CN109468284A - A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and PSMA and its application - Google Patents

A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and PSMA and its application Download PDF

Info

Publication number
CN109468284A
CN109468284A CN201811458426.6A CN201811458426A CN109468284A CN 109468284 A CN109468284 A CN 109468284A CN 201811458426 A CN201811458426 A CN 201811458426A CN 109468284 A CN109468284 A CN 109468284A
Authority
CN
China
Prior art keywords
gly
ser
leu
amino acid
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
CN201811458426.6A
Other languages
Chinese (zh)
Inventor
章睿
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Beijing American Kinge Biotech Co Ltd
Original Assignee
Beijing American Kinge Biotech Co Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Beijing American Kinge Biotech Co Ltd filed Critical Beijing American Kinge Biotech Co Ltd
Priority to CN201811458426.6A priority Critical patent/CN109468284A/en
Publication of CN109468284A publication Critical patent/CN109468284A/en
Priority to PCT/CN2019/122164 priority patent/WO2020108646A1/en
Pending legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/461—Cellular immunotherapy characterised by the cell type used
    • A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/463—Cellular immunotherapy characterised by recombinant expression
    • A61K39/4631—Chimeric Antigen Receptors [CAR]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464402—Receptors, cell surface antigens or cell surface determinants
    • A61K39/464411—Immunoglobulin superfamily
    • A61K39/464412—CD19 or B4
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464469—Tumor associated carbohydrates
    • A61K39/464471—Gangliosides, e.g. GM2, GD2 or GD3
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464493—Prostate associated antigens e.g. Prostate stem cell antigen [PSCA]; Prostate carcinoma tumor antigen [PCTA]; Prostatic acid phosphatase [PAP]; Prostate-specific G-protein-coupled receptor [PSGR]
    • A61K39/464495—Prostate specific membrane antigen [PSMA]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A61P35/02—Antineoplastic agents specific for leukemia
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/7051—T-cell receptor (TcR)-CD3 complex
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3069—Reproductive system, e.g. ovaria, uterus, testes, prostate
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86—Viral vectors
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/64—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
    • C12N9/6421—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
    • C12N9/6472—Cysteine endopeptidases (3.4.22)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
    • C12Y304/22—Cysteine endopeptidases (3.4.22)
    • C12Y304/22062—Caspase-9 (3.4.22.62)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507—Comprising a combination of two or more separate antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/80—Vaccine for a specifically defined cancer
    • A61K2039/804—Blood cells [leukemia, lymphoma]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/27—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by targeting or presenting multiple antigens
    • A61K2239/29—Multispecific CARs
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
    • A61K2239/48—Blood cells, e.g. leukemia or lymphoma
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00—Genetically modified cells
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00—Reverse transcribing RNA viruses
    • C12N2740/00011—Details
    • C12N2740/10011—Retroviridae
    • C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15021—Viruses as such, e.g. new isolates, mutants or their genomic sequences
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00—Reverse transcribing RNA viruses
    • C12N2740/00011—Details
    • C12N2740/10011—Retroviridae
    • C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15041—Use of virus, viral particle or viral elements as a vector
    • C12N2740/15043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00—Reverse transcribing RNA viruses
    • C12N2740/00011—Details
    • C12N2740/10011—Retroviridae
    • C12N2740/16011—Human Immunodeficiency Virus, HIV
    • C12N2740/16041—Use of virus, viral particle or viral elements as a vector
    • C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Cell Biology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Microbiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Oncology (AREA)
  • Biophysics (AREA)
  • General Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Virology (AREA)
  • Pregnancy & Childbirth (AREA)
  • Toxicology (AREA)
  • Reproductive Health (AREA)
  • Hematology (AREA)
  • Gynecology & Obstetrics (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Gastroenterology & Hepatology (AREA)

Abstract

The immunocyte and its application, the dual Chimeric antigen receptor for the dual Chimeric antigen receptor gene modification based on CD19 and PSMA that the present invention relates to a kind of include Chimeric antigen receptor CD19 and Chimeric antigen receptor PSMA.The Chimeric antigen receptor includes that antigen-binding domains, transmembrane domain, costimulatory signal conducting region and CD3 ζ signal transduction structural domain and inducible suicide Fusion domain are connected in series.Identification the tumor surface antigen CD19 and PSMA of Chimeric antigen receptor energy specificity of the invention, compared to using other single Chimeric antigen receptor T cells, two kinds of antigen targeting CAR-T cells, which are used in combination, makes therapeutic effect more preferable, is not susceptible to CD19 escape, it is easier to alleviate disease.

Description

A kind of dual Chimeric antigen receptor gene modification based on CD19 and PSMA it is immune thin Born of the same parents and its application
Technical field
The present invention relates to the cellular immunotherapy fields of tumour more particularly to a kind of dual chimeric based on CD19 and PSMA The immunocyte of antigen receptor gene modification and its application, it is chimeric specially based on tomour specific target spot CD19 and PSMA The construction method of antigen receptor T (CAR-T) cell technology and its application in antineoplaston.
Background technique
With the development of tumour immunity theory and clinical technology, Chimeric antigen receptor T cell therapy (Chimeric Antigen receptor T-cell immunotherapy, CAR-T) become tumour immunity treatment most promising at present One of method.Generally, Chimeric antigen receptor CAR is by a tumor associated antigen combined area, extracellular hinge area, trans-membrane region and born of the same parents Interior signal transduction district's groups at.In general, the single-chain fragment that CAR includes antibody can be changed (Single chain fragment Variable, scFv) area or to tumor associated antigen (tumor associated antigen, TAA) have specificity knot Structural domain is closed, is coupled by the cytoplasmic domains of hinge and transmembrane region and T cell signal transduction molecule.The most common lymph is thin Born of the same parents' activated partial includes the T cell costimulation structural domain with T cell effector function triggering (such as CD3 ζ) sections in series.CAR The T cell that the adoptive immunotherapy of mediation allows CAR-T to transplant is on non-HLA restrictive one Direct Recognition target tumour cell TAA.
It is most of with B cell malignant tumour (including B cell acute lymphatic leukemia (B cell acute Lymphocytic leukemia, leukemia, B-ALL) and chronic lymphocytic leukemia (chronic Lymphocytic leukemia, CLL) patient will be dead due to its disease.It is logical for treating a kind of method of these patients The expression for crossing CAR carries out genetic modification to T cell to target the antigen expressed on tumour cell.CAR is that be designed to people white Cellular antigens (human leukocyte antigen, HLA) dependent/non-dependent mode identifies the antigen receptor of cell surface antigen. It attempts to have been achieved for promising success using the genetically modified cell of expression CAR to treat the patient of these types.
CD19 molecule is the hot spot treated in the potential target spot of bone-marrow-derived lymphocyte system tumour and CAR research, the table of CD19 It is the CAR target for safety test accepted extensively up to normal and malignant B cell is confined to.Target the chimeric of CD19 molecule The T cell (CD19CAR-T) of antigen receptor gene modification is on treating multiple, intractable B-lineage Acute Lymphocyte Leukemia Immense success is obtained, and in the treatment of the chronic bone-marrow-derived lymphocyte leukaemia of intractable, recurrent and bone-marrow-derived lymphocyte system lymthoma Curative effect is obviously poor.
104788573 A of CN discloses a kind of Chimeric antigen receptor hCD19scFv-CD8 α-CD28-CD3 ζ and application thereof, The second generation Chimeric antigen receptor is by anti human CD 19 monoclonal antibody HI19a light chain and heavy chain variable region (hCD19scFv), people CD8 α hinge area, people CD28 transmembrane region and intracellular region and people's CD3 ζ intracellular region structures in series are constituted, and the CD19 in the patent exists It carrying out after CAR-T cell feeds back, the expression quantity of CD19 can reduce, it is easy to escape from immunologic mechanism, and second generation CART Immune factor storm is big, there is the hidden worry of safety.
In addition, according to this center with the actual count of forth generation CD19 Chimeric antigen receptor treatment lymthoma, in 9 patients In the middle, wherein there is the patient of 4 tumor tissues immunohistochemical staining CD19 strong positives, receiving the treatment of CD19 Chimeric antigen receptor All reach complete incidence graph afterwards, in addition the patient of 5 CD19 weak expressions, only 1 reaches alleviation after the treatment, remaining 2 only Part is alleviated, the stabilization of 1 maintenance disease, 1 disease has progressed, this bearing reaction is single with CD19 is embedding and antigen receptor treatment Predicament.
Therefore, for the recurrence of CD19 feminine gender and the B cell tumour of CD19 low expression, combine another potential chimeric Antigen receptor is able to solve the easily mutation problem low with expression quantity existing for CD19 and is particularly important.In addition to CD19, PSMA is also It is the potentiality target spot for treating malignant B cell tumour, immune group is carried out according to tumour of this center to 16 B cell lymphoma patients Change the positive rate that dyeing detects 98%, indicates that this target spot of PSMA is can be applied to really in the treatment of B cell lympha tumour.
Therefore, a kind of strong specific, high targeting is found, the Chimeric antigen receptor of CART therapeutic effect can be effectively improved Just it is particularly important.
Summary of the invention
For in current CAR-T technology treatment tumour single targeting long-term effect is not very ideal and tumour micro-loop Border influences the case where CAR-T technology therapeutic effect, and the present invention provides a kind of dual Chimeric antigen receptor based on CD19 and PSMA The immunocyte of gene modification and its application, combined needle has strong special the dual tumor targets of CD19 and PSMA to the present invention for the first time The effect of CART treatment can effectively be improved and be extended to the characteristics of anisotropic, high targeting, for surface antigen CD19 and PSMA Positive leukaemia or B cell lymphoma has better therapeutic effect, is effectively prevented from the escape of missing the target of single target spot.
To achieve this purpose, the present invention adopts the following technical scheme:
On the one hand, the present invention provides a kind of the immune thin of the dual Chimeric antigen receptor gene modification based on CD19 and PSMA Born of the same parents, the dual Chimeric antigen receptor include Chimeric antigen receptor CD19 and Chimeric antigen receptor PSMA.
In the present invention, by by antigen-binding domains combination tumor surface antigen CD19 and PSMA, then pass through slow virus Carrier modifies T cell, so that the combination that tumor surface antigen CD19 and PSMA can be special is in the embedding of the application It closes on antigen receptor, CAR-T cell can eliminate the tumour cell of CD19 and PSMA simultaneously, effectively avoid tumor-cell antigen table It escapes up to reduction, while enhancing the permanent immunity effect of CAR-T cell.
In the present invention, the dual Chimeric antigen receptor can be individual CD19 Chimeric antigen receptor and individual PSMA When Chimeric antigen receptor is used in combination, it is also possible to join CD19 Chimeric antigen receptor and PSMA Chimeric antigen receptor Conjunction is expressed as dual Chimeric antigen receptor, i.e. antigen-binding domains are that can combine tumor surface antigen CD19 and PSMA, this The combination therapy of two kinds of Chimeric antigen receptors either way may be implemented.
According to the present invention, the Chimeric antigen receptor includes antigen-binding domains, transmembrane domain, costimulatory signal biography It leads area, CD3 ζ signal transduction structural domain and can induce suicide Fusion domain and be connected in series.
Preferably, the antigen-binding domains are for the single-chain antibody of tumor surface antigen CD19 and for tumour table The single-chain antibody of face antigen PSMA.
According to the present invention, the T cell Chimerical receptor (CAR) and be directed to CD19 and PSMA antigen that the gene modification is transformed It is described below for the single-chain antibody (scFv) of binding structural domain.
In a specific embodiment, the amino acid sequence tool of the single-chain antibody for tumor surface antigen CD19 There is any one in amino acid sequence shown in (I), (II) or (III):
(I) there is the amino acid sequence as shown in SEQ ID NO.1；
(II) with amino acid sequence shown in SEQ ID NO.1 with >=90%, preferably >=95%, more preferably >=98%, most It is preferred that the amino acid sequence of >=99% homology；
(III) it modified with amino acid sequence shown in SEQ ID NO.1, replace, miss or add one or several ammonia The amino acid sequence that base acid obtains；
The amino acid sequence has the activity of the single-chain antibody for tumor surface antigen CD19；
It is as follows for the amino acid sequence (SEQ ID NO.1) of the single-chain antibody of tumor surface antigen CD19: DIQMTQTT SSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIA TYFCQQGNTLPYTFGGGTKLEITGSTSGSGKPGSGEGSTKGEVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVS WIRQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWG QGTSVTVSS.
According to the present invention, it is described its have 90% or more homology amino acid sequence or through modification, substitution, lack or add The amino acid sequence for adding one or several amino acid to obtain can be substituted by other single-chain antibodies or humanization CD19 single-chain antibody, Its amino acid mutants still has the function of CD19 single-chain antibody.
In a specific embodiment, the amino acid sequence tool of the single-chain antibody for tumor surface antigen PSMA There is any one in amino acid sequence shown in (I), (II) or (III):
(I) there is the amino acid sequence as shown in SEQ ID NO.2；
(II) with amino acid sequence shown in SEQ ID NO.2 with >=90%, preferably >=95%, more preferably >=98%, most It is preferred that the amino acid sequence of >=99% homology；
(III) it modified with amino acid sequence shown in SEQ ID NO.2, replace, miss or add one or several ammonia The amino acid sequence that base acid obtains；
The amino acid sequence has the activity of the single-chain antibody for tumor surface antigen PSMA；
It is as follows for the amino acid sequence (SEQ ID NO.2) of tumor surface antigen PSMA single-chain antibody:
EVQLVQSGAEVKKPGASVKISCKISGYTFTEYTIHWVKQASGKGLEWIGNINPNNGGTTYNQKFEDRA TLTVDKSTSTAYMELSSLRSEDTAVYYCAAGWNFDYWGQGTTVTVSSGSTSGSGKPGSSEGSTKGDIVMTQSPSSL SASVGDRVTIICKASQDVGTAVDWYQQKPGKAPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISSLQPEDFADYF CQQYNSYPLTFGGGTKLEIK.
According to the present invention, it is described its have 90% or more homology amino acid sequence or through modification, substitution, lack or add The amino acid sequence for adding one or several amino acid to obtain can be substituted by other single-chain antibodies or humanization PSMA single-chain antibody, Its amino acid mutants still has the function of PSMA single-chain antibody.
According to the present invention, the Chimeric antigen receptor by slow virus carrier to T cell carry out genetic modification, CD19 and It is stronger to kill tumor effect in conjunction with tumor surface antigen CD19 and PSMA for the dual CAR-T cell of PSMA.
According to the present invention, the transmembrane domain is CD28 transmembrane domain and/or CD8 α transmembrane domain, in some tools In body embodiment, transmembrane domain can be selected or modified by amino acid substitution.
According to the present invention, the costimulatory signal conducting region is CD28 signal transduction structural domain, CD27 signal transduction structure In domain or CD137 signal transduction structural domain any one or at least two combination, the CD28 signal transduction structural domain, The arrangement of CD27 signal transduction structural domain and CD137 signal transduction structural domain, those skilled in the art can according to need progress Adjustment, the arrangement different with CD137 signal transduction structural domain with CD27 signal transduction structural domain of CD28 signal transduction structural domain is not The Chimeric antigen receptor can be had an impact, the application is combined using the sequence of CD28-CD27.
According to the present invention, the forth generation CAR is to include 9 structure of Caspase with can induce suicide Fusion domain Domain, for amino acid sequence as shown in SEQ ID NO.3, amino acid sequence shown in the SEQ ID NO.3 is as follows:
GSGATNFSLLKQAGDVEENPGPMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKVDSSRDRNKP FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEGGGGSGGGGSGAMV GALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLA LLELARQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQ KDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETL DDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTSAS.
According to the present invention, the inducible suicide Fusion domain is mutually gone here and there by 2A sequence with CD3 ζ signal transduction structural domain Connection, the 2A sequence can make the albumen and the Chimeric antigen receptor chopping up proteins of the inducible suicide Fusion domain expression It opens, so that the Chimeric antigen receptor can play a role, and by injection activator, melt so that can induce suicide Structural domain activation is closed, the T cell so as to cause expression Chimeric antigen receptor is dead and ineffective.
According to the present invention, the Chimeric antigen receptor further includes signal peptide, and the signal peptide is that can instruct chimeric antigen The signal peptide of receptor transmembrane transfer, those skilled in the art can according to need the signal peptide of selection this field routine, the letter Number peptide is Secretory signal peptide, and the Secretory signal peptide is the signal peptide of GMCSFR gene, and amino acid sequence can With as follows as shown in SEQ ID NO.8: MLLLVTSLLLCELPHPAFLLIP.
Preferably, the Secretory signal peptide is the signal peptide of CD8a gene, the ammonia of the Secretory signal peptide Base acid sequence is as follows as shown in SEQ ID NO.9: MALPVTALLLPLALLLHAARP.
Chimeric antigen receptor of the invention can also include hinge area, and described hinge area those skilled in the art can basis Actual conditions are selected, and do not do particular determination herein, the presence of hinge area will not be to the property of Chimeric antigen receptor of the invention It can have an impact.
According to the present invention, the Chimeric antigen receptor includes signal peptide, antigen-binding domains, transmembrane domain, altogether thorn Energizing signal conducting region, CD3 ζ signal transduction structural domain, 2A sequence and inducible suicide Fusion domain are connected in series.
As optimal technical scheme, the Chimeric antigen receptor is Secretory signal peptide, CD19 antigen-binding domains And/or PSMA antigen-binding domains, CD8 α and/or CD28 transmembrane domain, CD28 extracellular signal conducting structure domain, CD28 Cellular Signaling Transduction Mediated structural domain, CD27 Cellular Signaling Transduction Mediated structural domain, CD3 ζ Cellular Signaling Transduction Mediated structural domain, 2A sequence It is connected in series with FBKP.Casp9 structural domain, specific arrangement is as follows:
Secretory-CD19 scFv-CD28-CD27-CD3ζ-2A-FBKP.Casp9；
Secretory-PSMA scFv-CD28-CD27-CD3ζ-2A-FBKP.Casp9。
In a specific embodiment, the Chimeric antigen receptor Secretory-CD19 scFv-CD28-CD27- The amino acid sequence of CD3 ζ -2A-FBKP.Casp9 has the amino of 90% or more homology as shown in SEQ ID NO.4 or with it Acid sequence, amino acid sequence shown in the SEQ ID NO.4 are as follows:
MLLLVTSLLLCELPHPAFLLIPQVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLE WMGWINTYTGEPTYADAFKGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDYGDYGMDYWGQGTTVTVSSGSTS GSGKPGSSEGSTKGDIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSFMHWYQQKPGQPPKLLIYLASNLESGV PDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHSREVPWTFGQGTKVEIKAAAIEVMYPPPYLDNEKSNGTIIHVKG KHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPR DFAAYRSASGGGGSGGGGSQRRKYRSNKGESPVEPAEPCHYSCPREEEGSTIPIQEDYRKPEPACSPGGGGSGGGG SRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIG MKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRTSGSGATNFSLLKQAGDVEENPGPMGVQVETISPGDGRT FPKRGQTCVVHYTGMLEDGKKVDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGI IPPHATLVFDVELLKLEGGGGSGGGGSGAMVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSN IDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELARQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSV EKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLP TPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLF FKTSAS；
In a specific embodiment, the Chimeric antigen receptor Secretory-CD19 scFv-CD28-CD27- The nucleotide sequence of CD3 ζ -2A-FBKP.Casp9 has the nucleosides of 95% or more homology as shown in SEQ ID NO.5 or with it Acid sequence, nucleic acid sequence shown in the SEQ ID NO.5 are as follows:
ATGCTGCTGCTGGTCACAAGCCTGCTGCTGTGCGAGCTGCCCCACCCCGCCTTTCTGCTGATCCCCGA CATCCAGATGACCCAGACCACCAGCAGCCTGAGCGCCAGCCTGGGCGACAGAGTGACCATCAGCTGCCGGGCCAGC CAGGACATCAGCAAGTACCTGAACTGGTATCAGCAGAAACCCGACGGCACCGTGAAGCTGCTGATCTACCACACCA GCCGGCTGCACAGCGGCGTGCCCAGCAGATTTTCTGGCAGCGGATCTGGCACCGACTACAGCCTGACCATCTCCAA CCTGGAACAGGAAGATATCGCTACCTACTTCTGTCAGCAGGGCAACACCCTGCCCTACACCTTCGGCGGAGGCACC AAGCTGGAAATCACCGGCAGCACCAGCGGCTCCGGCAAGCCTGGATCTGGCGAGGGCAGCACCAAGGGCGAAGTGA AGCTGCAGGAAAGCGGCCCTGGCCTGGTCGCCCCTAGCCAGAGCCTGTCCGTGACCTGTACCGTGTCCGGCGTGTC CCTGCCCGACTACGGCGTGTCCTGGATCAGACAGCCCCCCAGAAAGGGCCTGGAATGGCTGGGCGTGATCTGGGGC AGCGAGACAACCTACTACAACAGCGCCCTGAAGTCCCGGCTGACCATCATCAAGGACAACAGCAAGAGCCAGGTGT TCCTGAAGATGAACAGCCTGCAGACCGACGACACCGCCATCTACTACTGCGCCAAGCACTACTACTACGGCGGCAG CTACGCCATGGACTACTGGGGCCAGGGCACCAGCGTGACAGTCTCTTCTGCGGCCGCAATTGAAGTTATGTATCCT CCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACACCTTTGTCCAAGTCCCC TATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGGGGAGTCCTGGCTTGCTATAGCTTGCTAGT AACAGTGGCCTTTATTATTTTCTGGGTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACT CCCCGCCGCCCTGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCCG CTAGCGGAGGTGGAGGTTCTGGAGGTGGTGGAAGTCAAAGAAGGAAGTACCGCAGCAACAAAGGAGAATCTCCCGT CGAGCCAGCCGAGCCCTGTCATTATTCATGCCCAAGGGAGGAGGAGGGAAGTACAATCCCAATTCAAGAAGACTAC AGGAAGCCCGAACCTGCATGCAGTCCAGGTGGAGGCGGTTCTGGAGGCGGTGGCTCCCGGGTGAAATTCTCACGGT CTGCAGACGCACCCGCTTACCAGCAAGGCCAGAACCAACTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTA CGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGC CTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGG GCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGC CCTGCCCCCTCGCACTAGTGGCTCCGGAGCCACGAACTTCTCTCTGTTAAAGCAAGCAGGAGACGTGGAAGAAAAC CCCGGTCCCATGGGAGTGCAGGTGGAAACCATCTCCCCAGGAGACGGGCGCACCTTCCCCAAGCGCGGCCAGACCT GCGTGGTGCACTACACCGGGATGCTTGAAGATGGAAAGAAAGTGGACTCCTCCCGGGACAGAAACAAGCCCTTTAA GTTTATGCTAGGCAAGCAGGAGGTGATCCGAGGCTGGGAAGAAGGGGTTGCCCAGATGAGTGTGGGTCAGAGAGCC AAACTGACTATATCTCCAGATTATGCCTATGGTGCCACTGGGCACCCAGGCATCATCCCACCACATGCCACTCTCG TCTTCGATGTGGAGCTTCTAAAACTGGAAGGTGGAGGCGGTTCAGGCGGCGGCGGCAGCGGCGCCATGGTCGGTGC TCTTGAGAGTTTGAGGGGAAATGCAGATTTGGCTTACATCCTGAGCATGGAGCCCTGTGGCCACTGCCTCATTATC AACAATGTGAACTTCTGCCGTGAGTCCGGGCTCCGCACCCGCACTGGCTCCAACATCGACTGTGAGAAGTTGCGGC GTCGCTTCTCCTCGCTGCATTTCATGGTGGAGGTGAAGGGCGACCTGACTGCCAAGAAAATGGTGCTGGCTTTGCT GGAGCTGGCGCGGCAGGACCACGGTGCTCTGGACTGCTGCGTGGTGGTCATTCTCTCTCACGGCTGTCAGGCCAGC CACCTGCAGTTCCCAGGGGCTGTCTACGGCACAGATGGATGCCCTGTGTCGGTCGAGAAGATTGTGAACATCTTCA ATGGGACCAGCTGCCCCAGCCTGGGAGGGAAGCCCAAGCTCTTTTTCATCCAGGCCTGTGGTGGGGAGCAGAAAGA CCATGGGTTTGAGGTGGCCTCCACTTCCCCTGAAGACGAGTCCCCTGGCAGTAACCCCGAGCCAGATGCCACCCCG TTCCAGGAAGGTTTGAGGACCTTCGACCAGCTGGACGCCATATCTAGTTTGCCCACACCCAGTGACATCTTTGTGT CCTACTCTACTTTCCCAGGTTTTGTTTCCTGGAGGGACCCCAAGAGTGGCTCCTGGTACGTTGAGACCCTGGACGA CATCTTTGAGCAGTGGGCTCACTCTGAAGACCTGCAGTCCCTCCTGCTTAGGGTCGCTAATGCTGTTTCGGTGAAA GGGATTTATAAACAGATGCCTGGTTGCTTTAATTTCCTCCGGAAAAAACTTTTCTTTAAAACATCAGCTAGTTAA.
In a specific embodiment, the Chimeric antigen receptor Secretory-PSMA scFv-CD28-CD27- The amino acid sequence of CD3 ζ -2A-FBKP.Casp9 has the amino of 90% or more homology as shown in SEQ ID NO.6 or with it Acid sequence, amino acid sequence shown in the SEQ ID NO.6 are as follows:
MALPVTALLLPLALLLHAARPEVQLVQSGAEVKKPGASVKISCKISGYTFTEYTIHWVKQASGKGLEW IGNINPNNGGTTYNQKFEDRATLTVDKSTSTAYMELSSLRSEDTAVYYCAAGWNFDYWGQGTTVTVSSGSTSGSGK PGSSEGSTKGDIVMTQSPSSLSASVGDRVTIICKASQDVGTAVDWYQQKPGKAPKLLIYWASTRHTGVPDRFTGSG SGTDFTLTISSLQPEDFADYFCQQYNSYPLTFGGGTKLEIKAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPL FPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSA SGGGGSGGGGSQRRKYRSNKGESPVEPAEPCHYSCPREEEGSTIPIQEDYRKPEPACSPGGGGSGGGGSRVKFSRS ADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRG KGHDGLYQGLSTATKDTYDALHMQALPPRTSGSGATNFSLLKQAGDVEENPGPMGVQVETISPGDGRTFPKRGQTC VVHYTGMLEDGKKVDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLV FDVELLKLEGGGGSGGGGSGAMVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRR RFSSLHFMVEVKGDLTAKKMVLALLELARQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFN GTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVS YSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTSAS；
In a specific embodiment, the Chimeric antigen receptor Secretory-PSMA scFv-CD28-CD27- The nucleotide sequence of CD3 ζ -2A-FBKP.Casp9 has the nucleosides of 95% or more homology as shown in SEQ ID NO.7 or with it Acid sequence, nucleic acid sequence shown in the SEQ ID NO.7 are as follows:
ATGGCCCTCCCTGTTACCGCTCTGCTCCTCCCCTTGGCCCTTCTGCTGCATGCAGCCAGACCTGAGGT CCAACTGGTGCAGTCTGGTGCTGAAGTGAAGAAGCCTGGTGCCAGCGTGAAGATTAGCTGCAAGATTAGCGGCTAC ACCTTCACCGAGTATACCATTCACTGGGTCAAACAAGCCTCTGGAAAAGGGCTGGAATGGATAGGCAATATCAACC CCAACAATGGCGGAACAACCTACAACCAAAAGTTTGAGGATCGTGCCACTCTGACGGTTGACAAGTCCACGAGCAC AGCCTACATGGAGCTGTCAAGTCTGAGGTCCGAGGATACTGCGGTCTACTATTGTGCTGCTGGGTGGAACTTCGAC TATTGGGGACAGGGTACGACAGTTACTGTGTCCTCAGGCTCAACATCCGGCTCTGGAAAGCCTGGGTCCAGTGAAG GGAGCACAAAAGGGGACATCGTGATGACCCAGTCTCCAAGCAGCCTTAGCGCTAGTGTAGGGGATCGAGTGACCAT CATCTGCAAAGCATCTCAGGACGTAGGCACTGCAGTGGATTGGTATCAGCAGAAACCAGGAAAAGCGCCGAAACTG TTGATCTACTGGGCAAGTACACGCCACACTGGAGTCCCAGATCGGTTTACCGGGTCCGGCTCAGGCACTGACTTCA CTCTGACCATTTCCTCTCTTCAGCCCGAAGATTTTGCCGACTACTTCTGTCAGCAGTACAATAGCTATCCCCTGAC ATTTGGCGGTGGAACAAAGCTCGAGATAAAGGCGGCCGCAATTGAAGTTATGTATCCTCCTCCTTACCTAGACAAT GAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTA AGCCCTTTTGGGTGCTGGTGGTGGTTGGGGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTAT TTTCTGGGTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCTGGGCCC ACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCCGCTAGCGGAGGTGGAGGTT CTGGAGGTGGTGGAAGTCAAAGAAGGAAGTACCGCAGCAACAAAGGAGAATCTCCCGTCGAGCCAGCCGAGCCCTG TCATTATTCATGCCCAAGGGAGGAGGAGGGAAGTACAATCCCAATTCAAGAAGACTACAGGAAGCCCGAACCTGCA TGCAGTCCAGGTGGAGGCGGTTCTGGAGGCGGTGGCTCCCGGGTGAAATTCTCACGGTCTGCAGACGCACCCGCTT ACCAGCAAGGCCAGAACCAACTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAG ACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAG AAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCC TTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCACTAG TGGCTCCGGAGCCACGAACTTCTCTCTGTTAAAGCAAGCAGGAGACGTGGAAGAAAACCCCGGTCCCATGGGAGTG CAGGTGGAAACCATCTCCCCAGGAGACGGGCGCACCTTCCCCAAGCGCGGCCAGACCTGCGTGGTGCACTACACCG GGATGCTTGAAGATGGAAAGAAAGTGGACTCCTCCCGGGACAGAAACAAGCCCTTTAAGTTTATGCTAGGCAAGCA GGAGGTGATCCGAGGCTGGGAAGAAGGGGTTGCCCAGATGAGTGTGGGTCAGAGAGCCAAACTGACTATATCTCCA GATTATGCCTATGGTGCCACTGGGCACCCAGGCATCATCCCACCACATGCCACTCTCGTCTTCGATGTGGAGCTTC TAAAACTGGAAGGTGGAGGCGGTTCAGGCGGCGGCGGCAGCGGCGCCATGGTCGGTGCTCTTGAGAGTTTGAGGGG AAATGCAGATTTGGCTTACATCCTGAGCATGGAGCCCTGTGGCCACTGCCTCATTATCAACAATGTGAACTTCTGC CGTGAGTCCGGGCTCCGCACCCGCACTGGCTCCAACATCGACTGTGAGAAGTTGCGGCGTCGCTTCTCCTCGCTGC ATTTCATGGTGGAGGTGAAGGGCGACCTGACTGCCAAGAAAATGGTGCTGGCTTTGCTGGAGCTGGCGCGGCAGGA CCACGGTGCTCTGGACTGCTGCGTGGTGGTCATTCTCTCTCACGGCTGTCAGGCCAGCCACCTGCAGTTCCCAGGG GCTGTCTACGGCACAGATGGATGCCCTGTGTCGGTCGAGAAGATTGTGAACATCTTCAATGGGACCAGCTGCCCCA GCCTGGGAGGGAAGCCCAAGCTCTTTTTCATCCAGGCCTGTGGTGGGGAGCAGAAAGACCATGGGTTTGAGGTGGC CTCCACTTCCCCTGAAGACGAGTCCCCTGGCAGTAACCCCGAGCCAGATGCCACCCCGTTCCAGGAAGGTTTGAGG ACCTTCGACCAGCTGGACGCCATATCTAGTTTGCCCACACCCAGTGACATCTTTGTGTCCTACTCTACTTTCCCAG GTTTTGTTTCCTGGAGGGACCCCAAGAGTGGCTCCTGGTACGTTGAGACCCTGGACGACATCTTTGAGCAGTGGGC TCACTCTGAAGACCTGCAGTCCCTCCTGCTTAGGGTCGCTAATGCTGTTTCGGTGAAAGGGATTTATAAACAGATG CCTGGTTGCTTTAATTTCCTCCGGAAAAAACTTTTCTTTAAAACATCAGCTAGTTAA.
In the present invention, the Chimeric antigen receptor further includes promoter, and the promoter is in EF1a, CMV-TAR or CMV Any one or at least two combination.
According to the present invention, the Chimeric antigen receptor is transfected into T cell by the nucleic acid sequence of its coding and is expressed.
According to the present invention, the mode of the transfection is by appointing in viral vectors, eukaryon expression plasmid or mRNA sequence A kind of or at least two combinations of anticipating are transfected into T cell, are transfected into T cell preferably by viral vectors.
Preferably, the viral vectors is any one in slow virus carrier or retroviral vector or at least two Combination, preferably slow virus carrier.
Second aspect, the present invention provide a kind of recombinant slow virus, will include dual chimeric antigen as described in relation to the first aspect The recombinant lentiviral that the immunocyte and packaging helper plasmid pNHP and pHEF-VSVG cotransfection mammalian cell of acceptor gene modification obtain Virus.
In the present invention, the recombinant slow virus can effective immunocyte, including T cell can prepare targeting T-cells.
According to the present invention, the mammalian cell is 293 cells, in 293T cell or TE671 cell any one or extremely Few two kinds of combination.
The third aspect, the present invention provide a kind of pharmaceutical composition, comprising dual chimeric antigen as described in relation to the first aspect by The immunocyte of body gene modification and/or the recombinant slow virus as described in second aspect.
Fourth aspect, the present invention provide the immune thin of dual Chimeric antigen receptor gene modification as described in relation to the first aspect Born of the same parents, the recombinant slow virus as described in second aspect or the pharmaceutical composition as described in the third aspect are in preparation Chimeric antigen receptor T Application in cell, immunocompetent cell or tumor therapeutic agent.
In the present invention, the antigen receptor T cell has good targeting, at the same can discharge low dosage it is immune because Son has hypotoxicity reaction property.
Preferably, the tumour is the relevant tumor disease of blood and/or solid tumor, and the tumor disease is selected from but unlimited In leukaemia.
Compared with prior art, the invention has the following beneficial effects:
(1) dual Chimeric antigen receptor of the invention is based on by the way that T cell Chimerical receptor gene is specifically transformed The dual CAR-T cell of CD19 and PSMA is in conjunction with tumor surface antigen CD19 and PSMA, and it is stronger to kill tumor effect, tumor regression Effect becomes apparent；
(2) dual Chimeric antigen receptor of the invention can specificity identification tumor surface antigen CD19 and PSMA, CD19 Expression quantity is high in leukaemia and lymthoma with PSMA, has compared to other Chimeric antigen receptors and other tumour antigens and more pacifies Entirely, more significant effect is not susceptible to CD19 escape, it is easier to reach disease so that the immune effect of CAR-T cell enhances Place, improves the therapeutic effect of disease.
Detailed description of the invention
Fig. 1 is the synthetic gene sequence map of Chimeric antigen receptor CD19 and PSMA of the invention；
Fig. 2 is the schematic diagram that Chimeric antigen receptor CD19 and PSMA of the present invention is used in combination；
Fig. 3 is CD19 and PSMA immunohistochemical staining result figure, and sample is Lymphoma patients tumor tissues, and Fig. 3 (a) is one Follicular lymphoma specimens, Fig. 3 (b) diffuse big B Lymphoma tumor tissues figure for one；
Fig. 4 is 16 B cell lymphoma specimens immunohistochemical staining antigen presentation power statistics, is scored from 1+ It is weak to strongly expressed, Fig. 4 (a) CD19 expression strength distribution figure, Fig. 4 (b) PSMA expression strength distribution to 4+；
Fig. 5 is CD19 and PSMA Chimeric antigen receptor T cell combination therapy B cell leukemia/lymthoma clinical trial stream Cheng Tu；
Fig. 6 is combined clinical application CD19 and PSMA Chimeric antigen receptor T cell is treated a Gastric Lymphoma of Mucosa-Associated Lymphoid Tissue and suffered from Person measures CAR gene copy number in patient's body after feedback.
Specific embodiment
Further to illustrate technological means and its effect adopted by the present invention, below in conjunction with attached drawing and by specific real Mode to further illustrate the technical scheme of the present invention is applied, but the present invention is not limited in scope of embodiments.
In the examples where no specific technique or condition is specified, described technology or conditions according to the literature in the art, Or it is carried out according to product description.Reagents or instruments used without specified manufacturer, be can be by regular channel commercially available from The conventional products of acquisition.
The building of 1 Chimeric antigen receptor of embodiment
(1) by full genome synthesize Secretory signal peptide, CD19 or PSMA antigen-binding domains, CD8 α and/or CD28 transmembrane domain, CD28 signal transduction structural domain, CD27 signal transduction structural domain, CD3 ζ signal transduction structural domain, 2A sequence Column and 9 structural domain of Caspase, as shown in Figure 1, i.e. Secretory-CD19 scFv-CD28-CD27-CD3 ζ -2A- FBKP.Casp9 and Secretory-PSMA scFv-CD28-CD27-CD3 ζ -2A-FBKP.Casp9；Particular sequence is as follows:
The nucleotide sequence of Secretory-CD19scFv-CD28-CD27-CD3 ζ -2A-FBKP.Casp9 such as SEQ ID Shown in NO.5.
The nucleotide sequence such as SEQ ID of Secretory-PSMA scFv-CD28-CD27-CD3 ζ -2A-FBKP.Casp9 Shown in NO.7.
2 slow virus of embodiment packaging
(1) 293T cell is used, is cultivated 17-18 hours；
(2) fresh DMEM is added, includes 10% FBS；
(3) following reagent is added in sterile centrifugation tube: every hole takes DMEM that helper DNA mix (pNHP, pHEF- is added VSV-G) and pTYF DNA vector, vortex oscillation；
(4) centrifuge tube is added to Superfect or any transgenic line, be stored at room temperature 7-10 minutes；
(5) the DNA-Superfect mixed liquor in centrifuge tube is added dropwise in each culture cell, whirlpool is beaten；
(6) 37 DEG C of 3%CO2It is cultivated 4-5 hours in incubator；
(7) culture solution for siphoning away culture medium rinses culture medium with 293 cell culture fluids, and culture solution is added and continues to cultivate；
(8) culture medium is put back into 3%CO2Overnight incubation in incubator, the next morning are transfected with fluorescence microscope Efficiency.
The purifying and concentration of 3 slow virus of embodiment
1) viral purification
By being centrifuged 1000g, 5 minutes removing cell fragments obtain vial supernatant, with one 0.45 micron of low albumen Combined filtering device filters vial supernatant, and virus is distributed into aliquot, is stored in -80 DEG C；
Under normal conditions, in every milliliter of culture medium, transfection cell can produce 106To 107Transduced unit titrates slow Viral vectors.
2) slow virus carrier is concentrated with Centricon or similar filter
(1) vial supernatant is added in Centricon or similar screen pipe, is then centrifuged 30 minutes in 2500g；
(2) screen pipe is shaken, then 400g is centrifuged 2 minutes, collects the virus of concentration into collection cups.Finally by all pipes In virus focus in a centrifuge tube.
The transfection of embodiment 4CAR-T cell
By the T cell vaccination after activation into culture dish, the slow virus of concentration target gene is added, with 100g centrifugal force Speed is centrifuged 100 minutes, is placed in 37 DEG C of cultures for 24 hours, and the AIM-V culture medium for having the cell culture factor is added, after culture 2-3 days, Cell is harvested and counted, available CD19 CAR-T cell is become.
The external malignant B cell strain killing of CD19 and PSMA CAR-T cell is used in combination in embodiment 5
(1) figure it is seen that by CD19 combine PSMA can combination therapy tumour, indicate that the present invention selects double Weight Chimeric antigen receptor can play a significant role to oncotherapy, and prevent CD19 from escaping.
(2) identification killing ability of the dual CAR-T cell of evaluating in vitro to target cell: by non-specific T cell, GD2 CD19 CART and PSMA CART cell and expression CD19, PSMA prepared by CAR-T cell and the application but the target for not expressing GD2 Cell, that is, RS4-11 people's acute lymphatic leukaemia cell strain of expression GFP, lymphoma cell strain OCI-Ly3, lymthoma are thin Born of the same parents strain SUD-HL8 (T cell: tumor cell line=3:1), is placed in 37 ° of 5%CO2Incubator co-cultures for 24 hours；
It (3) include GD2 CART, CD19 by non-specific T cell or the CAR-T cell of unlike signal transduction domain CART, PSMA CART and CD19 CART+PSMA CART and RS4-11 of the present invention are placed in 37 degree of 5%CO2Incubator co-cultures 24h.The RS4-11 cell proportion of 24 hour record survivals after culture.
Compared to control group T cell and GD2 CART, CD19 CART, PSMA CART and CD19 CART+PSMA of the present invention CART causes RS4-11 cell significantly to kill effect.After 24 hours apparently, although CD19 CART+PSMA CART kills energy Power is slightly weaker than CD19 CART, is better than PSMA CART.Show that CD19CART+PSMA CART of the present invention can be to leukaemia cell It is melted.
The clinical application of embodiment 6CD19 and PSMA CAR-T cell
Sample: 75 years old women is diagnosed as Gastric Lymphoma of Mucosa-Associated Lymphoid Tissue two-and-a-half years, after multiple chemotherapy, Lung metastases occurs, uses Mabthera is crossed, lung tumors are still in progress, left side pleural effusion.It injects, is swollen under mark in subsequent Mabthera and bevacizumab thoracic cavity Drop unobvious, pulmonary lesions still have a small amount of pleural effusion without significant change.
CD19CART has developed for many years at present, has good effect to treatment B acute lymphoblastic tumour, and in lymthoma Treatment on, it has been found that fail to reach 85% or more complete incidence graph as leukaemia, many patients only observe part Alleviate or only maintain tumor stabilisation, then passes through and carried out the mono- target treatment of CD19CART in this center for the past, and by sheet The patient that the heart rather than the third-party institution carry out CD19 immunohistochemical staining to its tumour counts, as a result as shown in table 1 below, 9 In the patient of position, there is the patient of 4 CD19 strongly expresseds all to reach complete incidence graph, in addition the patient of 5 CD19 weak expressions, only 1 Position reaches complete incidence graph, other 4 only parts are alleviated, and maintains stable disease or progression of disease, it is shown that CD19 expression is strong The weak therapeutic effect for affecting CD19CART, for this limitation, we want that combine other target spots treats with CD19CART.
Table 1
Remarks: n=9 is to contaminate the Lymphoma patients of CD19 according to number in immunohistochemistry table, has only done the mono- target spot of CD19 Patient.
The antigen dyeing identification antigens c ART target spot of 7 tumour cell of embodiment
After the tumor tissues that operation obtains are fixed, block sections are placed on slide, dye to tumour antigen, are made With CD19 and PSMA specific antibody.Before feedback, this research center carries out immunohistochemical staining, target spot to its tumor biopsy CD19, PSMA strong positive, as a result as shown in Fig. 3 (a)-Fig. 3 (b), compared with the control group, this two tumor patient tumors are expressed simultaneously CD19 and PSMA antigen, it is strong and weak further directed to 10 B cell lymphoma specimens immunohistochemical staining antigen presentations It is counted, the patient CD19 that Fig. 4 (a) shows 53% is strongly expressed (3-4+), 47% patient's weak expression or is not expressed CD19 antigen (0-2+), Fig. 4 (b) show 71% patient's height expression CD70 antigen, its CD70 low expression of 29% tissue of patient Or it does not express.It can be seen that according to above data, CD70 is widely expressed in lympha tumour really, can be combined CD19CART and be done Treatment.
According to the above results carry out clinical test, flow chart as shown in figure 5, Case treatment case specific step is as follows, knot Fruit is as shown in Figure 6:
(1) the dense white blood cell liquid of patient is collected first, and wherein isolates CD3 positive T cell certainly, in embodiment 4 Method makes CART cell, is divided into two batches, feeds back patient's body.CD19 CART cell dosage amounts to 1 × 106CART cell Per kilogram of body weight, PSMA CART cell dosage amount to 1 × 106CART cell per kilogram of body weight；
(2) patient pre-processes before infusion through cyclophosphamide and fludarabine, and average infused cells number is per kilogram of body weight 1×106The quality of cell, leucocyte and CAR-T cell, gene transfection efficiency, CAR-T cell amplification situation and effective CAR-T are thin Born of the same parents are transfused number by assessment and record；
(3) after patient feeds back CAR-T cell, its immune factor storm and CAR copy number can be monitored closely in one month, Specific copy number results are as shown in Figure 6.
Specific clinical test results are as follows:
1) phenomena such as some out of strength and appetite are slightly worse in three weeks after feeding back, without other discomforts.The 83rd day after feedback, CT check Tumor reduces half, and no hydrothorax, life is as usual, and CA125 is normal.
2) 7 months still situation normal tables are fed back.From fig. 6, it can be seen that being most higher than after feedback the 21st day, divide in peripheral blood 1.58% CD19 CART cell, 0.25% PSMA CART can not measured；The 42nd day after feedback, it can also be surveyed respectively in peripheral blood To 0.15%CD19CART cell, 0.02% PSMA CART；Show that two kinds of CART cells are good in internal amplification.
3) it pays a return visit within three months after feeding back, the patient body balanced condition, physiological status is good, temporarily and does not rely on other drugs It maintains.
In conclusion dual Chimeric antigen receptor of the invention can specificity identification tumor surface antigen CD19 and PSMA is used in combination two kinds of CAR-T cells and makes therapeutic effect more compared to other single Chimeric antigen receptor T cells are used It is good, it is not susceptible to CD19 escape, it is easier to allow remission.
The Applicant declares that the present invention is explained by the above embodiments method detailed of the invention, but the present invention not office Be limited to above-mentioned method detailed, that is, do not mean that the invention must rely on the above detailed methods to implement.Technical field Technical staff it will be clearly understood that any improvement in the present invention, equivalence replacement and auxiliary element to each raw material of product of the present invention Addition, selection of concrete mode etc., all of which fall within the scope of protection and disclosure of the present invention.
SEQUENCE LISTING
<110>Beijing Meikang Ji Mian Biotechnology Co., Ltd
<120>a kind of immunocyte of dual Chimeric antigen receptor gene modification based on CD19 and PSMA and its application
<130> 2018
<160> 9
<170> PatentIn version 3.3
<210> 1
<211> 245
<212> PRT
<213>artificial synthesized sequence
<400> 1
Asp Ile Gln Met Thr Gln Thr Thr Ser Ser Leu Ser Ala Ser Leu Gly
1 5 10 15
Asp Arg Val Thr Ile Ser Cys Arg Ala Ser Gln Asp Ile Ser Lys Tyr
20 25 30
Leu Asn Trp Tyr Gln Gln Lys Pro Asp Gly Thr Val Lys Leu Leu Ile
35 40 45
Tyr His Thr Ser Arg Leu His Ser Gly Val Pro Ser Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Ser Asn Leu Glu Gln
65 70 75 80
Glu Asp Ile Ala Thr Tyr Phe Cys Gln Gln Gly Asn Thr Leu Pro Tyr
85 90 95
Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Thr Gly Ser Thr Ser Gly
100 105 110
Ser Gly Lys Pro Gly Ser Gly Glu Gly Ser Thr Lys Gly Glu Val Lys
115 120 125
Leu Gln Glu Ser Gly Pro Gly Leu Val Ala Pro Ser Gln Ser Leu Ser
130 135 140
Val Thr Cys Thr Val Ser Gly Val Ser Leu Pro Asp Tyr Gly Val Ser
145 150 155 160
Trp Ile Arg Gln Pro Pro Arg Lys Gly Leu Glu Trp Leu Gly Val Ile
165 170 175
Trp Gly Ser Glu Thr Thr Tyr Tyr Asn Ser Ala Leu Lys Ser Arg Leu
180 185 190
Thr Ile Ile Lys Asp Asn Ser Lys Ser Gln Val Phe Leu Lys Met Asn
195 200 205
Ser Leu Gln Thr Asp Asp Thr Ala Ile Tyr Tyr Cys Ala Lys His Tyr
210 215 220
Tyr Tyr Gly Gly Ser Tyr Ala Met Asp Tyr Trp Gly Gln Gly Thr Ser
225 230 235 240
Val Thr Val Ser Ser
245
<210> 2
<211> 240
<212> PRT
<213>artificial synthesized sequence
<400> 2
Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala
1 5 10 15
Ser Val Lys Ile Ser Cys Lys Ile Ser Gly Tyr Thr Phe Thr Glu Tyr
20 25 30
Thr Ile His Trp Val Lys Gln Ala Ser Gly Lys Gly Leu Glu Trp Ile
35 40 45
Gly Asn Ile Asn Pro Asn Asn Gly Gly Thr Thr Tyr Asn Gln Lys Phe
50 55 60
Glu Asp Arg Ala Thr Leu Thr Val Asp Lys Ser Thr Ser Thr Ala Tyr
65 70 75 80
Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Ala Gly Trp Asn Phe Asp Tyr Trp Gly Gln Gly Thr Thr Val Thr
100 105 110
Val Ser Ser Gly Ser Thr Ser Gly Ser Gly Lys Pro Gly Ser Ser Glu
115 120 125
Gly Ser Thr Lys Gly Asp Ile Val Met Thr Gln Ser Pro Ser Ser Leu
130 135 140
Ser Ala Ser Val Gly Asp Arg Val Thr Ile Ile Cys Lys Ala Ser Gln
145 150 155 160
Asp Val Gly Thr Ala Val Asp Trp Tyr Gln Gln Lys Pro Gly Lys Ala
165 170 175
Pro Lys Leu Leu Ile Tyr Trp Ala Ser Thr Arg His Thr Gly Val Pro
180 185 190
Asp Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile
195 200 205
Ser Ser Leu Gln Pro Glu Asp Phe Ala Asp Tyr Phe Cys Gln Gln Tyr
210 215 220
Asn Ser Tyr Pro Leu Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys
225 230 235 240
<210> 3
<211> 423
<212> PRT
<213>artificial synthesized sequence
<400> 3
Gly Ser Gly Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val
1 5 10 15
Glu Glu Asn Pro Gly Pro Met Gly Val Gln Val Glu Thr Ile Ser Pro
20 25 30
Gly Asp Gly Arg Thr Phe Pro Lys Arg Gly Gln Thr Cys Val Val His
35 40 45
Tyr Thr Gly Met Leu Glu Asp Gly Lys Lys Val Asp Ser Ser Arg Asp
50 55 60
Arg Asn Lys Pro Phe Lys Phe Met Leu Gly Lys Gln Glu Val Ile Arg
65 70 75 80
Gly Trp Glu Glu Gly Val Ala Gln Met Ser Val Gly Gln Arg Ala Lys
85 90 95
Leu Thr Ile Ser Pro Asp Tyr Ala Tyr Gly Ala Thr Gly His Pro Gly
100 105 110
Ile Ile Pro Pro His Ala Thr Leu Val Phe Asp Val Glu Leu Leu Lys
115 120 125
Leu Glu Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Ala Met Val
130 135 140
Gly Ala Leu Glu Ser Leu Arg Gly Asn Ala Asp Leu Ala Tyr Ile Leu
145 150 155 160
Ser Met Glu Pro Cys Gly His Cys Leu Ile Ile Asn Asn Val Asn Phe
165 170 175
Cys Arg Glu Ser Gly Leu Arg Thr Arg Thr Gly Ser Asn Ile Asp Cys
180 185 190
Glu Lys Leu Arg Arg Arg Phe Ser Ser Leu His Phe Met Val Glu Val
195 200 205
Lys Gly Asp Leu Thr Ala Lys Lys Met Val Leu Ala Leu Leu Glu Leu
210 215 220
Ala Arg Gln Asp His Gly Ala Leu Asp Cys Cys Val Val Val Ile Leu
225 230 235 240
Ser His Gly Cys Gln Ala Ser His Leu Gln Phe Pro Gly Ala Val Tyr
245 250 255
Gly Thr Asp Gly Cys Pro Val Ser Val Glu Lys Ile Val Asn Ile Phe
260 265 270
Asn Gly Thr Ser Cys Pro Ser Leu Gly Gly Lys Pro Lys Leu Phe Phe
275 280 285
Ile Gln Ala Cys Gly Gly Glu Gln Lys Asp His Gly Phe Glu Val Ala
290 295 300
Ser Thr Ser Pro Glu Asp Glu Ser Pro Gly Ser Asn Pro Glu Pro Asp
305 310 315 320
Ala Thr Pro Phe Gln Glu Gly Leu Arg Thr Phe Asp Gln Leu Asp Ala
325 330 335
Ile Ser Ser Leu Pro Thr Pro Ser Asp Ile Phe Val Ser Tyr Ser Thr
340 345 350
Phe Pro Gly Phe Val Ser Trp Arg Asp Pro Lys Ser Gly Ser Trp Tyr
355 360 365
Val Glu Thr Leu Asp Asp Ile Phe Glu Gln Trp Ala His Ser Glu Asp
370 375 380
Leu Gln Ser Leu Leu Leu Arg Val Ala Asn Ala Val Ser Val Lys Gly
385 390 395 400
Ile Tyr Lys Gln Met Pro Gly Cys Phe Asn Phe Leu Arg Lys Lys Leu
405 410 415
Phe Phe Lys Thr Ser Ala Ser
420
<210> 4
<211> 986
<212> PRT
<213>artificial synthesized sequence
<400> 4
Met Leu Leu Leu Val Thr Ser Leu Leu Leu Cys Glu Leu Pro His Pro
1 5 10 15
Ala Phe Leu Leu Ile Pro Gln Val Gln Leu Val Gln Ser Gly Ala Glu
20 25 30
Val Lys Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly
35 40 45
Tyr Thr Phe Thr Asn Tyr Gly Met Asn Trp Val Arg Gln Ala Pro Gly
50 55 60
Gln Gly Leu Glu Trp Met Gly Trp Ile Asn Thr Tyr Thr Gly Glu Pro
65 70 75 80
Thr Tyr Ala Asp Ala Phe Lys Gly Arg Val Thr Met Thr Thr Asp Thr
85 90 95
Ser Thr Ser Thr Ala Tyr Met Glu Leu Arg Ser Leu Arg Ser Asp Asp
100 105 110
Thr Ala Val Tyr Tyr Cys Ala Arg Asp Tyr Gly Asp Tyr Gly Met Asp
115 120 125
Tyr Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser Gly Ser Thr Ser
130 135 140
Gly Ser Gly Lys Pro Gly Ser Ser Glu Gly Ser Thr Lys Gly Asp Ile
145 150 155 160
Val Met Thr Gln Ser Pro Asp Ser Leu Ala Val Ser Leu Gly Glu Arg
165 170 175
Ala Thr Ile Asn Cys Arg Ala Ser Lys Ser Val Ser Thr Ser Gly Tyr
180 185 190
Ser Phe Met His Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu
195 200 205
Leu Ile Tyr Leu Ala Ser Asn Leu Glu Ser Gly Val Pro Asp Arg Phe
210 215 220
Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu
225 230 235 240
Gln Ala Glu Asp Val Ala Val Tyr Tyr Cys Gln His Ser Arg Glu Val
245 250 255
Pro Trp Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Ala Ala Ala
260 265 270
Ile Glu Val Met Tyr Pro Pro Pro Tyr Leu Asp Asn Glu Lys Ser Asn
275 280 285
Gly Thr Ile Ile His Val Lys Gly Lys His Leu Cys Pro Ser Pro Leu
290 295 300
Phe Pro Gly Pro Ser Lys Pro Phe Trp Val Leu Val Val Val Gly Gly
305 310 315 320
Val Leu Ala Cys Tyr Ser Leu Leu Val Thr Val Ala Phe Ile Ile Phe
325 330 335
Trp Val Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met Asn
340 345 350
Met Thr Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr
355 360 365
Ala Pro Pro Arg Asp Phe Ala Ala Tyr Arg Ser Ala Ser Gly Gly Gly
370 375 380
Gly Ser Gly Gly Gly Gly Ser Gln Arg Arg Lys Tyr Arg Ser Asn Lys
385 390 395 400
Gly Glu Ser Pro Val Glu Pro Ala Glu Pro Cys His Tyr Ser Cys Pro
405 410 415
Arg Glu Glu Glu Gly Ser Thr Ile Pro Ile Gln Glu Asp Tyr Arg Lys
420 425 430
Pro Glu Pro Ala Cys Ser Pro Gly Gly Gly Gly Ser Gly Gly Gly Gly
435 440 445
Ser Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln
450 455 460
Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu
465 470 475 480
Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly
485 490 495
Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln
500 505 510
Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu
515 520 525
Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr
530 535 540
Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro
545 550 555 560
Arg Thr Ser Gly Ser Gly Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala
565 570 575
Gly Asp Val Glu Glu Asn Pro Gly Pro Met Gly Val Gln Val Glu Thr
580 585 590
Ile Ser Pro Gly Asp Gly Arg Thr Phe Pro Lys Arg Gly Gln Thr Cys
595 600 605
Val Val His Tyr Thr Gly Met Leu Glu Asp Gly Lys Lys Val Asp Ser
610 615 620
Ser Arg Asp Arg Asn Lys Pro Phe Lys Phe Met Leu Gly Lys Gln Glu
625 630 635 640
Val Ile Arg Gly Trp Glu Glu Gly Val Ala Gln Met Ser Val Gly Gln
645 650 655
Arg Ala Lys Leu Thr Ile Ser Pro Asp Tyr Ala Tyr Gly Ala Thr Gly
660 665 670
His Pro Gly Ile Ile Pro Pro His Ala Thr Leu Val Phe Asp Val Glu
675 680 685
Leu Leu Lys Leu Glu Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
690 695 700
Ala Met Val Gly Ala Leu Glu Ser Leu Arg Gly Asn Ala Asp Leu Ala
705 710 715 720
Tyr Ile Leu Ser Met Glu Pro Cys Gly His Cys Leu Ile Ile Asn Asn
725 730 735
Val Asn Phe Cys Arg Glu Ser Gly Leu Arg Thr Arg Thr Gly Ser Asn
740 745 750
Ile Asp Cys Glu Lys Leu Arg Arg Arg Phe Ser Ser Leu His Phe Met
755 760 765
Val Glu Val Lys Gly Asp Leu Thr Ala Lys Lys Met Val Leu Ala Leu
770 775 780
Leu Glu Leu Ala Arg Gln Asp His Gly Ala Leu Asp Cys Cys Val Val
785 790 795 800
Val Ile Leu Ser His Gly Cys Gln Ala Ser His Leu Gln Phe Pro Gly
805 810 815
Ala Val Tyr Gly Thr Asp Gly Cys Pro Val Ser Val Glu Lys Ile Val
820 825 830
Asn Ile Phe Asn Gly Thr Ser Cys Pro Ser Leu Gly Gly Lys Pro Lys
835 840 845
Leu Phe Phe Ile Gln Ala Cys Gly Gly Glu Gln Lys Asp His Gly Phe
850 855 860
Glu Val Ala Ser Thr Ser Pro Glu Asp Glu Ser Pro Gly Ser Asn Pro
865 870 875 880
Glu Pro Asp Ala Thr Pro Phe Gln Glu Gly Leu Arg Thr Phe Asp Gln
885 890 895
Leu Asp Ala Ile Ser Ser Leu Pro Thr Pro Ser Asp Ile Phe Val Ser
900 905 910
Tyr Ser Thr Phe Pro Gly Phe Val Ser Trp Arg Asp Pro Lys Ser Gly
915 920 925
Ser Trp Tyr Val Glu Thr Leu Asp Asp Ile Phe Glu Gln Trp Ala His
930 935 940
Ser Glu Asp Leu Gln Ser Leu Leu Leu Arg Val Ala Asn Ala Val Ser
945 950 955 960
Val Lys Gly Ile Tyr Lys Gln Met Pro Gly Cys Phe Asn Phe Leu Arg
965 970 975
Lys Lys Leu Phe Phe Lys Thr Ser Ala Ser
980 985
<210> 5
<211> 2955
<212> DNA
<213>artificial synthesized sequence
<400> 5
atgctgctgc tggtcacaag cctgctgctg tgcgagctgc cccaccccgc ctttctgctg 60
atccccgaca tccagatgac ccagaccacc agcagcctga gcgccagcct gggcgacaga 120
gtgaccatca gctgccgggc cagccaggac atcagcaagt acctgaactg gtatcagcag 180
aaacccgacg gcaccgtgaa gctgctgatc taccacacca gccggctgca cagcggcgtg 240
cccagcagat tttctggcag cggatctggc accgactaca gcctgaccat ctccaacctg 300
gaacaggaag atatcgctac ctacttctgt cagcagggca acaccctgcc ctacaccttc 360
ggcggaggca ccaagctgga aatcaccggc agcaccagcg gctccggcaa gcctggatct 420
ggcgagggca gcaccaaggg cgaagtgaag ctgcaggaaa gcggccctgg cctggtcgcc 480
cctagccaga gcctgtccgt gacctgtacc gtgtccggcg tgtccctgcc cgactacggc 540
gtgtcctgga tcagacagcc ccccagaaag ggcctggaat ggctgggcgt gatctggggc 600
agcgagacaa cctactacaa cagcgccctg aagtcccggc tgaccatcat caaggacaac 660
agcaagagcc aggtgttcct gaagatgaac agcctgcaga ccgacgacac cgccatctac 720
tactgcgcca agcactacta ctacggcggc agctacgcca tggactactg gggccagggc 780
accagcgtga cagtctcttc tgcggccgca attgaagtta tgtatcctcc tccttaccta 840
gacaatgaga agagcaatgg aaccattatc catgtgaaag ggaaacacct ttgtccaagt 900
cccctatttc ccggaccttc taagcccttt tgggtgctgg tggtggttgg gggagtcctg 960
gcttgctata gcttgctagt aacagtggcc tttattattt tctgggtgag gagtaagagg 1020
agcaggctcc tgcacagtga ctacatgaac atgactcccc gccgccctgg gcccacccgc 1080
aagcattacc agccctatgc cccaccacgc gacttcgcag cctatcgctc cgctagcgga 1140
ggtggaggtt ctggaggtgg tggaagtcaa agaaggaagt accgcagcaa caaaggagaa 1200
tctcccgtcg agccagccga gccctgtcat tattcatgcc caagggagga ggagggaagt 1260
acaatcccaa ttcaagaaga ctacaggaag cccgaacctg catgcagtcc aggtggaggc 1320
ggttctggag gcggtggctc ccgggtgaaa ttctcacggt ctgcagacgc acccgcttac 1380
cagcaaggcc agaaccaact ctataacgag ctcaatctag gacgaagaga ggagtacgat 1440
gttttggaca agagacgtgg ccgggaccct gagatggggg gaaagccgag aaggaagaac 1500
cctcaggaag gcctgtacaa tgaactgcag aaagataaga tggcggaggc ctacagtgag 1560
attgggatga aaggcgagcg ccggaggggc aaggggcacg atggccttta ccagggtctc 1620
agtacagcca ccaaggacac ctacgacgcc cttcacatgc aggccctgcc ccctcgcact 1680
agtggctccg gagccacgaa cttctctctg ttaaagcaag caggagacgt ggaagaaaac 1740
cccggtccca tgggagtgca ggtggaaacc atctccccag gagacgggcg caccttcccc 1800
aagcgcggcc agacctgcgt ggtgcactac accgggatgc ttgaagatgg aaagaaagtg 1860
gactcctccc gggacagaaa caagcccttt aagtttatgc taggcaagca ggaggtgatc 1920
cgaggctggg aagaaggggt tgcccagatg agtgtgggtc agagagccaa actgactata 1980
tctccagatt atgcctatgg tgccactggg cacccaggca tcatcccacc acatgccact 2040
ctcgtcttcg atgtggagct tctaaaactg gaaggtggag gcggttcagg cggcggcggc 2100
agcggcgcca tggtcggtgc tcttgagagt ttgaggggaa atgcagattt ggcttacatc 2160
ctgagcatgg agccctgtgg ccactgcctc attatcaaca atgtgaactt ctgccgtgag 2220
tccgggctcc gcacccgcac tggctccaac atcgactgtg agaagttgcg gcgtcgcttc 2280
tcctcgctgc atttcatggt ggaggtgaag ggcgacctga ctgccaagaa aatggtgctg 2340
gctttgctgg agctggcgcg gcaggaccac ggtgctctgg actgctgcgt ggtggtcatt 2400
ctctctcacg gctgtcaggc cagccacctg cagttcccag gggctgtcta cggcacagat 2460
ggatgccctg tgtcggtcga gaagattgtg aacatcttca atgggaccag ctgccccagc 2520
ctgggaggga agcccaagct ctttttcatc caggcctgtg gtggggagca gaaagaccat 2580
gggtttgagg tggcctccac ttcccctgaa gacgagtccc ctggcagtaa ccccgagcca 2640
gatgccaccc cgttccagga aggtttgagg accttcgacc agctggacgc catatctagt 2700
ttgcccacac ccagtgacat ctttgtgtcc tactctactt tcccaggttt tgtttcctgg 2760
agggacccca agagtggctc ctggtacgtt gagaccctgg acgacatctt tgagcagtgg 2820
gctcactctg aagacctgca gtccctcctg cttagggtcg ctaatgctgt ttcggtgaaa 2880
gggatttata aacagatgcc tggttgcttt aatttcctcc ggaaaaaact tttctttaaa 2940
acatcagcta gttaa 2955
<210> 6
<211> 978
<212> PRT
<213>artificial synthesized sequence
<400> 6
Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu
1 5 10 15
His Ala Ala Arg Pro Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val
20 25 30
Lys Lys Pro Gly Ala Ser Val Lys Ile Ser Cys Lys Ile Ser Gly Tyr
35 40 45
Thr Phe Thr Glu Tyr Thr Ile His Trp Val Lys Gln Ala Ser Gly Lys
50 55 60
Gly Leu Glu Trp Ile Gly Asn Ile Asn Pro Asn Asn Gly Gly Thr Thr
65 70 75 80
Tyr Asn Gln Lys Phe Glu Asp Arg Ala Thr Leu Thr Val Asp Lys Ser
85 90 95
Thr Ser Thr Ala Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr
100 105 110
Ala Val Tyr Tyr Cys Ala Ala Gly Trp Asn Phe Asp Tyr Trp Gly Gln
115 120 125
Gly Thr Thr Val Thr Val Ser Ser Gly Ser Thr Ser Gly Ser Gly Lys
130 135 140
Pro Gly Ser Ser Glu Gly Ser Thr Lys Gly Asp Ile Val Met Thr Gln
145 150 155 160
Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Ile
165 170 175
Cys Lys Ala Ser Gln Asp Val Gly Thr Ala Val Asp Trp Tyr Gln Gln
180 185 190
Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Trp Ala Ser Thr Arg
195 200 205
His Thr Gly Val Pro Asp Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp
210 215 220
Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Asp Tyr
225 230 235 240
Phe Cys Gln Gln Tyr Asn Ser Tyr Pro Leu Thr Phe Gly Gly Gly Thr
245 250 255
Lys Leu Glu Ile Lys Ala Ala Ala Ile Glu Val Met Tyr Pro Pro Pro
260 265 270
Tyr Leu Asp Asn Glu Lys Ser Asn Gly Thr Ile Ile His Val Lys Gly
275 280 285
Lys His Leu Cys Pro Ser Pro Leu Phe Pro Gly Pro Ser Lys Pro Phe
290 295 300
Trp Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu Leu
305 310 315 320
Val Thr Val Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg Ser Arg
325 330 335
Leu Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro Gly Pro
340 345 350
Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe Ala Ala
355 360 365
Tyr Arg Ser Ala Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gln
370 375 380
Arg Arg Lys Tyr Arg Ser Asn Lys Gly Glu Ser Pro Val Glu Pro Ala
385 390 395 400
Glu Pro Cys His Tyr Ser Cys Pro Arg Glu Glu Glu Gly Ser Thr Ile
405 410 415
Pro Ile Gln Glu Asp Tyr Arg Lys Pro Glu Pro Ala Cys Ser Pro Gly
420 425 430
Gly Gly Gly Ser Gly Gly Gly Gly Ser Arg Val Lys Phe Ser Arg Ser
435 440 445
Ala Asp Ala Pro Ala Tyr Gln Gln Gly Gln Asn Gln Leu Tyr Asn Glu
450 455 460
Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp Val Leu Asp Lys Arg Arg
465 470 475 480
Gly Arg Asp Pro Glu Met Gly Gly Lys Pro Arg Arg Lys Asn Pro Gln
485 490 495
Glu Gly Leu Tyr Asn Glu Leu Gln Lys Asp Lys Met Ala Glu Ala Tyr
500 505 510
Ser Glu Ile Gly Met Lys Gly Glu Arg Arg Arg Gly Lys Gly His Asp
515 520 525
Gly Leu Tyr Gln Gly Leu Ser Thr Ala Thr Lys Asp Thr Tyr Asp Ala
530 535 540
Leu His Met Gln Ala Leu Pro Pro Arg Thr Ser Gly Ser Gly Ala Thr
545 550 555 560
Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val Glu Glu Asn Pro Gly
565 570 575
Pro Met Gly Val Gln Val Glu Thr Ile Ser Pro Gly Asp Gly Arg Thr
580 585 590
Phe Pro Lys Arg Gly Gln Thr Cys Val Val His Tyr Thr Gly Met Leu
595 600 605
Glu Asp Gly Lys Lys Val Asp Ser Ser Arg Asp Arg Asn Lys Pro Phe
610 615 620
Lys Phe Met Leu Gly Lys Gln Glu Val Ile Arg Gly Trp Glu Glu Gly
625 630 635 640
Val Ala Gln Met Ser Val Gly Gln Arg Ala Lys Leu Thr Ile Ser Pro
645 650 655
Asp Tyr Ala Tyr Gly Ala Thr Gly His Pro Gly Ile Ile Pro Pro His
660 665 670
Ala Thr Leu Val Phe Asp Val Glu Leu Leu Lys Leu Glu Gly Gly Gly
675 680 685
Gly Ser Gly Gly Gly Gly Ser Gly Ala Met Val Gly Ala Leu Glu Ser
690 695 700
Leu Arg Gly Asn Ala Asp Leu Ala Tyr Ile Leu Ser Met Glu Pro Cys
705 710 715 720
Gly His Cys Leu Ile Ile Asn Asn Val Asn Phe Cys Arg Glu Ser Gly
725 730 735
Leu Arg Thr Arg Thr Gly Ser Asn Ile Asp Cys Glu Lys Leu Arg Arg
740 745 750
Arg Phe Ser Ser Leu His Phe Met Val Glu Val Lys Gly Asp Leu Thr
755 760 765
Ala Lys Lys Met Val Leu Ala Leu Leu Glu Leu Ala Arg Gln Asp His
770 775 780
Gly Ala Leu Asp Cys Cys Val Val Val Ile Leu Ser His Gly Cys Gln
785 790 795 800
Ala Ser His Leu Gln Phe Pro Gly Ala Val Tyr Gly Thr Asp Gly Cys
805 810 815
Pro Val Ser Val Glu Lys Ile Val Asn Ile Phe Asn Gly Thr Ser Cys
820 825 830
Pro Ser Leu Gly Gly Lys Pro Lys Leu Phe Phe Ile Gln Ala Cys Gly
835 840 845
Gly Glu Gln Lys Asp His Gly Phe Glu Val Ala Ser Thr Ser Pro Glu
850 855 860
Asp Glu Ser Pro Gly Ser Asn Pro Glu Pro Asp Ala Thr Pro Phe Gln
865 870 875 880
Glu Gly Leu Arg Thr Phe Asp Gln Leu Asp Ala Ile Ser Ser Leu Pro
885 890 895
Thr Pro Ser Asp Ile Phe Val Ser Tyr Ser Thr Phe Pro Gly Phe Val
900 905 910
Ser Trp Arg Asp Pro Lys Ser Gly Ser Trp Tyr Val Glu Thr Leu Asp
915 920 925
Asp Ile Phe Glu Gln Trp Ala His Ser Glu Asp Leu Gln Ser Leu Leu
930 935 940
Leu Arg Val Ala Asn Ala Val Ser Val Lys Gly Ile Tyr Lys Gln Met
945 950 955 960
Pro Gly Cys Phe Asn Phe Leu Arg Lys Lys Leu Phe Phe Lys Thr Ser
965 970 975
Ala Ser
<210> 7
<211> 2937
<212> DNA
<213>artificial synthesized sequence
<400> 7
atggccctcc ctgttaccgc tctgctcctc cccttggccc ttctgctgca tgcagccaga 60
cctgaggtcc aactggtgca gtctggtgct gaagtgaaga agcctggtgc cagcgtgaag 120
attagctgca agattagcgg ctacaccttc accgagtata ccattcactg ggtcaaacaa 180
gcctctggaa aagggctgga atggataggc aatatcaacc ccaacaatgg cggaacaacc 240
tacaaccaaa agtttgagga tcgtgccact ctgacggttg acaagtccac gagcacagcc 300
tacatggagc tgtcaagtct gaggtccgag gatactgcgg tctactattg tgctgctggg 360
tggaacttcg actattgggg acagggtacg acagttactg tgtcctcagg ctcaacatcc 420
ggctctggaa agcctgggtc cagtgaaggg agcacaaaag gggacatcgt gatgacccag 480
tctccaagca gccttagcgc tagtgtaggg gatcgagtga ccatcatctg caaagcatct 540
caggacgtag gcactgcagt ggattggtat cagcagaaac caggaaaagc gccgaaactg 600
ttgatctact gggcaagtac acgccacact ggagtcccag atcggtttac cgggtccggc 660
tcaggcactg acttcactct gaccatttcc tctcttcagc ccgaagattt tgccgactac 720
ttctgtcagc agtacaatag ctatcccctg acatttggcg gtggaacaaa gctcgagata 780
aaggcggccg caattgaagt tatgtatcct cctccttacc tagacaatga gaagagcaat 840
ggaaccatta tccatgtgaa agggaaacac ctttgtccaa gtcccctatt tcccggacct 900
tctaagccct tttgggtgct ggtggtggtt gggggagtcc tggcttgcta tagcttgcta 960
gtaacagtgg cctttattat tttctgggtg aggagtaaga ggagcaggct cctgcacagt 1020
gactacatga acatgactcc ccgccgccct gggcccaccc gcaagcatta ccagccctat 1080
gccccaccac gcgacttcgc agcctatcgc tccgctagcg gaggtggagg ttctggaggt 1140
ggtggaagtc aaagaaggaa gtaccgcagc aacaaaggag aatctcccgt cgagccagcc 1200
gagccctgtc attattcatg cccaagggag gaggagggaa gtacaatccc aattcaagaa 1260
gactacagga agcccgaacc tgcatgcagt ccaggtggag gcggttctgg aggcggtggc 1320
tcccgggtga aattctcacg gtctgcagac gcacccgctt accagcaagg ccagaaccaa 1380
ctctataacg agctcaatct aggacgaaga gaggagtacg atgttttgga caagagacgt 1440
ggccgggacc ctgagatggg gggaaagccg agaaggaaga accctcagga aggcctgtac 1500
aatgaactgc agaaagataa gatggcggag gcctacagtg agattgggat gaaaggcgag 1560
cgccggaggg gcaaggggca cgatggcctt taccagggtc tcagtacagc caccaaggac 1620
acctacgacg cccttcacat gcaggccctg ccccctcgca ctagtggctc cggagccacg 1680
aacttctctc tgttaaagca agcaggagac gtggaagaaa accccggtcc catgggagtg 1740
caggtggaaa ccatctcccc aggagacggg cgcaccttcc ccaagcgcgg ccagacctgc 1800
gtggtgcact acaccgggat gcttgaagat ggaaagaaag tggactcctc ccgggacaga 1860
aacaagccct ttaagtttat gctaggcaag caggaggtga tccgaggctg ggaagaaggg 1920
gttgcccaga tgagtgtggg tcagagagcc aaactgacta tatctccaga ttatgcctat 1980
ggtgccactg ggcacccagg catcatccca ccacatgcca ctctcgtctt cgatgtggag 2040
cttctaaaac tggaaggtgg aggcggttca ggcggcggcg gcagcggcgc catggtcggt 2100
gctcttgaga gtttgagggg aaatgcagat ttggcttaca tcctgagcat ggagccctgt 2160
ggccactgcc tcattatcaa caatgtgaac ttctgccgtg agtccgggct ccgcacccgc 2220
actggctcca acatcgactg tgagaagttg cggcgtcgct tctcctcgct gcatttcatg 2280
gtggaggtga agggcgacct gactgccaag aaaatggtgc tggctttgct ggagctggcg 2340
cggcaggacc acggtgctct ggactgctgc gtggtggtca ttctctctca cggctgtcag 2400
gccagccacc tgcagttccc aggggctgtc tacggcacag atggatgccc tgtgtcggtc 2460
gagaagattg tgaacatctt caatgggacc agctgcccca gcctgggagg gaagcccaag 2520
ctctttttca tccaggcctg tggtggggag cagaaagacc atgggtttga ggtggcctcc 2580
acttcccctg aagacgagtc ccctggcagt aaccccgagc cagatgccac cccgttccag 2640
gaaggtttga ggaccttcga ccagctggac gccatatcta gtttgcccac acccagtgac 2700
atctttgtgt cctactctac tttcccaggt tttgtttcct ggagggaccc caagagtggc 2760
tcctggtacg ttgagaccct ggacgacatc tttgagcagt gggctcactc tgaagacctg 2820
cagtccctcc tgcttagggt cgctaatgct gtttcggtga aagggattta taaacagatg 2880
cctggttgct ttaatttcct ccggaaaaaa cttttcttta aaacatcagc tagttaa 2937
<210> 8
<211> 22
<212> PRT
<213>artificial synthesized sequence
<400> 8
Met Leu Leu Leu Val Thr Ser Leu Leu Leu Cys Glu Leu Pro His Pro
1 5 10 15
Ala Phe Leu Leu Ile Pro
20
<210> 9
<211> 21
<212> PRT
<213>artificial synthesized sequence
<400> 9
Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu
1 5 10 15
His Ala Ala Arg Pro
20

Claims (10)

1. a kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and PSMA, which is characterized in that described Dual Chimeric antigen receptor includes Chimeric antigen receptor CD19 and Chimeric antigen receptor PSMA.
2. immunocyte according to claim 1, which is characterized in that the Chimeric antigen receptor includes antigen binding structure Domain, transmembrane domain, costimulatory signal conducting region, CD3 ζ signal transduction structural domain and can induce suicide Fusion domain series connection and At；
Preferably, the antigen-binding domains are to resist for the single-chain antibody of tumor surface antigen CD19 and for tumor surface The single-chain antibody of former PSMA.
3. immunocyte according to claim 1 or 2, which is characterized in that the list for tumor surface antigen CD19 The amino acid sequence of chain antibody has any one in amino acid sequence shown in (I), (II) or (III):
(I) there is the amino acid sequence as shown in SEQ ID NO.1；
(II) with amino acid sequence shown in SEQ ID NO.1 with >=90%, preferably >=95%, more preferably >=98%, most preferably The amino acid sequence of >=99% homology；
(III) it modified with amino acid sequence shown in SEQ ID NO.1, replace, miss or add one or several amino acid The amino acid sequence of acquisition；
The amino acid sequence has the activity of the single-chain antibody for tumor surface antigen CD19；
Preferably, the amino acid sequence of the single-chain antibody for tumor surface antigen PSMA has (I), (II) or (III) Shown in any one in amino acid sequence:
(I) there is the amino acid sequence as shown in SEQ ID NO.2；
(II) with amino acid sequence shown in SEQ ID NO.2 with >=90%, preferably >=95%, more preferably >=98%, most preferably The amino acid sequence of >=99% homology；
(III) it modified with amino acid sequence shown in SEQ ID NO.2, replace, miss or add one or several amino acid The amino acid sequence of acquisition；
The amino acid sequence has the activity of the single-chain antibody for tumor surface antigen PSMA.
4. immunocyte according to any one of claim 1-3, which is characterized in that the transmembrane domain be CD28 across Spanning domain and/or CD8 α transmembrane domain；
Preferably, the costimulatory signal conducting region is CD28 signal transduction structural domain, CD27 signal transduction structural domain or CD137 In signal transduction structural domain any one or at least two combination；
Preferably, the inducible suicide Fusion domain is to include 9 structural domain of Caspase；
Preferably, the amino acid sequence of 9 structural domain of Caspase is as shown in SEQ ID NO.3；
Preferably, the inducible suicide Fusion domain is connected in series by 2A sequence and CD3 ζ signal transduction structural domain.
5. immunocyte described in any one of -4 according to claim 1, which is characterized in that the Chimeric antigen receptor includes letter Number peptide, antigen-binding domains, transmembrane domain, costimulatory signal conducting region, CD3 ζ signal transduction structural domain, 2A sequence and can Induction suicide Fusion domain is connected in series；
Preferably, the Chimeric antigen receptor is Secretory signal peptide, CD19 antigen-binding domains and/or PSMA antigen Binding structural domain, CD8 α and/or CD28 transmembrane domain, CD28 signal transduction structural domain, CD27 signal transduction structural domain, CD3 ζ Signal transduction structural domain, 2A sequence and 9 structural domain of Caspase are connected in series；
Preferably, the Chimeric antigen receptor CD19 is Secretory-CD19scFv-CD28-CD27-CD3 ζ -2A- FBKP.Casp9；The Chimeric antigen receptor PSMA is Secretory-PSMA scFv-CD28-CD27-CD3 ζ -2A- FBKP.Casp9；
Preferably, the amino acid sequence of the Chimeric antigen receptor CD19 as shown in SEQ ID NO.4 or with its have 90% with The amino acid sequence of upper homology；
Preferably, the amino acid sequence of the Chimeric antigen receptor PSMA as shown in SEQ ID NO.6 or with its have 90% with The amino acid sequence of upper homology.
6. immunocyte according to any one of claims 1-5, which is characterized in that the dual Chimeric antigen receptor is logical The nucleic acid sequence for crossing its coding, which is transfected into T cell, to be expressed；
Preferably, the mode of the transfection be by viral vectors, eukaryon expression plasmid or mRNA sequence any one or At least two combination is transfected into T cell, is transfected into T cell preferably by viral vectors；
Preferably, the viral vectors be in slow virus carrier or retroviral vector any one or at least two group It closes, preferably slow virus carrier.
7. a kind of recombinant slow virus, which is characterized in that will be comprising such as dual chimeric antigen of any of claims 1-6 The recombinant lentiviral that the immunocyte and packaging helper plasmid pNHP and pHEF-VSVG cotransfection mammalian cell of acceptor gene modification obtain Virus；
Preferably, the mammalian cell is 293 cells, any one in 293T cell or TE671 cell or at least two Combination.
8. a kind of pharmaceutical composition, which is characterized in that the composition includes as of any of claims 1-6 dual The immunocyte of Chimeric antigen receptor gene modification and/or recombinant slow virus as claimed in claim 7.
9. as the immunocyte of dual Chimeric antigen receptor gene modification of any of claims 1-6, such as right are wanted Recombinant slow virus described in asking 7 or pharmaceutical composition as claimed in claim 8 are preparing Chimeric antigen receptor T cell, are being immunized Application in competent cell or tumor therapeutic agent.
10. application according to claim 9, which is characterized in that the tumour is the relevant tumor disease of blood；
Preferably, the relevant tumor disease of the blood is leukaemia or lymthoma.
CN201811458426.6A 2018-11-30 2018-11-30 A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and PSMA and its application Pending CN109468284A (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
CN201811458426.6A CN109468284A (en) 2018-11-30 2018-11-30 A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and PSMA and its application
PCT/CN2019/122164 WO2020108646A1 (en) 2018-11-30 2019-11-29 Cd19-and psma-based combined car-t immunotherapy

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN201811458426.6A CN109468284A (en) 2018-11-30 2018-11-30 A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and PSMA and its application

Publications (1)

Publication Number Publication Date
CN109468284A true CN109468284A (en) 2019-03-15

Family

ID=65674717

Family Applications (1)

Application Number Title Priority Date Filing Date
CN201811458426.6A Pending CN109468284A (en) 2018-11-30 2018-11-30 A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and PSMA and its application

Country Status (2)

Country Link
CN (1) CN109468284A (en)
WO (1) WO2020108646A1 (en)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110055224A (en) * 2019-04-03 2019-07-26 深圳市体内生物医药科技有限公司 A kind of immunocyte of gene modification and its preparation method and application
WO2020108646A1 (en) * 2018-11-30 2020-06-04 Beijing Meikang Geno-Immune Biotechnology Co., Ltd. Cd19-and psma-based combined car-t immunotherapy
CN111848820A (en) * 2020-07-31 2020-10-30 广东昭泰体内生物医药科技有限公司 CD19 and BCMA double-target chimeric antigen receptor and application thereof
CN114853905A (en) * 2022-04-14 2022-08-05 呈诺再生医学科技(珠海横琴新区)有限公司 Scheme for treating tumors by combined use of genetically modified NK cells and antibodies
WO2024037531A1 (en) * 2022-08-17 2024-02-22 Beijing Meikang Geno-Immune Biotechnology Co., Ltd. Anti-psma single-chain antibody, chimeric antigen receptor associated therewith and use thereof

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111808821B (en) * 2020-06-24 2022-06-14 南方医科大学珠江医院 Construction and preparation of FLT3-NKG2D double-target CAR-T
IL303270A (en) 2020-12-21 2023-07-01 Allogene Therapeutics Inc Protease-activating cd45-gate car
JP2024502094A (en) 2020-12-30 2024-01-17 アラウノス セラピューティクス インコーポレイテッド Recombinant vectors containing polycistronic expression cassettes and methods for their use
KR20230142470A (en) 2021-01-29 2023-10-11 알로젠 테라퓨틱스 인코포레이티드 Knockdown or knockout of one or more of TAP2, NLRC5, β2m, TRAC, RFX5, RFXAP, and RFXANK to mitigate T cell recognition of allogeneic cell products
WO2024026445A1 (en) 2022-07-29 2024-02-01 Allogene Therapeutics Inc. Engineered cells with reduced gene expression to mitigate immune cell recognition

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN105085681A (en) * 2009-12-02 2015-11-25 伊麦吉纳博公司 J591 minibodies and cys-diabodies for targeting human prostate specific membrane antigen (psma) and methods for their use
CN107325185A (en) * 2017-06-06 2017-11-07 上海优卡迪生物医药科技有限公司 The double targeting Chimeric antigen receptors of anti-PSCA and PDL1 based on OCTS CAR, encoding gene and expression vector
CN108383914A (en) * 2018-02-23 2018-08-10 北京美康基免生物科技有限公司 A kind of Chimeric antigen receptor and its application based on CD19

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN114958764A (en) * 2015-04-08 2022-08-30 诺华股份有限公司 CD20 therapy, CD22 therapy, and combination therapy with CD19 Chimeric Antigen Receptor (CAR) -expressing cells
CN109468284A (en) * 2018-11-30 2019-03-15 北京美康基免生物科技有限公司 A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and PSMA and its application

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN105085681A (en) * 2009-12-02 2015-11-25 伊麦吉纳博公司 J591 minibodies and cys-diabodies for targeting human prostate specific membrane antigen (psma) and methods for their use
CN107325185A (en) * 2017-06-06 2017-11-07 上海优卡迪生物医药科技有限公司 The double targeting Chimeric antigen receptors of anti-PSCA and PDL1 based on OCTS CAR, encoding gene and expression vector
CN108383914A (en) * 2018-02-23 2018-08-10 北京美康基免生物科技有限公司 A kind of Chimeric antigen receptor and its application based on CD19

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
LUNG-JI CHANG等: "Phase I/II Trial of Multi-Target Chimeric Antigen Receptor Modified T Cells (4SCAR2.0) Against Relapsed or Refractory Lymphomas", 《BLOOD》 *

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020108646A1 (en) * 2018-11-30 2020-06-04 Beijing Meikang Geno-Immune Biotechnology Co., Ltd. Cd19-and psma-based combined car-t immunotherapy
CN110055224A (en) * 2019-04-03 2019-07-26 深圳市体内生物医药科技有限公司 A kind of immunocyte of gene modification and its preparation method and application
CN110055224B (en) * 2019-04-03 2023-06-30 深圳市体内生物医药科技有限公司 Genetically modified immune cell and preparation method and application thereof
CN111848820A (en) * 2020-07-31 2020-10-30 广东昭泰体内生物医药科技有限公司 CD19 and BCMA double-target chimeric antigen receptor and application thereof
CN114853905A (en) * 2022-04-14 2022-08-05 呈诺再生医学科技(珠海横琴新区)有限公司 Scheme for treating tumors by combined use of genetically modified NK cells and antibodies
WO2024037531A1 (en) * 2022-08-17 2024-02-22 Beijing Meikang Geno-Immune Biotechnology Co., Ltd. Anti-psma single-chain antibody, chimeric antigen receptor associated therewith and use thereof

Also Published As

Publication number Publication date
WO2020108646A1 (en) 2020-06-04

Similar Documents

Publication Publication Date Title
CN109468284A (en) A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and PSMA and its application
CN109880802A (en) A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and CD70 and its application
CN109468283A (en) A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and BCMA and its application
CN109517799A (en) A kind of immunocyte of the dual Chimeric antigen receptor gene modification based on CD19 and CD22 and its application
CN108383914A (en) A kind of Chimeric antigen receptor and its application based on CD19
CN108504668A (en) Target CD19 and CD22 Chimeric antigen receptors and application thereof
JP2022031784A (en) Bcma-targeted chimeric antigen receptor, and preparation method and use thereof
CN107058354A (en) The nucleic acid of encoding chimeric antigen receptor protein and the T lymphocytes for expressing Chimeric antigen receptor albumen
CN108026151A (en) PD-1-CD28 fusion proteins and its purposes in medicine
CN107709353A (en) The method and composition for the treatment of cancer
CN108395482A (en) A kind of activity identification of targeting CD20 antigen Chimeric antigen receptors built and its be engineered T cell
CN114891751A (en) CAR-T cell for efficiently and stably expressing activated antibody and application thereof
CN109468279A (en) Target immune effector cell and its application of GPC3
CN108948211A (en) A kind of Chimeric antigen receptor and its application based on GD2
IL165347A (en) Chimeric cd154 and nucleic acid molecule encoding it
US20070065875A1 (en) NTB-A, a surface molecule involved in natural killer cells activity
WO2020108642A1 (en) Cd19-and cd30-based combined car-t immunotherapy
CN113896801B (en) Chimeric antigen receptor cell targeting human Claudin18.2 and NKG2DL, and preparation method and application thereof
KR20000029877A (en) A tumor necrosis factor related ligand
CN109776671A (en) Cell, code nucleic acid, expression vector, preparation method, pharmaceutical composition and the application of isolated T cell receptor, its modification
CN111499767A (en) Synthetic T cell receptor antigen receptor complex and application thereof
CN114591444A (en) Humanized chimeric antigen receptor based on CD7 and application thereof
JP7386177B2 (en) Bidirectionally activated costimulatory molecule receptors and their uses
WO2019129056A1 (en) Cd137 bidirectional activation costimulatory molecule receptor and use thereof
CN110204619A (en) Chimeric antigen receptor and its application comprising Fc γ R I

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
RJ01 Rejection of invention patent application after publication

Application publication date: 20190315

RJ01 Rejection of invention patent application after publication