CN106749555A - A kind of bovine respiratory born of the same parents zoarium viral antigen proteins - Google Patents

A kind of bovine respiratory born of the same parents zoarium viral antigen proteins Download PDF

Info

Publication number
CN106749555A
CN106749555A CN201611064360.3A CN201611064360A CN106749555A CN 106749555 A CN106749555 A CN 106749555A CN 201611064360 A CN201611064360 A CN 201611064360A CN 106749555 A CN106749555 A CN 106749555A
Authority
CN
China
Prior art keywords
ser
val
leu
asn
ile
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
CN201611064360.3A
Other languages
Chinese (zh)
Inventor
汤斌
闫波
杜勇
钟鱼
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Yantai Royal Emperor Biological Engineering Co Ltd
Original Assignee
Yantai Royal Emperor Biological Engineering Co Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Yantai Royal Emperor Biological Engineering Co Ltd filed Critical Yantai Royal Emperor Biological Engineering Co Ltd
Priority to CN201611064360.3A priority Critical patent/CN106749555A/en
Publication of CN106749555A publication Critical patent/CN106749555A/en
Pending legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2299/00—Coordinates from 3D structures of peptides, e.g. proteins or enzymes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011—Details
    • C12N2760/18011—Paramyxoviridae
    • C12N2760/18511—Pneumovirus, e.g. human respiratory syncytial virus
    • C12N2760/18522—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Virology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The invention discloses a kind of bovine respiratory born of the same parents zoarium viral antigen proteins, the amino acid sequence of the bovine respiratory born of the same parents zoarium viral antigen proteins is substituted compared at least two sites of SEQ AAL90052.1 by cysteine, and by disulfide bond between the cysteine after substituting, carry out interior disulfide bond, hole filling and single-stranded connection etc. again on this basis to improve, while there is provided the preparation method of such antigen protein.The technology and theory of the antigen protein application protein crystallography, determine structure change of the albumen in virus infection and pathogenic course, result further according to structure change carries out genetic engineering transformation to this crucial virus protein, become and only infect proteantigen that is not pathogenic and causing animal body antibody highly effective reaction, the fit virus infection of bovine respiratory born of the same parents can effectively be prevented and treated, preferable viral vaccine can be developed based on this, the loss that effectively control and strick precaution virus infection bring, with great economic implications and social effect.

Description

A kind of bovine respiratory born of the same parents zoarium viral antigen proteins
Technical field
The invention belongs to biological product preparing technical field, be related to a kind of bovine respiratory born of the same parents zoarium viral antigen proteins and its Preparation method.
Background technology
The fit virus of bovine respiratory born of the same parents（Bovine Respiration Syncytial Virus – BRSV）Infection can draw Cattle respiratory disease is played, is listed in EU member country and is only second to bovine mucosal disease（BVD）And infectious bovine rhinotrachetis（IBR）'s One of important cattle disease.This disease is popular in world wide, and its harmfulness is that BRSV the incidence of infection is up to 60%-80%, extremely Rate of dying reaches more than 20% in some outbursts, and very big economic loss is caused to cattle-raising.Although this BRSV is from eighties of last century Begin to the seventies list research and development category in, do not develop preferable medicine and vaccine for various reasons.Although relevant In various inactivations of BRSV, weak poison, the report of restructuring and DNA vaccination, but also have certain distance, current state apart from Clinical practice Still without preferable viral vaccine on border.
The development of traditional vaccine and production are mainly by changing condition of culture, or passage makes cause on different host animals Sick Ecotoxicology weakens, or is inactivated to complete by physics, chemical method.With the continuous progress of human knowledge, The limitation of traditional vaccine is also increasingly revealed：(1) virus of animals and humans is needed to be cultivated in zooblast, and this is caused The cost of production of vaccine is very high；(2) morbid substance in vaccine is possible to not kill completely or fill in vaccine production process Divide attenuation, this can cause to contain strong toxicity morbid substance in vaccine, and then cause that disease is propagated in the larger context；(3) subtract Toxic bacterial strain is possible to undergo mutation, and causes disease.
Bovine respiratory born of the same parents zoarium virus is the member of family of paramyxovirus section, F- albumen thereon be it is highly conserved and Tripolymer furcella is formed, it occurs conformation change under activation.The fusion of the protein mediated viruses of F- and cell membrane, allows virus nucleocapsid Body enters cytoplasm, suppresses the protein mediated steps of F- and prevents the initial period of infectious cycle and neutralize viral infection and can have What is imitated prevents virus infraction, i.e., for the antibody of F- albumen, suppress its activity, can neutralize viral infection and can protect From BRSV infection.The open beginning for having created Chinese structure Basic of Biology theoretical research is applied, it is of the invention by structure biology It is applied in practice, synthesis bovine respiratory born of the same parents' zoarium viral antigen proteins.
The content of the invention
It is an object of the invention to the shortcoming for overcoming prior art to exist, there is provided a kind of bovine respiratory born of the same parents zoarium viral antigen Albumen and preparation method thereof, the technology and theory of the antigen protein application protein crystallography, determine albumen in virus infection and Structure change in pathogenic course, the result further according to structure change carries out genetic engineering and changes to this crucial virus protein Make, become and only infect proteantigen that is not pathogenic and causing animal body antibody highly effective reaction.
To achieve these goals, the technical scheme adopted by the invention to solve the technical problem is that：
A kind of bovine respiratory born of the same parents zoarium viral antigen proteins, the fit virus key protein F- albumen wild species of coding bovine respiratory born of the same parents Amino acid sequence abbreviation SEQ AAL90052.1, particular sequence is MATTTMRMIISIIIIFIYVQHITLCQNITEEFYQSTCSAVSRGYLSALRTGWYTSVVTIELSKIQKNVCNSTDSNVK LIKQELERYNNAVVELQSLMQNEPASSSRAKRGIPELIHYKRNSTKKFYGLMGKKRKRRFLGFLLGIGSAIASGVAV SKVLHLEGEVNKIKNALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKELLPKVNNHDCQISNIATVIEFQQKNNRLL EIAREFSVNAGITTPLSTYMLTNSELLSLINDMPITNDQKKLMSSNVQIVRQQSYSIMSVVKEEVMAYVVQLPIYGV IDTPCWKLHTSPLCTTDNKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPTDVNLCNTD IFNAKYDCKIMTSKTDISSSVITSIGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNRGVDTVSVGNTLYYVNKL EGKALYIKGEPIINYYDPLVFPSDEFDASIAQVNAKINQSLAFIRRSDELLHSVDVGKSTTNVVITTIIIVIVVVIL MLIAVGLLFYSKTRSTPIMLGKDQLSGINNLSFSK, it is characterised in that：The bovine respiratory born of the same parents zoarium viral antigen proteins Amino acid sequence substituted by cysteine compared at least two sites of SEQ AAL90052.1, and substitute after cysteine Between by disulfide bond.
Used as optimization, the site is the 148th valine of amino acid sequence and 288 isoleucines.
Used as optimization, the site is the 158th leucine of amino acid sequence and 290 serines.
Used as optimization, the amino acid sequence of the bovine respiratory born of the same parents zoarium viral antigen proteins compares SEQ AAL90052.1, the leucine in the 260th site is substituted by cysteine, and realizes that hole is filled in the site.
Used as optimization, the amino acid sequence for bovine respiratory born of the same parents zoarium viral antigen proteins rejects SEQ The amino acid sequence in 103 sites to 138 sites in AAL90052.1 sequences, 102 sites and 139 sites are connected using sgsgs.
Used as optimization, the amino acid sequence for bovine respiratory born of the same parents zoarium viral antigen proteins rejects SEQ The amino acid sequence in 103 sites to 142 sites in AAL90052.1 sequences, 102 sites and 143 sites are connected using sgsgs.
Used as optimization, the amino acid sequence of the coding bovine respiratory born of the same parents zoarium viral antigen proteins compares SEQ AAL90052.1 sequences, the 99th site aspartic acid is substituted by cysteine, and the 362nd site serine is substituted by cysteine, And disulfide bond in being connected between the cysteine after replacement.
A kind of preparation method of bovine respiratory born of the same parents zoarium viral antigen proteins, it is characterised in that：Concrete technology is as follows：
（1）According to the principle of structure biology, protein crystal is carried out, observed with X-ray after crystallization, it is determined that infecting viral key Cause of disease F- albumen infects front and rear structure change；
（2）According to step（1）Structure change designs the sequence and structure of antigen protein；
（3）The qualification for needing antigen protein is determined through various antigen tests and stability characteristic detection；
（4）Corresponding albumen synthesis, expression, purification will be carried out by the antigen protein sequence of checking and detected, obtain for making It is animal experiment and clinical test for bovine respiratory born of the same parents zoarium viral antigen proteins.
The fusion of the protein mediated viruses of the fit virus key F- of ox born of the same parents and cell membrane, allows viral nucleocapsid to enter cell.Pin It is that the structure change before and after being infected according to F- albumen sets to the antigen protein of bovine respiratory born of the same parents zoarium viral design, State before making F- protein structures remain at fusion on the basis of genetic engineering, makes it have and only infect not pathogenic and draw The features such as playing the proteantigen of animal body antibody highly effective reaction.
The present invention can make F- albumen that tripolymer furcella state is kept before and after infecting（Closure state）, only infected Proteantigen that is not pathogenic and causing animal's antibody highly effective reaction；In order to the F- albumen ensured to come from pathogenic virus is in The preinfective state of stabilization, to the connects chain that series is added on F- albumen, including interior disulfide bond, disulfide bond, hole filling With single-stranded connection.
Compared with prior art, its advantage is the present invention：The bovine respiratory prepared using protein crystallography method Born of the same parents' zoarium viral antigen proteins can effectively prevent and treat the fit virus infection of bovine respiratory born of the same parents, can open based on this Send preferable viral vaccine；The loss that effectively control and strick precaution virus infection bring, with great economic implications and society Meaning.
Brief description of the drawings
Fig. 1 the present invention relates to the use of Phenix softwares and carry out the 3-D solid structure simulation of ox syncytial virus F- albumen Figure, left figure is tripolymer 3-D solid structure simulation drawing before contaminating, and right figure is the partial enlarged drawing of left figure lower right corner square frame position.
Fig. 2 ox syncytial virus Respiroviruses of the present invention infect the crucial F- protein structures of front and rear process Change schematic diagram.Before display is infected in the figure（It is left）, F- albumen tripolymer is presented tripolymer furcella state, after infecting（It is right）F- eggs It is activated in vain, occurred conformation change, the fusion of virus and cell membrane, viral nucleocapsid enters cytoplasm, and then infects ox body simultaneously It is set cause a disease.
Fig. 3 Electronic Speculum that Niu Tihou is infected by the successful bovine respiratory born of the same parents zoarium proteantigen of transformation of the present invention Photo state.The bovine respiratory born of the same parents zoarium proteantigen of left figure display RD-BRSV-DB1-CF1 transformations infects the state of Niu Tihou, It can be seen that tripolymer furcella state before stable fusion is presented, right figure is without the bovine respiratory born of the same parents zoarium virus infection ox of transformation Electromicroscopic photograph after body.
Connects chain schematic diagram, including interior disulfide bond, disulfide bond, hole filling are added on Fig. 4 F- albumen of the present invention With single-stranded connection, these links guarantee F- albumen holding tripolymer furcella states.
Specific embodiment
Below by embodiment and with reference to accompanying drawing, the present invention is further described.
Embodiment 1：SEQ AAL90052.1 are carried out into following transformation and obtains a kind of fit disease of bovine respiratory born of the same parents of the invention Malicious antigen protein：
Bovine respiratory born of the same parents zoarium virus F- protein amino acid sequence SEQ the 148th valine of AAL90052.1 is replaced by cysteine Generation, the 288th isoleucine is substituted by cysteine, and is connected two sites by disulfide bond, is carried out corresponding albumen conjunction Into, expression, purification, the bovine respiratory born of the same parents zoarium viral antigen proteins abbreviation RD-BRSV-DB1 for obtaining, its amino acid sequence is referred to as It is SEQ DB1.
Bovine respiratory born of the same parents zoarium virus F- protein amino acid sequence SEQ the 158th leucine of AAL90052.1 is by half Guang ammonia Acid is substituted, and the 290th isoleucine is substituted by cysteine, and is connected two sites by disulfide bond, is carried out corresponding egg White synthesis, expression, purification, the bovine respiratory born of the same parents zoarium viral antigen proteins abbreviation RD-BRSV-DB2 for obtaining, its amino acid sequence Referred to as SEQ DB2.
Bovine respiratory born of the same parents zoarium virus F- protein amino acid sequence SEQ the 148th valine of AAL90052.1 is by half Guang ammonia Acid is substituted, and the 288th isoleucine is substituted by cysteine, and is connected two sites by disulfide bond, while by the 260th site Leucine is substituted by cysteine, and realizes that hole is filled in the site, is carried out corresponding albumen synthesis, expression, purification, The bovine respiratory born of the same parents zoarium viral antigen proteins abbreviation RD-BRSV-DB1-CF1 for obtaining, its amino acid sequence is referred to as SEQ DB1-CF1。
Bovine respiratory born of the same parents zoarium virus F- protein amino acid sequence SEQ the 158th leucine of AAL90052.1 is by half Guang ammonia Acid is substituted, and the 290th isoleucine is substituted by cysteine, and is connected two sites by disulfide bond, while by the 260th site Leucine is substituted by cysteine, and realizes that hole is filled in the site, is carried out corresponding albumen synthesis, expression, purification, The bovine respiratory born of the same parents zoarium viral antigen proteins abbreviation RD-BRSV-DB2-CF1 for obtaining, its amino acid sequence is referred to as SEQ DB2-CF1。
Bovine respiratory born of the same parents zoarium virus F- protein amino acid sequence SEQ the 148th valine of AAL90052.1 is by half Guang ammonia Acid is substituted, and the 288th isoleucine is substituted by cysteine, and is connected two sites by disulfide bond；Simultaneously by the 260th site Leucine is substituted by cysteine, and realizes that hole is filled in the site；Reject 103 to site in SEQ AAL90052.1 sequences The amino acid sequence in 138 sites, 102 and 139 sites are connected using sgsgs, are carried out corresponding albumen synthesis, express, carry Bovine respiratory born of the same parents zoarium viral antigen proteins abbreviation RD-BRSV-DB1-CF1-SC1 that is pure, obtaining, its amino acid sequence is referred to as SEQ DB1-CF1-SC1。
Bovine respiratory born of the same parents zoarium virus F- protein amino acid sequence SEQ the 158th leucine of AAL90052.1 is by half Guang ammonia Acid is substituted, and the 290th isoleucine is substituted by cysteine, and is connected two sites by disulfide bond, while by the 260th site Leucine is substituted by cysteine, and realizes that hole is filled in the site；Reject 103 to site in SEQ AAL90052.1 sequences The amino acid sequence in 138 sites, 102 and 139 sites are connected using sgsgs, are carried out corresponding albumen synthesis, express, carry Bovine respiratory born of the same parents zoarium viral antigen proteins abbreviation RD-BRSV-DB2-CF1-SC1 that is pure, obtaining, its amino acid sequence is referred to as SEQ DB2-CF1-SC1。
Bovine respiratory born of the same parents zoarium virus F- protein amino acid sequence SEQ the 148th valine of AAL90052.1 is by half Guang ammonia Acid is substituted, and the 288th isoleucine is substituted by cysteine, and is connected two sites by disulfide bond；Simultaneously by the 260th site Leucine is substituted by cysteine, and realizes that hole is filled in the site；Reject 103 to site in SEQ AAL90052.1 sequences The amino acid sequence in 138 sites, 102 and 139 sites are connected using sgsgs, and the 99th site aspartic acid is substituted by cysteine, 362nd site serine is substituted by cysteine, and disulfide bond in connection between cysteine after replacement, is carried out corresponding Albumen synthesis, expression, purification, the bovine respiratory born of the same parents zoarium viral antigen proteins abbreviation RD-BRSV-DB1-CF1-SC1- for obtaining ID1, its amino acid sequence is referred to as SEQ DB1-CF1-SC1-ID1.
Bovine respiratory born of the same parents zoarium virus F- protein amino acid sequence SEQ the 148th valine of AAL90052.1 is by half Guang ammonia Acid is substituted, and the 288th isoleucine is substituted by cysteine, and is connected two sites by disulfide bond；Simultaneously by the 260th site Leucine is substituted by cysteine, and realizes that hole is filled in the site；Reject 103 to site in SEQ AAL90052.1 sequences The amino acid sequence in 142 sites, 102 and 143 sites are connected using sgsgs, and the 99th site aspartic acid is substituted by cysteine, 362nd site serine is substituted by cysteine, and disulfide bond in connection between cysteine after replacement, is carried out corresponding Albumen synthesis, expression, purification, the bovine respiratory born of the same parents zoarium viral antigen proteins abbreviation RD-BRSV-DB1-CF1-SC2- for obtaining ID1, its amino acid sequence is referred to as SEQ DB1-CF1-SC2-ID1.
Bovine respiratory born of the same parents zoarium virus F- protein amino acid sequence SEQ the 158th leucine of AAL90052.1 is by half Guang ammonia Acid is substituted, and the 290th isoleucine is substituted by cysteine, and is connected two sites by disulfide bond, while by the 260th site Leucine is substituted by cysteine, and realizes that hole is filled in the site；Reject 103 to site in SEQ AAL90052.1 sequences The amino acid sequence in 138 sites, 102 and 139 sites are connected using sgsgs；99th site aspartic acid is substituted by cysteine, 362nd site serine is substituted by cysteine, and disulfide bond in connection between cysteine after replacement.It carries out corresponding Albumen synthesis, expression, purification, the bovine respiratory born of the same parents zoarium viral antigen proteins abbreviation RD-BRSV-DB2-CF1-SC1- for obtaining ID1, its amino acid sequence is referred to as SEQ DB2-CF1-SC1-ID1.
Bovine respiratory born of the same parents zoarium virus F- protein amino acid sequence SEQ the 158th leucine of AAL90052.1 is by half Guang ammonia Acid is substituted, and the 290th isoleucine is substituted by cysteine, and is connected two sites by disulfide bond, while by the 260th site Leucine is substituted by cysteine, and realizes that hole is filled in the site；Reject 103 to site in SEQ AAL90052.1 sequences The amino acid sequence in 142 sites, 102 and 143 sites are connected using sgsgs；99th site aspartic acid is substituted by cysteine, 362nd site serine is substituted by cysteine, and disulfide bond in connection between cysteine after replacement.It carries out corresponding Albumen synthesis, expression, purification, the bovine respiratory born of the same parents zoarium viral antigen proteins abbreviation RD-BRSV-DB2-CF1-SC2- for obtaining ID1, its amino acid sequence is referred to as SEQ DB2-CF1-SC2-ID1.
Immunogenicity refers to that antigenic stimulus body produces the characteristic of immune response ability also known as antigenicity.Immunoreactivity refers to Antigen molecule can be with the product of corresponding immune response（Antibody or sensitized lymphocyte）, specifically bind in vivo or in vitro Performance, the affinity of antigen and antibody-immune is tested using ELISA method.ELISA method has sensitive, special, letter Single, quick, stabilization and the features such as be easily operated automatically, as a new technology in immunodiagnosis, has been applied successfully to The quantitative determination of macromolecular antigen and small molecule antigens.The antibody of high affinity and the adhesion of antigen are strong, i.e., antigen concentration is very Also more antibodies bind antigen forms immune complex when low.Compatibility represents that K values are bigger, affine with equilibrium constant K Property is higher, also more firm with antigen binding.Table 1 give the present invention preparation antigen protein respectively Site, SiteQP, The compatibility data that Site V, the sites of Site II are combined with antibody.
The Characteristics Detection of the embodiment bovine respiratory born of the same parents of table 1 zoarium viral antigen proteins
The present invention has antibody library compatibility higher by the F- albumen of design improvement.All protected by improved antigen protein Hold tripolymer furcella state before fusion（Trimer）, and purpose antigen albumen can be obtained.
