CN111094357A - Novel Bcl10 polymerization inhibitor and application thereof - Google Patents
Novel Bcl10 polymerization inhibitor and application thereof Download PDFInfo
- Publication number
- CN111094357A CN111094357A CN201980004308.4A CN201980004308A CN111094357A CN 111094357 A CN111094357 A CN 111094357A CN 201980004308 A CN201980004308 A CN 201980004308A CN 111094357 A CN111094357 A CN 111094357A
- Authority
- CN
- China
- Prior art keywords
- bcl10
- polypeptide
- peptide
- pharmaceutically acceptable
- acceptable salt
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 102000046016 B-Cell CLL-Lymphoma 10 Human genes 0.000 title claims abstract description 99
- 108700024832 B-Cell CLL-Lymphoma 10 Proteins 0.000 title claims abstract description 92
- 101150074953 BCL10 gene Proteins 0.000 title claims abstract description 74
- 238000006116 polymerization reaction Methods 0.000 title claims abstract description 33
- 239000003112 inhibitor Substances 0.000 title abstract description 41
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 179
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 113
- 229920001184 polypeptide Polymers 0.000 claims abstract description 104
- 206010012818 diffuse large B-cell lymphoma Diseases 0.000 claims abstract description 82
- 230000002401 inhibitory effect Effects 0.000 claims abstract description 48
- 230000000694 effects Effects 0.000 claims abstract description 42
- 230000012010 growth Effects 0.000 claims abstract description 30
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 15
- 238000002360 preparation method Methods 0.000 claims abstract description 3
- 210000004027 cell Anatomy 0.000 claims description 43
- 150000001875 compounds Chemical class 0.000 claims description 38
- 208000031671 Large B-Cell Diffuse Lymphoma Diseases 0.000 claims description 33
- 150000003839 salts Chemical class 0.000 claims description 29
- 238000000034 method Methods 0.000 claims description 28
- 150000001413 amino acids Chemical class 0.000 claims description 24
- 238000012360 testing method Methods 0.000 claims description 19
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 17
- 239000000203 mixture Substances 0.000 claims description 17
- 230000014509 gene expression Effects 0.000 claims description 15
- 201000010099 disease Diseases 0.000 claims description 12
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 12
- 239000003814 drug Substances 0.000 claims description 12
- 230000004048 modification Effects 0.000 claims description 12
- 238000012986 modification Methods 0.000 claims description 12
- 230000005764 inhibitory process Effects 0.000 claims description 11
- 210000004881 tumor cell Anatomy 0.000 claims description 9
- 230000034190 positive regulation of NF-kappaB transcription factor activity Effects 0.000 claims description 8
- 102000020313 Cell-Penetrating Peptides Human genes 0.000 claims description 7
- 108010051109 Cell-Penetrating Peptides Proteins 0.000 claims description 7
- 239000003937 drug carrier Substances 0.000 claims description 7
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 7
- 238000002560 therapeutic procedure Methods 0.000 claims description 6
- 210000004899 c-terminal region Anatomy 0.000 claims description 4
- 238000012258 culturing Methods 0.000 claims description 4
- IPCSVZSSVZVIGE-UHFFFAOYSA-N hexadecanoic acid Chemical compound CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 claims description 4
- 238000002156 mixing Methods 0.000 claims description 4
- 150000007523 nucleic acids Chemical class 0.000 claims description 4
- 238000012216 screening Methods 0.000 claims description 4
- 238000000338 in vitro Methods 0.000 claims description 3
- 102000039446 nucleic acids Human genes 0.000 claims description 3
- 108020004707 nucleic acids Proteins 0.000 claims description 3
- SNDPXSYFESPGGJ-UHFFFAOYSA-N 2-aminopentanoic acid Chemical compound CCCC(N)C(O)=O SNDPXSYFESPGGJ-UHFFFAOYSA-N 0.000 claims description 2
- 235000021314 Palmitic acid Nutrition 0.000 claims description 2
- 102000007079 Peptide Fragments Human genes 0.000 claims description 2
- 108010033276 Peptide Fragments Proteins 0.000 claims description 2
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 claims description 2
- 125000001584 benzyloxycarbonyl group Chemical group C(=O)(OCC1=CC=CC=C1)* 0.000 claims description 2
- WQEPLUUGTLDZJY-UHFFFAOYSA-N n-Pentadecanoic acid Natural products CCCCCCCCCCCCCCC(O)=O WQEPLUUGTLDZJY-UHFFFAOYSA-N 0.000 claims description 2
- UYWQUFXKFGHYNT-UHFFFAOYSA-N phenylmethyl ester of formic acid Natural products O=COCC1=CC=CC=C1 UYWQUFXKFGHYNT-UHFFFAOYSA-N 0.000 claims description 2
- 238000011191 terminal modification Methods 0.000 claims 1
- 108010057466 NF-kappa B Proteins 0.000 abstract description 13
- 102000003945 NF-kappa B Human genes 0.000 abstract description 13
- 230000004913 activation Effects 0.000 abstract description 12
- 208000003950 B-cell lymphoma Diseases 0.000 abstract description 5
- 230000009266 disease activity Effects 0.000 abstract description 4
- 230000001404 mediated effect Effects 0.000 abstract description 4
- 208000008884 Aneurysmal Bone Cysts Diseases 0.000 description 48
- 150000003384 small molecules Chemical class 0.000 description 34
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 24
- 108090000623 proteins and genes Proteins 0.000 description 20
- 102000004169 proteins and genes Human genes 0.000 description 17
- 206010028980 Neoplasm Diseases 0.000 description 15
- 230000015572 biosynthetic process Effects 0.000 description 13
- 239000011347 resin Substances 0.000 description 13
- 229920005989 resin Polymers 0.000 description 13
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 12
- 102000057613 Mucosa-Associated Lymphoid Tissue Lymphoma Translocation 1 Human genes 0.000 description 10
- 108700026676 Mucosa-Associated Lymphoid Tissue Lymphoma Translocation 1 Proteins 0.000 description 10
- 241000699670 Mus sp. Species 0.000 description 10
- 201000004681 Psoriasis Diseases 0.000 description 10
- 239000007788 liquid Substances 0.000 description 10
- 238000003786 synthesis reaction Methods 0.000 description 9
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 8
- 238000010532 solid phase synthesis reaction Methods 0.000 description 8
- 230000001225 therapeutic effect Effects 0.000 description 8
- 101710109862 B-cell lymphoma/leukemia 10 Proteins 0.000 description 7
- 101150113681 MALT1 gene Proteins 0.000 description 7
- 125000000539 amino acid group Chemical group 0.000 description 7
- 210000003719 b-lymphocyte Anatomy 0.000 description 7
- 239000013598 vector Substances 0.000 description 7
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 6
- 208000023275 Autoimmune disease Diseases 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 241000699666 Mus <mouse, genus> Species 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 229940079593 drug Drugs 0.000 description 6
- -1 for example Polymers 0.000 description 6
- 239000012634 fragment Substances 0.000 description 6
- 229960002751 imiquimod Drugs 0.000 description 6
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 6
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 6
- 102000040430 polynucleotide Human genes 0.000 description 6
- 108091033319 polynucleotide Proteins 0.000 description 6
- 239000002157 polynucleotide Substances 0.000 description 6
- 206010006187 Breast cancer Diseases 0.000 description 5
- 208000026310 Breast neoplasm Diseases 0.000 description 5
- 108091026890 Coding region Proteins 0.000 description 5
- 206010009944 Colon cancer Diseases 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 210000002615 epidermis Anatomy 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 230000009036 growth inhibition Effects 0.000 description 5
- 238000004128 high performance liquid chromatography Methods 0.000 description 5
- 230000019491 signal transduction Effects 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- 210000001519 tissue Anatomy 0.000 description 5
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 4
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 208000004736 B-Cell Leukemia Diseases 0.000 description 4
- 101100016516 Caenorhabditis elegans hbl-1 gene Proteins 0.000 description 4
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 4
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 4
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 4
- XFAZZQREFHAALG-UHFFFAOYSA-N N-{1-amino-6-[(5-nitro-2-furoyl)amino]-1-oxohexan-2-yl}-23-(indol-3-yl)-20-oxo-4,7,10,13,16-pentaoxa-19-azatricosan-1-amide Chemical compound C=1NC2=CC=CC=C2C=1CCCC(=O)NCCOCCOCCOCCOCCOCCC(=O)NC(C(=O)N)CCCCNC(=O)C1=CC=C([N+]([O-])=O)O1 XFAZZQREFHAALG-UHFFFAOYSA-N 0.000 description 4
- 208000000389 T-cell leukemia Diseases 0.000 description 4
- 208000028530 T-cell lymphoblastic leukemia/lymphoma Diseases 0.000 description 4
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 4
- 201000011510 cancer Diseases 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 239000002552 dosage form Substances 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 239000000835 fiber Substances 0.000 description 4
- 201000001441 melanoma Diseases 0.000 description 4
- 230000035772 mutation Effects 0.000 description 4
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 125000003729 nucleotide group Chemical group 0.000 description 4
- 229920002401 polyacrylamide Polymers 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 125000006239 protecting group Chemical group 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 230000004083 survival effect Effects 0.000 description 4
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- WFDIJRYMOXRFFG-UHFFFAOYSA-N Acetic anhydride Chemical compound CC(=O)OC(C)=O WFDIJRYMOXRFFG-UHFFFAOYSA-N 0.000 description 3
- 238000011725 BALB/c mouse Methods 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 3
- 239000003875 Wang resin Substances 0.000 description 3
- NERFNHBZJXXFGY-UHFFFAOYSA-N [4-[(4-methylphenyl)methoxy]phenyl]methanol Chemical group C1=CC(C)=CC=C1COC1=CC=C(CO)C=C1 NERFNHBZJXXFGY-UHFFFAOYSA-N 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 238000010168 coupling process Methods 0.000 description 3
- 239000012043 crude product Substances 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 239000006196 drop Substances 0.000 description 3
- 238000004108 freeze drying Methods 0.000 description 3
- 238000001641 gel filtration chromatography Methods 0.000 description 3
- 230000013595 glycosylation Effects 0.000 description 3
- 238000006206 glycosylation reaction Methods 0.000 description 3
- 239000004310 lactic acid Substances 0.000 description 3
- 235000014655 lactic acid Nutrition 0.000 description 3
- 230000036210 malignancy Effects 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 108091005601 modified peptides Proteins 0.000 description 3
- IWDCLRJOBJJRNH-UHFFFAOYSA-N p-cresol Chemical compound CC1=CC=C(O)C=C1 IWDCLRJOBJJRNH-UHFFFAOYSA-N 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 238000013268 sustained release Methods 0.000 description 3
- 239000012730 sustained-release form Substances 0.000 description 3
- 231100000331 toxic Toxicity 0.000 description 3
- 230000002588 toxic effect Effects 0.000 description 3
- 102000001714 Agammaglobulinaemia Tyrosine Kinase Human genes 0.000 description 2
- 108010029445 Agammaglobulinaemia Tyrosine Kinase Proteins 0.000 description 2
