CN106267188A - The novel antibodies of small molecule immune agonist coupling PD 1 antibody and the application in antitumor thereof - Google Patents
The novel antibodies of small molecule immune agonist coupling PD 1 antibody and the application in antitumor thereof Download PDFInfo
- Publication number
- CN106267188A CN106267188A CN201610671971.8A CN201610671971A CN106267188A CN 106267188 A CN106267188 A CN 106267188A CN 201610671971 A CN201610671971 A CN 201610671971A CN 106267188 A CN106267188 A CN 106267188A
- Authority
- CN
- China
- Prior art keywords
- antibody
- small molecule
- compound
- novel antibodies
- immune agonist
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 102100040678 Programmed cell death protein 1 Human genes 0.000 title claims abstract description 65
- 101710089372 Programmed cell death protein 1 Proteins 0.000 title claims abstract description 62
- 230000008878 coupling Effects 0.000 title claims abstract description 49
- 238000010168 coupling process Methods 0.000 title claims abstract description 49
- 238000005859 coupling reaction Methods 0.000 title claims abstract description 49
- 150000003384 small molecules Chemical class 0.000 title claims abstract description 48
- 239000012651 immune agonist Substances 0.000 title claims abstract description 45
- 229940044680 immune agonist Drugs 0.000 title claims abstract description 45
- 230000000259 anti-tumor effect Effects 0.000 title description 9
- 150000001875 compounds Chemical class 0.000 claims abstract description 37
- 238000002360 preparation method Methods 0.000 claims description 21
- 239000002243 precursor Substances 0.000 claims description 20
- 238000000034 method Methods 0.000 claims description 18
- 239000003814 drug Substances 0.000 claims description 13
- 238000006243 chemical reaction Methods 0.000 claims description 12
- 206010028980 Neoplasm Diseases 0.000 claims description 11
- -1 polyethylene Polymers 0.000 claims description 10
- 229960003301 nivolumab Drugs 0.000 claims description 7
- 229940079593 drug Drugs 0.000 claims description 6
- 239000000556 agonist Substances 0.000 claims description 5
- 210000004698 lymphocyte Anatomy 0.000 claims description 5
- 229960002621 pembrolizumab Drugs 0.000 claims description 5
- 150000003839 salts Chemical class 0.000 claims description 5
- 229960003444 immunosuppressant agent Drugs 0.000 claims description 4
- 230000001861 immunosuppressant effect Effects 0.000 claims description 4
- 239000003018 immunosuppressive agent Substances 0.000 claims description 4
- 239000004615 ingredient Substances 0.000 claims description 4
- 238000002347 injection Methods 0.000 claims description 4
- 239000007924 injection Substances 0.000 claims description 4
- 239000004698 Polyethylene Substances 0.000 claims description 3
- 125000003545 alkoxy group Chemical group 0.000 claims description 3
- 125000003282 alkyl amino group Chemical group 0.000 claims description 3
- 201000010099 disease Diseases 0.000 claims description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 3
- 229950010773 pidilizumab Drugs 0.000 claims description 3
- 229920000573 polyethylene Polymers 0.000 claims description 3
- 125000002813 thiocarbonyl group Chemical group *C(*)=S 0.000 claims description 3
- 239000000427 antigen Substances 0.000 claims description 2
- 102000036639 antigens Human genes 0.000 claims description 2
- 108091007433 antigens Proteins 0.000 claims description 2
- 238000003501 co-culture Methods 0.000 claims description 2
- 210000004443 dendritic cell Anatomy 0.000 claims description 2
- 210000003714 granulocyte Anatomy 0.000 claims description 2
- 238000010255 intramuscular injection Methods 0.000 claims description 2
- 239000007927 intramuscular injection Substances 0.000 claims description 2
- 210000002540 macrophage Anatomy 0.000 claims description 2
- 210000000822 natural killer cell Anatomy 0.000 claims description 2
- 238000010254 subcutaneous injection Methods 0.000 claims description 2
- 239000007929 subcutaneous injection Substances 0.000 claims description 2
- 238000005829 trimerization reaction Methods 0.000 claims description 2
- 206010018473 Glycosuria Diseases 0.000 claims 1
- 125000003158 alcohol group Chemical group 0.000 claims 1
- 230000000840 anti-viral effect Effects 0.000 claims 1
- 210000001367 artery Anatomy 0.000 claims 1
- 239000003937 drug carrier Substances 0.000 claims 1
- 210000002865 immune cell Anatomy 0.000 claims 1
- 239000002955 immunomodulating agent Substances 0.000 claims 1
- 229940121354 immunomodulator Drugs 0.000 claims 1
- 230000002584 immunomodulator Effects 0.000 claims 1
- 238000009169 immunotherapy Methods 0.000 claims 1
- 230000002194 synthesizing effect Effects 0.000 claims 1
- 210000003462 vein Anatomy 0.000 claims 1
- 201000011510 cancer Diseases 0.000 abstract description 3
- 230000003053 immunization Effects 0.000 abstract description 3
- 238000002649 immunization Methods 0.000 abstract description 3
- 238000002560 therapeutic procedure Methods 0.000 abstract description 3
- 230000002519 immonomodulatory effect Effects 0.000 abstract description 2
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 18
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 18
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 14
- 230000000694 effects Effects 0.000 description 13
- 239000007787 solid Substances 0.000 description 11
- 239000000376 reactant Substances 0.000 description 10
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 9
- 239000000203 mixture Substances 0.000 description 8
- 238000003756 stirring Methods 0.000 description 8
- 230000015572 biosynthetic process Effects 0.000 description 7
- 238000003786 synthesis reaction Methods 0.000 description 7
- 0 CCC(C)(C(*)=O)NC(C)(C)C=O Chemical compound CCC(C)(C(*)=O)NC(C)(C)C=O 0.000 description 6
- 102000004889 Interleukin-6 Human genes 0.000 description 6
- 108090001005 Interleukin-6 Proteins 0.000 description 6
- 210000001744 T-lymphocyte Anatomy 0.000 description 6
- 238000002474 experimental method Methods 0.000 description 6
- 230000036039 immunity Effects 0.000 description 6
- 229940100601 interleukin-6 Drugs 0.000 description 6
- 230000033228 biological regulation Effects 0.000 description 5
- 210000004027 cell Anatomy 0.000 description 5
- 239000003480 eluent Substances 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 239000002904 solvent Substances 0.000 description 5
- 230000004936 stimulating effect Effects 0.000 description 5
- UNILWMWFPHPYOR-KXEYIPSPSA-M 1-[6-[2-[3-[3-[3-[2-[2-[3-[[2-[2-[[(2r)-1-[[2-[[(2r)-1-[3-[2-[2-[3-[[2-(2-amino-2-oxoethoxy)acetyl]amino]propoxy]ethoxy]ethoxy]propylamino]-3-hydroxy-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-3-[(2r)-2,3-di(hexadecanoyloxy)propyl]sulfanyl-1-oxopropan-2-yl Chemical compound O=C1C(SCCC(=O)NCCCOCCOCCOCCCNC(=O)COCC(=O)N[C@@H](CSC[C@@H](COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NCC(=O)N[C@H](CO)C(=O)NCCCOCCOCCOCCCNC(=O)COCC(N)=O)CC(=O)N1CCNC(=O)CCCCCN\1C2=CC=C(S([O-])(=O)=O)C=C2CC/1=C/C=C/C=C/C1=[N+](CC)C2=CC=C(S([O-])(=O)=O)C=C2C1 UNILWMWFPHPYOR-KXEYIPSPSA-M 0.000 description 4
- 241000282414 Homo sapiens Species 0.000 description 4
- 102100037850 Interferon gamma Human genes 0.000 description 4
- 108010074328 Interferon-gamma Proteins 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 150000002148 esters Chemical class 0.000 description 4
- 238000001914 filtration Methods 0.000 description 4
- 238000004108 freeze drying Methods 0.000 description 4
- 238000001819 mass spectrum Methods 0.000 description 4
- AOSZTAHDEDLTLQ-AZKQZHLXSA-N (1S,2S,4R,8S,9S,11S,12R,13S,19S)-6-[(3-chlorophenyl)methyl]-12,19-difluoro-11-hydroxy-8-(2-hydroxyacetyl)-9,13-dimethyl-6-azapentacyclo[10.8.0.02,9.04,8.013,18]icosa-14,17-dien-16-one Chemical compound C([C@@H]1C[C@H]2[C@H]3[C@]([C@]4(C=CC(=O)C=C4[C@@H](F)C3)C)(F)[C@@H](O)C[C@@]2([C@@]1(C1)C(=O)CO)C)N1CC1=CC=CC(Cl)=C1 AOSZTAHDEDLTLQ-AZKQZHLXSA-N 0.000 description 3
- GLGNXYJARSMNGJ-VKTIVEEGSA-N (1s,2s,3r,4r)-3-[[5-chloro-2-[(1-ethyl-6-methoxy-2-oxo-4,5-dihydro-3h-1-benzazepin-7-yl)amino]pyrimidin-4-yl]amino]bicyclo[2.2.1]hept-5-ene-2-carboxamide Chemical compound CCN1C(=O)CCCC2=C(OC)C(NC=3N=C(C(=CN=3)Cl)N[C@H]3[C@H]([C@@]4([H])C[C@@]3(C=C4)[H])C(N)=O)=CC=C21 GLGNXYJARSMNGJ-VKTIVEEGSA-N 0.000 description 3
- QFLWZFQWSBQYPS-AWRAUJHKSA-N (3S)-3-[[(2S)-2-[[(2S)-2-[5-[(3aS,6aR)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoylamino]-3-methylbutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-4-[1-bis(4-chlorophenoxy)phosphorylbutylamino]-4-oxobutanoic acid Chemical compound CCCC(NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](NC(=O)CCCCC1SC[C@@H]2NC(=O)N[C@H]12)C(C)C)P(=O)(Oc1ccc(Cl)cc1)Oc1ccc(Cl)cc1 QFLWZFQWSBQYPS-AWRAUJHKSA-N 0.000 description 3
- 229940126657 Compound 17 Drugs 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 230000001588 bifunctional effect Effects 0.000 description 3
- 229940125758 compound 15 Drugs 0.000 description 3
- 230000005934 immune activation Effects 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- ITOFPJRDSCGOSA-KZLRUDJFSA-N (2s)-2-[[(4r)-4-[(3r,5r,8r,9s,10s,13r,14s,17r)-3-hydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]pentanoyl]amino]-3-(1h-indol-3-yl)propanoic acid Chemical compound C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H](CC[C@]13C)[C@@H]2[C@@H]3CC[C@@H]1[C@H](C)CCC(=O)N[C@H](C(O)=O)CC1=CNC2=CC=CC=C12 ITOFPJRDSCGOSA-KZLRUDJFSA-N 0.000 description 2
- VHYFNPMBLIVWCW-UHFFFAOYSA-N 4-Dimethylaminopyridine Chemical compound CN(C)C1=CC=NC=C1 VHYFNPMBLIVWCW-UHFFFAOYSA-N 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 239000012267 brine Substances 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 229940125904 compound 1 Drugs 0.000 description 2
- 229940125810 compound 20 Drugs 0.000 description 2
- 210000003677 hemocyte Anatomy 0.000 description 2
- 229940000351 hemocyte Drugs 0.000 description 2
- 230000036737 immune function Effects 0.000 description 2
- 238000002513 implantation Methods 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 210000005087 mononuclear cell Anatomy 0.000 description 2
- 210000005259 peripheral blood Anatomy 0.000 description 2
- 239000011886 peripheral blood Substances 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 210000000952 spleen Anatomy 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- WWTBZEKOSBFBEM-SPWPXUSOSA-N (2s)-2-[[2-benzyl-3-[hydroxy-[(1r)-2-phenyl-1-(phenylmethoxycarbonylamino)ethyl]phosphoryl]propanoyl]amino]-3-(1h-indol-3-yl)propanoic acid Chemical compound N([C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)O)C(=O)C(CP(O)(=O)[C@H](CC=1C=CC=CC=1)NC(=O)OCC=1C=CC=CC=1)CC1=CC=CC=C1 WWTBZEKOSBFBEM-SPWPXUSOSA-N 0.000 description 1
- IWZSHWBGHQBIML-ZGGLMWTQSA-N (3S,8S,10R,13S,14S,17S)-17-isoquinolin-7-yl-N,N,10,13-tetramethyl-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-3-amine Chemical compound CN(C)[C@H]1CC[C@]2(C)C3CC[C@@]4(C)[C@@H](CC[C@@H]4c4ccc5ccncc5c4)[C@@H]3CC=C2C1 IWZSHWBGHQBIML-ZGGLMWTQSA-N 0.000 description 1
- FALRKNHUBBKYCC-UHFFFAOYSA-N 2-(chloromethyl)pyridine-3-carbonitrile Chemical compound ClCC1=NC=CC=C1C#N FALRKNHUBBKYCC-UHFFFAOYSA-N 0.000 description 1
- DEZXLFKSYRODPB-UHFFFAOYSA-N 3-[2-(2-aminoethoxy)ethoxy]propanoic acid Chemical compound NCCOCCOCCC(O)=O DEZXLFKSYRODPB-UHFFFAOYSA-N 0.000 description 1
- 229960000549 4-dimethylaminophenol Drugs 0.000 description 1
- 108010074708 B7-H1 Antigen Proteins 0.000 description 1
- DWAJGHCTNURVNF-UHFFFAOYSA-N CCOc(nc1[n]2CC3C=CC(CNC(CSC(CC(N4CC(CC5)CCC5C(ON(C(CC5)=O)C5=O)=O)=O)C4=O)=O)=CC3)nc(N)c1nc2O Chemical compound CCOc(nc1[n]2CC3C=CC(CNC(CSC(CC(N4CC(CC5)CCC5C(ON(C(CC5)=O)C5=O)=O)=O)C4=O)=O)=CC3)nc(N)c1nc2O DWAJGHCTNURVNF-UHFFFAOYSA-N 0.000 description 1
- VWFVGRJBJUOADI-UHFFFAOYSA-N COCCOc(nc1[n]2Cc3ccc(CNC(CS)=O)cc3)ncc1nc2O Chemical compound COCCOc(nc1[n]2Cc3ccc(CNC(CS)=O)cc3)ncc1nc2O VWFVGRJBJUOADI-UHFFFAOYSA-N 0.000 description 1
- YMELBHRGHUSPQK-UHFFFAOYSA-N COCON(C(CC1)=O)C1=O Chemical compound COCON(C(CC1)=O)C1=O YMELBHRGHUSPQK-UHFFFAOYSA-N 0.000 description 1
- 102000008203 CTLA-4 Antigen Human genes 0.000 description 1
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- 238000007445 Chromatographic isolation Methods 0.000 description 1
- 206010015548 Euthanasia Diseases 0.000 description 1
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 1
- 101710083479 Hepatitis A virus cellular receptor 2 homolog Proteins 0.000 description 1
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 1
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 1
- 102000017578 LAG3 Human genes 0.000 description 1
- OPFJDXRVMFKJJO-ZHHKINOHSA-N N-{[3-(2-benzamido-4-methyl-1,3-thiazol-5-yl)-pyrazol-5-yl]carbonyl}-G-dR-G-dD-dD-dD-NH2 Chemical compound S1C(C=2NN=C(C=2)C(=O)NCC(=O)N[C@H](CCCN=C(N)N)C(=O)NCC(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC(O)=O)C(N)=O)=C(C)N=C1NC(=O)C1=CC=CC=C1 OPFJDXRVMFKJJO-ZHHKINOHSA-N 0.000 description 1
- KZNICNPSHKQLFF-UHFFFAOYSA-N O=C(CC1)NC1=O Chemical compound O=C(CC1)NC1=O KZNICNPSHKQLFF-UHFFFAOYSA-N 0.000 description 1
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 1
- 108010087230 Sincalide Proteins 0.000 description 1
- 229940126547 T-cell immunoglobulin mucin-3 Drugs 0.000 description 1
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000000118 anti-neoplastic effect Effects 0.000 description 1
- 229940125644 antibody drug Drugs 0.000 description 1
- 230000005975 antitumor immune response Effects 0.000 description 1
- XRWSZZJLZRKHHD-WVWIJVSJSA-N asunaprevir Chemical compound O=C([C@@H]1C[C@H](CN1C(=O)[C@@H](NC(=O)OC(C)(C)C)C(C)(C)C)OC1=NC=C(C2=CC=C(Cl)C=C21)OC)N[C@]1(C(=O)NS(=O)(=O)C2CC2)C[C@H]1C=C XRWSZZJLZRKHHD-WVWIJVSJSA-N 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 238000010609 cell counting kit-8 assay Methods 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000011097 chromatography purification Methods 0.000 description 1
- 229940126086 compound 21 Drugs 0.000 description 1
- 229940126208 compound 22 Drugs 0.000 description 1
- 229940125961 compound 24 Drugs 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 235000019628 coolness Nutrition 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000004043 dyeing Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 125000003827 glycol group Chemical group 0.000 description 1
- 238000004896 high resolution mass spectrometry Methods 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000008629 immune suppression Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000006028 immune-suppresssive effect Effects 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 238000001698 laser desorption ionisation Methods 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 238000011866 long-term treatment Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- WHQSYGRFZMUQGQ-UHFFFAOYSA-N n,n-dimethylformamide;hydrate Chemical compound O.CN(C)C=O WHQSYGRFZMUQGQ-UHFFFAOYSA-N 0.000 description 1
- 230000004719 natural immunity Effects 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 238000005191 phase separation Methods 0.000 description 1
- 239000002574 poison Substances 0.000 description 1
- 231100000614 poison Toxicity 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 108090000623 proteins and genes Proteins 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 238000005728 strengthening Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 229940014800 succinic anhydride Drugs 0.000 description 1
- 230000008093 supporting effect Effects 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000011282 treatment Methods 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 230000005760 tumorsuppression Effects 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/519—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
- A61K31/52—Purines, e.g. adenine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D473/00—Heterocyclic compounds containing purine ring systems
- C07D473/02—Heterocyclic compounds containing purine ring systems with oxygen, sulphur, or nitrogen atoms directly attached in positions 2 and 6
- C07D473/18—Heterocyclic compounds containing purine ring systems with oxygen, sulphur, or nitrogen atoms directly attached in positions 2 and 6 one oxygen and one nitrogen atom, e.g. guanine
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Biomedical Technology (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
The invention provides novel antibodies and the application thereof of a kind of small molecule immune agonist coupling PD 1 antibody, described novel antibodies is reacted by small molecule immune agonist and PD 1 antibody coupling and obtains, and described novel antibodies includes the compound of below general formula [I]: the novel antibodies in the present invention can be used for immunization therapy and the immunomodulating of malignant tumor.
Description
Technical field
The present invention relates to immunochemistry field, more particularly, it relates to a kind of PD-inhibited to immune system
1 antibody and small molecule immunity agonist chemical combination coupling form novel antibodies, and the preparation of this novel antibodies and anti-swollen
Application in tumor.
Background technology
In recent years, an impressive progress in immunity antitumor field is the immune antitumor action of application PD-1 antibody,
As a breakthrough antibody drug of antineoplastic, its target spot is the expression PD-1 albumen (such as T cell) on immunocyte.
PD-1 is an immune suppressive protein, and suppression and the effect of immunologic balance are excessively played in the immunity to normal human.But swollen
In tumor human body, PD-1 also produces inhibitory action to normal anti tumor immune response；Therefore PD-1 antibody can release this
Immunosuppressive action (Products in China magazine volume 27 6 phase 856 860 in June, 2014) to tumor, this acts on and faces
Bed treatment tumor creates the effect of many long-term treatments.
At present PD-1 antibody the U.S., Japan and other countries listing clinical practice (specifically can be found in following network address:http://www.fiercebiotech.com/biotech/anti-pd-1-cancer-star-nivolumab-wins-
world-s-first-regulatory-approval；http://www.pharmatimes.com/news/japan_
Approves_worlds_first_pd-1_drug%2C_nivolumab_1002153).
But, the effect of PD-1 antibody simply releases the immune suppression effect of " braking ", although therefore its curative effect shows
Write, but only in about 20% to 30% patient effectively.In order to improve its curative effect ratio, a kind of product of needs can be simultaneously
Improve tumour patient autoimmune ability, to produce synergism and higher therapeutic effect.
Summary of the invention
The technical problem to be solved in the present invention is, for the problem that above-mentioned PD-1 antibody curative effect ratio is relatively low, it is provided that one
Plant the novel antibodies of small molecule immune agonist coupling PD-1 antibody and the application in antitumor thereof.
The present invention solves the technical scheme of above-mentioned technical problem and is to provide a kind of small molecule immune agonist coupling PD-1 and resists
The novel antibodies of body, described novel antibodies is reacted by small molecule immune agonist and PD-1 antibody coupling and obtains, described novel anti-
Body includes the compound of below general formula [I]:
In formula [I]: X1Represent OH or SH；R1Represent alkoxyl or alkyl amine group, X2Represent link group；Wherein antibody portion
Dividing and linked with small molecule immune agonist ingredient formed by small molecule immune agonist and described antibody covalent combination, m is
The number (m is defined as coupling degree) of small molecule agonist, is the numeral of 1～10；Antibody moiety refers to the monoclonal antibody for anti-PD-1
(IgG1, IgG2 or IgG4).
When the compound that described small molecule immune agonist is formula 1:
Described X2Expression thiocarbonyl group:
When the compound that described small molecule immune agonist is formula 2-1,2-2,2-3:
Described X2It is expressed as follows group:
When the compound that described small molecule immune agonist is formula 3:
In formula 3, u is the integer of 0～12；
X2It is expressed as follows group:
Wherein u is the integer of 0～12；
When the compound that described small molecule immune agonist is formula 4:
X2It is expressed as follows group:
Wherein PEG is polyethylene groupAs two polyethylene groups areTrimerization second
Glycol group isFour polyethylene groups are
The invention provides a kind of novel bifunctional antibody 10,12,14,16,18, the existing immunity of these novel antibodies presses down
Removing function processed (with the antitumous effect that significantly improves as representative), has activation immunologic function the most simultaneously.
It is in place of the creation of the present invention, it is provided that existing immunosuppressant removing function is (with the antitumous effect significantly improved
For representing), there is novel antibodies activating immunologic function and preparation method thereof the most simultaneously.
It is in place of the creation of the present invention, it is provided that have above-mentioned difunctional, can promote that again active t cell is value-added novel anti-
Body and preparation method thereof.
It is an object of the invention to, it is provided that for preparing coupling precursor micromolecular compound and the synthesis of above-mentioned novel antibodies
The compound of these little molecules of coupling precursor or their salt.
Another object of the present invention is to, it is provided that prepared novel antibodies immunosuppressant release and excite, disease-resistant
Application in the regulation of poison, tumour immunity and knubble biological immunization therapy.
New coupled antibody in the present invention can be used for immunization therapy and the immunomodulating of malignant tumor, and its administrated method can be
Lumbar injection, subcutaneous injection, intramuscular injection and intravenous injection；Or can use the novel antibodies in the present invention and immunocyte
After (such as dendritic cell, natural killer cell NK, lymphocyte, Monocytes/Macrophages, granulocyte etc.) co-culture, separation is exempted from
The method fed back in epidemic disease cyton.
Above-mentioned novel antibodies can be made into the corresponding small molecule immune agonist compound or their salt of preparing them
It is applicable to above-mentioned various medicine, compound medicine, cooperative drug can be made with other drug or make pharmaceutically acceptable
The complex of carrier or conjugate.
The New-type bifunctional antibody of the present invention or their salt can be used for preparing in the medicine of various ratio.
Accompanying drawing explanation
Fig. 1 is interleukin-6 (IL-6) stimulating activity of novel antibodies 10,12,14,16,18.
Fig. 2 is IL-12 (IL-12) stimulating activity of novel antibodies 10,12,14,16,18.
Fig. 3 is the IFN-γ stimulating activity of novel antibodies 10,12,14,16,18.
Fig. 4 is the anti-tumor activity of novel antibodies 10,12,14,16,18.
Fig. 5 is the promotion T cell increment activity of novel antibodies 10,12,14,16,18.
Fig. 6 be small molecule immune agonist 19,20,21,22, the IFN-γ stimulating activity of 20-2.
Fig. 7 is interleukin-6 (IL-6) stimulating activity of small molecule immune agonist 19,20,21,22.
Fig. 8 is the functional character of PD-1 antibody.
Fig. 9,10,11 are the PD-1 antibody function features of novel antibodies of the present invention.
Detailed description of the invention
In order to make the purpose of the present invention, technical scheme and advantage clearer, below in conjunction with drawings and Examples, right
The present invention is further elaborated.Should be appreciated that specific embodiment described herein only in order to explain the present invention, and
It is not used in the restriction present invention.
The invention provides the novel antibodies of a kind of small molecule immune agonist coupling PD-1 antibody, there is following structure
Formula [I] represents:
In formula [I]: X1Represent OH or SH；R1Represent alkoxyl or alkyl amine group, X2Represent link group；Wherein antibody with
Small molecule immune agonist ingredient is linked by small molecule immune agonist and described antibody covalent combination and is formed, and m is little point
The number (m is defined as coupling degree) of sub-agonist, is the numeral of 1～10；Antibody moiety refer to monoclonal antibody for anti-PD-1 (IgG1,
IgG2 or IgG4).
When the compound that described small molecule immune agonist is formula 1:
Described X2Expression thiocarbonyl group:
When the compound that described small molecule immune agonist is formula 2-1,2-2,2-3:
Described X2It is expressed as follows group:
When the compound that described small molecule immune agonist is formula 3:
In formula 3, u is the integer of 0～12；
X2It is expressed as follows group:
Wherein u is the integer of 0～12；
When the compound that described small molecule immune agonist is formula 4:
X2It is expressed as follows group:
Wherein PEG is polyethylene groupAs two polyethylene groups areThree
Polyethylene group isFour polyethylene groups are
Deng.
When small molecule immune agonist be formula 1,2-1,2-2,2-3,4 represent compound time, with PD-1 antibody and other
The Typical Representative structural formula of the novel antibodies formed as antibody moiety as a example by antibody is as follows:
Wherein m is the number between 1 to 10.
When the compound that the little molecule of the precursor of coupling novel antibodies is formula 1,2-1,2-2,2-3,4 representatives, resist with PD-1
The Typical Representative synthesis of the novel antibodies formed as representative antibodies as a example by body and structural formula thereof are as follows:
In the novel antibodies that above-mentioned coupling is formed, antibody is selected from PD-1 monoclonal antibody；Also apply be applicable to other similar solution
Except immunosuppressant antibody, such as PD-L1 antibody, CTLA-4 antibody, TIM-3 antibody, LAG3 antibody, TIGIT antibody etc.；PD-1 is mono-
The anti-monoclonal antibody (IgG1, IgG2 and IgG4) including various anti-human PD-1 albumen, the sequence of described PD-1 albumen is as follows:
1MQIPQAPWPWWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS61ESFVLNWYR70MSPSNQ
TDKLAAFPEDR86SQPGQDCRFRVTQLPNGRDFHMSWRARRND118SGTYLCGAISLAPKAQIKE136SLRAELRVTERR
AEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS181LVLLVWVLAVICSRAARGTIGARRTGQPLKEDP5AVPVFSVDY
GELDFQWREKTPEPPVP241CVPEQTEYATIVFP5GMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL
Described PD-1 antibody is the epitope sequences of antigen for this sequence.
Coupling precursor compound 11 synthesis citing:
20-1 is dissolved in anhydrous DMSO, adds the succinic anhydride of equivalent, mixture natural room temperature in 10 DEG C of coolings
Stir 24 hours.Mixed reactant falls with 20 times of volume of water, separates out a large amount of compound as white solid SZU-101；Yield 88%；
MS(ESI)445.27(M+1)；
SZU-101 (1eq), NHS (1.2eq) and EDC (1.3eq) are dissolved in dry DMF, under room temperature, stir 4h, terminate anti-
Should, reactant liquor is poured in dichloromethane, sucking filtration, be dried, obtain active ester 23 white solid, be directly used in next step reaction.Will
Active ester and NH2-PEG2-COOH (compound 24) are dissolved in DMF in equivalent ratio, be stirred at room temperature to reaction terminate (TLC supervise
Survey).Adding water, separate out a large amount of solid, sucking filtration, be dried, column chromatographic isolation and purification (dichloromethane: methanol=10:1) obtains white solid
Compound 19, yield 86%；Fusing point 221 DEG C；High resolution mass spectrum molecular weight HRMS (ESI) theoretical value m/z 603.2746, found
604.2757(M+H)。
19 (1eq), NHS (1.2eq) and EDC (1.3eq) are dissolved in dry DMF, stir 12h under room temperature, terminate reaction, will
Reactant liquor is poured in dichloromethane, sucking filtration, is dried, obtains active ester compound 11 white solid, yield 82%；Fusing point 187 DEG C；High
Resolution Mass Spectrometry molecular weight HRMS (ESI) theoretical value m/z 700.2839, found 701.2842 (M+1).
Coupling precursor compound 13 synthesis citing:
Compound 20-1 (with reference to Chinese patent CN201210382202.8) (1eq) and TGA (1eq) are dissolved in nothing
Water DMF, adds 1.2eq HBTU, 3eq triethylamine and 0.1eq DMAP, is stirred at room temperature, and after reaction terminates, adds water, and sucking filtration is dry
Dry 20-2 faint yellow solid.It is stirred at room temperature in DMF with 4-(N-maleimidomehyl) hexamethylene-1-carboxylic acid (1eq) again,
TLC monitoring raw material disappears, and reactant mixture pours into cold water, and product solid filters, and is dried to obtain compound 20, MS (ESI)
656.27 (M+1). compound 20 (1eq) is added NHS (1.2eq) and the DMF solution stirred overnight at room temperature of EDC (1.3eq), instead
After should completing, obtaining active ester compound 13, fusing point 201 DEG C through preparation liquid phase separation, yield 35% (is calculated from initiation material 20-1
Rise)；High resolution mass spectrum molecular weight HRMS (ESI) theoretical value m/z 752.2630, found 753.2632 (M+1).
Coupling precursor compound 15,17 synthesis preparation method, reaction condition are identical with preparing compound 13 with ingredient proportion,
Simply willWithReplace；
Coupling precursor compound 15 synthetic route:
Obtain compound 21, white solid, Mass Spectrometric Identification molecular weight: HRMS (ESI) 630.2356 (M+1).Obtain coupling precursor
Compound 15, white solid, Mass Spectrometric Identification molecular weight: HRMS (ESI) 727.2431 (M+1).
The synthetic route of coupling precursor compound 17:
Obtain compound 22, white solid, Mass Spectrometric Identification molecular weight: HRMS (ESI) 588.1819 (M+1).Obtain coupling precursor
Compound 17, white solid, Mass Spectrometric Identification molecular weight: HRMS (ESI) 685.2022 (M+1).
With New-type bifunctional antibody preparation synthesis implementation example in the present invention that PD-1 antibody is formed:
Identification mass spectrograph model: LDI-1700 laser desorption ionisation flight time mass spectrum (MALDI-TOF-MS) is raw
Business men: Linear Scientific company of the U.S..
Mass spectrum determines that the method for the ratio (coupling degree) of small molecule immune agonist is as follows: Mass Spectrometric Identification gained coupling is novel
The molecular weight of antibody products deducts former PD-1 antibody molecule and measures value added, calculates: molecular weight value added/(little point of coupling precursor
Sub-molecular weight-18)=coupling degree；(1 molecular weight deducting 1 hydrone of the every coupling of micromolecular compound).
PD-1 antibody first-selection is Nivolumab (BMS-936558), Pembrolizumab (MK-3475), AMP-514,
AMP-224, Pidilizumab；But it is also applied for the PD-1 antibody in other source.
The preparation of Nivolumab according in patent WO2006121168 prepare 5C4,17D8,2D3,4H1,4A11,7D3 and
The method of 5F4；And the method announced in CN201380062005.0.
The preparation of Pembrolizumab according to preparation h409A11 in patent WO2008156712 (A1) and
The method announced in US8354509 and US8900587 patent.
The preparation of AMP-514 and AMP-224 is according to the method announced in patent WO201214549 patent.
The preparation of Pidilizumab is according to the method announced in patent WO2009014708 and WO2009114335 patent.
The preparation method of PD-1 antibody may be used without other open method well known in the art, as at Chinese patent
CN201410838610.9；CN201310199947.5；CN201380079581.6；CN201480011008.6；
Method disclosed in CN201310258289.2.
PD-1 antibody can also be bought as source, such as purchased from BioXCell company of U.S. PD-1 antibody, title in market:
Anti h PD-1 (h CD279) IgG1, content 95%；Ke Xin bio tech ltd, Beijing anti-PD-1 human monoclonal resists
Body.PD-1 antibody sources in novel antibodies synthetic method of the present invention is not limited to this.
The reaction density of following PD-1 antibody is 1 equivalent concentration (1eq, relative to other reactant).
The preparation of novel antibodies 10:
The synthesis preparation method of coupling precursor micromolecular compound 1 refer to Chinese patent (CN201210382202.8).
Compound 1 (10eq equivalent concentration) and PD-1 antibody (Nivolumab) are mixed in the DMSO solvent of 1mL, mixed
Compound added triethylamine 0.1mL, with 5 DEG C to 20 DEG C of stirring reactions 12 hours.Reactant mixture mixes with 0 DEG C of pure water of 10mL,
Shake up, be filtered to remove little molecule with the biological filter membrane of 10kD, use pure water eluted product, eluent lyophilization to obtain novel antibodies 10
(yield 60%).Mass Spectrometric Identification molecular weight increases to 1167；Calculating coupling degree is 3.(1167/386=3.02).
The preparation of novel antibodies 12:
Compound 11 (30eq equivalent concentration) and PD-1 antibody (Nivolumab) are mixed in appropriate DMSO solvent, mixed
Compound addition triethylamine regulation pH value was to 8, with 5 DEG C to 20 DEG C of stirring reactions 12 hours.Reactant mixture and 0 DEG C of 10 times of volumes
Pure water mixes, and shakes up, is filtered to remove little molecule with the biological filter membrane of 10kD, is temporarily released from one's regular work thing by pure water rinsing, eluent lyophilization
Obtain novel antibodies 12 (yield 72%).Mass Spectrometric Identification molecular weight increases to 2931；Calculating coupling degree is 5.(2931/585.6=
5)。
(in the preparation method of novel antibodies 12, Nivolumab is replaced with BioXCell company PD-1 antibody: anti
H PD-1 (h CD279) IgG1, obtains novel antibodies 12-2, and the result of its preparation process and gained novel antibodies 12-2 is with novel
Antibody 12 is identical).
The preparation of novel antibodies 14:
Compound 13 (40eq equivalent concentration) and PD-1 antibody (AMP-514) are mixed in appropriate DMSO solvent, mixing
Thing addition triethylamine regulation pH value was to 8, with 5 DEG C to 20 DEG C of stirring reactions 12 hours.0 DEG C of reactant mixture and 10 times of volumes pure
Water mixes, and shakes up, is filtered to remove little molecule with the biological filter membrane of 10kD, is temporarily released from one's regular work thing by pure water rinsing, and eluent lyophilization obtains
Novel antibodies 14 (yield 66%).Mass Spectrometric Identification molecular weight increases to 1917；Calculating coupling degree is 3.
The preparation of novel antibodies 16:
Compound 15 (40eq equivalent concentration) and PD-1 antibody (Pembrolizumab) are mixed in appropriate DMSO solvent
In, mixture addition triethylamine regulation pH value was to 8, with 5 DEG C to 20 DEG C of stirring reactions 12 hours.Reactant mixture and 10 times of volumes
The mixing of 0 DEG C of pure water, shake up, be filtered to remove little molecule with the biological filter membrane of 10kD, be temporarily released from one's regular work thing by pure water rinsing, eluent is freezing
It is dried to obtain novel antibodies 16 (yield 73%).Mass Spectrometric Identification molecular weight increases to 2377；Calculate coupling degree and be about 4.
The preparation of novel antibodies 18:
Compound 17 (40eq equivalent concentration) and PD-1 antibody (AMP-224) are mixed in appropriate DMSO solvent, mixing
Thing addition triethylamine regulation pH value was to 8, with 5 DEG C to 20 DEG C of stirring reactions 12 hours.0 DEG C of reactant mixture and 10 times of volumes pure
Water mixes, and shakes up, is filtered to remove little molecule with the biological filter membrane of 10kD, is temporarily released from one's regular work thing by pure water rinsing, and eluent lyophilization obtains
Novel antibodies 18 (yield 57%).Mass Spectrometric Identification molecular weight increases to 1143；Calculate coupling degree and be about 2.
The immune activation experimental technique (mice) of novel antibodies of the present invention:
1. take Balb/C mouse spleen lymphocyte, by 1x106/ ml/ hole bed board
2. preferred antibody concentration: stimulate 24h by 0.1 μM of dosing.
3. collect supernatant and detect IL-6/IL-12 (effect is as shown in Figure 1, 2) by ELISA method.
The immune activation experimental technique (mice) of small molecular immunity agonist of the present invention:
1. take Balb/C mouse spleen lymphocyte, by 1x106/ ml/ hole bed board
2. choose the concentration of small molecule immune agonist: stimulate 24h by 0.1,10,20 μMs of dosings.
3. collect supernatant and detect IFN-γ/IL-6 (effect is as shown in Figure 6,7) by ELISA method.
The immune activation experimental technique (people) of novel antibodies of the present invention:
1. take volunteer peripheral mononuclear cells, isolate T cell (suspension cell) in 37 DEG C, 5%CO2Containing blood serum medium
Cultivate 7 days, by 1x106/ ml/ hole bed board
2. preferred antibody concentration: stimulate 24h by 0.1 μM of dosing.
3. collect supernatant and detect IFN-γ (as shown in Figure 3) by ELISA method.
The antitumous effect experimental technique of novel antibodies of the present invention:
The Balb/C mice of 68 week old is randomly divided into 7 groups.At mouse back subcutaneous implantation 2.5x105Individual 4T1 tumor
Cell.It is administered with the PD-1 antibody control of PBS blank, 10mg/kg respectively；Comparison medicine and novel antibodies 10,12,14,16,
The dosage of 18 is 10mg/kg, volume 100 μ L；Each group administering mode is lumbar injection.After implantation tumor the 1st day, the
7,15,22,29 days each group be administered respectively.When tumor reaches 1500mm3Or more than body weight 15% time by mice euthanasia.Swollen
Tumor suppression result is as shown in Figure 4.In the visible present invention, novel antibodies process group has the Graft Versus Tumor significantly improved.
The promotion T cell increment experimental technique of novel antibodies of the present invention:
Take volunteer peripheral mononuclear cells, isolate T cell (suspension cell) in 37 DEG C, 5%CO2Train containing blood serum medium
After supporting 7 days, change serum-free medium and be simultaneously introduced novel antibodies and the PD-1 (comparison) (concentration is 1 μM) of the present invention, after 3 days
CCK-8 cell dyeing method detects.Visible novel antibodies of the present invention can promote by strengthening blocking-up PD-1 and the activation natural immunity
Enter T cell increment.Result is as shown in Figure 5.
The PD-1 antibody function characterization experiments method of novel antibodies of the present invention (resists with the specificity two anti-detection PD-1 of PD-1
Body):
1. extraction healthy volunteer's peripheral blood
2. acquirement peripheral blood is in centrifuge tube, 800g, 30min.Separate serum and hemocyte.
3. it is resuspended in normal saline after obtaining hemocyte, adds to peripheral blood lymphocyte separation liquid along wall gently
Layer.
4.800g is centrifuged 30min. and draws tunica albuginea layer (periphery lymphocyte layer).
5. the peripheral blood lymphocyte of isolated is resuspended in 900g in normal saline, 10min.Wash 2 times.
6. counting separates the peripheral blood lymphocyte obtained.
7. taking 1x106 cell, 100ul normal saline is resuspended, uses PD-1 antibody respectively, novel antibodies of the present invention 10,12,
16, and IgG1 (comparison), hatch 30min for 37 degree.
8. brine 3 times, resuspended with 100ul normal saline, add the two of Anti-PD-1-FITC and resist, room temperature is incubated
Educate 30min.
9. brine, machine testing in streaming.
Result is as shown in Fig. 8,9,10,11: compare with the group of matched group and non-coupling it is found that
The PD-1 antibody function feature of the novel antibodies of the present invention remains intact.
The above, the only present invention preferably detailed description of the invention, but protection scope of the present invention is not limited thereto,
Any those familiar with the art in the technical scope that the invention discloses, the change that can readily occur in or replacement,
All should contain within protection scope of the present invention.Therefore, protection scope of the present invention should be with scope of the claims
It is as the criterion.
Claims (10)
1. the novel antibodies of a small molecule immune agonist coupling PD-1 antibody, it is characterised in that described novel antibodies is by little
Molecular immune agonist and the reaction of PD-1 antibody coupling obtain, and described novel antibodies includes the compound of below general formula [I]:
In formula [I]: X1Represent OH or SH；R1Represent alkoxyl or alkyl amine group, X2Represent link group；Wherein antibody moiety with
Small molecule immune agonist ingredient is to be linked shape by small molecule immune agonist coupling precursor and described antibody covalent combination
Becoming, m is the number (m is defined as coupling degree) of small molecule agonist, is the numeral of 1～10；Antibody moiety refers to the list for anti-PD-1
Anti-(IgG1, IgG2 or IgG4)；Described small molecule immune agonist coupling precursor is defined as when carrying out covalent combination with antibody
The activated form of small molecule immune agonist.
When the compound that described small molecule immune agonist coupling precursor is formula 1:
Described X2Expression thiocarbonyl group:
When the compound that described small molecule immune agonist coupling precursor is formula 2-1,2-2,2-3:
Described X2It is expressed as follows group:
When the compound that described small molecule immune agonist coupling precursor is formula 3:
In formula 3, u is the integer of 0～12；
X2It is expressed as follows group:
Wherein u is the integer of 0～12；
When the compound that described small molecule immune agonist coupling precursor is formula 4:
X2It is expressed as follows group:
Wherein PEG is polyethylene groupAs two polyethylene groups areTrimerization second two
Alcohol groups isFour polyethylene groups are
The novel antibodies of small molecule immune agonist coupling PD-1 antibody the most according to claim 1, it is characterised in that: institute
Stating PD-1 antibody and include the monoclonal antibody (IgG1, IgG2 or IgG4) of various anti-human PD-1 albumen, the sequence of described PD-1 albumen is preferential
Select as follows:
1MQIPQAPWPWWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLWTEGDNATFTCSFSNTS61ESFVLNWYR70MSP
SNQTDKLAAFPEDR86SQPGQDCRFRVTQLPNGRDFHMSWRARRND118SGTYLCGAISLAPKAQIKE136SLRAELRVT
ERRAEVPTAHPSPSPRPAGQFQTLWGVVGGLLGS181LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSV
DYGELDFQWREKTPEPPVP241CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL；
Described PD-1 antibody is the epitope sequences of antigen for this sequence.
The novel antibodies of small molecule immune agonist coupling PD-1 antibody the most according to claim 1, it is characterised in that: institute
The PD-1 antibody stated is Nivolumab, Pembrolizumab, AMP-514, AMP-224, Pidilizumab or other anti h
PD-1(h CD279)IgG1。
The novel antibodies of small molecule immune agonist coupling PD-1 antibody the most according to claim 1, it is characterised in that: when
When small molecule immune agonist is the compound of formula 1,2-1,2-2,2-3,4 representatives, the Typical Representative structure of described novel antibodies
Formula is as follows:
Wherein m is the number between 1 to 10.
The novel antibodies of small molecule immune agonist coupling PD-1 antibody the most according to claim 4, it is characterised in that: when
Small molecule immune agonist be formula 1,2-1,2-2,2-3,4 represent compound time, the Typical Representative 10 of described novel antibodies,
12, the structural formula of 14,16,18 is as follows:
6. a small molecule immune agonist coupling precursor compound, it is characterised in that: for new as in claim 5 of preparation
The Typical Representative 12,14,16,18 of type antibody, correspondence includes the compound of following structural formula 11,13,15,17:
7. exciting for synthesizing the small molecule immune of small molecule immune agonist coupling precursor compound as claimed in claim 6
Immunomodulator compounds, it is characterised in that: described small molecule immune agonist compound for include structure as shown below formula 19,20-2,20,
21,22 compound or their salt:
8. according to fitting that the novel antibodies according to any one of claim 1---7 and micromolecular compound or their salt are made
Make compound medicine, cooperative drug for various medicines or with other drug, or make pharmaceutically acceptable carrier
Complex or conjugate.
9. use medicine as described in claim 8, immunosuppressant release and excite, prepared by antibody, antiviral, glycosuria
Application in disease and immunotherapy of tumors.
10. the application of as described in claim 9 medicine, administrated method is lumbar injection, subcutaneous injection, intramuscular injection and quiet
Arteries and veins injection or oral；Or can be used for immunocyte (as dendritic cell, natural killer cell NK, lymphocyte, monokaryon/
Macrophage, granulocyte etc.) co-culture after, the method fed back in isolating immune cells body.
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201610671971.8A CN106267188A (en) | 2016-08-15 | 2016-08-15 | The novel antibodies of small molecule immune agonist coupling PD 1 antibody and the application in antitumor thereof |
| PCT/CN2017/081007 WO2018032793A1 (en) | 2016-08-15 | 2017-04-19 | Novel antibody obtained by coupling small molecule immuno-agonist and pd-1 antibody, and application thereof in tumor resistance |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201610671971.8A CN106267188A (en) | 2016-08-15 | 2016-08-15 | The novel antibodies of small molecule immune agonist coupling PD 1 antibody and the application in antitumor thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN106267188A true CN106267188A (en) | 2017-01-04 |
Family
ID=57670446
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201610671971.8A Pending CN106267188A (en) | 2016-08-15 | 2016-08-15 | The novel antibodies of small molecule immune agonist coupling PD 1 antibody and the application in antitumor thereof |
Country Status (2)
| Country | Link |
|---|---|
| CN (1) | CN106267188A (en) |
| WO (1) | WO2018032793A1 (en) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107281484A (en) * | 2017-05-31 | 2017-10-24 | 深圳大学 | Composition for preparing hepatitis B vaccine and its preparation method and application |
| CN107281483A (en) * | 2017-04-25 | 2017-10-24 | 深圳大学 | The preparation method of immune activator and composition and its application and composition |
| WO2018032793A1 (en) * | 2016-08-15 | 2018-02-22 | 深圳大学 | Novel antibody obtained by coupling small molecule immuno-agonist and pd-1 antibody, and application thereof in tumor resistance |
| CN108379591A (en) * | 2018-04-03 | 2018-08-10 | 深圳大学 | The synthesis and its application of immune agonist target compound |
| CN111704614A (en) * | 2020-04-15 | 2020-09-25 | 深圳大学 | Novel series immune agonists |
| WO2022194153A1 (en) * | 2021-03-16 | 2022-09-22 | 中国科学院上海药物研究所 | Pd-l1 and tlr7 double-targeting nanobody coupling drug and use thereof in anti-tumor |
| WO2023174312A1 (en) * | 2022-03-15 | 2023-09-21 | 中国科学院上海药物研究所 | Anti-human pd-l1 and tlr7 double-targeting nanobody conjugate drug and use thereof in resisting tumor |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018127918A1 (en) | 2017-01-05 | 2018-07-12 | Kahr Medical Ltd. | A sirp alpha-cd70 fusion protein and methods of use thereof |
| US11566060B2 (en) | 2017-01-05 | 2023-01-31 | Kahr Medical Ltd. | PD1-CD70 fusion protein and methods of use thereof |
| US11702458B2 (en) | 2017-01-05 | 2023-07-18 | Kahr Medical Ltd. | PD1-41BBL fusion protein and methods of use thereof |
| HRP20220230T1 (en) | 2017-01-05 | 2022-04-29 | Kahr Medical Ltd. | A sirp1 alpha-41bbl fusion protein and methods of use thereof |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101239980A (en) * | 2008-02-18 | 2008-08-13 | 靳广毅 | Immune receptor regulator couplet precursor, couplet and application thereof |
| WO2011134669A1 (en) * | 2010-04-30 | 2011-11-03 | Telormedix Sa | Methods for inducing an immune response |
| CN102993265A (en) * | 2012-10-10 | 2013-03-27 | 靳广毅 | Immune receptor regulator couplet as well as preparation method and application thereof, coupling precursor for preparing immune receptor regulator couplet and compound for compounding coupling precursor |
| CN103254304A (en) * | 2012-05-30 | 2013-08-21 | 深圳大学 | Immune stimulant couplet, preparation method thereof and antineoplastic application of the immune stimulant couplet |
| CN104220441A (en) * | 2012-02-13 | 2014-12-17 | 百时美施贵宝公司 | Enediyne compounds, conjugates thereof, and uses and methods therefor |
| CN104974252A (en) * | 2014-04-01 | 2015-10-14 | 上海中信国健药业股份有限公司 | Antibody-small molecule drug conjugate capable of inhibiting tumor growth, and preparation method and application thereof |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101230064A (en) * | 2007-01-22 | 2008-07-30 | 靳广毅 | 9 methylene aryl substituted purine derivative |
| CN102439011B (en) * | 2009-02-11 | 2016-05-04 | 加利福尼亚大学校务委员会 | The treatment of TOLL sample receptor modulators and disease |
| CN103467590B (en) * | 2013-09-02 | 2016-04-13 | 深圳大学 | Bioconjugation body, the purine compound preparing it, synthetic method, medicinal preparations and its application in immunomodulatory |
| CN105311032B (en) * | 2015-11-09 | 2018-09-25 | 深圳大学 | TLR7 agonists are combined application in preparation of anti-tumor drugs with tyrosine kinase inhibitor |
| CN105315281B (en) * | 2015-11-16 | 2017-04-19 | 深圳大学 | Compound I and compound II as well as preparation methods and application thereof |
| CN105327345A (en) * | 2015-11-19 | 2016-02-17 | 深圳大学 | Vaccine adjuvant and vaccine comprising same |
| CN106267188A (en) * | 2016-08-15 | 2017-01-04 | 深圳大学 | The novel antibodies of small molecule immune agonist coupling PD 1 antibody and the application in antitumor thereof |
-
2016
- 2016-08-15 CN CN201610671971.8A patent/CN106267188A/en active Pending
-
2017
- 2017-04-19 WO PCT/CN2017/081007 patent/WO2018032793A1/en active Application Filing
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101239980A (en) * | 2008-02-18 | 2008-08-13 | 靳广毅 | Immune receptor regulator couplet precursor, couplet and application thereof |
| WO2011134669A1 (en) * | 2010-04-30 | 2011-11-03 | Telormedix Sa | Methods for inducing an immune response |
| CN104220441A (en) * | 2012-02-13 | 2014-12-17 | 百时美施贵宝公司 | Enediyne compounds, conjugates thereof, and uses and methods therefor |
| CN103254304A (en) * | 2012-05-30 | 2013-08-21 | 深圳大学 | Immune stimulant couplet, preparation method thereof and antineoplastic application of the immune stimulant couplet |
| CN102993265A (en) * | 2012-10-10 | 2013-03-27 | 靳广毅 | Immune receptor regulator couplet as well as preparation method and application thereof, coupling precursor for preparing immune receptor regulator couplet and compound for compounding coupling precursor |
| CN104974252A (en) * | 2014-04-01 | 2015-10-14 | 上海中信国健药业股份有限公司 | Antibody-small molecule drug conjugate capable of inhibiting tumor growth, and preparation method and application thereof |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018032793A1 (en) * | 2016-08-15 | 2018-02-22 | 深圳大学 | Novel antibody obtained by coupling small molecule immuno-agonist and pd-1 antibody, and application thereof in tumor resistance |
| CN107281483A (en) * | 2017-04-25 | 2017-10-24 | 深圳大学 | The preparation method of immune activator and composition and its application and composition |
| CN107281484A (en) * | 2017-05-31 | 2017-10-24 | 深圳大学 | Composition for preparing hepatitis B vaccine and its preparation method and application |
| WO2018219266A1 (en) * | 2017-05-31 | 2018-12-06 | 深圳大学 | Composition for preparing hepatitis b vaccine, preparation method therefor, and application thereof |
| CN108379591A (en) * | 2018-04-03 | 2018-08-10 | 深圳大学 | The synthesis and its application of immune agonist target compound |
| WO2019192454A1 (en) * | 2018-04-03 | 2019-10-10 | 深圳大学 | Novel small molecule immune agonists and immune targeting compounds and application thereof |
| CN108379591B (en) * | 2018-04-03 | 2022-03-29 | 深圳大学 | Synthesis of immune agonist targeting compound and application thereof |
| CN115192726A (en) * | 2018-04-03 | 2022-10-18 | 深圳大学 | Synthesis of immune agonist targeting compound and application thereof |
| CN111704614A (en) * | 2020-04-15 | 2020-09-25 | 深圳大学 | Novel series immune agonists |
| WO2021208459A1 (en) * | 2020-04-15 | 2021-10-21 | 深圳大学 | Immune agonists |
| WO2022194153A1 (en) * | 2021-03-16 | 2022-09-22 | 中国科学院上海药物研究所 | Pd-l1 and tlr7 double-targeting nanobody coupling drug and use thereof in anti-tumor |
| WO2023174312A1 (en) * | 2022-03-15 | 2023-09-21 | 中国科学院上海药物研究所 | Anti-human pd-l1 and tlr7 double-targeting nanobody conjugate drug and use thereof in resisting tumor |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2018032793A1 (en) | 2018-02-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN106267188A (en) | The novel antibodies of small molecule immune agonist coupling PD 1 antibody and the application in antitumor thereof | |
| CN111375056B (en) | Immune receptor modulator conjugate, preparation method and application thereof, coupling precursor for preparing immune receptor modulator conjugate and compound for synthesizing coupling precursor | |
| Chatenoud et al. | The human immune response to the OKT3 monoclonal antibody is oligoclonal | |
| CN108315305B (en) | Preparation method and application of immune cell exosome carrying chimeric antigen receptor | |
| Jondal et al. | Human spontaneous killer cells selective for tumour-derived target cells | |
| CN109310677A (en) | Tumor load is reduced by the way that CCR1 antagonist and PD-1 inhibitor or PD-L1 antagonist is administered in combination | |
| CN110248662B (en) | Combination, pharmaceutical composition and treatment method for treating prostate cancer | |
| JP2022532247A (en) | Cyanocyclobutyl compounds for Cbl-b inhibition and their use | |
| TW201919693A (en) | Compounds comprising cleavable linker and uses thereof | |
| JP2021121602A (en) | Novel compositions and methods for immunotherapies comprising small molecule integrin receptor-ligand agonist adjuvants | |
| WO2017201043A1 (en) | Combination therapy for treating cancer | |
| JP2023503050A (en) | immune modulator | |
| CN109021114A (en) | Combine the bispecific chimeric antigen receptor and expression vector of two kinds of single-chain antibodies | |
| CN105658673B (en) | The peptide of the novel CTL epitope with 4 connections | |
| CN105315281A (en) | Compound I and compound II as well as preparation methods and application thereof | |
| Sun et al. | Cyclic diguanylate analogues: Facile synthesis, STING binding mode and anti-tumor immunity delivered by cytidinyl/cationic lipid | |
| CN110522923A (en) | The matrix material of fructose and the co-modified dual-target triple negative breast cancer of RGD peptide | |
| CN105008399B (en) | The peptide of the novel CTL epitopes with 5 connections | |
| CA3176256A1 (en) | Technologies for preventing or treating infections | |
| CN114163479A (en) | Platinum compounds for treating cancer and preparation method thereof | |
| CN111909240B (en) | PD-1/PD-L1 polypeptide inhibitor and medical application thereof | |
| Werkmeister et al. | Identification of a structure on human melanoma cells recognized by CTL exhibiting anomalous killer cell function. | |
| CN109053682B (en) | TDO small molecule inhibitor derivative, anti-tumor conjugate thereof and preparation method | |
| JPH0421680B2 (en) | ||
| WO2019177011A1 (en) | Tumor immunopotentiator |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination |