colon). The onset of the disease is closely related to life style, heredity, large intestine adenoma and the like. The onset age is aged, and the ratio of men to women is 1.65:1. at present, about 312 thousands of new cancer cases are generated annually in China, and on average, 8550 people are diagnosed every day, 6 people are diagnosed as cancer every minute, and 5 people die from the cancer. The number of cancer death cases is 270 ten thousand per year.
In the tumors with the highest incidence of five diseases in China, the number of digestive tract tumors is four, so that the incidence of gastric cancer, esophageal cancer and liver cancer is stable in practice. However, there is a clear upward trend in the incidence of colorectal cancer. The incidence rate of colorectal cancer rises rapidly, and white-collar people are particularly obvious and have a tendency to younger. Colon and rectum cancers are collectively referred to as colorectal or colorectal cancers. Experts show that the incidence rate of colorectal cancer rises rapidly, the incidence rate of colorectal cancer is particularly obvious in white-collar people in large cities such as northern Guangdong, and the trend of younger occurrence is predicted by scientists, so that the incidence rate of colorectal cancer in the near future probably exceeds lung cancer and gastric cancer, and the colorectal cancer becomes the first of the cancer. The rejuvenation of colorectal cancer, in addition to genetic factors, exacerbation of urbanization and changes in the dietary structure of the population are also important reasons, and urban white-collar under high intensity working pressure is of particular concern.
Research on pathogenesis of colorectal cancer generally suggests that the pathogenesis of colorectal cancer is complex, and genetic material abnormality, genetic abnormality, unhealthy eating habits and the like are main causes of colorectal cancer. From a genetic perspective, the onset of colorectal cancer is mainly manifested as familial adenomatous polyposis and hereditary non-polyposis colorectal cancer. Adenomatous polyposis gene has the function of inhibiting oncogene, and its loss of function results in the elevation of p-calnexin level, which directly induces tumor occurrence. The occurrence of hereditary non-polyposis colorectal cancer is related to the defect of the mismatching repair system. Hereditary non-polyp colorectal cancer is a susceptible pestilence group of tumors, and from the current research, the change of the mismatching repair related genes has great influence on the formation of tumors. Changes in Hmshl, hmsh2, hpsml, hpsm2 and GTBP genes are the main causes of tumor induction. In addition, high-fat low-cellulose diet and long-term smoking are causative factors of colorectal cancer. At present, common colorectal cancer chemotherapeutic drugs in the market include 5-FU, capecitabine, oxaliplatin, irinotecan, cetuximab, bevacizumab, panitumumab and the like. The main monoclonal antibody medicine is cetuximab, bevacizumab and panitumumab. But the variety of drugs is not yet abundant.
The growth and metastasis of malignant solid tumors depend on the formation of new blood vessels in tumor tissues, which acquire nutrients through tumor blood vessels, excrete metabolites and import tumor cells into the host, which are closely related to tumor growth, invasion and metastasis, while CD 105 Also participates in angiogenesis, is a new vessel mark. From this, it is expected that CD 105 Plays an important role in diagnosis, prognosis and treatment of human malignant tumor. CD (compact disc) 105 Also known as endoglin, which is a surface of endothelial cell membranesThe glycoprotein is one of the components of the transforming growth factor beta receptor complex, but can be present independently on the cell surface. CD (compact disc) 105/ endoglin regulates endothelial and interstitial signaling by participating in TGF- β receptor signaling, and plays an important role in tumor angiogenesis. Tumor vascular growth is an important condition for tumorigenesis, growth, and invasive metastasis. CD (compact disc) 105/ endoglin provides a new therapeutic target for anti-tumor vascular treatment. The targeted therapy for inhibiting tumor angiogenesis or selectively damaging tumor blood vessels is a new ideal tumor treatment method after traditional surgery, chemotherapy and radiotherapy. In the mouse experiments, the CD is shown 105/ endoglin as acting target and CD resisting 105/ The endoglin antibody is taken as a carrier, and a compound combined with the endoglin antibody, such as a chemotherapeutic drug, biotoxin, radionuclide, and the like, can specifically guide to a tumor part, directly kill tumor cells, has obvious tumor inhibiting effect, and has no obvious adverse effect. In the recent CD 105 In the research of antitumor blood vessels serving as targets, the oral vaccine induces CD8+ cell mediated immune response, so that lung metastasis of breast cancer of a cancer cell line is effectively inhibited, and the effect of antitumor blood vessel targeted therapy in future breast cancer treatment is predicted. Because the anti-angiogenesis treatment has the advantages of high efficiency, specificity, difficult generation of drug resistance, small toxic and side effects and the like, the CD is applied 105/ The endoglin monoclonal antibody has broad prospect in combination with chemotherapeutics, biotoxins and radionuclides for anti-tumor treatment.
However, at present, research on endoglin monoclonal antibodies is not enough, and research is not enough, so that corresponding medicaments are still to be further developed.
Disclosure of Invention
The application overcomes the defects of the prior art and provides a novel method for treating colorectal cancer.
In one aspect, the application provides a monoclonal antibody specific for endoglin.
In one aspect, the application provides a monoclonal antibody a11 directed against endoglin, the amino acid sequence of the light chain variable region:
amino acid sequence of heavy chain variable region:
in another aspect of the application, there is provided the use of a monoclonal antibody directed against endoglin for the preparation of a pharmaceutical composition for the treatment of colorectal cancer.
Further, the colorectal cancer is caused by a human colorectal cancer cell line HCT 116.
Human Serum Albumin (HSA) is a natural carrier of human endogenous substances and hydrophobic molecules, and HSA has a special transport mechanism, so that the concentration of a drug combined with the HSA in tumor cells can be greatly improved. Thus in a further aspect, the present application also provides albumin paclitaxel nanoparticles.
The nanometer example is that paclitaxel is dissolved in acetone, a certain amount of human albumin is taken to be dissolved in water, the medicine carrying ratio (medicine/albumin mol ratio) is set to be 10:1, the paclitaxel acetone solution is dropwise added into the albumin water solution under the stirring condition, the stirring is continued for 6min, then acetone is removed by rotary evaporation, water is added for volume fixing, and high-pressure homogenization is carried out, thus obtaining the albumin paclitaxel nanoparticle solution.
In another aspect, the application also provides the use of a monoclonal antibody directed against endoglin and albumin paclitaxel nanoparticles for the preparation of a pharmaceutical composition for the treatment of colorectal cancer.
Further, the colorectal cancer is caused by a human colorectal cancer cell line HCT 116.
Furthermore, the albumin paclitaxel nanoparticle can also be prepared by other conventional preparation methods in the field.
In some embodiments, the pharmaceutical composition, wherein the antibody comprises the amino acid sequence: a variable region sequence having at least 80% (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) homology to the amino acid sequence shown in SEQ ID NO.1 or SEQ ID NO. 2.
The pharmaceutical compositions of the application are useful for administration to a subject in need thereof. In particular, the pharmaceutical compositions of the application are useful for treating cancer, and in certain embodiments, for treating cancer in which endoglin is expressed, e.g., a therapeutically effective amount or a prophylactically effective amount. In some embodiments, the cancer is selected from: adrenal gland cancer, anal cancer, AIDS-related cancer, alveolar soft tissue sarcoma, bile duct cancer, one bile duct cancer, bladder cancer, bone cancer, brain and spinal cord cancer, breast cancer, metastatic breast cancer, carotid aneurysm, cervical cancer, HPV-related cervical cancer, chondrosarcoma, chordoma, borborrelia renal cell carcinoma, clear cell carcinoma, colon cancer, colorectal cancer, connective tissue proliferative microcirculatory cell tumor, ependymoma, endometrial cancer, ewing & #8217 sarcoma, extraosseous mucoid chondrosarcoma, fibroblastic bone, fibrodysplasia of bone, gall bladder or bile duct cancer, gastric cancer, gastroesophageal junction (GEJ) cancer, gestational trophoblastoma, germ cell tumor, head and neck cancer, islet cell tumor, kaposi sarcoma, kidney cancer, leukemia, liposarcoma/malignant lipoma, liver cancer, hepatocellular carcinoma liver cancer (HCC), lymphoma, non-hodgkin's lymphoma (NHL), lung cancer, small Cell Lung Cancer (SCLC), non-small cell lung cancer (NSCLC), myeloblastoma, melanoma, meningioma, merkel cell carcinoma, multiple endocrine tumor, multiple myeloma, myelodysplastic syndrome, neuroblastoma, neuroendocrine tumor, ovarian cancer, pancreatic cancer, papillary thyroid cancer, parathyroid tumor, pediatric cancer, peripheral nerve sheath tumor, pheochromocytoma, pituitary tumor, prostate cancer, posterior uveal melanoma, renal metastasis carcinoma, coryne, rhabdomyosarcoma, sarcoma, skin cancer, soft tissue sarcoma, squamous cell carcinoma head and neck cancer (SCCHN), gastric cancer, synovial sarcoma, testicular cancer, thymus cancer, thymoma, thyroid cancer and uterine cancer.
The pharmaceutical compositions of the present disclosure may be manufactured using methods well known in the art, such as conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, freeze-drying, and the like.
The solid oral compositions may be prepared by conventional mixing, filling or tabletting methods. For example, it can be obtained by the following method: the active compound is mixed with solid auxiliary materials, the resulting mixture is optionally milled, if desired with other suitable auxiliary materials, and the mixture is then processed to granules, giving a tablet or dragee core. Suitable excipients include, but are not limited to: binders, diluents, disintegrants, lubricants, glidants, sweeteners or flavoring agents, and the like.
The pharmaceutical composition comprising the present application is physically introduced into a subject. Routes of administration include intravenous, intramuscular, subcutaneous, intraperitoneal, spinal or other parenteral routes of administration, for example by injection or infusion. The phrase "parenteral administration" as used herein refers to modes of administration other than enteral and topical administration, typically by injection, and includes, but is not limited to, intravenous, intramuscular, intraarterial, intrathecal, intralymphatic, intralesional, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intra-articular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion, and in vivo electroporation. In certain embodiments, administration is by a non-parenteral route, in certain embodiments, oral administration. Other non-parenteral routes include topical, epidermal or mucosal routes of administration, e.g., intranasally, vaginally, rectally, sublingually or topically. Administration may also be performed, for example, one, multiple times, and/or over one or more extended periods of time.
Advantageous effects
The application prepares a specific monoclonal antibody aiming at endoglin, which can effectively inhibit proliferation of colorectal cancer cells and can directly regulate expression of TGF-beta 1 at the downstream of endoglin by inhibiting activity of endoglin. The paclitaxel/albumin nanoparticle and the endoglin specific monoclonal antibody are combined, so that the tumor inhibition rate can be effectively improved, and a better treatment effect is achieved.
Drawings
FIG. 1 shows a diagram of the results of monoclonal antibody specificity identification
FIG. 2 proliferation effect of monoclonal antibodies on cancer cells
FIG. 3 influence of monoclonal antibodies on TGF- β1 Gene expression in cancer cells
FIG. 4 is a graph showing tumor-inhibiting effect of albumin-paclitaxel nanoparticles combined with monoclonal antibodies
Detailed Description
The present disclosure is further described below in connection with specific embodiments, however, these embodiments are merely illustrative of the present disclosure and do not limit the scope of the present disclosure. Also, the present disclosure is not limited to any particular preferred embodiment described herein. It should be understood by those skilled in the art that equivalent substitutions and corresponding modifications of the technical features of the present disclosure still fall within the protection scope of the present disclosure. The reagents used in the examples below are commercially available products, and the solutions may be formulated using techniques conventional in the art, unless otherwise specified.
EXAMPLE 1 preparation of endoglin monoclonal antibodies
Recombinant endoglin was used as an immunogen (Prospec, cat# CYT-525) and was prepared as a 1mg/ml solution.
Three SPF-class 6-week-old female Balb/c mice, labeled 1, 2, and 3 mice, were selected and first bred for two weeks to adapt to the environment. Three immunizations and one booster immunization were performed, respectively. Wherein the first immunization is that antigen 0.1 mg+0.15 ml of sterile physiological saline+0.3 ml of Freund's complete adjuvant, the subcutaneous multipoint injection is carried out after three weeks, the second immunization is carried out, the subcutaneous multipoint injection of antigen 0.1 mg+0.15 ml of sterile physiological saline+0.3 ml of Freund's incomplete adjuvant, the third immunization is carried out after three weeks, the subcutaneous multipoint injection of antigen 0.1 mg+0.15 ml of sterile physiological saline+0.3 ml of Freund's incomplete adjuvant is carried out, and after three weeks, the intraperitoneal injection of mice is carried out after the dilution of antigen 0.1mg with physiological saline 0.15 ml. Serum titers were determined after 5 days, and showed that the serum titers of mouse number 2 reached up to 1:25000, significantly higher than other mice. Therefore, spleen of mouse No.2 with highest serum titer was selected for cell fusionAnd (5) combining. The eyes were first dug out and serum was collected. Preparation of spleen cell suspension of immunized mice, counting living cells so that the final concentration of cell suspension is 5X 10 7 /ml。
SP2/0 myeloma cells (1X 10) were mixed in a 5:1 ratio in a 50ml centrifuge tube 7 Individual/ml) and immunized murine spleen cells (5X 10) 7 25ml of 1640 medium was added thereto, centrifuged at 1000rpm/min for 10min, and the supernatant was discarded. Lightly beating the bottom of the tube with fingers to disperse the precipitated cells, and placing the dispersed cells in a constant-temperature water bath box at 37 ℃ for heat preservation; 1ml of 50% PEG4000 was added in 1min while gently shaking; slowly add serum-free 1640 to dilute, slowly add serum-free 1640 (15 ml), terminate PEG action; centrifuging and precipitating at 1000rpm/min for 10min, and sucking supernatant; 1ml is added dropwise every 1min, and a centrifuge tube is slowly rotated while adding for 5min; the bottom of the tube was tapped, 1ml of RPMI-1640 medium containing 20% fetal bovine serum HAT was added, the mixture was mixed and counted, and the mixture was added to a 96-well cell culture plate containing feeder cells after 24 hours of culture. Setting culture plates with different cell numbers for ensuring the growth rate of the fused cells; placing 5% CO 2 Culturing in a 37℃incubator, sucking 50. Mu.L of the culture supernatant from each well on days 4, 6, 8 and 10, adding 50. Mu.L of HAT culture solution, culturing with HT culture solution for one week on day 15, and then using normal culture solution. When the surviving cell clone occupies more than 1/10 area of the visual field, the liquid is changed, 100 mu l of culture liquid is sucked out, and positive cells are detected by indirect ELISA. The result shows that the total positive rate reaches 52.3% when the total positive rate is 71 holes. Cloning positive hybridoma cells, subcloning four times by adopting a limiting dilution method continuously until all cell holes with cell clone growth are positive, and considering subcloning to be successful. After four subcloning, two cells with strongest positivity were obtained, a11 and F15, respectively.
Preparation of monoclonal antibody: a6-8 week normal male Balb/c mouse was given by intraperitoneal injection of 0.5ml of liquid paraffin. After 7d, the A11 and F15 hybridoma cells in the logarithmic growth phase were collected, centrifuged at 1000rpm X5 min, and the supernatant was discarded, and the cell concentration was adjusted to 1X 10 with physiological saline sterilized by autoclaving in advance 6 Each mouse was intraperitoneally injected with 0.5ml of the cell suspension, about 5X 10, per ml 5 Individual impuritiesAnd (3) an hybridoma cell. The abdominal state of the mice is observed, a large amount of ascites can be generated after 10 days of inoculation, and the obvious increase of the abdomen of the mice can be seen. When the abdomen of the mice is large enough and the movement is inconvenient (about 14 days), the mice are sacrificed after the eyeballs are picked for blood collection. The epidermis was cut off with sterile scissors in an ultra clean bench, the peritoneum was exposed, the peritoneum was lifted with sterilized forceps and cut off at the uppermost end, and ascites was collected. After the ascites is collected, the residual ascites is sucked out by using normal saline, and the residual ascites is packaged separately and marked as ascites in washing liquid. After accumulated extraction and collection, centrifugation is carried out, after the floating fat on the uppermost layer is removed, the yellow clarified liquid is transferred into an EP pipe, the impurities on the bottom layer are discarded, and the mixture is purified by a column and utilizedThe Ultra-15 centrifugal filter removes substances smaller than 50KD so as to achieve the aim of improving the concentration of the antibody, and the titers of the concentrated A11 monoclonal antibody and F15 monoclonal antibody are respectively 1:160000 and 1:320000, so that the effect is better. SDS-PAGA electrophoresis experiments determine the purified sample bands, and the results show that the two target proteins have protein bands at 25KD and 55KD and have fewer hetero proteins.
EXAMPLE 2 Endoglin monoclonal antibody A11 specificity identification
Monoclonal antibody specificity assay: ELISA plates coated with the immunogen endoglin recombinant protein, BSA, AFP, CEA, and 1:4000 dilution of antibody were added. Negative and blank wells were set simultaneously. The enzyme-labeled instrument measures A450nm. P/N (a certain dilution of purified antibody A450 nm-blank A450 nm)/(negative control A450 nm-blank A450 nm) ]. Gtoreq.2.1 was positive. The results are shown in FIG. 1.
As can be seen from the specific identification result of the ELISA system shown in FIG. 1, the P/N value of the A11 monoclonal antibody against endoglin protein is obviously larger than 2.1, the monoclonal antibody is positive, and the detection result against other substances is negative, which indicates that the system can specifically detect target antigen protein, and also indicates that the A11 monoclonal antibody has better specificity.
Example 3 affinity and sequence identification of endoglin monoclonal antibody A11
Antibody binding kinetics rate constants were determined using biological membrane interferometry (BLI, forteBio oct RED 96). BLI test lineA biosensor (ForteBio) with AHC (Anti-hIgG Fc Capture) was used to Capture Anti-antibody endoglin monoclonal antibody (750 ng/mL), a 0.5nM shift (shift) was obtained, and then the biosensor was immersed in different concentrations (i.e., 0, 0.625, 1.25, 2.5, 5, 10, 20, and 40 nM) of recombinant endoglin protein in an electrophoresis buffer containing 0.1% Bovine Serum Albumin (BSA), 0.1% Tween-20, 250mM NaCl, 2.7mM KCl, 10mM Na 2 HPO 4 1.8mM KH 2 PO 4 ). The rate constant was calculated using a curve fitting analysis of the binding reaction for 5 minutes binding and 15 minutes separation interaction time (curve fitting analysis;1:1 Langmuir model), resulting in an equilibrium dissociation constant (KD=Kd/Ka) value for the antibody as shown in FIG. 1.
TABLE 1 Endoglin monoclonal antibody A11 dissociation constant
Referring to Table 1, it can be seen that the A11 antibody has a lower KD value, representing that the antibody of the present application has a high affinity for endoglin.
Reverse transcription of total RNA of hybridoma cells into cDNA; amplifying antibody light chain variable region IgVL (κ) and heavy chain variable region VH sequences using degenerate primers and a Phusion kit; purifying the PCR amplification product by using a gel recovery kit; and connecting the amplified PCR product to a T vector according to the specification of a T vector cloning kit, converting the E.coli competent cells, amplifying the strain, extracting plasmids, and then carrying out DNA sequencing to obtain a monoclonal antibody variable region sequence. Sequencing results show that the amino acid sequence of the light chain variable region of the monoclonal antibody A11 is shown as SEQ ID NO.1, and the sequence of the heavy chain variable region is shown as SEQ ID NO. 2.
Example 4 Effect of endoglin monoclonal antibody A11 on proliferation and Gene expression of cancer cells
Human colorectal cancer cell line HCT116 was maintained supplemented with 10% foetal cattleSerum, 100U/ml penicillin and 100U/ml streptomycin in DMEM medium and at 37℃with 5% CO 2 Is incubated in a saturated humid environment.
The above treated HCT116 was placed in 96-well plates with a density of 1X 10 per well 4 Cells, the culture plate is placed in the DMEM medium, and the culture plate contains 5% CO at 37 DEG C 2 Is cultured for 24 hours until the cells adhere to the wall. A blank control group (without any treatment), a positive control LY364947 (10. Mu.g/ml, 10. Mu.l), a low-dose group of A11 (1. Mu.g/ml, 10. Mu.l), a medium-dose group of A11 (10. Mu.g/ml, 10. Mu.l), a high-dose group of A11 (100. Mu.g/ml, 10. Mu.l) were added to each of the above-mentioned adherent cells in this order, and culturing was continued for 48 hours according to the protocol. After the preset time is reached, the original culture medium is discarded, 20 mu l of CCK-8 reagent is added into each hole to avoid generating bubbles, cells are incubated with the culture medium containing the CCK-8 reagent for 2 hours, the color of the culture solution is developed, and the absorbance value (A value) of each hole at 450nm is measured by an enzyme-labeled instrument. Cell viability (%) (cell activity) was calculated according to the formula: (experimental group A value-blank group A value)/(control group A value-blank group A value). Times.100%, the proliferation of each group of cells is expressed as cell activity.
As shown in fig. 2, HCT116 cell activity after mab a 11-mediated drying was significantly reduced (P < 0.05) compared to the control group without any intervention, with no significant difference (P > 0.05) compared to the positive control group LY 364947; within the same intervention time, there was a statistical difference in HCT116 cell activity between each mab dose group, suggesting that there was a dose dependence of the mab on the cytotoxic effect of HCT116, with only (36.17 ±1.86)% of cell activity under a11 high dose group treatment conditions.
The cells from each group were collected and the lower pellet was washed 3 times with cold PBS and lysed in immunoprecipitation assay lysis buffer, and the cells were collected and sonicated. And (3) carrying out protein extraction on a small amount of supernatant after ice cracking, regulating the content of each group of proteins after measurement, mixing with a protein loading buffer solution, and carrying out Western blot experiment, wherein the whole sample lysate is separated through sodium dodecyl sulfate polyacrylamide gel electrophoresis and then transferred onto a polyvinylidene fluoride membrane at low temperature. Membranes were blocked with 5% bovine serum albumin for 1h at room temperature and incubated overnight at 4℃with shaking in GAPDH, TGF- β1 primary antibody. TBST is washed three times and then is placed in horseradish peroxidase-coupled secondary antibody at 3 ℃ for incubation for 1h, filter membrane color development is carried out by using enhanced chemiluminescent reagent with the secondary antibody, an analytical imager is used for photographing images, and related software QuantityOne-4.6.5 is used for analyzing data.
As shown in fig. 3, overall, the protein expression of TGF- β1 was significantly reduced (P < 0.05) in HCT116 cells following mab a 11-dry prognosis compared to the control group without any intervention; specifically, the TGF-beta 1 expression of HCT116 cells among each monoclonal antibody dose group has dose dependency, and under the treatment condition of the A11 high-dose group, the TGF-beta 1 expression amount is only (23 61+/-1.96)% relative to the blank control group. This also demonstrates that the a11 mab of the present application is capable of directly modulating the expression of TGF- β1 downstream thereof by inhibiting the activity of endoglin. The positive control had less effect on the expression level of TGF-. Beta.1.
EXAMPLE 5 paclitaxel albumin nanoparticle preparation
10mg of paclitaxel is dissolved in 2ml of acetone, a certain amount of human serum albumin is taken and dissolved in 15ml of water, the medicine carrying ratio (medicine/albumin molar ratio) is set to be 8:1 and 10:1, the paclitaxel acetone solution is dropwise added into the albumin aqueous solution under the stirring condition, the stirring is continued for 6min, the acetone is removed by rotary evaporation, the water is added to fix the volume to 20ml, the paclitaxel albumin nanoparticle (or called albumin paclitaxel nanoparticle) solution is obtained after high-pressure homogenization, the particle size is measured by adopting a particle size meter, and the result is shown in table 2.
TABLE 2 particle size of paclitaxel albumin nanoparticles with different drug loading ratios
Medicine-carrying ratio | Particle size nm |
8:1 | 156.4±1.6 |
10:1 | 164.8±2.0 |
From the results of the measured particle sizes, the particle sizes of the paclitaxel/albumin nanoparticles with different drug loading ratios are different.
Taking paclitaxel albumin nanoparticle with the molar ratio of 10:1, placing the paclitaxel albumin nanoparticle in a refrigerator at the temperature of 4 ℃ for a week in a dark place, measuring the particle size by a Markov particle analyzer to determine the stability, freeze-drying 2mL of nanoparticle solution, re-dissolving the nanoparticle solution in 1mL of organic solvent (methanol), swirling for 1min to denature and precipitate the protein, centrifuging at 10000rpm for 10min to discard the protein precipitate, properly diluting the supernatant with methanol, measuring the ultraviolet absorbance at the wavelength of 227nm to obtain the drug concentration, and calculating the drug loading DL (%) = (W1/W2) 100% according to the following formula, wherein W1 is the drug mass in the freeze-dried nanoparticle, and W2 is the total mass of the freeze-dried nanoparticle. The results show that the particle size of the particles which are placed for one week is hardly changed, the particles are uniformly distributed, and the stability is good. The drug loading of paclitaxel in the prepared nano-particles is 10.59%.
EXAMPLE 6 Albumin paclitaxel in combination with monoclonal antibody treatment experiments
Inoculating HCT116 cell strain of colorectal cancer cell line into sterile culture flask, adding into 100×10 strain containing 10% calf serum 3 U/L penicillin, 100X 10 3 In RPMI1640 medium of U/L streptomycin, the temperature is constant at 37 ℃ and CO is 5% 2 And culturing in a saturated humidity incubator, wherein the cells grow in a single-layer adherence manner, and are passaged for 1 time every 3-4 d, and are digested for 3min by 0.02% EDTA (ethylene diamine tetraacetic acid), and are blown into a cell suspension by a culture solution, and inoculated according to the required concentration. Building a tumor-bearing animal model: HCT116 cells were inoculated subcutaneously in the right proximal axilla of BALB/C nude mice at an inoculum size of 0.2ml cell suspension with a total cell count of 2X 10 7 And each. Experimental grouping and processing: mice were randomly divided into 2 groups of 10 animals each, male and female halves.
(1) A11 antibody group: while inoculating HCT116 cells, injecting endoglin monoclonal antibody A11 μg,0.2ml by intraperitoneal injection, and boosting 1 time per week;
(2) Physiological saline group: while inoculating HCT116 cells, injecting physiological saline into the abdominal cavity, wherein the physiological saline is 0.2ml, and the physiological saline is strengthened 1 time per week;
(3) Albumin paclitaxel group: while inoculating HCT116 cells, 100 μg,0.2ml of paclitaxel albumin nanoparticle prepared in example 5 was injected intraperitoneally, 1 time a week;
(4) Albumin paclitaxel in combination with a11 mab treatment group: while inoculating HCT116 cells, 100 μg,0.1ml of paclitaxel albumin nanoparticle prepared in example 5 was injected intraperitoneally; antibody A11 μg,0.2ml was injected 1 week after 2h intervals;
(5) Positive control group: while the HCT116 cells were seeded, LY364947 100 μg,0.2ml, 1-week booster was injected intraperitoneally;
after 3 weeks of treatment, the size of the subcutaneous tumor was measured using vernier calipers. The tumor volume calculation method comprises the steps of measuring the maximum front and rear diameter (a), the left and right diameter (b) and the upper and lower diameter (c 1 times, three diameters are perpendicular to each other and record volume change by using a vernier caliper, wherein the tumor volume calculation method comprises the step of calculating the tumor volume (mln) of the mice by a multiplied by c multiplied by pi/6, and the tumor inhibition rate is equal to the average tumor volume of a physiological saline control group, the average tumor volume of a treatment group, and the average tumor volume of the physiological saline control group multiplied by 100%.
From the experimental results of fig. 4, it is shown that the a11 antibody group, the albumin-paclitaxel group, the positive control group, and the albumin-paclitaxel combined mab group significantly inhibit the growth of tumors compared with the physiological saline group, and the difference is significant (P < 0.05). From the results of fig. 4, it can also be seen that the albumin paclitaxel combined with the a11 monoclonal antibody has a synergistic better promoting therapeutic effect, and the tumor inhibition rate reaches (93.6±2.03%).
While the application has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses or adaptations of the application following, in general, the principles of the application and including such departures from the present disclosure as come within known or customary practice within the art to which the application pertains and as may be applied to the essential features hereinbefore set forth. Such modifications and variations are intended to fall within the scope of this disclosure and/or the appended claims. It is to be understood that the present disclosure is not limited to particular methods or compositions, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting of the application.
Claims (6)
1. A monoclonal antibody a11 directed against endoglin, characterized by the amino acid sequence of the light chain variable region being:
DLVMTQTAPSVPVTPGESVSISCRSTDTRYTSMKKDCLYWFLQRPGQSPQLLIYSCVNLASGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCIKILPYMCQFGSGTKLEIK
the amino acid sequence of the heavy chain variable region is:
VKPGGSLKLSCAASGERMQRNFMSWVRQTPDKRLEWVAIPACKQCMCYYPDSVKGRFTISRDQDKQTLYLQMSSLKSEDTAMYYCVGTTGNGWFQRWGQGTTVTVS。
2. use of the monoclonal antibody a11 of endoglin according to claim 1 for the preparation of a pharmaceutical composition for the treatment of colorectal cancer.
3. The use according to claim 2, wherein the pharmaceutical composition further comprises a pharmaceutically acceptable carrier.
4. Use of the monoclonal antibody a11 of endoglin and human serum albumin loaded with paclitaxel according to claim 1 for the preparation of a pharmaceutical composition for the treatment of colorectal cancer.
5. The use according to claim 4, wherein the pharmaceutical composition further comprises a pharmaceutically acceptable carrier.
6. The method according to claim 4, wherein the paclitaxel-loaded human serum albumin is prepared by dissolving paclitaxel in acetone, adding paclitaxel acetone solution dropwise into albumin aqueous solution under stirring according to a drug loading ratio of 10:1, stirring for 6min, removing acetone by rotary evaporation, and homogenizing under high pressure.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202210985801.2A CN115991773B (en) | 2022-08-15 | 2022-08-15 | Pharmaceutical composition containing human serum albumin |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202210985801.2A CN115991773B (en) | 2022-08-15 | 2022-08-15 | Pharmaceutical composition containing human serum albumin |
Publications (2)
Publication Number | Publication Date |
---|---|
CN115991773A CN115991773A (en) | 2023-04-21 |
CN115991773B true CN115991773B (en) | 2023-11-17 |
Family
ID=85989383
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202210985801.2A Active CN115991773B (en) | 2022-08-15 | 2022-08-15 | Pharmaceutical composition containing human serum albumin |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN115991773B (en) |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5928641A (en) * | 1996-05-31 | 1999-07-27 | Health Research Inc. | Anti-endoglin monoclonal antibodies and their use in antiangiogenic therapy |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN102711809B (en) * | 2009-08-17 | 2015-09-30 | 特雷康制药公司 | Use anti-endoglin antibody and anti-VEGF agent therapeutic alliance cancer |
-
2022
- 2022-08-15 CN CN202210985801.2A patent/CN115991773B/en active Active
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5928641A (en) * | 1996-05-31 | 1999-07-27 | Health Research Inc. | Anti-endoglin monoclonal antibodies and their use in antiangiogenic therapy |
Non-Patent Citations (2)
Title |
---|
Endoglin-Targeted Cancer Therapy;Seon, BK等;《CURRENT DRUG DELIVERY》;第8卷(第1期);第135-143页 * |
抗人CD105鼠单克隆抗体、紫杉醇高分子聚合体制备及其体外抗肿瘤作用的研究;赵俪梅;《中国优秀硕士学位论文全文数据库 医药卫生科技辑》(2014年第01期);正文第10-28页第二章 * |
Also Published As
Publication number | Publication date |
---|---|
CN115991773A (en) | 2023-04-21 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
JP7404306B2 (en) | Novel peptides and peptide combinations for use in immunotherapy against ovarian and other cancers | |
US11912749B2 (en) | Peptides and combination of peptides for use in immunotherapy against ovarian cancer and other cancers | |
JP7342701B2 (en) | Pharmaceutical composition for cancer treatment and/or prevention | |
JP5909767B2 (en) | FOXM1 peptide and drug containing the same | |
BR122020014377A2 (en) | peptide, antibody, t cell receptor, in vitro method for the production of activated t lymphocytes, pharmaceutical composition, production method, use and kit | |
WO2019230645A1 (en) | Treatment of her2-mutated cancer by administering anti-her2 antibody-drug conjugate | |
BR112021005246A2 (en) | therapeutic agent, and, method of treatment for cancer | |
US9040047B2 (en) | Combinations of anti ErbB antibodies for the treatment of cancer | |
CN112912403A (en) | Method for treating tumors | |
US20220396615A1 (en) | Anti-human il6 monoclonal antibodies, preparation method therefor and use thereof | |
WO2020022898A2 (en) | Off-the-shelf cancer vaccines | |
EP3703734A1 (en) | Immunotherapeutic methods for treating and/or preventing lung cancer | |
CN115991773B (en) | Pharmaceutical composition containing human serum albumin | |
CN116063496B (en) | Application of drug-loaded human serum albumin combined monoclonal antibody in preparation of pharmaceutical composition | |
CN110760582A (en) | Application of metformin in treatment of KRAS mutant colorectal cancer | |
CN107488231B (en) | anti-CD 56 antibodies and uses thereof | |
JP2022517087A (en) | Combination with TIM-3 antibody and other checkpoint inhibitors for the treatment of cancer | |
CN110760581A (en) | Application of MATE1 gene in treatment of colorectal cancer | |
WO2022102695A1 (en) | Treatment for mesothelioma through administration of anti-b7-h3 antibody-drug conjugate | |
US20230070988A1 (en) | Combinations of egfr inhibitors and ror1 inhibitors for the treatment of cancer | |
Pirozzi et al. | Tumor-Specific Mutations in Gliomas and Their Implications for Immunotherapy | |
WO2020188836A1 (en) | Anti-podoplanin antibody | |
JP2023549342A (en) | Neoantigen selection for personalized cancer vaccines | |
JP2020524180A (en) | Biomarkers for predicting tumor response to immunotherapy and its toxicity |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
TA01 | Transfer of patent application right | ||
TA01 | Transfer of patent application right |
Effective date of registration: 20231025 Address after: 430000, No. 666 Gaoxin Avenue, Jiufeng Street, Donghu New Technology Development Zone, Wuhan City, Hubei Province, China. Optics Valley Biotech City C4-1003 Applicant after: Yingling (Wuhan) Biotechnology Co.,Ltd. Address before: Room 2151, Building 2, East Ring Road, Yanqingyuan, Zhongguancun, Yanqing District, Beijing 100000 Applicant before: Beijing Renli Jinghe Biotechnology Co.,Ltd. |
|
GR01 | Patent grant | ||
GR01 | Patent grant |