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 108091033380 Coding strand Proteins 0.000 description 2
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 2
- QOSSAOTZNIDXMA-UHFFFAOYSA-N Dicylcohexylcarbodiimide Chemical compound C1CCCCC1N=C=NC1CCCCC1 QOSSAOTZNIDXMA-UHFFFAOYSA-N 0.000 description 2
- 206010059866 Drug resistance Diseases 0.000 description 2
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 206010025323 Lymphomas Diseases 0.000 description 2
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- 239000004793 Polystyrene Substances 0.000 description 2
- 241000288906 Primates Species 0.000 description 2
- 102000015766 Protein Kinase C beta Human genes 0.000 description 2
- 108010024526 Protein Kinase C beta Proteins 0.000 description 2
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 2
- LCTONWCANYUPML-UHFFFAOYSA-N Pyruvic acid Chemical compound CC(=O)C(O)=O LCTONWCANYUPML-UHFFFAOYSA-N 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- 239000012505 Superdex™ Substances 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- COQLPRJCUIATTQ-UHFFFAOYSA-N Uranyl acetate Chemical compound O.O.O=[U]=O.CC(O)=O.CC(O)=O COQLPRJCUIATTQ-UHFFFAOYSA-N 0.000 description 2
- 230000021736 acetylation Effects 0.000 description 2
- 238000006640 acetylation reaction Methods 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 238000007605 air drying Methods 0.000 description 2
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 2
- 239000002585 base Substances 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000007795 chemical reaction product Substances 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 229920001577 copolymer Polymers 0.000 description 2
- 229910052802 copper Inorganic materials 0.000 description 2
- 239000010949 copper Substances 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- 239000013613 expression plasmid Substances 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- 239000000706 filtrate Substances 0.000 description 2
- 238000002523 gelfiltration Methods 0.000 description 2
- 210000001102 germinal center b cell Anatomy 0.000 description 2
- 239000008187 granular material Substances 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- SUMDYPCJJOFFON-UHFFFAOYSA-N isethionic acid Chemical compound OCCS(O)(=O)=O SUMDYPCJJOFFON-UHFFFAOYSA-N 0.000 description 2
- 230000002147 killing effect Effects 0.000 description 2
- 239000007791 liquid phase Substances 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 239000002808 molecular sieve Substances 0.000 description 2
- 238000006386 neutralization reaction Methods 0.000 description 2
- FEMOMIGRRWSMCU-UHFFFAOYSA-N ninhydrin Chemical compound C1=CC=C2C(=O)C(O)(O)C(=O)C2=C1 FEMOMIGRRWSMCU-UHFFFAOYSA-N 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 229940049954 penicillin Drugs 0.000 description 2
- 230000002085 persistent effect Effects 0.000 description 2
- 239000006187 pill Substances 0.000 description 2
- 229920002223 polystyrene Polymers 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 239000011541 reaction mixture Substances 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- URGAHOPLAPQHLN-UHFFFAOYSA-N sodium aluminosilicate Chemical compound [Na+].[Al+3].[O-][Si]([O-])=O.[O-][Si]([O-])=O URGAHOPLAPQHLN-UHFFFAOYSA-N 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 239000000080 wetting agent Substances 0.000 description 2
- AUXMWYRZQPIXCC-KNIFDHDWSA-N (2s)-2-amino-4-methylpentanoic acid;(2s)-2-aminopropanoic acid Chemical compound C[C@H](N)C(O)=O.CC(C)C[C@H](N)C(O)=O AUXMWYRZQPIXCC-KNIFDHDWSA-N 0.000 description 1
- DHBXNPKRAUYBTH-UHFFFAOYSA-N 1,1-ethanedithiol Chemical compound CC(S)S DHBXNPKRAUYBTH-UHFFFAOYSA-N 0.000 description 1
- ASOKPJOREAFHNY-UHFFFAOYSA-N 1-Hydroxybenzotriazole Chemical compound C1=CC=C2N(O)N=NC2=C1 ASOKPJOREAFHNY-UHFFFAOYSA-N 0.000 description 1
- VOYUYEUKNWTUJN-UHFFFAOYSA-N 2,3,4-trichloro-1h-pyrrole Chemical compound ClC1=CNC(Cl)=C1Cl VOYUYEUKNWTUJN-UHFFFAOYSA-N 0.000 description 1
- WFIYPADYPQQLNN-UHFFFAOYSA-N 2-[2-(4-bromopyrazol-1-yl)ethyl]isoindole-1,3-dione Chemical compound C1=C(Br)C=NN1CCN1C(=O)C2=CC=CC=C2C1=O WFIYPADYPQQLNN-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- SSSRLHJWMBEUAF-UHFFFAOYSA-N 2-[4-(hydroxymethyl)phenyl]acetamide Chemical compound NC(=O)CC1=CC=C(CO)C=C1 SSSRLHJWMBEUAF-UHFFFAOYSA-N 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- FAWLNURBQMTKEB-URDPEVQOSA-N 213546-53-3 Chemical compound N([C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N1[C@@H](CCC1)C(O)=O)C(C)C)C(C)C)C(=O)[C@@H]1CCCN1C(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)N)C(C)C FAWLNURBQMTKEB-URDPEVQOSA-N 0.000 description 1
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 1
- WQVFQXXBNHHPLX-ZKWXMUAHSA-N Ala-Ala-His Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1cnc[nH]1)C(O)=O WQVFQXXBNHHPLX-ZKWXMUAHSA-N 0.000 description 1
- YYSWCHMLFJLLBJ-ZLUOBGJFSA-N Ala-Ala-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YYSWCHMLFJLLBJ-ZLUOBGJFSA-N 0.000 description 1
- 108700031308 Antennapedia Homeodomain Proteins 0.000 description 1
- 101150019028 Antp gene Proteins 0.000 description 1
- PTVGLOCPAVYPFG-CIUDSAMLSA-N Arg-Gln-Asp Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O PTVGLOCPAVYPFG-CIUDSAMLSA-N 0.000 description 1
- PTNFNTOBUDWHNZ-GUBZILKMSA-N Asn-Arg-Met Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(O)=O PTNFNTOBUDWHNZ-GUBZILKMSA-N 0.000 description 1
- LJUOLNXOWSWGKF-ACZMJKKPSA-N Asn-Asn-Glu Chemical compound C(CC(=O)O)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)N)N LJUOLNXOWSWGKF-ACZMJKKPSA-N 0.000 description 1
- KHCNTVRVAYCPQE-CIUDSAMLSA-N Asn-Lys-Asn Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O KHCNTVRVAYCPQE-CIUDSAMLSA-N 0.000 description 1
- FRYULLIZUDQONW-IMJSIDKUSA-N Asp-Asp Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(O)=O FRYULLIZUDQONW-IMJSIDKUSA-N 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 102100027205 B-cell antigen receptor complex-associated protein alpha chain Human genes 0.000 description 1
- 102100027203 B-cell antigen receptor complex-associated protein beta chain Human genes 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 102000001189 Cyclic Peptides Human genes 0.000 description 1
- 108010069514 Cyclic Peptides Proteins 0.000 description 1
- 150000008574 D-amino acids Chemical class 0.000 description 1
- 108010086291 Deubiquitinating Enzyme CYLD Proteins 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- KRHYYFGTRYWZRS-UHFFFAOYSA-N Fluorane Chemical compound F KRHYYFGTRYWZRS-UHFFFAOYSA-N 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- NUSWUSKZRCGFEX-FXQIFTODSA-N Glu-Glu-Cys Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CS)C(O)=O NUSWUSKZRCGFEX-FXQIFTODSA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102100025210 Histone-arginine methyltransferase CARM1 Human genes 0.000 description 1
- 101000914489 Homo sapiens B-cell antigen receptor complex-associated protein alpha chain Proteins 0.000 description 1
- 101000914491 Homo sapiens B-cell antigen receptor complex-associated protein beta chain Proteins 0.000 description 1
- IOVUXUSIGXCREV-DKIMLUQUSA-N Ile-Leu-Phe Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 IOVUXUSIGXCREV-DKIMLUQUSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 150000008575 L-amino acids Chemical class 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 102100025129 Mastermind-like protein 1 Human genes 0.000 description 1
- 101710165470 Mastermind-like protein 1 Proteins 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- BZQFBWGGLXLEPQ-UHFFFAOYSA-N O-phosphoryl-L-serine Natural products OC(=O)C(N)COP(O)(O)=O BZQFBWGGLXLEPQ-UHFFFAOYSA-N 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- WEMYTDDMDBLPMI-DKIMLUQUSA-N Phe-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)N WEMYTDDMDBLPMI-DKIMLUQUSA-N 0.000 description 1
- YTILBRIUASDGBL-BZSNNMDCSA-N Phe-Leu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=CC=C1 YTILBRIUASDGBL-BZSNNMDCSA-N 0.000 description 1
- KIQUCMUULDXTAZ-HJOGWXRNSA-N Phe-Tyr-Tyr Chemical compound N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(O)=O KIQUCMUULDXTAZ-HJOGWXRNSA-N 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 108010076181 Proinsulin Proteins 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-N Propanedioic acid Natural products OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 239000012979 RPMI medium Substances 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- QMCDMHWAKMUGJE-IHRRRGAJSA-N Ser-Phe-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(O)=O QMCDMHWAKMUGJE-IHRRRGAJSA-N 0.000 description 1
- FZXOPYUEQGDGMS-ACZMJKKPSA-N Ser-Ser-Gln Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(O)=O FZXOPYUEQGDGMS-ACZMJKKPSA-N 0.000 description 1
- DKGRNFUXVTYRAS-UBHSHLNASA-N Ser-Ser-Trp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O DKGRNFUXVTYRAS-UBHSHLNASA-N 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Natural products OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- COYHRQWNJDJCNA-NUJDXYNKSA-N Thr-Thr-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O COYHRQWNJDJCNA-NUJDXYNKSA-N 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- ARJASMXQBRNAGI-YESZJQIVSA-N Tyr-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)N ARJASMXQBRNAGI-YESZJQIVSA-N 0.000 description 1
- 102100024250 Ubiquitin carboxyl-terminal hydrolase CYLD Human genes 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 238000005377 adsorption chromatography Methods 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 150000001342 alkaline earth metals Chemical class 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 108010040443 aspartyl-aspartic acid Proteins 0.000 description 1
- 208000006673 asthma Diseases 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- SRSXLGNVWSONIS-UHFFFAOYSA-N benzenesulfonic acid Chemical compound OS(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-N 0.000 description 1
- 125000005605 benzo group Chemical group 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 229920002988 biodegradable polymer Polymers 0.000 description 1
- 239000004621 biodegradable polymer Substances 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 230000005587 bubbling Effects 0.000 description 1
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 150000004657 carbamic acid derivatives Chemical class 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 230000021523 carboxylation Effects 0.000 description 1
- 238000006473 carboxylation reaction Methods 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 238000000006 cell growth inhibition assay Methods 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 210000003855 cell nucleus Anatomy 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 238000012054 celltiter-glo Methods 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 235000015165 citric acid Nutrition 0.000 description 1
- 238000004140 cleaning Methods 0.000 description 1
- 108010030886 coactivator-associated arginine methyltransferase 1 Proteins 0.000 description 1
- 201000003970 colon lymphoma Diseases 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 239000007822 coupling agent Substances 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 238000010511 deprotection reaction Methods 0.000 description 1
- 229950006137 dexfosfoserine Drugs 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 238000004043 dyeing Methods 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- CCIVGXIOQKPBKL-UHFFFAOYSA-N ethanesulfonic acid Chemical compound CCS(O)(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-N 0.000 description 1
- DNJIEGIFACGWOD-UHFFFAOYSA-N ethyl mercaptane Natural products CCS DNJIEGIFACGWOD-UHFFFAOYSA-N 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 238000009501 film coating Methods 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000001506 fluorescence spectroscopy Methods 0.000 description 1
- 239000001530 fumaric acid Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 230000009422 growth inhibiting effect Effects 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 208000018821 hormone-resistant prostate carcinoma Diseases 0.000 description 1
- 101150003074 hoxa5 gene Proteins 0.000 description 1
- 238000007037 hydroformylation reaction Methods 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 229940045996 isethionic acid Drugs 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 238000011813 knockout mouse model Methods 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 239000012931 lyophilized formulation Substances 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- 239000011976 maleic acid Substances 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 230000017128 negative regulation of NF-kappaB transcription factor activity Effects 0.000 description 1
- 230000009826 neoplastic cell growth Effects 0.000 description 1
- 210000005036 nerve Anatomy 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 239000006186 oral dosage form Substances 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 235000006408 oxalic acid Nutrition 0.000 description 1
- KHPXUQMNIQBQEV-UHFFFAOYSA-N oxaloacetic acid Chemical compound OC(=O)CC(=O)C(O)=O KHPXUQMNIQBQEV-UHFFFAOYSA-N 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 239000006201 parenteral dosage form Substances 0.000 description 1
- CBHCDHNUZWWAPP-UHFFFAOYSA-N pecazine Chemical compound C1N(C)CCCC1CN1C2=CC=CC=C2SC2=CC=CC=C21 CBHCDHNUZWWAPP-UHFFFAOYSA-N 0.000 description 1
- 229950007538 pecazine Drugs 0.000 description 1
- 239000012466 permeate Substances 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 235000011007 phosphoric acid Nutrition 0.000 description 1
- BZQFBWGGLXLEPQ-REOHCLBHSA-N phosphoserine Chemical compound OC(=O)[C@@H](N)COP(O)(O)=O BZQFBWGGLXLEPQ-REOHCLBHSA-N 0.000 description 1
- USRGIUJOYOXOQJ-GBXIJSLDSA-N phosphothreonine Chemical compound OP(=O)(O)O[C@H](C)[C@H](N)C(O)=O USRGIUJOYOXOQJ-GBXIJSLDSA-N 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- DCWXELXMIBXGTH-UHFFFAOYSA-N phosphotyrosine Chemical compound OC(=O)C(N)CC1=CC=C(OP(O)(O)=O)C=C1 DCWXELXMIBXGTH-UHFFFAOYSA-N 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000002985 plastic film Substances 0.000 description 1
- 229920006255 plastic film Polymers 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 230000037048 polymerization activity Effects 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 239000000651 prodrug Substances 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 238000013309 psoriasis mouse model Methods 0.000 description 1
- 238000005086 pumping Methods 0.000 description 1
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 description 1
- 229940107700 pyruvic acid Drugs 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000004153 renaturation Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 102000009076 src-Family Kinases Human genes 0.000 description 1
- 108010087686 src-Family Kinases Proteins 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 239000001117 sulphuric acid Substances 0.000 description 1
- 235000011149 sulphuric acid Nutrition 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- 125000003698 tetramethyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 239000006208 topical dosage form Substances 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 238000004627 transmission electron microscopy Methods 0.000 description 1
- ZGYICYBLPGRURT-UHFFFAOYSA-N tri(propan-2-yl)silicon Chemical compound CC(C)[Si](C(C)C)C(C)C ZGYICYBLPGRURT-UHFFFAOYSA-N 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000005199 ultracentrifugation Methods 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/10—Peptides having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/02—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving viable microorganisms
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5011—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing antineoplastic activity
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Hematology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Urology & Nephrology (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Analytical Chemistry (AREA)
- Cell Biology (AREA)
- Zoology (AREA)
- Food Science & Technology (AREA)
- Wood Science & Technology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Biophysics (AREA)
- General Engineering & Computer Science (AREA)
- Pain & Pain Management (AREA)
- Gastroenterology & Hepatology (AREA)
- Epidemiology (AREA)
- Rheumatology (AREA)
- Pulmonology (AREA)
Abstract
The invention provides a novel Bcl10 polymerization inhibitor and application thereof. The Bcl10 polymerization inhibitor is a polypeptide and has (i) inhibiting Bcl10 polymerization; (ii) inhibiting the activity of the CBM complex; (iii) activity to selectively inhibit the growth of B cell lymphoma (e.g., ABC-DLBCL); and/or (iv) preventing and/or treating disease activity associated with CBM complex mediated NF-kB activation. The invention also provides a preparation method and application of the polypeptide and a pharmaceutical composition containing the polypeptide.
Description
The invention relates to the field of biological medicines, in particular to a novel Bcl10 polymerization inhibitor and application thereof.
Diffuse large B-cell lymphoma (DLBCL) is the most common non-hodgkin lymphoma, and can be divided into three subtypes according to the difference in gene expression profiles: germinal center B cell like DLBCL (GCB-DLBCL), Activated B cell type (ABC-DLBCL) and Primary mediastinal B cell type (PMBL). The ABC-DLBCL has the highest malignancy degree and has strong drug resistance to the existing immunochemistry therapy, after the classical R-CHOP treatment, the five-year survival rate of the GCB-DLBCL can reach 76 percent, and the five-year survival rate of the ABC-DLBCL is only about 30 percent.
Therefore, the search for drugs and therapeutic methods that can effectively treat ABC-DLBCL is a problem that needs to be solved clinically.
Disclosure of Invention
The invention aims to provide a medicament and a treatment method for effectively treating ABC-DLBCL.
Another objective of the invention is to provide a novel drug for inhibiting the polymerization activity of Bcl10, and also to provide application of Bcl10 inhibitors in the treatment of ABC-DLBCL and other CBM complex-mediated NF-kB dependent diseases.
In a first aspect of the invention, there is provided a polypeptide of formula I, or a pharmaceutically acceptable salt thereof,
Z0-Z1-Z2-Z3-Z4 (I)
z0 is nothing, a modification group at the N end or a peptide segment of 1-3 amino acids;
z1 is a cell penetrating peptide element;
z2 is nothing or a linker peptide;
z3 is a Bcl10 inhibitory peptide element, and the length of Z3 is 12-25aa, preferably 13-20aa, more preferably 14-18 aa;
z4 is nothing, a modification group at the C terminal or a peptide segment of 1-3 amino acids;
"-" is a peptide bond.
In another preferred embodiment, the length of the polypeptide is 30-50aa, preferably 32-40 aa.
In another preferred embodiment, the N-terminal modifying group is selected from the group consisting of: acetyl, benzyloxycarbonyl C, aminopentanoic acid, palmitic acid, or combinations thereof.
In another preferred embodiment, the cell-penetrating peptide element has a sequence as shown in SEQ ID No. 1.
In another preferred embodiment, the amino acid sequence of the cell-penetrating peptide element is shown in SEQ ID No. 1.
In another preferred embodiment, the length of the linking peptide is 0-10aa, preferably 0-6 aa.
In another preferred embodiment, said Z3 has the motif (5'-3') represented by formula a1 or the inverted amino acid motif (5'-3') represented by formula a 2:
R-X1-RA-X2-K-X3-L (A1); or
L-X3-K-X2'-AR-X1'-R (A2)
In the formula (I), the compound is shown in the specification,
x1 is a peptide segment of 4-6 amino acids; preferably X1 is HFDHL or TSSRK;
x2 is nothing, or a peptide segment of 1-2 amino acids; preferably X2 is K or G;
x3 is a peptide of 1-2 amino acids; preferably, X3 is I or L;
x1' is a peptide segment of 4-6 amino acids; preferably X1 is KRSST or LHDFH;
x2' is nothing, or a peptide fragment of 1-2 amino acids; preferably X2' is K or G.
In another preferred embodiment, said Z3 has the motif (5'-3') represented by formula a1 or the inverted D-form amino acid motif (5'-3') represented by formula a 2:
R-X1-RA-X2-K-X3-L (A1); or
L-X3-K-X2'-AR-X1'-R (A2)
In the formula (I), the compound is shown in the specification,
x1 is a peptide segment of 4-6 amino acids; preferably X1 is HFDHL or TSSRK;
x2 is nothing, or a peptide segment of 1-2 amino acids; preferably X2 is K or G;
x3 is a peptide of 1-2 amino acids; preferably, X3 is I or L;
x1' is a peptide segment of 4-6D-amino acids; preferably X1 is KRSST or LHDFH;
x2' is peptide segment without or 1-2D amino acids; preferably X2' is K or G.
In another preferred embodiment, the C-terminal modifying group is selected from the group consisting of: amidation, hydroformylation, or a combination thereof.
In another preferred embodiment, Z3 has the amino acid sequence shown in SEQ ID No. 2 or 3 or 15 or 16.
In another preferred embodiment, the amino acid sequence of Z3 is as shown in SEQ ID NO. 2 or 3 or 15 or 16.
In another preferred embodiment, the polypeptide has the sequence shown in SEQ ID No. 4 or 5 or 8 or 9 or 13 or 14.
In another preferred embodiment, the amino acid sequence of the polypeptide is as shown in SEQ ID No. 4 or 5 or 8 or 9 or 13 or 14.
In another preferred embodiment, the polypeptide is natural or synthetic.
In another preferred embodiment, the polypeptide is selected from the group consisting of:
(a) a polypeptide having an amino acid sequence shown as SEQ ID NO 4 or 5 or 8 or 9 or 13 or 14;
(b) a polypeptide derived from (a) which is formed by substituting, deleting or adding 1-5 (preferably 1-3, more preferably 1-2) amino acid residues in an amino acid sequence shown in SEQ ID NO. 4, 5, 8, 9, 13 or 14, and has the function of inhibiting the polymerization of Bcl 10.
In another preferred embodiment, the polypeptide is a polypeptide represented by SEQ ID No. 4 or 5 or 8 or 9 or 13 or 14, which is substituted or deleted by 1-3, preferably 1-2, more preferably 1 amino acid; and/or
Formed by the addition of 1 to 5, preferably 1 to 4, more preferably 1 to 3, most preferably 1 to 2 amino acids.
In another preferred embodiment, the derivative polypeptide retains ≥ 70% of the activity of the polypeptide shown in SEQ ID NO 4 or 5 or 8 or 9 or 13 or 14 in inhibiting Bcl10 polymerization.
In another preferred embodiment, the derived polypeptide has an identity of 80% or more, preferably 90% or more, to SEQ ID NO 4 or 5 or 8 or 9 or 13 or 14; more preferably not less than 95%.
The invention also provides dimeric and multimeric forms of the compounds of formula I that inhibit polymerization of Bcl10, and which have activity in inhibiting polymerization of Bcl 10.