The antigen protein that the present invention obtains purifying is specifically bound with D25 antibody, through protein immunization electrophoresis and ELISA Method detection, as a result shows not only there is preferable immunogenicity, and being capable of inducing mouse generation antibody level higher, table The 2 immunogenicity weighted averages for giving D25 antibody and antigen protein of the present invention specific binding, control group is unmanifest open country Non-hibernating eggs.
The Characteristics Detection that the embodiment bovine respiratory born of the same parents of table 2 zoarium viral antigen proteins specifically bind with D25
Physical and chemical stability is carried out to the antigen protein in the present invention to be measured, including aspects such as temperature, pH, osmotic pressure, Detailed data is shown in Table 3, and data are the active ratio with optimal antigen protein activity of antigen protein under corresponding conditionses, knot in table Fruit shows that the antigen protein by design improvement is presented preferable stability to temperature, pH value, osmotic pressure etc., with higher anti- Should activity.
The reactivity stability of the embodiment bovine respiratory born of the same parents of table 3 zoarium viral antigen proteins
Embodiment 2：Prepare the concrete technology of RD-BRSV-DB1-CF1-SC1-ID1 in embodiment 1.See albumen mechanism and shape Can be by following three kinds of approach, respectively x- rays（x-ray Crystallography）, nuclear magnetic resonance（NMR）, Electronic Speculum, The present invention is observed protein structure using x-ray method.It is serial by target egg using the plux of Solution maker 600 Crystallized in vain, the target protein after crystallization is used into X-ray system（SER-CAT22）Collect crystallization volume data, and make its into Picture, obtains the electronic cloud of protein structure, obtains key protein F- albumen and infects front and rear data variation, infects front-end geometry change Change as shown in Figure 2.
Data processing of racking is entered to above-mentioned electronic cloud, using corresponding software（Phenix）Carried out with wild protein sequence Digital simulation, forms the 3-D solid structure simulation figure of protein structure.According to the three-dimensional protein structure that protein sequence is simulated Figure obtains the Trimeric structures of F- albumen, refers to Fig. 1.
According to the principle of crystal chemistry, antigen protein structure design is carried out using simulation softward, its design is included such as Fig. 4 institutes The four kinds of modes shown：Interior disulfide bond（intra disulphide bond）, disulfide bond（disulphide bond）, hole filling （cavity filling）With single-stranded connection（single chain）, wild species AAL90052.1 is designed.
The protein sequence that will be designed is translated into DNA sequence dna, the Expi293F conducts provided using invitrogen companies Cell carrier carries out culture 5 days in 293Fectin culture mediums, collects cell culture fluid, and target protein is carried out into purification The BRSV F- albumen of the purifying for being designed, i.e. RD-BRSV-DB1-CF1-SC1-ID1, improved bovine respiratory born of the same parents close Body protein antigen infects tripolymer furcella state before Niu Tihou is presented stable fusion and sees Fig. 3（It is left）.
Above-mentioned specific embodiment is only specific case of the invention, and scope of patent protection of the invention is included but is not limited to The product form and style of above-mentioned specific embodiment, a kind of any bovine respiratory born of the same parents for meeting claims of the present invention are fit Appropriate change or modification that viral antigen proteins and any person of an ordinary skill in the technical field are done to it, should all fall into Scope of patent protection of the invention.
SEQUENCE LISTING
<110>Yantai Ruo Di bioengineering Co., Ltd
<120>A kind of bovine respiratory born of the same parents zoarium viral antigen proteins
<130>
<160> 11
<170> PatentIn version 3.3
<210> 1
<211> 574
<212> PRT
<213>Bovine respiratory born of the same parents zoarium virus F- albumen wild species
<400> 1
Met Ala Thr Thr Thr Met Arg Met Ile Ile Ser Ile Ile Ile Ile Phe
1 5 10 15
Ile Tyr Val Gln His Ile Thr Leu Cys Gln Asn Ile Thr Glu Glu Phe
20 25 30
Tyr Gln Ser Thr Cys Ser Ala Val Ser Arg Gly Tyr Leu Ser Ala Leu
35 40 45
Arg Thr Gly Trp Tyr Thr Ser Val Val Thr Ile Glu Leu Ser Lys Ile
50 55 60
Gln Lys Asn Val Cys Asn Ser Thr Asp Ser Asn Val Lys Leu Ile Lys
65 70 75 80
Gln Glu Leu Glu Arg Tyr Asn Asn Ala Val Val Glu Leu Gln Ser Leu
85 90 95
Met Gln Asn Glu Pro Ala Ser Ser Ser Arg Ala Lys Arg Gly Ile Pro
100 105 110
Glu Leu Ile His Tyr Lys Arg Asn Ser Thr Lys Lys Phe Tyr Gly Leu
115 120 125
Met Gly Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Ile
130 135 140
Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser Lys Val Leu His Leu
145 150 155 160
Glu Gly Glu Val Asn Lys Ile Lys Asn Ala Leu Leu Ser Thr Asn Lys
165 170 175
Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val
180 185 190
Leu Asp Leu Lys Asn Tyr Ile Asp Lys Glu Leu Leu Pro Lys Val Asn
195 200 205
Asn His Asp Cys Gln Ile Ser Asn Ile Ala Thr Val Ile Glu Phe Gln
210 215 220
Gln Lys Asn Asn Arg Leu Leu Glu Ile Ala Arg Glu Phe Ser Val Asn
225 230 235 240
Ala Gly Ile Thr Thr Pro Leu Ser Thr Tyr Met Leu Thr Asn Ser Glu
245 250 255
Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys
260 265 270
Leu Met Ser Ser Asn Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile
275 280 285
Met Ser Val Val Lys Glu Glu Val Met Ala Tyr Val Val Gln Leu Pro
290 295 300
Ile Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro
305 310 315 320
Leu Cys Thr Thr Asp Asn Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335
Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350
Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp
355 360 365
Thr Met Asn Ser Leu Thr Leu Pro Thr Asp Val Asn Leu Cys Asn Thr
370 375 380
Asp Ile Phe Asn Ala Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr
385 390 395 400
Asp Ile Ser Ser Ser Val Ile Thr Ser Ile Gly Ala Ile Val Ser Cys
405 410 415
Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430
Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Arg Gly Val Asp
435 440 445
Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Leu Glu Gly
450 455 460
Lys Ala Leu Tyr Ile Lys Gly Glu Pro Ile Ile Asn Tyr Tyr Asp Pro
465 470 475 480
Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ala Gln Val Asn
485 490 495
Ala Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Arg Ser Asp Glu Leu
500 505 510
Leu His Ser Val Asp Val Gly Lys Ser Thr Thr Asn Val Val Ile Thr
515 520 525
Thr Ile Ile Ile Val Ile Val Val Val Ile Leu Met Leu Ile Ala Val
530 535 540
Gly Leu Leu Phe Tyr Ser Lys Thr Arg Ser Thr Pro Ile Met Leu Gly
545 550 555 560
Lys Asp Gln Leu Ser Gly Ile Asn Asn Leu Ser Phe Ser Lys
565 570
<210> 2
<211> 489
<212> PRT
<213>Artificial sequence
<400> 2
Gln Asn Ile Thr Glu Glu Phe Tyr Gln Ser Thr Cys Ser Ala Val Ser
1 5 10 15
Arg Gly Tyr Leu Ser Ala Leu Arg Thr Gly Trp Tyr Thr Ser Val Val
20 25 30
Thr Ile Glu Leu Ser Lys Ile Gln Lys Asn Val Cys Asn Ser Thr Asp
35 40 45
Ser Asn Val Lys Leu Ile Lys Gln Glu Leu Glu Arg Tyr Asn Asn Ala
50 55 60
Val Val Glu Leu Gln Ser Leu Met Gln Asn Glu Pro Ala Ser Ser Ser
65 70 75 80
Arg Ala Lys Arg Gly Ile Pro Glu Leu Ile His Tyr Lys Arg Asn Ser
85 90 95
Thr Lys Lys Phe Tyr Gly Leu Met Gly Lys Lys Arg Lys Arg Arg Phe
100 105 110
Leu Gly Phe Leu Leu Gly Ile Gly Ser Ala Cys Ala Ser Gly Val Ala
115 120 125
Val Ser Lys Val Leu His Leu Glu Gly Glu Val Asn Lys Ile Lys Asn
130 135 140
Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly Val
145 150 155 160
Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile Asp Lys
165 170 175
Glu Leu Leu Pro Lys Val Asn Asn His Asp Cys Gln Ile Ser Asn Ile
180 185 190
Ala Thr Val Ile Glu Phe Gln Gln Lys Asn Asn Arg Leu Leu Glu Ile
195 200 205
Ala Arg Glu Phe Ser Val Asn Ala Gly Ile Thr Thr Pro Leu Ser Thr
210 215 220
Tyr Met Leu Thr Asn Ser Glu Leu Leu Ser Leu Ile Asn Asp Met Pro
225 230 235 240
Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Ser Asn Val Gln Ile Val
245 250 255
Arg Gln Gln Ser Tyr Ser Cys Met Ser Val Val Lys Glu Glu Val Met
260 265 270
Ala Tyr Val Val Gln Leu Pro Ile Tyr Gly Val Ile Asp Thr Pro Cys
275 280 285
Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asp Asn Lys Glu Gly
290 295 300
Ser Asn Ile Cys Leu Thr Arg Thr Asp Arg Gly Trp Tyr Cys Asp Asn
305 310 315 320
Ala Gly Ser Val Ser Phe Phe Pro Gln Ala Glu Thr Cys Lys Val Gln
325 330 335
Ser Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu Pro Thr
340 345 350
Asp Val Asn Leu Cys Asn Thr Asp Ile Phe Asn Ala Lys Tyr Asp Cys
355 360 365
Lys Ile Met Thr Ser Lys Thr Asp Ile Ser Ser Ser Val Ile Thr Ser
370 375 380
Ile Gly Ala Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys Thr Ala Ser
385 390 395 400
Asn Lys Asn Arg Gly Ile Ile Lys Thr Phe Ser Asn Gly Cys Asp Tyr
405 410 415
Val Ser Asn Arg Gly Val Asp Thr Val Ser Val Gly Asn Thr Leu Tyr
420 425 430
Tyr Val Asn Lys Leu Glu Gly Lys Ala Leu Tyr Ile Lys Gly Glu Pro
435 440 445
Ile Ile Asn Tyr Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp
450 455 460
Ala Ser Ile Ala Gln Val Asn Ala Lys Ile Asn Gln Ser Leu Ala Phe
465 470 475 480
Ile Arg Arg Ser Asp Glu Leu Leu His
485
<210> 3
<211> 489
<212> PRT
<213>Artificial sequence
<400> 3
Gln Asn Ile Thr Glu Glu Phe Tyr Gln Ser Thr Cys Ser Ala Val Ser
1 5 10 15
Arg Gly Tyr Leu Ser Ala Leu Arg Thr Gly Trp Tyr Thr Ser Val Val
20 25 30
Thr Ile Glu Leu Ser Lys Ile Gln Lys Asn Val Cys Asn Ser Thr Asp
35 40 45
Ser Asn Val Lys Leu Ile Lys Gln Glu Leu Glu Arg Tyr Asn Asn Ala
50 55 60
Val Val Glu Leu Gln Ser Leu Met Gln Asn Glu Pro Ala Ser Ser Ser
65 70 75 80
Arg Ala Lys Arg Gly Ile Pro Glu Leu Ile His Tyr Lys Arg Asn Ser
85 90 95
Thr Lys Lys Phe Tyr Gly Leu Met Gly Lys Lys Arg Lys Arg Arg Phe
100 105 110
Leu Gly Phe Leu Leu Gly Ile Gly Ser Ala Ile Ala Ser Gly Val Ala
115 120 125
Val Ser Lys Val Cys His Leu Glu Gly Glu Val Asn Lys Ile Lys Asn
130 135 140
Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly Val
145 150 155 160
Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile Asp Lys
165 170 175
Glu Leu Leu Pro Lys Val Asn Asn His Asp Cys Gln Ile Ser Asn Ile
180 185 190
Ala Thr Val Ile Glu Phe Gln Gln Lys Asn Asn Arg Leu Leu Glu Ile
195 200 205
Ala Arg Glu Phe Ser Val Asn Ala Gly Ile Thr Thr Pro Leu Ser Thr
210 215 220
Tyr Met Leu Thr Asn Ser Glu Leu Leu Ser Leu Ile Asn Asp Met Pro
225 230 235 240
Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Ser Asn Val Gln Ile Val
245 250 255
Arg Gln Gln Ser Tyr Ser Ile Met Cys Val Val Lys Glu Glu Val Met
260 265 270
Ala Tyr Val Val Gln Leu Pro Ile Tyr Gly Val Ile Asp Thr Pro Cys
275 280 285
Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asp Asn Lys Glu Gly
290 295 300
Ser Asn Ile Cys Leu Thr Arg Thr Asp Arg Gly Trp Tyr Cys Asp Asn
305 310 315 320
Ala Gly Ser Val Ser Phe Phe Pro Gln Ala Glu Thr Cys Lys Val Gln
325 330 335
Ser Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu Pro Thr
340 345 350
Asp Val Asn Leu Cys Asn Thr Asp Ile Phe Asn Ala Lys Tyr Asp Cys
355 360 365
Lys Ile Met Thr Ser Lys Thr Asp Ile Ser Ser Ser Val Ile Thr Ser
370 375 380
Ile Gly Ala Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys Thr Ala Ser
385 390 395 400
Asn Lys Asn Arg Gly Ile Ile Lys Thr Phe Ser Asn Gly Cys Asp Tyr
405 410 415
Val Ser Asn Arg Gly Val Asp Thr Val Ser Val Gly Asn Thr Leu Tyr
420 425 430
Tyr Val Asn Lys Leu Glu Gly Lys Ala Leu Tyr Ile Lys Gly Glu Pro
435 440 445
Ile Ile Asn Tyr Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp
450 455 460
Ala Ser Ile Ala Gln Val Asn Ala Lys Ile Asn Gln Ser Leu Ala Phe
465 470 475 480
Ile Arg Arg Ser Asp Glu Leu Leu His
485
<210> 4
<211> 489
<212> PRT
<213>Artificial sequence
<400> 4
Gln Asn Ile Thr Glu Glu Phe Tyr Gln Ser Thr Cys Ser Ala Val Ser
1 5 10 15
Arg Gly Tyr Leu Ser Ala Leu Arg Thr Gly Trp Tyr Thr Ser Val Val
20 25 30
Thr Ile Glu Leu Ser Lys Ile Gln Lys Asn Val Cys Asn Ser Thr Asp
35 40 45
Ser Asn Val Lys Leu Ile Lys Gln Glu Leu Glu Arg Tyr Asn Asn Ala
50 55 60
Val Val Glu Leu Gln Ser Leu Met Gln Asn Glu Pro Ala Ser Ser Ser
65 70 75 80
Arg Ala Lys Arg Gly Ile Pro Glu Leu Ile His Tyr Lys Arg Asn Ser
85 90 95
Thr Lys Lys Phe Tyr Gly Leu Met Gly Lys Lys Arg Lys Arg Arg Phe
100 105 110
Leu Gly Phe Leu Leu Gly Ile Gly Ser Ala Cys Ala Ser Gly Val Ala
115 120 125
Val Ser Lys Val Leu His Leu Glu Gly Glu Val Asn Lys Ile Lys Asn
130 135 140
Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly Val
145 150 155 160
Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile Asp Lys
165 170 175
Glu Leu Leu Pro Lys Val Asn Asn His Asp Cys Gln Ile Ser Asn Ile
180 185 190
Ala Thr Val Ile Glu Phe Gln Gln Lys Asn Asn Arg Leu Leu Glu Ile
195 200 205
Ala Arg Glu Phe Ser Val Asn Ala Gly Ile Thr Thr Pro Leu Ser Thr
210 215 220
Tyr Met Leu Thr Asn Ser Glu Leu Leu Ser Phe Ile Asn Asp Met Pro
225 230 235 240
Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Ser Asn Val Gln Ile Val
245 250 255
Arg Gln Gln Ser Tyr Ser Cys Met Ser Val Val Lys Glu Glu Val Met
260 265 270
Ala Tyr Val Val Gln Leu Pro Ile Tyr Gly Val Ile Asp Thr Pro Cys
275 280 285
Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asp Asn Lys Glu Gly
290 295 300
Ser Asn Ile Cys Leu Thr Arg Thr Asp Arg Gly Trp Tyr Cys Asp Asn
305 310 315 320
Ala Gly Ser Val Ser Phe Phe Pro Gln Ala Glu Thr Cys Lys Val Gln
325 330 335
Ser Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu Pro Thr
340 345 350
Asp Val Asn Leu Cys Asn Thr Asp Ile Phe Asn Ala Lys Tyr Asp Cys
355 360 365
Lys Ile Met Thr Ser Lys Thr Asp Ile Ser Ser Ser Val Ile Thr Ser
370 375 380
Ile Gly Ala Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys Thr Ala Ser
385 390 395 400
Asn Lys Asn Arg Gly Ile Ile Lys Thr Phe Ser Asn Gly Cys Asp Tyr
405 410 415
Val Ser Asn Arg Gly Val Asp Thr Val Ser Val Gly Asn Thr Leu Tyr
420 425 430
Tyr Val Asn Lys Leu Glu Gly Lys Ala Leu Tyr Ile Lys Gly Glu Pro
435 440 445
Ile Ile Asn Tyr Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp
450 455 460
Ala Ser Ile Ala Gln Val Asn Ala Lys Ile Asn Gln Ser Leu Ala Phe
465 470 475 480
Ile Arg Arg Ser Asp Glu Leu Leu His
485
<210> 5
<211> 489
<212> PRT
<213>Artificial sequence
<400> 5
Gln Asn Ile Thr Glu Glu Phe Tyr Gln Ser Thr Cys Ser Ala Val Ser
1 5 10 15
Arg Gly Tyr Leu Ser Ala Leu Arg Thr Gly Trp Tyr Thr Ser Val Val
20 25 30
Thr Ile Glu Leu Ser Lys Ile Gln Lys Asn Val Cys Asn Ser Thr Asp
35 40 45
Ser Asn Val Lys Leu Ile Lys Gln Glu Leu Glu Arg Tyr Asn Asn Ala
50 55 60
Val Val Glu Leu Gln Ser Leu Met Gln Asn Glu Pro Ala Ser Ser Ser
65 70 75 80
Arg Ala Lys Arg Gly Ile Pro Glu Leu Ile His Tyr Lys Arg Asn Ser
85 90 95
Thr Lys Lys Phe Tyr Gly Leu Met Gly Lys Lys Arg Lys Arg Arg Phe
100 105 110
Leu Gly Phe Leu Leu Gly Ile Gly Ser Ala Ile Ala Ser Gly Val Ala
115 120 125
Val Ser Lys Val Cys His Leu Glu Gly Glu Val Asn Lys Ile Lys Asn
130 135 140
Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly Val
145 150 155 160
Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile Asp Lys
165 170 175
Glu Leu Leu Pro Lys Val Asn Asn His Asp Cys Gln Ile Ser Asn Ile
180 185 190
Ala Thr Val Ile Glu Phe Gln Gln Lys Asn Asn Arg Leu Leu Glu Ile
195 200 205
Ala Arg Glu Phe Ser Val Asn Ala Gly Ile Thr Thr Pro Leu Ser Thr
210 215 220
Tyr Met Leu Thr Asn Ser Glu Leu Leu Ser Phe Ile Asn Asp Met Pro
225 230 235 240
Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Ser Asn Val Gln Ile Val
245 250 255
Arg Gln Gln Ser Tyr Ser Ile Met Cys Val Val Lys Glu Glu Val Met
260 265 270
Ala Tyr Val Val Gln Leu Pro Ile Tyr Gly Val Ile Asp Thr Pro Cys
275 280 285
Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asp Asn Lys Glu Gly
290 295 300
Ser Asn Ile Cys Leu Thr Arg Thr Asp Arg Gly Trp Tyr Cys Asp Asn
305 310 315 320
Ala Gly Ser Val Ser Phe Phe Pro Gln Ala Glu Thr Cys Lys Val Gln
325 330 335
Ser Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu Pro Thr
340 345 350
Asp Val Asn Leu Cys Asn Thr Asp Ile Phe Asn Ala Lys Tyr Asp Cys
355 360 365
Lys Ile Met Thr Ser Lys Thr Asp Ile Ser Ser Ser Val Ile Thr Ser
370 375 380
Ile Gly Ala Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys Thr Ala Ser
385 390 395 400
Asn Lys Asn Arg Gly Ile Ile Lys Thr Phe Ser Asn Gly Cys Asp Tyr
405 410 415
Val Ser Asn Arg Gly Val Asp Thr Val Ser Val Gly Asn Thr Leu Tyr
420 425 430
Tyr Val Asn Lys Leu Glu Gly Lys Ala Leu Tyr Ile Lys Gly Glu Pro
435 440 445
Ile Ile Asn Tyr Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp
450 455 460
Ala Ser Ile Ala Gln Val Asn Ala Lys Ile Asn Gln Ser Leu Ala Phe
465 470 475 480
Ile Arg Arg Ser Asp Glu Leu Leu His
485
<210> 6
<211> 458
<212> PRT
<213>Artificial sequence
<400> 6
Gln Asn Ile Thr Glu Glu Phe Tyr Gln Ser Thr Cys Ser Ala Val Ser
1 5 10 15
Arg Gly Tyr Leu Ser Ala Leu Arg Thr Gly Trp Tyr Thr Ser Val Val
20 25 30
Thr Ile Glu Leu Ser Lys Ile Gln Lys Asn Val Cys Asn Ser Thr Asp
35 40 45
Ser Asn Val Lys Leu Ile Lys Gln Glu Leu Glu Arg Tyr Asn Asn Ala
50 55 60
Val Val Glu Leu Gln Ser Leu Met Gln Asn Glu Pro Ala Ser Gly Ser
65 70 75 80
Gly Ser Gly Phe Leu Leu Gly Ile Gly Ser Ala Cys Ala Ser Gly Val
85 90 95
Ala Val Ser Lys Val Leu His Leu Glu Gly Glu Val Asn Lys Ile Lys
100 105 110
Asn Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly
115 120 125
Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile Asp
130 135 140
Lys Glu Leu Leu Pro Lys Val Asn Asn His Asp Cys Gln Ile Ser Asn
145 150 155 160
Ile Ala Thr Val Ile Glu Phe Gln Gln Lys Asn Asn Arg Leu Leu Glu
165 170 175
Ile Ala Arg Glu Phe Ser Val Asn Ala Gly Ile Thr Thr Pro Leu Ser
180 185 190
Thr Tyr Met Leu Thr Asn Ser Glu Leu Leu Ser Phe Ile Asn Asp Met
195 200 205
Pro Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Ser Asn Val Gln Ile
210 215 220
Val Arg Gln Gln Ser Tyr Ser Cys Met Ser Val Val Lys Glu Glu Val
225 230 235 240
Met Ala Tyr Val Val Gln Leu Pro Ile Tyr Gly Val Ile Asp Thr Pro
245 250 255
Cys Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asp Asn Lys Glu
260 265 270
Gly Ser Asn Ile Cys Leu Thr Arg Thr Asp Arg Gly Trp Tyr Cys Asp
275 280 285
Asn Ala Gly Ser Val Ser Phe Phe Pro Gln Ala Glu Thr Cys Lys Val
290 295 300
Gln Ser Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu Pro
305 310 315 320
Thr Asp Val Asn Leu Cys Asn Thr Asp Ile Phe Asn Ala Lys Tyr Asp
325 330 335
Cys Lys Ile Met Thr Ser Lys Thr Asp Ile Ser Ser Ser Val Ile Thr
340 345 350
Ser Ile Gly Ala Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys Thr Ala
355 360 365
Ser Asn Lys Asn Arg Gly Ile Ile Lys Thr Phe Ser Asn Gly Cys Asp
370 375 380
Tyr Val Ser Asn Arg Gly Val Asp Thr Val Ser Val Gly Asn Thr Leu
385 390 395 400
Tyr Tyr Val Asn Lys Leu Glu Gly Lys Ala Leu Tyr Ile Lys Gly Glu
405 410 415
Pro Ile Ile Asn Tyr Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe
420 425 430
Asp Ala Ser Ile Ala Gln Val Asn Ala Lys Ile Asn Gln Ser Leu Ala
435 440 445
Phe Ile Arg Arg Ser Asp Glu Leu Leu His
450 455
<210> 7
<211> 454
<212> PRT
<213>Artificial sequence
<400> 7
Gln Asn Ile Thr Glu Glu Phe Tyr Gln Ser Thr Cys Ser Ala Val Ser
1 5 10 15
Arg Gly Tyr Leu Ser Ala Leu Arg Thr Gly Trp Tyr Thr Ser Val Val
20 25 30
Thr Ile Glu Leu Ser Lys Ile Gln Lys Asn Val Cys Asn Ser Thr Asp
35 40 45
Ser Asn Val Lys Leu Ile Lys Gln Glu Leu Glu Arg Tyr Asn Asn Ala
50 55 60
Val Val Glu Leu Gln Ser Leu Met Gln Asn Glu Pro Ala Ser Gly Ser
65 70 75 80
Gly Ser Gly Ile Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser Lys
85 90 95
Val Cys His Leu Glu Gly Glu Val Asn Lys Ile Lys Asn Ala Leu Leu
100 105 110
Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu
115 120 125
Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile Asp Lys Glu Leu Leu
130 135 140
Pro Lys Val Asn Asn His Asp Cys Gln Ile Ser Asn Ile Ala Thr Val
145 150 155 160
Ile Glu Phe Gln Gln Lys Asn Asn Arg Leu Leu Glu Ile Ala Arg Glu
165 170 175
Phe Ser Val Asn Ala Gly Ile Thr Thr Pro Leu Ser Thr Tyr Met Leu
180 185 190
Thr Asn Ser Glu Leu Leu Ser Phe Ile Asn Asp Met Pro Ile Thr Asn
195 200 205
Asp Gln Lys Lys Leu Met Ser Ser Asn Val Gln Ile Val Arg Gln Gln
210 215 220
Ser Tyr Ser Ile Met Cys Val Val Lys Glu Glu Val Met Ala Tyr Val
225 230 235 240
Val Gln Leu Pro Ile Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu
245 250 255
His Thr Ser Pro Leu Cys Thr Thr Asp Asn Lys Glu Gly Ser Asn Ile
260 265 270
Cys Leu Thr Arg Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser
275 280 285
Val Ser Phe Phe Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg
290 295 300
Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu Pro Thr Asp Val Asn
305 310 315 320
Leu Cys Asn Thr Asp Ile Phe Asn Ala Lys Tyr Asp Cys Lys Ile Met
325 330 335
Thr Ser Lys Thr Asp Ile Ser Ser Ser Val Ile Thr Ser Ile Gly Ala
340 345 350
Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn
355 360 365
Arg Gly Ile Ile Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn
370 375 380
Arg Gly Val Asp Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
385 390 395 400
Lys Leu Glu Gly Lys Ala Leu Tyr Ile Lys Gly Glu Pro Ile Ile Asn
405 410 415
Tyr Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile
420 425 430
Ala Gln Val Asn Ala Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Arg
435 440 445
Ser Asp Glu Leu Leu His
450
<210> 8
<211> 458
<212> PRT
<213>Artificial sequence
<400> 8
Gln Asn Ile Thr Glu Glu Phe Tyr Gln Ser Thr Cys Ser Ala Val Ser
1 5 10 15
Arg Gly Tyr Leu Ser Ala Leu Arg Thr Gly Trp Tyr Thr Ser Val Val
20 25 30
Thr Ile Glu Leu Ser Lys Ile Gln Lys Asn Val Cys Asn Ser Thr Asp
35 40 45
Ser Asn Val Lys Leu Ile Lys Gln Glu Leu Glu Arg Tyr Asn Asn Ala
50 55 60
Val Val Glu Leu Gln Ser Leu Met Gln Cys Glu Pro Ala Ser Gly Ser
65 70 75 80
Gly Ser Gly Phe Leu Leu Gly Ile Gly Ser Ala Cys Ala Ser Gly Val
85 90 95
Ala Val Ser Lys Val Leu His Leu Glu Gly Glu Val Asn Lys Ile Lys
100 105 110
Asn Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly
115 120 125
Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile Asp
130 135 140
Lys Glu Leu Leu Pro Lys Val Asn Asn His Asp Cys Gln Ile Ser Asn
145 150 155 160
Ile Ala Thr Val Ile Glu Phe Gln Gln Lys Asn Asn Arg Leu Leu Glu
165 170 175
Ile Ala Arg Glu Phe Ser Val Asn Ala Gly Ile Thr Thr Pro Leu Ser
180 185 190
Thr Tyr Met Leu Thr Asn Ser Glu Leu Leu Ser Phe Ile Asn Asp Met
195 200 205
Pro Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Ser Asn Val Gln Ile
210 215 220
Val Arg Gln Gln Ser Tyr Ser Cys Met Ser Val Val Lys Glu Glu Val
225 230 235 240
Met Ala Tyr Val Val Gln Leu Pro Ile Tyr Gly Val Ile Asp Thr Pro
245 250 255
Cys Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asp Asn Lys Glu
260 265 270
Gly Ser Asn Ile Cys Leu Thr Arg Thr Asp Arg Gly Trp Tyr Cys Asp
275 280 285
Asn Ala Gly Ser Val Ser Phe Phe Pro Gln Ala Glu Thr Cys Lys Val
290 295 300
Gln Cys Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu Pro
305 310 315 320
Thr Asp Val Asn Leu Cys Asn Thr Asp Ile Phe Asn Ala Lys Tyr Asp
325 330 335
Cys Lys Ile Met Thr Ser Lys Thr Asp Ile Ser Ser Ser Val Ile Thr
340 345 350
Ser Ile Gly Ala Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys Thr Ala
355 360 365
Ser Asn Lys Asn Arg Gly Ile Ile Lys Thr Phe Ser Asn Gly Cys Asp
370 375 380
Tyr Val Ser Asn Arg Gly Val Asp Thr Val Ser Val Gly Asn Thr Leu
385 390 395 400
Tyr Tyr Val Asn Lys Leu Glu Gly Lys Ala Leu Tyr Ile Lys Gly Glu
405 410 415
Pro Ile Ile Asn Tyr Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe
420 425 430
Asp Ala Ser Ile Ala Gln Val Asn Ala Lys Ile Asn Gln Ser Leu Ala
435 440 445
Phe Ile Arg Arg Ser Asp Glu Leu Leu His
450 455
<210> 9
<211> 454
<212> PRT
<213>Artificial sequence
<400> 9
Gln Asn Ile Thr Glu Glu Phe Tyr Gln Ser Thr Cys Ser Ala Val Ser
1 5 10 15
Arg Gly Tyr Leu Ser Ala Leu Arg Thr Gly Trp Tyr Thr Ser Val Val
20 25 30
Thr Ile Glu Leu Ser Lys Ile Gln Lys Asn Val Cys Asn Ser Thr Asp
35 40 45
Ser Asn Val Lys Leu Ile Lys Gln Glu Leu Glu Arg Tyr Asn Asn Ala
50 55 60
Val Val Glu Leu Gln Ser Leu Met Gln Cys Glu Pro Ala Ser Gly Ser
65 70 75 80
Gly Ser Gly Ile Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser Lys
85 90 95
Val Cys His Leu Glu Gly Glu Val Asn Lys Ile Lys Asn Ala Leu Leu
100 105 110
Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu
115 120 125
Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile Asp Lys Glu Leu Leu
130 135 140
Pro Lys Val Asn Asn His Asp Cys Gln Ile Ser Asn Ile Ala Thr Val
145 150 155 160
Ile Glu Phe Gln Gln Lys Asn Asn Arg Leu Leu Glu Ile Ala Arg Glu
165 170 175
Phe Ser Val Asn Ala Gly Ile Thr Thr Pro Leu Ser Thr Tyr Met Leu
180 185 190
Thr Asn Ser Glu Leu Leu Ser Phe Ile Asn Asp Met Pro Ile Thr Asn
195 200 205
Asp Gln Lys Lys Leu Met Ser Ser Asn Val Gln Ile Val Arg Gln Gln
210 215 220
Ser Tyr Ser Ile Met Cys Val Val Lys Glu Glu Val Met Ala Tyr Val
225 230 235 240
Val Gln Leu Pro Ile Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu
245 250 255
His Thr Ser Pro Leu Cys Thr Thr Asp Asn Lys Glu Gly Ser Asn Ile
260 265 270
Cys Leu Thr Arg Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser
275 280 285
Val Ser Phe Phe Pro Gln Ala Glu Thr Cys Lys Val Gln Cys Asn Arg
290 295 300
Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu Pro Thr Asp Val Asn
305 310 315 320
Leu Cys Asn Thr Asp Ile Phe Asn Ala Lys Tyr Asp Cys Lys Ile Met
325 330 335
Thr Ser Lys Thr Asp Ile Ser Ser Ser Val Ile Thr Ser Ile Gly Ala
340 345 350
Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn
355 360 365
Arg Gly Ile Ile Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn
370 375 380
Arg Gly Val Asp Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
385 390 395 400
Lys Leu Glu Gly Lys Ala Leu Tyr Ile Lys Gly Glu Pro Ile Ile Asn
405 410 415
Tyr Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile
420 425 430
Ala Gln Val Asn Ala Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Arg
435 440 445
Ser Asp Glu Leu Leu His
450
<210> 10
<211> 458
<212> PRT
<213>Artificial sequence
<400> 10
Gln Asn Ile Thr Glu Glu Phe Tyr Gln Ser Thr Cys Ser Ala Val Ser
1 5 10 15
Arg Gly Tyr Leu Ser Ala Leu Arg Thr Gly Trp Tyr Thr Ser Val Val
20 25 30
Thr Ile Glu Leu Ser Lys Ile Gln Lys Asn Val Cys Asn Ser Thr Asp
35 40 45
Ser Asn Val Lys Leu Ile Lys Gln Glu Leu Glu Arg Tyr Asn Asn Ala
50 55 60
Val Val Glu Leu Gln Ser Leu Met Gln Cys Glu Pro Ala Ser Gly Ser
65 70 75 80
Gly Ser Gly Phe Leu Leu Gly Ile Gly Ser Ala Ser Ala Ser Gly Val
85 90 95
Ala Val Cys Lys Val Leu His Leu Glu Gly Glu Val Asn Lys Ile Lys
100 105 110
Asn Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly
115 120 125
Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile Asp
130 135 140
Lys Glu Leu Leu Pro Lys Val Asn Asn His Asp Cys Gln Ile Ser Asn
145 150 155 160
Ile Ala Thr Val Ile Glu Phe Gln Gln Lys Asn Asn Arg Leu Leu Glu
165 170 175
Ile Ala Arg Glu Phe Ser Val Asn Ala Gly Ile Thr Thr Pro Leu Ser
180 185 190
Thr Tyr Met Leu Thr Asn Ser Glu Leu Leu Ser Phe Ile Asn Asp Met
195 200 205
Pro Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Ser Asn Val Gln Ile
210 215 220
Val Arg Gln Gln Ser Tyr Ser Cys Met Ser Val Val Lys Glu Glu Val
225 230 235 240
Met Ala Tyr Val Val Gln Leu Pro Ile Tyr Gly Val Ile Asp Thr Pro
245 250 255
Cys Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asp Asn Lys Glu
260 265 270
Gly Ser Asn Ile Cys Leu Thr Arg Thr Asp Arg Gly Trp Tyr Cys Asp
275 280 285
Asn Ala Gly Ser Val Ser Phe Phe Pro Gln Ala Glu Thr Cys Lys Val
290 295 300
Gln Cys Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu Pro
305 310 315 320
Thr Asp Val Asn Leu Cys Asn Thr Asp Ile Phe Asn Ala Lys Tyr Asp
325 330 335
Cys Lys Ile Met Thr Ser Lys Thr Asp Ile Ser Ser Ser Val Ile Thr
340 345 350
Ser Ile Gly Ala Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys Thr Ala
355 360 365
Ser Asn Lys Asn Arg Gly Ile Ile Lys Thr Phe Ser Asn Gly Cys Asp
370 375 380
Tyr Val Ser Asn Arg Gly Val Asp Thr Val Ser Val Gly Asn Thr Leu
385 390 395 400
Tyr Tyr Val Asn Lys Leu Glu Gly Lys Ala Leu Tyr Ile Lys Gly Glu
405 410 415
Pro Ile Ile Asn Tyr Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe
420 425 430
Asp Ala Ser Ile Ala Gln Val Asn Ala Lys Ile Asn Gln Ser Leu Ala
435 440 445
Phe Ile Arg Arg Ser Asp Glu Leu Leu His
450 455
<210> 11
<211> 454
<212> PRT
<213>Artificial sequence
<400> 11
Gln Asn Ile Thr Glu Glu Phe Tyr Gln Ser Thr Cys Ser Ala Val Ser
1 5 10 15
Arg Gly Tyr Leu Ser Ala Leu Arg Thr Gly Trp Tyr Thr Ser Val Val
20 25 30
Thr Ile Glu Leu Ser Lys Ile Gln Lys Asn Val Cys Asn Ser Thr Asp
35 40 45
Ser Asn Val Lys Leu Ile Lys Gln Glu Leu Glu Arg Tyr Asn Asn Ala
50 55 60
Val Val Glu Leu Gln Ser Leu Met Gln Cys Glu Pro Ala Ser Gly Ser
65 70 75 80
Gly Ser Gly Ile Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser Lys
85 90 95
Val Cys His Leu Glu Gly Glu Val Asn Lys Ile Lys Asn Ala Leu Leu
100 105 110
Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu
115 120 125
Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile Asp Lys Glu Leu Leu
130 135 140
Pro Lys Val Asn Asn His Asp Cys Gln Ile Ser Asn Ile Ala Thr Val
145 150 155 160
Ile Glu Phe Gln Gln Lys Asn Asn Arg Leu Leu Glu Ile Ala Arg Glu
165 170 175
Phe Ser Val Asn Ala Gly Ile Thr Thr Pro Leu Ser Thr Tyr Met Leu
180 185 190
Thr Asn Ser Glu Leu Leu Ser Phe Ile Asn Asp Met Pro Ile Thr Asn
195 200 205
Asp Gln Lys Lys Leu Met Ser Ser Asn Val Gln Ile Val Arg Gln Gln
210 215 220
Ser Tyr Ser Ile Met Cys Val Val Lys Glu Glu Val Met Ala Tyr Val
225 230 235 240
Val Gln Leu Pro Ile Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu
245 250 255
His Thr Ser Pro Leu Cys Thr Thr Asp Asn Lys Glu Gly Ser Asn Ile
260 265 270
Cys Leu Thr Arg Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser
275 280 285
Val Ser Phe Phe Pro Gln Ala Glu Thr Cys Lys Val Gln Cys Asn Arg
290 295 300
Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu Pro Thr Asp Val Asn
305 310 315 320
Leu Cys Asn Thr Asp Ile Phe Asn Ala Lys Tyr Asp Cys Lys Ile Met
325 330 335
Thr Ser Lys Thr Asp Ile Ser Ser Ser Val Ile Thr Ser Ile Gly Ala
340 345 350
Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn
355 360 365
Arg Gly Ile Ile Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn
370 375 380
Arg Gly Val Asp Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
385 390 395 400
Lys Leu Glu Gly Lys Ala Leu Tyr Ile Lys Gly Glu Pro Ile Ile Asn
405 410 415
Tyr Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile
420 425 430
Ala Gln Val Asn Ala Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Arg
435 440 445
Ser Asp Glu Leu Leu His
450

Claims (8)

1. a kind of bovine respiratory born of the same parents zoarium viral antigen proteins, encode the fit virus key protein F- albumen of bovine respiratory born of the same parents wild The amino acid sequence planted is abbreviation SEQ AAL90052.1, and particular sequence is MATTTMRMIISIIIIFIYVQHITLCQNITEEFYQSTCSAVSRGYLSALRTGWYTSVVTIELSKIQKNVCNSTDSNVK LIKQELERYNNAVVELQSLMQNEPASSSRAKRGIPELIHYKRNSTKKFYGLMGKKRKRRFLGFLLGIGSAIASGVAV SKVLHLEGEVNKIKNALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKELLPKVNNHDCQISNIATVIEFQQKNNRLL EIAREFSVNAGITTPLSTYMLTNSELLSLINDMPITNDQKKLMSSNVQIVRQQSYSIMSVVKEEVMAYVVQLPIYGV IDTPCWKLHTSPLCTTDNKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPTDVNLCNTD IFNAKYDCKIMTSKTDISSSVITSIGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNRGVDTVSVGNTLYYVNKL EGKALYIKGEPIINYYDPLVFPSDEFDASIAQVNAKINQSLAFIRRSDELLHSVDVGKSTTNVVITTIIIVIVVVIL MLIAVGLLFYSKTRSTPIMLGKDQLSGINNLSFSK, it is characterised in that：The bovine respiratory born of the same parents zoarium viral antigen proteins Amino acid sequence substituted by cysteine compared at least two sites of SEQ AAL90052.1, and substitute after cysteine Between by disulfide bond.
2. a kind of bovine respiratory born of the same parents zoarium viral antigen proteins according to claim 1, it is characterised in that：The site is The 148th valine of amino acid sequence and 288 isoleucines.
3. a kind of bovine respiratory born of the same parents zoarium viral antigen proteins according to claim 1, it is characterised in that：The site is The 158th leucine of amino acid sequence and 290 serines.
4. a kind of fit viral antigen proteins of bovine respiratory born of the same parents according to claim 1, it is characterised in that：The ox exhales The amino acid sequence for inhaling road born of the same parents zoarium viral antigen proteins compares SEQ AAL90052.1, the 260th site leucine by half Cystine is substituted, and realizes that hole is filled in the site.
5. the fit viral antigen proteins of any one bovine respiratory born of the same parents according to claim 1 ~ 3, it is characterised in that：It is described For 103 sites in the amino acid sequence rejecting SEQ AAL90052.1 sequences of bovine respiratory born of the same parents zoarium viral antigen proteins extremely The amino acid sequence in 138 sites, 102 sites and 139 sites are connected using sgsgs.
6. the fit viral antigen proteins of any one bovine respiratory born of the same parents according to claim 1 ~ 3, it is characterised in that：It is described For 103 sites in the amino acid sequence rejecting SEQ AAL90052.1 sequences of bovine respiratory born of the same parents zoarium viral antigen proteins extremely The amino acid sequence in 142 sites, 102 sites and 143 sites are connected using sgsgs.
7. the fit viral antigen proteins of any one bovine respiratory born of the same parents according to claim 1 ~ 3, it is characterised in that：It is described The amino acid sequence of coding bovine respiratory born of the same parents' zoarium viral antigen proteins compares SEQ AAL90052.1 sequences, the 99th site asparagus fern Propylhomoserin is substituted by cysteine, and the 362nd site serine is substituted by cysteine, and is connected between cysteine after replacement Interior disulfide bond.
8. the preparation method of a kind of bovine respiratory born of the same parents zoarium viral antigen proteins, it is characterised in that：Concrete technology is as follows：
（1）According to the principle of structure biology, protein crystal is carried out, observed with X-ray after crystallization, it is determined that infecting viral key Cause of disease F- albumen infects front and rear structure change；
（2）According to step（1）Structure change designs the sequence and structure of antigen protein；
（3）The qualification for needing antigen protein is determined through various antigen tests and stability characteristic detection；
（4）Corresponding albumen synthesis, expression, purification will be carried out by the antigen protein sequence of checking and detected, obtain for making It is animal experiment and clinical test for bovine respiratory born of the same parents zoarium viral antigen proteins.
CN201611064360.3A 2016-11-28 2016-11-28 A kind of bovine respiratory born of the same parents zoarium viral antigen proteins Pending CN106749555A (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN201611064360.3A CN106749555A (en) 2016-11-28 2016-11-28 A kind of bovine respiratory born of the same parents zoarium viral antigen proteins

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN201611064360.3A CN106749555A (en) 2016-11-28 2016-11-28 A kind of bovine respiratory born of the same parents zoarium viral antigen proteins

Publications (1)

Publication Number Publication Date
CN106749555A true CN106749555A (en) 2017-05-31

Family

ID=58904447

Family Applications (1)

Application Number Title Priority Date Filing Date
CN201611064360.3A Pending CN106749555A (en) 2016-11-28 2016-11-28 A kind of bovine respiratory born of the same parents zoarium viral antigen proteins

Country Status (1)

Country Link
CN (1) CN106749555A (en)

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN1264425A (en) * 1997-07-17 2000-08-23 皮埃尔法博赫药品公司 Syncytial respiratory virus epitopes and antibodies comprising them, useful in diagnosis and therapy
CN103842374A (en) * 2011-05-13 2014-06-04 诺华股份有限公司 Pre-fusion rsv f antigens

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN1264425A (en) * 1997-07-17 2000-08-23 皮埃尔法博赫药品公司 Syncytial respiratory virus epitopes and antibodies comprising them, useful in diagnosis and therapy
CN103842374A (en) * 2011-05-13 2014-06-04 诺华股份有限公司 Pre-fusion rsv f antigens

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
ECKARDT-MICHEL,J.等: "fusion protein [synthetic construct]", 《GENBANK DATABSE》 *

Similar Documents

Publication Publication Date Title
CN104244973B (en) For the urgent vaccine based on synthetic peptide of aftosa (FMD)
CN105934441A (en) A novel sars immunogenic composition
CN108912215A (en) Method and composition for dengue virus epitope
CN104271594B (en) For just exempting from the vesicular stomatitis virus of booster vaccine
Riitho et al. Bovine pestivirus heterogeneity and its potential impact on vaccination and diagnosis
WO2007068154A1 (en) A method for preparing specific igy against mutant avian influenza virus and the preparation tηereof
ES2524975T3 (en) High-performance yellow fever virus strain with greater spread in cells
CN112961224B (en) Preparation and application of bovine viral diarrhea virus type 1 virus-like particles
Barteling Modern inactivated foot-and-mouth disease (FMD) vaccines: historical background and key elements in production and use
CN107287218A (en) Infectious bronchitis of chicken velogen strain S1 genes and its velogen strain and application
CN104829710A (en) An anti-Ebola-virus immunoglobulin F(ab&#39;)2 and a preparing method thereof
ES2560452T3 (en) IPV-DPT vaccine
CN1650013B (en) DNA vaccines against hantavirus infections
CN102397559B (en) Broad spectrum type influenza vaccine and preparation method thereof
CN107849540A (en) Enterovirus 71 animal model
Li et al. B and T cell epitopes of the incursionary foot-and-mouth disease virus serotype SAT2 for vaccine development
RU2603003C1 (en) Inactivated sorptive vaccine to fmd types a, o, asia-1
CN103539839A (en) Neutralizing epitope peptide of enterovirus 71-type VP2 antigen and application thereof
CN109957009A (en) Anti-human 7 type adenovirus antibody 2-1H and its application
CN109897104A (en) 7 type adenovirus monoclonal antibody 3-3E of people and its application
CN106749556A (en) A kind of bovine respiratory born of the same parents zoarium viral antigen proteins
CN104353063A (en) Biological preparation for preventing and controlling human respiratory syncytial virus infection and preparation method
CN102240399B (en) Application of siniperca chuatsi ISKNV (Infectious Spleen and Kidney Necrosis Virus) ORF093 protein
CN111840532A (en) Live vaccine for preventing viral infectious diseases
CN106432439A (en) Bovine respiratory syncytial virus antigen protein

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
RJ01 Rejection of invention patent application after publication

Application publication date: 20170531

RJ01 Rejection of invention patent application after publication