CN101684156B - Human TNF alpha monoclonal antibody, PEGylation nanoparticle and application thereof - Google Patents
Human TNF alpha monoclonal antibody, PEGylation nanoparticle and application thereof Download PDFInfo
- Publication number
- CN101684156B CN101684156B CN2008102006628A CN200810200662A CN101684156B CN 101684156 B CN101684156 B CN 101684156B CN 2008102006628 A CN2008102006628 A CN 2008102006628A CN 200810200662 A CN200810200662 A CN 200810200662A CN 101684156 B CN101684156 B CN 101684156B
- Authority
- CN
- China
- Prior art keywords
- antibody
- monoclonal antibody
- seq
- pegization
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 239000002105 nanoparticle Substances 0.000 title claims abstract description 25
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 title abstract description 20
- 230000006320 pegylation Effects 0.000 title abstract description 5
- 102000057041 human TNF Human genes 0.000 title description 15
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 6
- 108700012920 TNF Proteins 0.000 claims description 23
- 230000014509 gene expression Effects 0.000 claims description 19
- 239000003814 drug Substances 0.000 claims description 17
- 238000002360 preparation method Methods 0.000 claims description 13
- 208000023275 Autoimmune disease Diseases 0.000 claims description 8
- 230000008878 coupling Effects 0.000 claims description 5
- 238000010168 coupling process Methods 0.000 claims description 5
- 238000005859 coupling reaction Methods 0.000 claims description 5
- 241000588724 Escherichia coli Species 0.000 claims description 3
- 238000000034 method Methods 0.000 abstract description 20
- 230000000694 effects Effects 0.000 abstract description 15
- 238000005516 engineering process Methods 0.000 abstract description 12
- 238000001727 in vivo Methods 0.000 abstract description 5
- 230000005847 immunogenicity Effects 0.000 abstract description 3
- 238000000338 in vitro Methods 0.000 abstract description 3
- 230000009466 transformation Effects 0.000 abstract description 3
- 238000004519 manufacturing process Methods 0.000 abstract description 2
- 238000012986 modification Methods 0.000 abstract description 2
- 230000004048 modification Effects 0.000 abstract description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 37
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 37
- 210000004027 cell Anatomy 0.000 description 35
- 241000699666 Mus <mouse, genus> Species 0.000 description 22
- 210000003719 b-lymphocyte Anatomy 0.000 description 18
- 108090000623 proteins and genes Proteins 0.000 description 15
- 108020004414 DNA Proteins 0.000 description 12
- 201000003068 rheumatic fever Diseases 0.000 description 12
- 239000000047 product Substances 0.000 description 9
- 235000018102 proteins Nutrition 0.000 description 9
- 102000004169 proteins and genes Human genes 0.000 description 9
- 238000011160 research Methods 0.000 description 8
- 238000002965 ELISA Methods 0.000 description 7
- 108010008165 Etanercept Proteins 0.000 description 7
- 150000001413 amino acids Chemical class 0.000 description 7
- 230000034994 death Effects 0.000 description 7
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 7
- 229940116176 remicade Drugs 0.000 description 7
- 238000001890 transfection Methods 0.000 description 7
- 108091026890 Coding region Proteins 0.000 description 6
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 6
- 229940073621 enbrel Drugs 0.000 description 6
- 229940048921 humira Drugs 0.000 description 6
- 239000010410 layer Substances 0.000 description 6
- 229960000485 methotrexate Drugs 0.000 description 6
- 206010039073 rheumatoid arthritis Diseases 0.000 description 6
- 210000002966 serum Anatomy 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 238000005406 washing Methods 0.000 description 6
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 5
- 210000000683 abdominal cavity Anatomy 0.000 description 5
- 210000004369 blood Anatomy 0.000 description 5
- 239000008280 blood Substances 0.000 description 5
- 229960003115 certolizumab pegol Drugs 0.000 description 5
- 201000010099 disease Diseases 0.000 description 5
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 239000000203 mixture Substances 0.000 description 5
- 239000002243 precursor Substances 0.000 description 5
- 230000008569 process Effects 0.000 description 5
- 238000012216 screening Methods 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- 210000003462 vein Anatomy 0.000 description 5
- 239000012980 RPMI-1640 medium Substances 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 231100000636 lethal dose Toxicity 0.000 description 4
- 230000028327 secretion Effects 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- 208000024891 symptom Diseases 0.000 description 4
- 101100230376 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) celI gene Proteins 0.000 description 3
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 3
- 241000699802 Cricetulus griseus Species 0.000 description 3
- 235000001014 amino acid Nutrition 0.000 description 3
- 244000309466 calf Species 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 239000012091 fetal bovine serum Substances 0.000 description 3
- 239000012634 fragment Substances 0.000 description 3
- 230000003814 hair luster Effects 0.000 description 3
- 210000001672 ovary Anatomy 0.000 description 3
- 229920001184 polypeptide Polymers 0.000 description 3
- 108090000765 processed proteins & peptides Proteins 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 238000000926 separation method Methods 0.000 description 3
- 238000010998 test method Methods 0.000 description 3
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 2
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- 201000004681 Psoriasis Diseases 0.000 description 2
- -1 Streptomycin sulphates Chemical class 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 102000018594 Tumour necrosis factor Human genes 0.000 description 2
- 108050007852 Tumour necrosis factor Proteins 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 230000005875 antibody response Effects 0.000 description 2
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 239000003292 glue Substances 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 239000000041 non-steroidal anti-inflammatory agent Substances 0.000 description 2
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 230000007170 pathology Effects 0.000 description 2
- 229940049954 penicillin Drugs 0.000 description 2
- 239000002516 radical scavenger Substances 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Natural products CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- OPIFSICVWOWJMJ-AEOCFKNESA-N 5-bromo-4-chloro-3-indolyl beta-D-galactoside Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1OC1=CNC2=CC=C(Br)C(Cl)=C12 OPIFSICVWOWJMJ-AEOCFKNESA-N 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 208000011691 Burkitt lymphomas Diseases 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 208000024172 Cardiovascular disease Diseases 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 229920001917 Ficoll Polymers 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 1
- 241000710842 Japanese encephalitis virus Species 0.000 description 1
- 241000713869 Moloney murine leukemia virus Species 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 206010028851 Necrosis Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 206010039361 Sacroiliitis Diseases 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 102000013275 Somatomedins Human genes 0.000 description 1
- 201000002661 Spondylitis Diseases 0.000 description 1
- OUUQCZGPVNCOIJ-UHFFFAOYSA-M Superoxide Chemical compound [O-][O] OUUQCZGPVNCOIJ-UHFFFAOYSA-M 0.000 description 1
- 230000010530 Virus Neutralization Effects 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 229960003697 abatacept Drugs 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 229960002964 adalimumab Drugs 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 229940125644 antibody drug Drugs 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 239000003593 chromogenic compound Substances 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 229940021171 curative drug Drugs 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000003113 dilution method Methods 0.000 description 1
- 230000005611 electricity Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 238000003114 enzyme-linked immunosorbent spot assay Methods 0.000 description 1
- 229960000403 etanercept Drugs 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 210000000416 exudates and transudate Anatomy 0.000 description 1
- 238000000855 fermentation Methods 0.000 description 1
- 230000004151 fermentation Effects 0.000 description 1
- 238000013467 fragmentation Methods 0.000 description 1
- 238000006062 fragmentation reaction Methods 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 230000035876 healing Effects 0.000 description 1
- 230000002607 hemopoietic effect Effects 0.000 description 1
- 230000002008 hemorrhagic effect Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 229940124589 immunosuppressive drug Drugs 0.000 description 1
- 230000008676 import Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 229960000598 infliximab Drugs 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 230000008407 joint function Effects 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 206010025482 malaise Diseases 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 230000013011 mating Effects 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 239000002539 nanocarrier Substances 0.000 description 1
- 230000017074 necrotic cell death Effects 0.000 description 1
- 239000002547 new drug Substances 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 238000004091 panning Methods 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 101150059999 pro gene Proteins 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- 230000001185 psoriatic effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 238000007789 sealing Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 238000005204 segregation Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000002356 single layer Substances 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 229940046728 tumor necrosis factor alpha inhibitor Drugs 0.000 description 1
- 239000002451 tumor necrosis factor inhibitor Substances 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
Landscapes
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Description
V2L | ATGGACATGCGGGTTCCAGCCCAGCTTCTCGGACTTCTGCTGTTGTGGCTGCGCGGAGCACGGTGCGAAATTGTGCTCACACAGTCACCAGACTTTCAGTCTGTCACCCCTAAGGAGAAAGTGACCATCACTTGCAGGGCCTCTCAGTTCGTCGGCTATAGTATCCACTGGTACCAGCAGAAACCCGATCAGTCCCCTAAACTGCTGATCAAGTACGCCTCTGAATCAAGGTCAGGTGTCCCCAGTCGATTTTCTGGATCAGGATCTGGTACCGACTTCACCCTCACCATCAATAGCTTGGAGGCCGAGGACGCTGCTACCTACTACTGCCAACAAAGCCACAGCTGGCACTTTACTTTTGGCCAGGGGACCAAGCTTGAGATCAAACGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGC |
? | GAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTAGATTCAGATCCGTTAACGGTTACCAACTACCTAGACTGGATTCGTGACACATGCGGCCGTGATATCTACGT ATGATCAGCCTCGAGGGCCCACGCGTAA (SEQ ID NO:1) |
V2H | ATGGAGTTCGGACTCAGTTGGCTGTTCCTGGTGGCCATCCTGAAGGGTGTGCAGTGTGAAGTCCAGCTGGTCGAGAGCGGTGGCGGGCTGGTGCAACCCGGTGGATCACTGCGGCTCAGCTGCGCTGCTAGTGGCTTTCCCTTCTCTAACCACTGGATGAATTGGGTCCGGCAGGCTCCAGGAAAGGGTCTGGAGTGGGTGGGTGAGATCAGGAGTAAGTCTATGAACTCCGCCACACACTATGCTGAAAGCGTGAAAGGGCGCTTCACAATCTCTAGAGACGATTCAAAGAACTCTCTGTACCTGCAGATGAACAGTCTGAAAACAGAGGACACCGCTGTGTATTACTGTGCTCGGAACTACTACGGTTCAACTTACGACCACTGGGGCCAAGGTACACTGGTCACCGTCTCGAGTGCCTCCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGGGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTT |
? | CCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA(SEQ?ID?NO:2) |
2L | MDMRVPAQLLGLLLLWLRGARCEIVLTQSPDFQSVTPKEKVTITCRASQFVGYSIHWYQQKPDQSPKLLIK YASESRSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSHSWHFTFGQGTKLEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV YACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO:3) |
2H | MEFGLSWLFLVAILKGVQCEVQLVESGGGLVQPGGSLRLSCAASGFPFSNHWMNWVRQAPGKGLEWVGEIR SKSMNSATHYAESVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCARNYYGSTYDHWGQGTLVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS SLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO:4) |
Claims (10)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN2008102006628A CN101684156B (en) | 2008-09-27 | 2008-09-27 | Human TNF alpha monoclonal antibody, PEGylation nanoparticle and application thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN2008102006628A CN101684156B (en) | 2008-09-27 | 2008-09-27 | Human TNF alpha monoclonal antibody, PEGylation nanoparticle and application thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN101684156A CN101684156A (en) | 2010-03-31 |
CN101684156B true CN101684156B (en) | 2011-12-28 |
Family
ID=42047556
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN2008102006628A Active CN101684156B (en) | 2008-09-27 | 2008-09-27 | Human TNF alpha monoclonal antibody, PEGylation nanoparticle and application thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN101684156B (en) |
Families Citing this family (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN102127167B (en) * | 2010-01-15 | 2013-06-19 | 苏州工业园区晨健抗体组药物开发有限公司 | Whole human TNF alpha (tumor necrosis factor alpha) monoclonal antibody and preparation and application thereof |
CN101899416A (en) * | 2010-05-27 | 2010-12-01 | 中国科学院生物物理研究所 | Recombinant rat myeloma cell NS0-F10 and application thereof |
PT2575884T (en) * | 2010-06-03 | 2018-10-31 | Abbvie Biotechnology Ltd | Uses and compositions for treatment of hidradenitis suppurativa (hs) |
CN102336834B (en) * | 2010-07-22 | 2014-01-01 | 苏州工业园区晨健抗体组药物开发有限公司 | Fully human TNFalpha-Fab antibody and its PEG antibody |
CA2812430C (en) * | 2010-09-30 | 2019-01-15 | Chengdu Kanghong Biotechnologies Co., Ltd. | Humanized anti-tnf-.alpha. antibody and antigen-binding fragment (fab) thereof and use of the same |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2001094585A1 (en) * | 2000-06-06 | 2001-12-13 | Celltech R & D Limited | Antibody molecules having specificity for human tumor necrosis factor alpha, and use thereof |
CN1613874A (en) * | 2003-11-06 | 2005-05-11 | 上海中信国健药业有限公司 | Human tumour necrosin antibody, its preparation and medicinal composition |
-
2008
- 2008-09-27 CN CN2008102006628A patent/CN101684156B/en active Active
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2001094585A1 (en) * | 2000-06-06 | 2001-12-13 | Celltech R & D Limited | Antibody molecules having specificity for human tumor necrosis factor alpha, and use thereof |
CN1613874A (en) * | 2003-11-06 | 2005-05-11 | 上海中信国健药业有限公司 | Human tumour necrosin antibody, its preparation and medicinal composition |
Non-Patent Citations (1)
Title |
---|
颜苹苹等.肿瘤坏死因子单克隆抗体的制备和鉴定.《福建医学院学报》.1993, * |
Also Published As
Publication number | Publication date |
---|---|
CN101684156A (en) | 2010-03-31 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
JP6753946B2 (en) | Anti-human PD-1 humanized monoclonal antibody and application | |
US11390688B2 (en) | Anti-PCSK9 monoclonal antibody | |
US8597648B2 (en) | Fully human anti-TNF-alpha monoclonal antibody, preparation method and use thereof | |
JP6006404B2 (en) | Anti-BLyS antibody | |
CN101684156B (en) | Human TNF alpha monoclonal antibody, PEGylation nanoparticle and application thereof | |
CN103495165A (en) | Method of administering anti-TNFalpha antibodies | |
CN105143259B (en) | Pan-ELR+CXC chemotactic factor (CF) antibody | |
CN102994441A (en) | Cell culture medium, and preparation method and use thereof | |
EP3587440B1 (en) | Human pd-l1 high-protein-affinity peptide and use thereof | |
CN102702355B (en) | Anti FGF23 antibody and a pharmaceutical composition comprising the same | |
CN103936854A (en) | Anti-IL-17A monoclonal antibody as well as preparation and application thereof | |
CN117940461A (en) | Bispecific antibody and application thereof | |
CN103012590A (en) | Anti-CD20 monoclonal antibody, preparation method and application thereof | |
CN108350415A (en) | The method for adjusting recombinant protein production overview in fill-up mode | |
CN105916883B (en) | Bifunctional fusion proteins and its preparation method and application | |
WO2019109947A1 (en) | Anti-human il6 monoclonal antibodies, preparation method therefor and use thereof | |
EP2409992B1 (en) | A human anti-tumor necrosis factor alpha monoclonal antibody and use thereof | |
CN103360494B (en) | Completely anti-CD20 human monoclonal antibody and application thereof | |
CN104231086A (en) | Bifunctional fusion protein as well as preparation method and use thereof | |
CN113698493B (en) | Double-function protein aiming at VEGF and TGF-beta and application thereof | |
CN102336834B (en) | Fully human TNFalpha-Fab antibody and its PEG antibody | |
CN109400709B (en) | Bifunctional antibodies and uses thereof | |
CN105061596A (en) | Human b lymphocyte stimulating factor monoclonal antibody and application thereof | |
Werner | Large‐scale manufacturing of biopharmaceuticals–speed up the road to market by scale up: the 6× 15 000 l BI bioreactors | |
CN111234021B (en) | anti-CCR 5 antibody and application thereof in treating tumors |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
C06 | Publication | ||
PB01 | Publication | ||
C10 | Entry into substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
C14 | Grant of patent or utility model | ||
GR01 | Patent grant | ||
TR01 | Transfer of patent right | ||
TR01 | Transfer of patent right |
Effective date of registration: 20181214 Address after: Room 3302, Room 3, 102 Location, Building 797, Puxing Road, Minhang District, Shanghai, 20114 Patentee after: Shanghai Chenjian Biotechnology Co.,Ltd. Address before: 215021 Suzhou Industrial Park, Jiangsu Province, Jinji Lake Avenue (Airport Road) 9 Xingzhou Street, Suzhou and Qiao Lijing Apartment Hotel, 6 Rooms 2006 Patentee before: Suzhou Industrial Park Chenjian Antibody Group Pharmaceutical Development Co.,Ltd. |
|
TR01 | Transfer of patent right | ||
TR01 | Transfer of patent right |
Effective date of registration: 20210902 Address after: 518118 unit 1505, block a, innovation Plaza, No. 2007, Pingshan street, Pingshan District, Shenzhen, Guangdong Patentee after: Yourui Biomedical Technology (Shenzhen) Co.,Ltd. Address before: Room 3302, Room 3, 102 Location, Building 797, Puxing Road, Minhang District, Shanghai, 20114 Patentee before: Shanghai Chenjian Biotechnology Co.,Ltd. |
|
PP01 | Preservation of patent right | ||
PP01 | Preservation of patent right |
Effective date of registration: 20230522 Granted publication date: 20111228 |
|
PD01 | Discharge of preservation of patent | ||
PD01 | Discharge of preservation of patent |
Date of cancellation: 20230815 Granted publication date: 20111228 |
|
CP03 | Change of name, title or address | ||
CP03 | Change of name, title or address |
Address after: 518118 unit 1505, block a, innovation Plaza, No. 2007, Pingshan street, Pingshan District, Shenzhen, Guangdong Patentee after: Youjian Biopharmaceutical Technology (Shenzhen) Co.,Ltd. Country or region after: China Address before: 518118 unit 1505, block a, innovation Plaza, No. 2007, Pingshan street, Pingshan District, Shenzhen, Guangdong Patentee before: Yourui Biomedical Technology (Shenzhen) Co.,Ltd. Country or region before: China |