In a second aspect, the present invention provides an isolated nucleic acid molecule encoding a polypeptide according to the first aspect of the present invention or a pharmaceutically acceptable salt thereof.
In a third aspect, the present invention provides a pharmaceutical composition comprising:
(a) a therapeutically effective amount of the polypeptide of claim 1 or a pharmaceutically acceptable salt thereof; and
(b) a pharmaceutically acceptable carrier or excipient.
In another preferred embodiment, the polypeptide retains ≥ 70%, 75%, 80%, 85%, 90%, 95%, 100%, 105%, 110%, 115%, 120%, 125%, 130%, 135%, 140%, 145%, 150%, 155%, 160%, 165%, 170%, 175%, 180%, 185%, 190%, 195%, or 200% of the activity of the polypeptide set forth in SEQ ID NO:1 in inhibiting polymerization of Bcl 10.
In another preferred embodiment, the dosage form of the composition comprises an oral dosage form, or a parenteral dosage form, such as a topical or topical dosage form.
In another preferred embodiment, the dosage form of the composition comprises a tablet, a pill, a pellet, a sustained release formulation, an emulsion, a suspension, a granule, a capsule, a powder, an oral liquid, a lyophilized formulation, a syrup, an ointment, a cream, a drop, an buccal formulation, an intravenous injection, a suppository, a spray, an aerosol, a lotion, a gargle, a patch, or an eye drop.
In another preferred embodiment, the pharmaceutical composition further comprises an additional agent that (i) inhibits polymerization of Bcl 10; (ii) inhibiting the activity of the CBM complex; (iii) selectively inhibiting the growth of diffuse large B-cell lymphoma (such as ABC-DLBCL); and/or (iv) an agent for preventing and/or treating a disease associated with NF-. kappa.B activation induced by CBM complex.
In another preferred embodiment, the other(s) inhibit Bcl10 polymerization; (ii) inhibiting the activity of the CBM complex; (iii) selectively inhibiting the growth of diffuse large B-cell lymphoma (such as ABC-DLBCL); and/or (iv) an agent for preventing and/or treating a disease associated with CBM complex-induced NF- κ B activation selected from the group consisting of: MI-2, Mepazine, or a combination thereof.
In another preferred embodiment, the polypeptide or its pharmaceutically acceptable salt is contained in the pharmaceutical composition in an amount of 0.0001-99 wt%, preferably 0.001-90 wt%, more preferably 0.01-50 wt%, based on the total weight of the composition.
In a fourth aspect, the invention provides a use of a polypeptide according to the first aspect of the invention, or a pharmaceutically acceptable salt thereof, for the manufacture of a composition or medicament for (i) inhibiting Bcl10 polymerisation; (ii) inhibiting the activity of the CBM complex; (iii) selectively inhibiting the growth of diffuse large B-cell lymphoma (such as ABC-DLBCL); and/or (iv) preventing and/or treating diseases associated with CBM complex-induced NF- κ B activation.
In another preferred embodiment, the disease associated with the CBM complex is selected from the group consisting of: autoimmune diseases, chronic inflammatory reactions, allergic diseases, NF- κ B dependent cancers, or a combination thereof.
In another preferred embodiment, the autoimmune disease is selected from the group consisting of: psoriasis, lupus erythematosus, rheumatoid arthritis, atherosclerosis, or a combination thereof.
In another preferred embodiment, the composition or medicament is also for the treatment of one or more diseases selected from the group consisting of:
asthma, breast cancer, non-small cell lung cancer, melanoma, colorectal cancer, T/B cell leukemia, or a combination thereof.
In a fifth aspect, the present invention provides a method for selectively inhibiting the growth of diffuse large B-cell lymphoma, comprising the steps of: administering to a subject in need thereof a polypeptide according to the first aspect of the invention or a pharmaceutically acceptable salt thereof.
In another preferred embodiment, the subject is a human or non-human mammal.
In another preferred embodiment, the concentration of the polypeptide or the pharmaceutically acceptable salt thereof is 10-300mM, preferably 30-160mM, more preferably 130-160 mM.
In another preferred embodiment, the non-human mammal includes a rodent (e.g., mouse, rat, rabbit), primate (e.g., monkey).
In another preferred embodiment, the method is non-therapeutic and non-diagnostic.
In another preferred embodiment, the diffuse large B-cell lymphoma cells are selected from the group consisting of: ABC-DLBCL, GCB-DLBCL, or a combination thereof.
In another preferred embodiment, the diffuse large B-cell lymphoma cells comprise ABC-DLBCL.
In a sixth aspect, the present invention provides an in vitro non-therapeutic method of inhibiting polymerization of Bcl10, comprising the steps of:
culturing a tumor cell in the presence of a polypeptide of the first aspect of the invention, or a pharmaceutically acceptable salt thereof, thereby inhibiting polymerization of Bcl10 in said tumor cell.
In another preferred embodiment, the tumor cell is selected from the group consisting of: diffuse large B cell lymphoma, breast cancer, non-small cell lung cancer, melanoma, colorectal cancer, T/B cell leukemia, or a combination thereof.
In a seventh aspect, the present invention provides a method for preventing and/or treating a disease associated with NF- κ B activation induced by CBM complex, comprising the steps of: administering to a subject in need thereof a therapeutically effective amount of a polypeptide according to the first aspect of the invention, and/or a pharmaceutical composition according to the third aspect of the invention.
In another preferred embodiment, the subject is a human or non-human mammal.
In another preferred embodiment, the non-human mammal includes a rodent (e.g., mouse, rat, rabbit), primate (e.g., monkey).
An eighth aspect of the present invention provides a method of screening a candidate compound for selective inhibition of the growth of diffuse large B-cell lymphoma, comprising the steps of:
(a) mixing the Bcl10 protein with a library of compounds, and determining binding of compounds in the library of compounds to the Bcl10 protein;
wherein, if a compound in the test compound library binds to the Bcl10 protein, it indicates that the compound that binds to the Bcl10 protein is a candidate compound.
(b) Administering the candidate compound identified in step (a) to diffuse large B-cell lymphoma cells and determining its effect on diffuse large B-cell lymphoma.
In another preferred embodiment, the method is non-diagnostic and non-therapeutic.
In another preferred embodiment, the diffuse large B-cell lymphoma cells are selected from the group consisting of: ABC-DLBCL, GCB-DLBCL, or a combination thereof.
In another preferred embodiment, the diffuse large B-cell lymphoma cells comprise ABC-DLBCL.
In a ninth aspect, the present invention provides a method of screening a candidate compound for selective inhibition of the growth of diffuse large B-cell lymphoma comprising the steps of:
(a) culturing tumor cells expressing Bcl10 protein in a test group in a culture system in the presence of a test compound for a period of time T1, and detecting the expression of the Bcl10 protein in the culture system of the test group E1;
and detecting expression of said Bcl10 protein in said culture system of a control group in a control group otherwise identical in the absence of said test compound E2;
(b) if the expression profile of the Bcl10 protein in the test group, E1, is significantly lower than the expression profile of the Bcl10 protein in the control group, E2, then it is an indication that the test compound is a candidate compound.
In another preferred embodiment, the method comprises the step (c): administering the candidate compound identified in step (b) to a mammalian model and determining its effect on the mammal.
In another preferred example, the mammal is a mammal suffering from diffuse large B-cell lymphoma.
In another preferred embodiment, the phrase "substantially less than" means E1/E2 ≦ 1/2, preferably ≦ 1/3, more preferably ≦ 1/4.
In another preferred embodiment, the method is non-diagnostic and non-therapeutic.
It is to be understood that within the scope of the present invention, the above-described features of the present invention and those specifically described below (e.g., in the examples) may be combined with each other to form new or preferred embodiments. Not to be reiterated herein, but to the extent of space.
The following drawings are included to illustrate specific embodiments of the invention and are not intended to limit the scope of the invention as defined by the claims.
FIG. 1 shows the peak shape of MBP-Bcl10 by gel filtration chromatography and the result of SDS-PAGE gel.
Figure 2 shows that 1 control small peptide and 5 Bcl10 small peptide inhibitors were designed based on a structural model of the CB complex.
FIG. 3 shows the effect of Bcl10 small molecule peptide inhibitors on the formation of Bcl10 fibrous structures.
FIG. 4 shows the effect of a Bcl10 small molecule peptide inhibitor on the growth of ABC-DLBCL cell line (HBL-1 and TMD8) and GCB-DLBCL cell line (OCL-LY 1).
FIG. 5 shows the effect of a Bcl10 small molecule peptide inhibitor modified peptide on the growth of ABC-DLBCL cell line (HBL-1 and TMD8) and GCB-DLBCL cell line (OCL-LY 1).
FIG. 6 shows the effect of Bcl10 small peptide inhibitors on the growth of ABC-DLBCL tumors in NCG mice.
Figure 7 shows the effect of Bcl10 small molecule peptide inhibitors on psoriasis models. Wherein, fig. 7A is H & E staining graph of mouse epidermal tissue sections of different Bcl10 small molecule inhibitory peptide treatment groups in an Imiquimod (IMQ) -induced psoriasis model, showing the effect of different treatment groups on mouse epidermal thickness, and fig. 7B is a statistical graph of mouse epidermal thickness of different treatment groups.
The present inventors have conducted extensive and intensive studies and have for the first time prepared a class of small polypeptides having a molecular weight of less than 5KD (e.g., only about 2.3-4.4KD) that inhibit the polymerization of Bcl 10. Specifically, the invention designs a plurality of candidate sequences, and the candidate sequences are synthesized by a solid phase method, separated and purified to obtain high-purity small peptides Bcl10-P2, Bcl10-P4 and modified forms thereof, and are identified by HPLC and MS, and then are screened in a large amount to obtain a novel peptide which has (i) the function of inhibiting Bcl10 polymerization; (ii) inhibiting the activity of the CBM complex; (iii) selectively inhibiting the growth of B cell lymphoma (e.g., ABC-DLBCL); and/or (iv) small molecule polypeptides that prevent and/or treat disease activities associated with CBM complex-induced NF- κ B activation. On this basis, the present inventors have completed the present invention.
Active polypeptide
In the present invention, the terms "polypeptide of the present invention", "Bcl 10 polymerization inhibitor" are used interchangeably and all refer to a polypeptide having (i) inhibitory activity against Bcl10 polymerization; (ii) inhibiting the activity of the CBM complex; (iii) selectively inhibiting the growth of B cell lymphoma (e.g., ABC-DLBCL); and/or (iv) a protein or polypeptide having an amino acid sequence as set forth in SEQ ID No. 4 or 5 or 8 or 9 or 13 or 14 for preventing and/or treating disease activity associated with NF- κ B activation induced by CBM complex. In addition, the term also includes compositions having an inhibitory activity (i) against Bcl10 polymerization; (ii) inhibiting the activity of the CBM complex; (iii) selectively inhibiting the growth of B cell lymphoma (e.g., ABC-DLBCL); and/or (iv) the activity of SEQ ID NO:4 or 5 or 8 or 9 or 13 or 14. These variants include (but are not limited to): deletion, insertion and/or substitution of 1 to 5 (usually 1 to 4, preferably 1 to 3, more preferably 1 to 2, most preferably 1) amino acids, and addition or deletion of one or several (usually within 5, preferably within 3, more preferably within 2) amino acids at the C-terminal and/or N-terminal. For example, in the art, substitutions with amino acids of similar or similar properties will not generally alter the function of the protein. Also, for example, the addition or deletion of one or several amino acids at the C-terminus and/or N-terminus does not generally alter the structure and function of the protein. In addition, the term also includes monomeric and multimeric forms of the polypeptides of the invention. The term also includes linear as well as non-linear polypeptides (e.g., cyclic peptides).
The invention also includes active fragments, derivatives and analogs of the polypeptides of the invention. As used herein, the terms "fragment," "derivative," and "analog" refer to a polypeptide that substantially retains (i) inhibition of Bcl10 polymerization; (ii) inhibiting the activity of the CBM complex; (iii) selectively inhibiting the growth of B cell lymphoma (e.g., ABC-DLBCL); and/or (iv) polypeptides associated with disease activity for the prevention and/or treatment of CBM complex-induced NF- κ B activation. The fragment, derivative or analogue of the polypeptide of the present invention may be (i) a polypeptide in which one or more conserved or non-conserved amino acid residues (preferably conserved amino acid residues) are substituted, or (ii) a polypeptide having a substituent group in one or more amino acid residues, or (iii) a polypeptide in which the polypeptide of the present invention is fused to another compound (such as a compound for increasing the half-life of the polypeptide, for example, polyethylene glycol), or (iv) a polypeptide in which an additional amino acid sequence is fused to the polypeptide sequence (a protein which is then fused to a leader sequence, a secretory sequence or a tag sequence such as 6 His). Such fragments, derivatives and analogs are within the purview of those skilled in the art in view of the teachings herein.
A preferred class of reactive derivatives refers to polypeptides formed by the replacement of up to 5, preferably up to 3, more preferably up to 2, most preferably 1 amino acid with an amino acid of similar or analogous nature compared to the amino acid sequence of formula I. These conservative variant polypeptides are preferably generated by amino acid substitutions according to Table 1.
TABLE 1
Initial residue(s) | Representative substitutions | Preferred substitutions |
Ala(A) | Val;Leu;Ile | Val |
Arg(R) | Lys;Gln;Asn | Lys |
Asn(N) | Gln;His;Lys;Arg | Gln |
Asp(D) | Glu | Glu |
Cys(C) | Ser | Ser |
Gln(Q) | Asn | Asn |
Glu(E) | Asp | Asp |
Gly(G) | Pro;Ala | Ala |
His(H) | Asn;Gln;Lys;Arg | Arg |
Ile(I) | Leu;Val;Met;Ala;Phe | Leu |
Leu(L) | Ile;Val;Met;Ala;Phe | Ile |
Lys(K) | Arg;Gln;Asn | Arg |
Met(M) | Leu;Phe;Ile | Leu |
Phe(F) | Leu;Val;Ile;Ala;Tyr | Leu |
Pro(P) | Ala | Ala |
Ser(S) | Thr | Thr |
Thr(T) | Ser | Ser |
Trp(W) | Tyr;Phe | Tyr |
Tyr(Y) | Trp;Phe;Thr;Ser | Phe |
Val(V) | Ile;Leu;Met;Phe;Ala | Leu |
Analogs also include analogs having residues other than the natural L-amino acid (e.g., the D-amino acid), as well as analogs having non-naturally occurring or synthetic amino acids (e.g., β, gamma-amino acids).
Modified (generally without altering primary structure) forms include: chemically derivatized forms of the polypeptide, such as acetylation or carboxylation, in vivo or in vitro. Modifications also include glycosylation, such as those resulting from glycosylation modifications in the synthesis and processing of the polypeptide or in further processing steps. Such modification may be accomplished by exposing the polypeptide to an enzyme that performs glycosylation, such as a mammalian glycosylase or deglycosylase. Modified forms also include sequences having phosphorylated amino acid residues (e.g., phosphotyrosine, phosphoserine, phosphothreonine). Also included are polypeptides modified to increase their resistance to proteolysis or to optimize solubility.
The polypeptides of the invention can also be used in the form of salts derived from pharmaceutically or physiologically acceptable acids or bases. These salts include, but are not limited to, salts formed with the following acids: hydrochloric acid, hydrobromic acid, sulphuric acid, citric acid, tartaric acid, phosphoric acid, lactic acid, pyruvic acid, acetic acid, succinic acid, oxalic acid, fumaric acid, maleic acid, oxaloacetic acid, methanesulphonic acid, ethanesulphonic acid, benzenesulphonic acid or isethionic acid. Other salts include: salts with alkali or alkaline earth metals (such as sodium, potassium, calcium or magnesium), and in the form of esters, carbamates or other conventional "prodrug" forms.
Coding sequence
The present invention also relates to polynucleotides encoding the polypeptides of the invention. A preferred coding sequence is shown in SEQ ID NO 6(Bcl10-P2) or 7(Bcl10-P4) which encodes the amino acid sequence of the polypeptide shown in SEQ ID NO 4(Bcl10-P2) or 5(Bcl 10-P4).
In a preferred embodiment, the nucleotide sequence of Bcl10-P2 is as follows:
Bcl10-P2:
5’-GACCGCCAGATAAAGATTTGGTTCCAGAATCGGCGCATGAAGTGGAAGAAGAGACATTTTGATCATCTACGTGCAAAAAAAATACTCAGTAGA-3’(SEQ ID No.:6)
in a preferred embodiment, the nucleotide sequence of Bcl10-P4 is as follows:
Bcl10-P4:
5’-GACCGCCAGATAAAGATTTGGTTCCAGAATCGGCGCATGAAGTGGAAGAAGCGAACATCAAGTAGAAAAAGGGCTGGAAAATTGTTAGACTACTTACAGGAA-3’(SEQ ID No.:7)
the polynucleotide of the present invention may be in the form of DNA or RNA. The DNA may be the coding strand or the non-coding strand. The sequence of the coding region encoding the mature polypeptide may be identical to the sequence of the coding region as shown in SEQ ID NO 6 or 7 or may be a degenerate variant. As used herein, in the case of SEQ ID NO 6 or 7, a "degenerate variant" refers herein to a nucleic acid sequence which encodes a polypeptide having the sequence shown in SEQ ID NO 4 or 5, but differs from the corresponding coding region sequence in SEQ ID NO 6 or 7.
The full-length nucleotide sequence of the polypeptide of the present invention or a fragment thereof can be obtained by PCR amplification, recombination, or artificial synthesis. At present, DNA sequences encoding the polypeptides of the present invention (or fragments or derivatives thereof) have been obtained entirely by chemical synthesis. The DNA sequence may then be introduced into various existing DNA molecules (or vectors, for example) and cells known in the art.
The invention also relates to vectors comprising the polynucleotides of the invention, and to genetically engineered host cells produced with the vectors or ZY polypeptide coding sequences of the invention.
In another aspect, the invention also includes polyclonal and monoclonal antibodies, particularly monoclonal antibodies, specific for the polypeptides of the invention.
The term "substantially identical" in the context of two nucleic acids or polypeptides, when compared and aligned for maximum correspondence, refers to two or more sequences or subsequences that have at least about 80%, e.g., at least about 85%, about 90%, about 95%, about 98%, or about 99% nucleotide or amino acid residue identity to a particular reference sequence, as determined using the following sequence comparison method and/or by visual inspection.
In the present invention, all sequences are shown in the following table.
Preparation method
The polypeptides of the invention may be recombinant polypeptides or synthetic polypeptides. The polypeptides of the invention may be chemically synthesized, or recombinant. Accordingly, the polypeptides of the present invention can be artificially synthesized by a conventional method or can be produced by a recombinant method.
A preferred method is to use liquid phase synthesis techniques or solid phase synthesis techniques, such as Boc solid phase method, Fmoc solid phase method or a combination of both. The solid phase synthesis can quickly obtain samples, and can select proper resin carriers and synthesis systems according to the sequence characteristics of target peptides. For example, the preferred solid support in the Fmoc system is Wang resin with C-terminal amino acid attached to the peptide, Wang resin is polystyrene in structure, and the arm between the Wang resin and the amino acid is 4-alkoxybenzyl alcohol; the Fmoc protecting group was removed by treatment with 25% piperidine/dimethylformamide for 20 minutes at room temperature and extended from the C-terminus to the N-terminus one by one according to the given amino acid sequence. After completion of the synthesis, the synthesized proinsulin-related peptide is cleaved from the resin with trifluoroacetic acid containing 4% p-methylphenol and the protecting groups are removed, optionally by filtration and isolated as a crude peptide by ether precipitation. After lyophilization of the resulting solution of the product, the desired peptide was purified by gel filtration and reverse phase high pressure liquid chromatography. When the solid phase synthesis is performed using the Boc system, it is preferable that the resin is a PAM resin to which a C-terminal amino acid in a peptide is attached, the PAM resin has a structure of polystyrene, and an arm between the PAM resin and the amino acid is 4-hydroxymethylphenylacetamide; in the Boc synthesis system, after the cycle of deprotection, neutralization and coupling, Boc of the protecting group is removed with TFA/Dichloromethane (DCM) and diisopropylethylamine (DIEA/dichloromethane neutralization. peptide chain condensation is completed, the peptide chain is cleaved from the resin by treatment with Hydrogen Fluoride (HF) containing p-cresol (5-10%) at 0 ℃ for 1 hour while removing the protecting group, the peptide is extracted with 50-80% acetic acid (containing a small amount of mercaptoethanol), the solution is lyophilized and then further separated and purified with molecular sieves Sephadex G10 or Tsk-40f, followed by high pressure liquid phase purification to obtain the desired peptide, various coupling agents and coupling methods known in the field of peptide chemistry can be used to couple each amino acid residue, for example, Dicyclohexylcarbodiimide (DCC), hydroxybenzotriazole (HOBt) or 1,1,3, 3-tetraurea Hexafluorophosphate (HBTU) can be used for direct coupling of the synthesized short peptide, the purity and structure of the product can be confirmed by reversed-phase high performance liquid chromatography and mass spectrometry.
In a preferred embodiment, the polypeptide of the present invention is prepared by solid phase synthesis according to its sequence, and purified by high performance liquid chromatography to obtain high purity target peptide lyophilized powder, which is stored at-20 ℃.
Another method is to produce the polypeptide of the invention by recombinant techniques. The polynucleotides of the present invention may be used to express or produce recombinant polypeptides of the present invention by conventional recombinant DNA techniques. Generally, the following steps are performed:
(1) transforming or transducing a suitable host cell with a polynucleotide (or variant) of the invention encoding a polypeptide of the invention, or with a recombinant expression vector comprising the polynucleotide;
(2) a host cell cultured in a suitable medium;
(3) isolating and purifying the protein from the culture medium or the cells.
The recombinant polypeptide may be expressed or secreted intracellularly or on the cell membrane outside the cell. If necessary, the recombinant protein can be isolated and purified by various separation methods using its physical, chemical and other properties. These methods are well known to those skilled in the art. Examples of such methods include, but are not limited to: conventional renaturation treatment, treatment with a protein precipitant (such as salt precipitation), centrifugation, cell lysis by osmosis, sonication, ultracentrifugation, molecular sieve chromatography (gel filtration), adsorption chromatography, ion exchange chromatography, High Performance Liquid Chromatography (HPLC), and other various liquid chromatography techniques, and combinations thereof.
Because the polypeptide of the invention is short, a plurality of polypeptides can be considered to be connected in series, a multimeric expression product is obtained after recombinant expression, and then the required small peptide is formed by enzyme digestion and other methods.
Pharmaceutical compositions and methods of administration
In another aspect, the present invention provides a pharmaceutical composition comprising (a) a safe and effective amount of a polypeptide of the present invention or a pharmaceutically acceptable salt thereof; and (b) a pharmaceutically acceptable carrier or excipient. The amount of the polypeptide of the present invention is usually 10. mu.g to 100 mg/dose, preferably 100. mu.g to 1000. mu.g/dose.
For the purposes of the present invention, an effective dose is about 0.01 mg/kg to 50 mg/kg, preferably 0.05 mg/kg to 10mg/kg, of the polypeptide of the invention to a subject. In addition, the polypeptides of the invention may be used alone or in combination with other therapeutic agents (e.g., formulated in the same pharmaceutical composition).
The pharmaceutical composition may further comprise a pharmaceutically acceptable carrier. The term "pharmaceutically acceptable carrier" refers to a carrier for administration of a therapeutic agent. The term refers to such pharmaceutical carriers: they do not themselves induce the production of antibodies harmful to the individual receiving the composition and are not unduly toxic after administration. Such vectors are well known to those of ordinary skill in the art. A thorough discussion of pharmaceutically acceptable excipients can be found in Remington's Pharmaceutical Sciences (Mack pub. co., n.j.1991). Such vectors include (but are not limited to): saline, buffer, glucose, water, glycerol, ethanol, adjuvants, and combinations thereof.
Pharmaceutically acceptable carriers in therapeutic compositions can comprise liquids such as water, saline, glycerol and ethanol. In addition, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances and the like may also be present in these carriers.
Generally, the therapeutic compositions can be prepared as injectables, e.g., as liquid solutions or suspensions; solid forms suitable for constitution with a solution or suspension, or liquid carrier, before injection, may also be prepared.
Once formulated, the compositions of the present invention may be administered by conventional routes including, but not limited to: intramuscular, intravenous, subcutaneous, intradermal, or topical administration. The subject to be prevented or treated may be an animal; especially a human.
When the pharmaceutical composition of the present invention is used for practical treatment, various dosage forms of the pharmaceutical composition may be used depending on the use case. Preferably, tablets, granules, capsules, pills, injections, or oral liquids are exemplified.
These pharmaceutical compositions may be formulated by mixing, dilution or dissolution according to a conventional method, and occasionally, suitable pharmaceutical additives such as excipients, disintegrants, binders, lubricants, diluents, buffers, isotonic agents (isotonicities), preservatives, wetting agents, emulsifiers, dispersants, stabilizers and solubilizing agents are added, and the formulation process may be carried out in a conventional manner according to the dosage form.
For example, the formulation may be carried out as follows: the polypeptide of the present invention or a pharmaceutically acceptable salt thereof is dissolved in sterile water (in which a surfactant is dissolved) together with a basic substance, the osmotic pressure and the pH value are adjusted to physiological conditions, and suitable pharmaceutical additives such as a preservative, a stabilizer, a buffer, an isotonizing agent, an antioxidant and a tackifier may be optionally added and then completely dissolved.
The pharmaceutical compositions of the present invention may also be administered in the form of sustained release formulations. For example, the polypeptide of the invention or a salt thereof can be incorporated into a pellet or microcapsule carried by a slow release polymer and then surgically implanted into the tissue to be treated. In addition, the polypeptide of the present invention or a salt thereof can be used by inserting an intraocular lens previously coated with a drug. As examples of the sustained-release polymer, ethylene-vinyl acetate copolymer, polyhydroxymethacrylate, polyacrylamide, polyvinylpyrrolidone, methylcellulose, lactic acid polymer, lactic acid-glycolic acid copolymer and the like can be exemplified, and biodegradable polymers such as lactic acid polymer and lactic acid-glycolic acid copolymer can be preferably exemplified.
When the pharmaceutical composition of the present invention is used for practical treatment, the dosage of the polypeptide of the present invention or a pharmaceutically acceptable salt thereof as an active ingredient can be determined reasonably according to the body weight, age, sex, and degree of symptoms of each patient to be treated.
Cell-penetrating peptide element
The cell-penetrating peptide element is a part of an antennapedia mutation gene (Antp) homology box of drosophila, can enter into cell nucleus and is combined with a promoter region of HOX-1.3 gene to promote differentiation of nerve cells.
In a preferred embodiment of the invention, the cell-penetrating peptide element has the amino acid sequence shown in SEQ ID No. 1.
Diffuse large B cell lymphoma
Diffuse large B-cell lymphoma (DLBCL) is the most common non-hodgkin lymphoma, and can be divided into three subtypes according to the difference in gene expression profiles: germinal center B cell like DLBCL (GCB-DLBCL), Activated B cell type (ABC-DLBCL) and Primary mediastinal B cell type (PMBL). The ABC-DLBCL has the highest malignancy degree and has strong drug resistance to the existing immunochemistry therapy, after the classical R-CHOP treatment, the five-year survival rate of the GCB-DLBCL can reach 76 percent, and the five-year survival rate of the ABC-DLBCL is only about 30 percent.
CBM-mediated NF-kB related diseases
In different cell types, the CBM complex plays an important role in mediating NF-. kappa.B activation, and the persistent activity of the CBM complex can lead to the persistent activation of NF-. kappa.B in various cells and the production of related diseases.
In the present invention, CBM-mediated NF-. kappa.B-related diseases include (but are not limited to): autoimmune diseases (such as psoriasis), diffuse large B-cell lymphoma, breast cancer, non-small cell lung cancer, melanoma, colorectal cancer, or T/B cell leukemia.
The main advantages of the invention include:
(a) the polypeptide and the derived polypeptide thereof have small molecular weight and can permeate a tissue barrier;
(b) the polypeptide of the invention can effectively inhibit Bcl10 polymerization, thereby inhibiting the growth of diffuse large B-cell lymphoma (especially activated B-cell type diffuse large B-cell lymphoma).
(c) The polypeptide of the invention can effectively prevent and/or treat diseases related to the CBM complex (such as autoimmune diseases, diffuse large B cell lymphoma, breast cancer, non-small cell lung cancer, melanoma, colorectal cancer, T/B cell leukemia and the like).
(d) The polypeptide of the invention has high safety and small toxic and side effects on biological tissues.
(e) The polypeptide of the invention can be prepared by a solid phase synthesis method, and has high purity, large yield and low cost.
(f) The polypeptide of the invention has good stability.
(g) The polypeptide of the invention has high specificity and good selectivity.
The invention will be further illustrated with reference to the following specific examples. It should be understood that these examples are for illustrative purposes only and are not intended to limit the scope of the present invention. Experimental procedures without specific conditions noted in the following examples, molecular cloning is generally performed according to conventional conditions such as Sambrook et al: the conditions described in the Laboratory Manual (New York: Cold Spring Harbor Laboratory Press,1989), or according to the manufacturer's recommendations.
Unless otherwise specified, all reagents and materials used in examples of the present invention are commercially available products.
Materials and methods
1.1 MBP-Bcl10 protein expression and purification
Expression plasmids of Bcl10(1-233) were constructed on a vector of pDB-His-MBP, transformed into BL21(DE3) cell line for expression, preliminarily purified by Ni-NTA (Qiagen, Valencia, CA) affinity chromatography, further purified by gel filtration chromatography Superdex 200HR 10/300(GE Healthcare, UK), collected for the protein of interest, and finally stored in a buffer containing 20mM Tris (pH 7.5),150mM NaCl, and 5mM DTT.
1.2 Bcl10 Small molecule polypeptide Synthesis
A plurality of small-molecule peptides are designed, and two of the small-molecule peptides are proved to be capable of effectively inhibiting the polymerization of Bcl10 and the formation of a fiber structure through tests. Their sequences were respectively: DRQIKIWFQNRRMKWKKRTSSRKRAGKLLDYLQE (SEQ ID No.:5) and DRQIKIWFQNRRMKWKKRHFDHLRAKKILSR (SEQ ID No.: 4).
① Synthesis sequence of small molecule peptide, from C end to N end of the sequence, the steps are as follows:
a. weighing n equivalents of resin, putting the resin into a reactor, adding DCM (dichloromethane) to swell for half an hour, then pumping out DCM, adding 2n equivalents of the first amino acid in the sequence, adding 2n equivalents of DIEA, an appropriate amount of DMF (dimethyl formamide), DCM (the appropriate amount is that the resin can be fully stirred), DIEA (diisopropylethylamine), DMF (dimethyl formamide), DCM, and nitrogen for bubbling reaction for 60 min. Then, about 5n equivalent of methanol was added thereto, and the reaction mixture was reacted for half an hour, and then the reaction mixture was taken out and washed with DMF and MEOH.
b. The second amino acid in the sequence (also 2N equivalents), 2N equivalents HBTU (1-hydroxy, benzo, trichloroazol tetramethyl hexafluorophosphate) and DIEA, N2 were bubbled through the reactor for half an hour, washed off the liquid, assayed for ninhydrin, and then capped with pyridine and acetic anhydride. And finally, washing, adding a proper amount of decapping liquid to remove the Fmoc (9-fluorenylmethyloxycarbonyl) protecting group, washing, and detecting ninhydrin.
c. And (c) adding different amino acids in the sequence in sequence according to the mode of the step b and carrying out various modifications.
d. The resin was blown dry with nitrogen, taken out of the reaction column, poured into a flask, and then a certain amount (about 10 ml/g ratio of cleavage solution to resin) of a cleavage solution (composition 95% TFA, 2% ethanedithiol, 2% triisopropylsilane, 1% water) was added to the flask, shaken, and the resin was filtered off.
e. Obtaining filtrate, then adding a large amount of ether into the filtrate to separate out a crude product, then centrifuging and cleaning to obtain the crude product of the sequence.
② polypeptide purification:
the crude product is purified to the required purity by high performance liquid chromatography.
③ lyophilization of the polypeptide:
and (4) putting the purified liquid into a freeze dryer for concentration, and freeze-drying to obtain white powder.
1.3 Transmission Electron microscopy EM experiment
Mixing the purified MBP-Bcl10 and a Bcl10 small-molecule peptide inhibitor in a ratio of 1:1 or 1:2, adding TEV enzyme, reacting at room temperature for 1 hour, dripping 5ul of a reaction product on an electron microscope copper net (BZ 10024a) containing thin-layer carbon and a plastic film coating, sucking the liquid drops after one minute, air-drying, carrying out negative dyeing by 3% uranyl acetate for one minute, sucking the liquid drops, air-drying, and observing under a JEM-1230 electron microscope in a nerve endoscope room of Shanghai institute of sciences.
1.4 cell culture
ABC-DLBCL cell lines HBL-1 and TMD8 were cultured in RPMI medium containing 10% FBS, 2mM glutamine, 10mM Hepes buffer and penicillin streptomycin. GCB-DLBCL cell line OCI-LY1 was cultured in IMEM medium containing 20% fetal bovine serum and penicillin streptomycin. All cell lines were cultured in the presence of 5% CO237 ℃ in a constant temperature humid incubator.
1.5 cell growth inhibition assay
DLBCL cell lines in the logarithmic growth phase were cultured overnight in 96-well plates containing the respective culture liquids, and each candidate compound was added to the cells the next day, and a concentration gradient was set at a dilution ratio of 3.16 times for each compound. Cell proliferation is the number of cells measured by quantitative measurement of intracellular ATP content by fluorescence spectrometry (CellTiter-Glo, Promega, Madison, Wis.). The DLBCL cell line was treated with the compound for 0 hours and 72 hours, and then the fluorescence signal was detected using a multifunctional microplate reader (SpectraMax Paradigm, Molecular Devices, USA). The calculation formula of the growth inhibition rate of the small molecule peptide inhibitor is as follows: if the fluorescence value at 72 hours (T72) is greater than the fluorescence value at 0 hours (T0), the growth inhibition rate is (T72)cpd-T0)/(T72DMSO-T0) × 100; if T72 is less than T0, the growth inhibition rate is (T72)cpd-T0)/T0 x 100. Cell growth inhibition was plotted using GraphPad Prism 5 software and the concentration of small molecule compound that inhibited 50% of cell growth was calculated. 3 duplicate wells were set for each experiment.
Example 1 expression and purification of MBP-Bcl10
Expression plasmids of Bcl10(1-233) were constructed on a vector of pDB-His-MBP, transformed into BL21(DE3) cell line for expression, preliminarily purified by Ni-NTA (Qiagen, Valencia, CA) affinity chromatography, further purified by gel filtration chromatography Superdex 200HR 10/300(GE Healthcare, UK), collected for the protein of interest, and finally stored in a buffer containing 20mM Tris (pH 7.5),150mM NaCl, and 5mM DTT.
As a result, as shown in FIG. 1, the peak of the desired protein began to appear at a position of about 12-14mL, and it was confirmed by SDS-PAGE that the protein in this peak form was indeed MBP-Bcl10 protein, and had a molecular weight of 75kD and a purity of 95%.
Example 2 design of Bcl10 Small molecule peptide inhibitors
1 control small peptide and 5 Bcl10 small peptide inhibitors were designed based on a structural model of the CB complex. The sequences are shown in Table 1 and FIG. 2.
Table 1: bcl10 small molecule peptide inhibitor sequence:
peptides | Sequence of | SEQ ID No.: |
Bcl10-Ctl: | |
1 |
Bcl10-P1: | |
10 |
Bcl10-P2: | |
4 |
Bcl10-P3: | |
11 |
Bcl10-P4: | |
5 |
Bcl10-P5: | |
12 |
Wherein, the horizontal line part is a base sequence part, and the sequence is SEQ ID NO. 2(P2) or 3 (P4).
Example 3 Effect of Small molecule inhibitors of Bcl10 on Bcl10 polymerization
In order to test the influence of the Bcl10 small-molecule inhibitor on the action of the Bcl10 inhibitor, the purified MBP-Bcl10 protein and the Bcl10 small-molecule peptide inhibitor are mixed according to the molar ratio of 1:1 or 1:2, and are incubated at room temperature for half an hour, and then TEV enzyme is added to react at room temperature for one hour. The reaction product is dripped on a copper net of EM and is negatively stained with uranyl acetate, and the influence of the Bcl10 small-molecule peptide inhibitor on the polymerization of Bcl10 is observed under an electron microscope.
As shown in FIG. 3, MBP-Bcl10 can form fibrous structures, while the small-molecule peptide inhibitors Bcl-P2 and Bcl-P4 can effectively inhibit the formation of the fibrous structures of Bcl10, while Bcl-P3 cannot inhibit the formation of the fibrous structures of Bcl10, which indicates that the Bcl-P2 and Bcl-P4 are effective Bcl10 polymerization inhibitors.
Example 4 growth inhibition of ABC-DLBCL cell lines with Small molecule peptide inhibitors of Bcl10
In order to test the influence of the Bcl10 small-molecule peptide inhibitor on the proliferation of ABC-DLBCL and GCB-DLBCL cells, the small-molecule peptide inhibitor with different concentration gradients is adopted to act on two ABC-DLBCL cell strains, namely HBL-1 and TMD8 and one GCB-DLBCL cell strain OCI-LY1 respectively, and the cell number is measured after 0h and 72 h.
The result shows that the small molecule peptides Bcl-P2 and BclP4 capable of effectively inhibiting the polymerization of Bcl10 can specifically inhibit the growth of ABC-DLBCL cells (GI 50: 3-5 mu M), and have no obvious inhibition effect on the growth of GCB-DLBCL (GI50>100 mu M); and small molecule peptide inhibitors Bcl-P1, Bcl-P3 and Bcl-P5 which have no influence on the polymerization of Bcl10 have no inhibition effect on the growth of ABC-DLBCL, which shows that the polymerization of Bcl10 has a key effect on the growth of ABC-DLBCL, and Bcl10 is an effective target for inhibiting the growth of ABC-DLBCL.
Example 5 Bcl10 Small molecule peptide inhibitor modified peptides specifically inhibit the growth of ABC-DLBCL cell line
Small-molecule peptide inhibitors are often easy to degrade and unstable in cells, and modification of small-molecule peptides is an effective strategy for improving stability and effectiveness of the peptides. Bcl-P2 and BclP4 were subjected to N-terminal acetylation (Ac-Bcl10-P2-NH2, Ac-Bcl10-P4-NH2) and reverse D-peptide modification (DRI-Bcl10-P2, DRI-Bcl10-P4) (see Table 2 for specific sequences), and the effect of the modifications in cells was tested, and it was found that these modified peptides can also selectively inhibit the growth of ABC-DLBCL cells (FIG. 5).
Table 2: modified Bcl10 small molecule peptide inhibitor sequence:
note that lower case letters represent the D form of amino acids
The horizontal line part is an inverted amino acid motif, and the sequence is SEQ ID No. 15 or 16 respectively.
Example 6 Bcl10 Small molecule peptide inhibitors effectively inhibit the growth of ABC-DLBCL tumors
To test the inability of Bcl10 small-molecule peptide inhibitors to inhibit the growth of ABC-DLBCL in mice, the ABC-DLBCL cell line TMD8 cells and GCB-DLBCL cells OCL-LY1 cells were implanted into NCG mice for subcutaneous neoplasia, then Bcl-ctl and Bcl-P4 were administered daily via the caudal vein and the growth inhibitory effect of Bcl10 small-molecule inhibitory peptides on ABC-DLBCL tumors was observed. As shown in FIG. 6, the result shows that Bcl-P4 can effectively inhibit the growth of ABC-DLBCL tumor in mice without obvious toxic and side effects. The growth inhibition effect of the Bcl-P4 on GCB-DLBCL tumor is not obvious.
Example 7 Bcl10 Small molecule peptide inhibitors are effective in reducing the incidence of psoriasis
To test the effect of Bcl10 inhibitors in an IMQ-induced psoriasis mouse model, experiments were performed using BALB/c mice (purchased from the university of tokyo). BALB/c mice were pretreated by intraperitoneal injection of a Bcl10 inhibitor DRI-Bcl10-P4 (concentration 20mg/kg) or a control peptide Bcl10-Ctl (concentration: 10mg/kg) for 2 days, and then the skin of the mice was smeared with Imiquimod (IMQ) (60 mg per day) for 5 days to induce psoriasis, and at the same time DRI-Bcl10-P4 (concentration 20mg/kg) was administered, so that IMQ was found to be effective in inducing psoriasis-like features such as thickening of the epidermis in the mice (FIGS. 7A and 7B), whereas mice treated with DRI-Bcl10-P4 had a marked reduction in the thickness of the epidermis and marked alleviation of the psoriasis-like symptoms (FIGS. 7A and 7B), indicating that the Bcl10 inhibitor was effective in inhibiting the development of ImQ-induced psoriasis-like features in BALB/c mice. Fig. 7A is a H & E stained histological section of the epidermis of mice of different treatment groups showing the effect of different treatment groups on the thickness of the epidermis of the mice, and fig. 7B is a statistical graph of the thickness of the epidermis of mice of different treatment groups.
Discussion of the related Art
ABC-DLBCL is the lymphoma with the highest degree of malignancy at present and has strong resistance to the immunochemical R-CHOP therapy which is commonly used clinically at present. One of the characteristics of the method is that the NF-kB signal path with the functions of promoting growth and resisting apoptosis is continuously activated, so that theoretically, finding a targeted drug for blocking NF-kB signals in ABC-DLBCL is an effective method for treating ABC-DLBCL. However, NF-. kappa.B is a transcription factor with a wide range of important biological activities and is not suitable as a therapeutic target per se.
In B cells, Src family kinases are induced to phosphorylate tyrosine in the ITAM domain of CD79A and CD79B upon antigen binding to BCR, followed by activation of tyrosine kinase Syk by binding to phosphorylated ITAM, which triggers a signaling cascade including Bruton's Tyrosine Kinase (BTK), phosphatase C γ (phosphoipase C γ), and protein kinase C β (protein kinase C β - β). PKC- β phosphorylates CARM1, causing it to recruit BCL10 and MALT1, forming a CBM complex, which activates ikb kinase (IKK), which finally stimulates NF- κ B signaling pathway (21). on the other hand, activated mam 1 cleaves through its enzymatic activity an NF- κ B inhibitor such as a20(22), CYLD (23,24), further promotes activation of the NF- κ B signaling pathway, mutations in tumor cells such as CD 3825, CD 7342, CD 1/CD 7375, or the above mutation of the gene translocation of BCL-B19, which results in negative feedback mutations of tumor cells such as CD 1, CD 7342, and/isb 7374.
As can be seen from the above, the CBM complex plays an important role in mediating NF- κ B activation. While the only enzymatically active MALT1 protein in the CBM complex is the hot molecular target for the recent development of targeted drugs for the treatment of ABC-DLBCL: firstly, the inhibition of the activity of MALT1 can effectively inhibit the signal of NF-kB, thereby selectively inhibiting or even killing ABC-DLBCL cells, and the therapeutic effectiveness of targeting MALT1 enzyme activity is demonstrated; secondly, the MALT1 knockout mouse shows a part of defects in the activation of T cells and B cells and has normal phenotype in other aspects, which suggests that the side effect of targeting MALT1 enzyme activity to treat ABC-DLBCL is smaller; third, the caspase-like domain of MALT1 is unique among human genes, and inhibition of MALT1 does not produce a wide range of side effects due to inhibition of other structurally similar proteins, etc. The inventors have developed small molecule inhibitors of MALT1 and demonstrated that MALT1 is an effective target for the treatment of ABC-DLBCL.
The Bcl10 is the core of the fiber structure of the CBM complex, and the fiber structure of the Bcl10 provides a central scaffold platform for the activation of the CBM complex and the recruitment and activation of key proteins of the NF-kB signaling pathway, and is the key to the activation of the NF-kB signaling pathway. The mutant of Bcl10 which can not form a fiber structure has the inhibiting effect of dominant negative effect on the activation of NF-kB signal path, therefore, the Bcl10 can be another effective target point for inhibiting the NF-kB signal path and treating ABC-DLBCL. According to the invention, a small-molecule peptide inhibitor for inhibiting Bcl10 is designed according to a structure model of Bcl10, wherein Bcl-P2 and Bcl-P4 can effectively inhibit the polymerization of Bcl10, the formation of a fibrous structure and the activity of NF-kB, and show very specific killing effect on ABC-DLBCL on a cell level and a mouse allograft tumor model, so that Bcl10 is an effective target for inhibiting the activity of NF-kB and ABC-DLBCL.
A large number of researches show that the activation of abnormal NF-kB signal channels plays an important role in various cancers such as breast cancer, hormone-resistant prostate cancer, lung cancer, thyroid cancer, colon cancer, lymphoma and the like and autoimmune diseases (such as psoriasis and the like). Recent studies have shown that the CBM protein complex and its family proteins are widely expressed in these cancer tissues, and that this complex may also have a key role in NF-. kappa.B-related cancers other than lymphoma. Therefore, Bcl10 inhibitors may also provide effective therapeutic approaches for the treatment of the above-mentioned cancers and autoimmune diseases.
All documents referred to herein are incorporated by reference into this application as if each were individually incorporated by reference. Furthermore, it should be understood that various changes and modifications of the present invention can be made by those skilled in the art after reading the above teachings of the present invention, and these equivalents also fall within the scope of the present invention as defined by the appended claims.
Claims (12)
- A polypeptide of formula I, or a pharmaceutically acceptable salt thereof,Z0-Z1-Z2-Z3-Z4 (I)z0 is nothing, a modification group at the N end or a peptide segment of 1-3 amino acids;z1 is a cell penetrating peptide element;z2 is nothing or a linker peptide;z3 is a Bcl10 inhibitory peptide element, and the length of Z3 is 12-25aa, preferably 13-20aa, more preferably 14-18 aa;z4 is nothing, a modification group at the C terminal or a peptide segment of 1-3 amino acids;"-" is a peptide bond.
- The polypeptide of formula I according to claim 1, or a pharmaceutically acceptable salt thereof, wherein said polypeptide has a length of 30-50aa, preferably 32-40 aa.
- The polypeptide of formula I of claim 1, or a pharmaceutically acceptable salt thereof, wherein the N-terminal modification group is selected from the group consisting of: acetyl, benzyloxycarbonyl C, aminopentanoic acid, palmitic acid, or combinations thereof.
- The polypeptide of formula I according to claim 1, or a pharmaceutically acceptable salt thereof, wherein Z3 has the motif (5'-3') of formula a1 or the inverted amino acid motif (5'-3') of formula a 2:R-X1-RA-X2-K-X3-L (A1); orL-X3-K-X2'-AR-X1'-R (A2)In the formula (I), the compound is shown in the specification,x1 is a peptide segment of 4-6 amino acids; preferably X1 is HFDHL or TSSRK;x2 is nothing, or a peptide segment of 1-2 amino acids; preferably X2 is K or G;x3 is a peptide of 1-2 amino acids; preferably, X3 is I or L;x1' is a peptide segment of 4-6 amino acids; preferably X1 is KRSST or LHDFH;x2' is nothing, or a peptide fragment of 1-2 amino acids; preferably X2' is K or G.
- The polypeptide of formula I of claim 1, or a pharmaceutically acceptable salt thereof, wherein the polypeptide has the sequence of SEQ ID No. 4 or 5 or 8 or 9 or 13 or 14.
- An isolated nucleic acid molecule encoding the polypeptide of claim 1 or a pharmaceutically acceptable salt thereof.
- A pharmaceutical composition, comprising:(a) a therapeutically effective amount of the polypeptide of claim 1 or a pharmaceutically acceptable salt thereof; and(b) a pharmaceutically acceptable carrier or excipient.
- Use of the polypeptide of claim 1, or a pharmaceutically acceptable salt thereof, for the preparation of a composition or medicament for (i) inhibiting Bcl10 polymerization; (ii) inhibiting the activity of the CBM complex; (iii) selectively inhibiting the growth of diffuse large B-cell lymphoma; and/or (iv) preventing and/or treating diseases associated with CBM complex-induced NF- κ B activation.
- A method of selectively inhibiting the growth of diffuse large B-cell lymphoma comprising the steps of: administering to a subject in need thereof a polypeptide of claim 1 or a pharmaceutically acceptable salt thereof.
- An in vitro non-therapeutic method of inhibiting polymerization of Bcl10, comprising the steps of:culturing a tumor cell in the presence of the polypeptide of claim 1 or a pharmaceutically acceptable salt thereof, thereby inhibiting polymerization of Bcl10 in the tumor cell.
- A method of screening a candidate compound for selective inhibition of the growth of diffuse large B-cell lymphoma comprising the steps of:(a) mixing the Bcl10 protein with a library of compounds, and determining binding of compounds in the library of compounds to the Bcl10 protein;wherein, if a compound in the test compound library binds to the Bcl10 protein, it indicates that the compound that binds to the Bcl10 protein is a candidate compound.(b) Administering the candidate compound identified in step (a) to diffuse large B-cell lymphoma cells and determining its effect on diffuse large B-cell lymphoma.
- A method of screening a candidate compound for selective inhibition of the growth of diffuse large B-cell lymphoma comprising the steps of:(a) culturing tumor cells expressing Bcl10 protein in a test group in a culture system in the presence of a test compound for a period of time T1, and detecting the expression of the Bcl10 protein in the culture system of the test group E1;and detecting expression of said Bcl10 protein in said culture system of a control group in a control group otherwise identical in the absence of said test compound E2;(b) if the expression profile of the Bcl10 protein in the test group, E1, is significantly lower than the expression profile of the Bcl10 protein in the control group, E2, then it is an indication that the test compound is a candidate compound.
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN2018106945845 | 2018-06-29 | ||
CN201810694584.5A CN110655583A (en) | 2018-06-29 | 2018-06-29 | Novel Bcl10 polymerization inhibitor and application thereof |
PCT/CN2019/093094 WO2020001495A1 (en) | 2018-06-29 | 2019-06-26 | Novel bcl10 polymerization inhibitor and application thereof |
Publications (1)
Publication Number | Publication Date |
---|---|
CN111094357A true CN111094357A (en) | 2020-05-01 |
Family
ID=68985873
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201810694584.5A Pending CN110655583A (en) | 2018-06-29 | 2018-06-29 | Novel Bcl10 polymerization inhibitor and application thereof |
CN201980004308.4A Pending CN111094357A (en) | 2018-06-29 | 2019-06-26 | Novel Bcl10 polymerization inhibitor and application thereof |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201810694584.5A Pending CN110655583A (en) | 2018-06-29 | 2018-06-29 | Novel Bcl10 polymerization inhibitor and application thereof |
Country Status (2)
Country | Link |
---|---|
CN (2) | CN110655583A (en) |
WO (1) | WO2020001495A1 (en) |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN105920582A (en) * | 2008-12-10 | 2016-09-07 | 普渡研究基金会 | Cell-permeant Peptide-based Inhibitor Of Kinases |
-
2018
- 2018-06-29 CN CN201810694584.5A patent/CN110655583A/en active Pending
-
2019
- 2019-06-26 CN CN201980004308.4A patent/CN111094357A/en active Pending
- 2019-06-26 WO PCT/CN2019/093094 patent/WO2020001495A1/en active Application Filing
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN105920582A (en) * | 2008-12-10 | 2016-09-07 | 普渡研究基金会 | Cell-permeant Peptide-based Inhibitor Of Kinases |
Non-Patent Citations (1)
Title |
---|
DANIELA M.等: "Generation and functional characterization of a BCL10-inhibitory peptide that represses NF-κB activation", 《BIOCHEM. J.》 * |
Also Published As
Publication number | Publication date |
---|---|
CN110655583A (en) | 2020-01-07 |
WO2020001495A1 (en) | 2020-01-02 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP1991560B1 (en) | Peptide having cell membrane penetrating activity | |
US20110195909A1 (en) | Novel x-conotoxin peptides (-ii) | |
KR101363455B1 (en) | Peptides Inhibiting the Activity of Matrix Metalloproteases and Use Thereof | |
CN106279423B (en) | Slit2D2-HSA fusion protein and application thereof in tumor resistance | |
EP4124621A1 (en) | Carrier peptide fragment for nucleolar localization and use thereof | |
CN112041330A (en) | Compstatin analogs and medical uses thereof | |
CN105524139B (en) | High-activity tumor inhibitor and its preparing process and application | |
WO2015055148A1 (en) | Yap protein inhibiting polypeptide and application thereof | |
EP2846819B1 (en) | Variants of tace pro-domain as tnf-a inhibitor and their medical use | |
EP2687537B1 (en) | Polypeptide drug against hepatitis b virus x protein | |
US10246488B2 (en) | Use of inhibitory peptides for the treatment of inflammatory diseases | |
CN107629114B (en) | Polypeptide, derivative thereof and application thereof in preparation of anti-pulmonary fibrosis drugs | |
WO2012142930A1 (en) | Anti-fatty acid synthase polypeptide and use thereof | |
CN109890837B (en) | High stability and high affinity DMIC and its preparing process | |
CN111094357A (en) | Novel Bcl10 polymerization inhibitor and application thereof | |
US20230340027A1 (en) | Ubiquitin high affinity peptides, and methods of using same, and identifying same | |
KR102017973B1 (en) | Anti-Hepatitis B Virus X Protein Polypeptide Pharmaceuticals | |
WO2018109771A1 (en) | Fusion proteins for treatment of cancer | |
CN1948335B (en) | Candida albicans mycellium regulating and controlling factor gene and its use | |
KR101651330B1 (en) | Methods of TAT-A20 fusion protein with good cell penetration and use thereof | |
AU2020203749A1 (en) | Variants Of Tissue Inhibitor Of Metalloproteinase Type Three (TIMP-3), Compositions And Methods | |
US20140343249A1 (en) | Cell killing fusion peptide exhibiting tumor cell-specific necrosis induction and tumor regression | |
WO2012122942A1 (en) | Polypeptide drug against hepatitis b virus x protein | |
WO2012122943A1 (en) | Anti-hepatitis b virus x protein polypeptide drug | |
CN113018418B (en) | Application of micro RNA31 precursor encoding polypeptide miPEP31 in preparation of hypertension drugs |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
CB02 | Change of applicant information |
Address after: 200031 Yueyang Road, Shanghai, No. 319, No. Applicant after: Shanghai Institute of nutrition and health, Chinese Academy of Sciences Address before: 200031 Yueyang Road, Shanghai, No. 319, No. Applicant before: SHANGHAI INSTITUTES FOR BIOLOGICAL SCIENCES, CHINESE ACADEMY OF SCIENCES |
|
CB02 | Change of applicant information | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination |