CA2836750A1

CA2836750A1 - Method and agents to quantify proteins from tissues

Info

Publication number: CA2836750A1
Application number: CA2836750A
Authority: CA
Inventors: Yetrib Hathout; Kristy Brown; Eric Hoffman
Original assignee: Agada Biosciences LLC
Current assignee: Agada Biosciences LLC
Priority date: 2013-12-17
Filing date: 2013-12-17
Publication date: 2015-06-17
Also published as: CA2875418A1

Abstract

As described herein, a robust generalizable method to accurately and sensitively quantitate proteins in tissues and fluids from human patients in a direct manner, not reliant on antibody reagents has been developed. This provides new and robust methods that are useful as biochemical outcome measures in human clinical trials. The methods where mouse tissues fully labeled with stable isotopes are mixed with the human tissue of interest, and the mixture subjected to high throughput proteomics methods are provided. The method detects multiple protein peptides showing 100% conservation between human and mouse, and establishes test and control proteins for quantitation of surrogate biomarkers. This assay method provides a high degree of reliability and sensitivity, as well as generalizability, compared to more traditional antibody-based assays. The specific peptide pairs and methods of quantitation are also described.

Description

METHOD AND AGENTS TO QUANTIFY PROTEINS FROM TISSUES
FIELD OF THE INVENTION
The invention generally relates to methods and agents that enable the sensitive and reliable detection and quantification of proteins of interest in human tissues from patients enrolled in clinical trials (surrogate biochemical biomarker). The invention enables and facilitates regulatory review by providing robust measurements of surrogate biochemical biomarkers at accuracies far exceeding previous methods.
BACKGROUND OF THE INVENTION
Bringing a new drug (new chemical entity; NCE) to market and to the benefit of patients requires regulatory agency approvals, and such approvals require clinical trials.
Proving that a NCE
shows efficacy often depends on showing improvement of clinical outcome measures, typically related to patient quality of life. However, clinical outcome measures often require clinical trials of long duration, and the endpoints can be subjective and variable. These increase the number of patients needed for a robust clinical trial, their cost, and time required.
An alternative to clinical endpoints in clinical trials are surrogate biochemical biomarkers as endpoints (1). A surrogate biochemical endpoint should have a compelling rationale for being reflective of the underlying disease process, and should be able to be measured using sensitive and reliable assay methods. If robust biomarkers are identified, then consideration of accelerated approval for a drug may be based on the biomarker data alone, without associated clinical endpoint data. One of the more compelling connections between a disease and a biomarker is with regards to inherited disease, where gene mutations lead to loss of the corresponding protein product in a tissue. This inherited inborn error of metabolism initiates the cascade of pathologies that lead to the patient's clinical picture. An increasing number of drug development programs aim to replace the missing protein in patient tissue, thus directly addressing the primary biochemical defect. As the connection between the primary gene/protein deficiency and the disease process is compelling then quantifying the replacement of this same protein in clinical trials is generally viewed as a valid biochemical surrogate endpoint.
For example, dystrophin is a relatively large (427 kDa) multi-domain protein that plays an essential role in muscle fiber integrity and function. It is predominantly expressed in skeletal muscle by other isoforms have been found expressed in heart and brain (15).
Dystrophin is a fairly low abundance protein, accounting for approximately 0.002% of the total striated muscle protein (2). Gene mutations resulting in the complete loss of dystrophin protein expression are the cause of Duchenne muscular dystrophy (DMD), the most common and severe form of muscular dystrophy (16). Mutations resulting in the production of a truncated but partially functional dystrophin protein give rise to a milder dystrophinopathy termed Becker muscular dystrophy (BMD). In general, BMD patients have longer lives and less severe clinical presentations than DMD patients. This is mainly due to the presence of the partially functional dystrophin protein in BMD patients (17). But, BMD patients do have a wide variety of phenotypes ranging from mild to severe most probably due to the variable amounts of expressed dystrophin often seen in BMD population (18).
The need to accurately detect and quantitate dystrophin in human skeletal muscle biopsies is becoming crucial as new promising therapies aiming to restore dystrophin expression, especially in DMD patients, are entering phase II/III clinical trials (3-7). Perhaps one of the most

2 promising new generation therapies for DMD is "exon skipping" which has been effective in restoring dystrophin expression and muscle force in both mouse and dog models of DMD (19, 20). The goal of this approach is to "skip" an exon neighboring a deletion mutation during pre-mRNA splicing, thereby restoring the mRNA reading frame, resulting in the production of a shorter length, partially functional Becker-like dystrophin protein. As such, quantification of dystrophin protein is an ideal endpoint measure and clinically meaningful since it is directly linked to the disease.
Most existing methods used to quantify proteins rely on antibodies, and assays association with antibody binding to the target protein. Antibody-based methods, such as immunoblotting, immunostaining, and ELISA methods are inherently indirect methods of assaying proteins, and are typically associated with assay-to-assay variability due to the indirect nature of the tests.
Also, robust immunological assays for a target protein require well characterized and highly specific antibody reagents, yet these do not exist for the large majority of target proteins that may be used as surrogate biochemical endpoints in clinical trials. Thus, there is a need to directly measure proteins in patient tissue, in order to develop robust biochemical endpoints for clinical trials.
SUMMARY OF THE INVENTION
As described herein, a robust generalizable method to accurately and sensitively quantitate protein of interest in tissues and body fluids from human patients in a direct manner, not reliant on antibody reagents has been developed. This provides new and robust methods that are useful as biochemical outcome measures in human clinical trials. The methods where mouse tissues fully labeled with stable isotopes are mixed with the human tissue of interest, and the mixture

3 subjected to precision mass spectrometry proteomics methods are provided. The method detects multiple protein peptides showing 100% conservation between human and mouse, and establishes test and control proteins for quantitation of surrogate biomarkers. This assay method provides a high degree of reliability and sensitivity, as well as generalizability, compared to more traditional antibody-based assays. The specific peptide pairs and methods of quantitation are also described.
According to an aspect of the present invention, there is provided a method for identifying candidate peptide markers for a protein from a biological sample of interest.
The method comprising the steps of:_extracting proteins from the biological sample of interest and a corresponding biological sample from an animal that has been labeled with one or more stable isotopic amino acids; mixing a quantity of protein from the biological sample of interest with a quantity of protein from the corresponding biological sample from the labeled animal to form a spiked sample; separating the spiked sample based on a physical property;
digesting the proteins of interest using a protease; subjecting the digested samples to mass spectrometry analysis; and identifying unique candidate peptide markers that correspond to a protein.
According to another aspect of the present invention, there is provided a method for quantifying expression of a biomarker from a biological sample obtained from a subject with a disease or disorder. The method comprising the steps of: extracting proteins from the biological sample of interest; mixing a known quantity of protein from the biological sample of interest with a known quantity of protein a the corresponding biological sample from a labeled animal or a labeled synthetic peptide corresponding to a protein of interest to form a spiked sample; separating the spiked sample based on a physical property; digesting the proteins of interest using a protease;

4 subjecting the digested samples to mass spectrometry analysis; determining intensities of unique candidate peptide markers that correspond to a proteins of interest; and quantifying the amount of the protein of interest in the sample based on the relative intensity of the unique candidate peptide markers.
In one embodiment, the step of quantifying comprises comparing peak areas and area ratios of one or more unique candidate peptide markers from the biological sample of interest to the peak areas and area ratios of one or more labeled peptide markers.
In another embodiment, the step of quantifying comprises comparing the relative intensities to a standard curve generated by creating a series of dilutions of a biological sample from a normal subject with a biological sample from a subject with a disease or disorder, wherein the amount of total protein in the mixed sample remains constant; mixing a known quantity of protein from the mixed sample with a known quantity of protein a corresponding biological sample from a labeled animal or a labeled synthetic peptide corresponding to a protein of interest to form a spiked sample; separating the spiked sample based on a physical property; digesting the proteins of interest using a protease; subjecting the digested samples to mass spectrometry analysis; and generating a titration curve based on the intensities obtained for each sample.
According to a further aspect of the invention, there is provided a method for quantifying dystrophin expression from a biological sample obtained from a subject with Duchenne's Muscular Dystrophy. The method comprising the steps of: extracting proteins from the biological sample of interest; mixing a known quantity of total protein from the biological sample of interest with a known quantity of total protein a the corresponding biological sample from a labeled animal or a labeled synthetic peptide corresponding to dystrophin to form a

5 spiked sample; separating the spiked sample based on a physical property;
digesting the proteins of interest using a protease; subjecting the digested samples to mass spectrometry analysis; and quantifying the amount of the protein of interest in the sample based on the relative intensity of the unique candidate peptide markers.
In one embodiment, the step of quantifying comprises comparing peak areas and area ratios of one or more unique candidate peptide markers from the biological sample of interest to the peak areas and area ratios of one or more labeled peptide markers.
In another embodiment, the step of quantifying comprises comparing the relative intensities to a standard curve generated by creating a series of dilutions of a biological sample from a normal subject with a biological sample from a subject with a disease or disorder, wherein the amount of total protein in the mixed sample remains constant; mixing a known quantity of protein from the mixed sample with a known quantity of protein a corresponding biological sample from a labeled animal or a labeled synthetic peptide corresponding to a protein of interest to form a spiked sample; separating the spiked sample based on a physical property; digesting the proteins of interest using a protease; subjecting the digested samples to mass spectrometry analysis; and generating a titration curve based on the intensities obtained for each sample.
In a further embodiment, the subject is being treated with a pharmaceutical composition.
In a yet further embodiment, the one or more peptides are selected from QAPIGGDFPAVQK, VLSQIDVAQK, IFLTEQPLEGLEK, TLNATGEEIIQQSSK, and VHALNNVNK.
In a still further embodiment, the proteins are extracted using a buffer comprising 10% sodium-dodecyl sulfate (SDS).

6 In an embodiment, the known quantity of total protein corresponding to the biological sample from a labeled animal is half the known quantity of total protein from the biological sample of interest.
In another embodiment, the known quantity of total protein corresponding to the biological sample of interest is 50 1.tg and the known quantity of total protein the corresponding to the biological sample from a labeled animal is 25 pg.
In a further embodiment, the protease is trypsin.
In a yet further embodiment, the spiked sample is separated based on size, charge, shape or a combination thereof using electrophoresis.
In a still further embodiment, the spiked sample is separated using gel electrophoresis.
In one embodiment, the method further comprising the step of excising a portion of the gel containing the proteins of interest prior to the digesting step.
BRIEF DESCRIPTION OF THE DRAWINGS
These and other features, aspects and advantages of the present invention will become better understood with regard to the following description and accompanying drawings wherein:
FIG. 1 is a flow chart showing the experimental design used to quantitate dystrophin protein in human skeletal muscle. . Left panel shows the post-digestion spike-in approach where 501.1,g total muscle protein extract from human bisopsie were fractionated on SDS-PAGE
using 3-8%
Tris-Acetate gel, which is suitable for high molecular mass proteins. Then the area

7 corresponding to dystrophin migration level (dashed blue lines) was serially sliced, in-gel digested by trypsin and spiked with stable isotope labeled standard peptides standards for subsequent LC-MS/MS analysis and peptide quantitation. In the Pre-digestion spike-in approach (right panel), 50 p,g total muscle protein extract was spiked with 25 [ig of 13C6-Lysine labeled SILAC mouse muscle protein extract. The mixture was then fractionated by SDS-PAGE and the area corresponding to dystrophin migration was excised, in-gel digested and the resulting peptides were analyzed by LC-MS/MS for identification and quantitation;
FIG. 2 shows representative mass spectra of spiked-in labeled standard peptides and corresponding unlabeled endogenous peptide using a post-digestion spike-in approach (A) Mass spectra of labeled and unlabeled peptide pairs detected after spiking in-gel digested dystrophin with varying amounts of 13C6, 15N2 Lysine labeled standard peptide [IFLTEQPLEGLEK]. (B) Shows mass spectra of labeled and unlabeled peptide pairs detected after spiking in-gel digested dystrophin with varying amounts of 13C6, 15N2 Lysine labeled standard peptide [LLDLLEGLTGQK], (C) Shows mass spectra of labeled and unlabeled peptide pairs detected after spiking in-gel digested dystrophin with varying amounts of 13C6, 15N4 Lysine labeled standard [LLVEELPLR]. The concentration of each spike-in standard peptide, starting for the top to the low panels, was as follows (160 nM, 80 nM, 40 nM
and 14 nM).
Samples were analyzed on the LTQ-Orbitrap XL at 30,000 resolution and mass error better than 10 ppm. All ions were detected as doubly protonated species with the correct m/z values;
FIG. 3 represents mass spectrometry data obtained for triplicate experiments using the same extract from a muscle biopsy obtained from a healthy donor. Three aliquots of 50 p,g total

8 muscle protein extract were separated by SDS-PAGE as described in Methods. The migration area corresponding to dystrophin was excised, in-gel digested and spiked with optimal concentration (30 nM) of stable isotope labeled standard peptides. The left panel shows MS
spectra of unlabeled peptide [IFLTEQPLEGLEK] generated from endogenous dystrophin and the spike-in stable isotope labeled standard peptide [IFLTEQPLEGLEK*]. Both peptides were detected as doubly charged ions at their corresponding m/z value of 758.92 and 762.92, respectively. The right panel shows extracted ion chromatograms used for ratio measurement of unlabeled endogenous dystrophin peptide (blue trace) to the stable isotope labeled standard peptide (red trace);
FIG. 4 is a graphical representation showing inter sample reproducibility of the post-digestion spike-in approach. Three samples containing varying amount of dystrophin obtained by mixing muscle extract from a DMD and age matched healthy donor at ratio of 25/75, 50/50 and 75/25 respectively were evaluated for dystrophin quantitation using the post-digestion spike-in approach with 30 nM of stable isotope standard peptides. Histograms represent intensity ratios of endogenous dystrophin peptides and filamin c peptide to their corresponding stable isotope labeled standard peptide. P1, P2 and P3 corresponds to dystrophin peptides [LLDLLEGLTGQK], [LLVEELPLR], [IFLTEQPLEGLEK] respectively and P4 correspond to filamin c peptide [VYNVTYTVK] that was used as an internal control. It is clearly seen that some ratios did not decrease with decreasing amounts of dystrophin, especially for the peptide Pl, showing high variability for this approach;

9 FIG. 5 is a graphical representation showing a titration curve of dystrophin protein and other muscle specific proteins using predigestion spike-in approach. Dystrophin protein, as well as myomesin and filamin c, were quantitated in different combination mixtures of muscle extracts from DMD and age matched healthy donors at ratios leading to 0, 5, 10, 25, 50, 75, 90, 95 and 100% of dystrophin relative to normal. Each final mixture contained 50 lag of total muscle protein and was spiked with 25 g of '3C6- Lysine labeled SILAC mouse muscle extract. Gel bands encompassing dystrophin protein and other muscle specific proteins were excised and processed for mass spectrometry analysis as described in Methods. Transition ion intensities obtained at the MS/MS level for the targeted labeled and unlabeled peptide pairs generated from the spike-in standard and endogenous human dystrophin were used to determine the relative amount of dystrophin and other muscle proteins (myomesin and filamin c).
Standard deviation at each data point represents average ratios obtained from labeled and unlabeled peptide pairs: 5 pairs for dystrophin protein (QAPIGGDFPAVQK, VLSQIDVAQK, IFLTEQPLEGLEK, TLNATGEEIIQQSSK, VHALNNVNK); 3 pairs for filamin c (SPFVVNVAPPLDLSK, EVGEHVVSVRK, HIGISFTPK) and two pairs for myomesin (VSEPVAALDPAEK, VLGGLPDWTIQEGK). These peptides have 100% sequence homology between human and mouse and were used for ratio measurements. As expected, dystrophin protein increased with increasing relative amount of normal muscle extract while myomesin and filamin c remained unchanged; and FIG. 6 is a graphical representation showing calculated absolute amount of dystrophin in muscle biopsies obtained from BMD and age matched healthy controls. Total protein extract (50 pig) from each biopsy was spiked with 25 jig of C6-Lysine labeled SILAC mouse muscle extract and processed using the pre- digestion spike-in approach (see Figure 1 and Methods). Intensity ratios of labeled and unlabeled peptide pairs were used to determine the absolute amount of dystrophin in each muscle extract.
DETAILED DESCRIPTION OF THE INVENTION
Described herein are methods for identifying candidate peptide markers for a protein from a biological sample of interest, as well as for quantifying a protein from a biological sample of interest. In some embodiments, methods for quantitating specific proteins in a biological sample of interest using labeled peptides and mass spectrometry analysis are provided. It will be appreciated that the embodiments described herein are for illustrative purposes, and not intended to be limiting in any way.
Without wishing to be limiting in any way, it is envisioned that some or all of the following steps may be performed when carrying out an embodiment of a method for identifying candidate peptide markers for a protein from a biological sample of interest:
- extracting proteins from a biological sample of interest, - obtaining a labeled protein and/or peptide sample with peptide fragments and/or protein corresponding to one or more candidate peptide markers for a protein, -mixing a quantity of protein from the biological sample of interest with a quantity of the labeled protein and/or peptide sample to produce a spiked sample, - separating at least a portion of the spiked sample based on a physical property using, for example, gel electrophoresis, - obtaining a separated sample comprising at least the one or more protein(s) of interest, - digesting the separated sample using, for example, a protease, - analyzing the digested sample using mass spectrometry analysis, and - identifying unique candidate peptide markers that correspond to a protein.

In certain embodiments, it is envisioned that some or all of the following steps may be performed when carrying out an embodiment of a method for identifying candidate peptide markers for a protein from a biological sample of interest:
- extracting proteins from a biological sample of interest, - obtaining a labeled protein and/or peptide sample with peptide fragments and/or protein corresponding to one or more candidate peptide markers for a protein, - separating at least a portion of the extracted protein sample based on a physical property using, for example, gel electrophoresis, - digesting the separated sample using, for example, a protease, using, for example, in-gel digestion, - obtaining a separated sample comprising at least the one or more protein(s) of interest, -mixing a quantity of the separated sample with a quantity of the labeled protein and/or peptide sample to produce a spiked sample, - analyzing the spiked sample using mass spectrometry analysis, and - identifying unique candidate peptide markers that correspond to a protein.
Without wishing to be limiting in any way, it is envisioned that some or all of the following steps may be performed when carrying out an embodiment of a method for identifying candidate peptide markers for a protein from a biological sample of interest:
- extracting proteins from a biological sample of interest, - obtaining a labeled protein and/or peptide sample with peptide fragments and/or protein corresponding to one or more candidate peptide markers for a protein, -mixing a quantity of protein from the biological sample of interest with a quantity of the labeled protein and/or peptide sample to produce a spiked sample, - separating at least a portion of the spiked sample based on a physical property using, for example, gel electrophoresis, - obtaining a separated sample comprising at least the one or more protein(s) of interest, - digesting the separated sample using, for example, a protease, - analyzing the digested sample using mass spectrometry analysis, and - identifying unique candidate peptide markers that correspond to a protein.
In certain embodiments, it is envisioned that some or all of the following steps may be performed when carrying out an embodiment of a method for identifying candidate peptide markers for a protein from a biological sample of interest:
- extracting proteins from a biological sample of interest, - obtaining a labeled protein and/or peptide sample with peptide fragments and/or protein corresponding to one or more candidate peptide markers for a protein, -mixing a quantity of protein from the biological sample of interest with a quantity of the labeled protein and/or peptide sample to produce a spiked sample, - separating at least a portion of the spiked sample based on a physical property using, for example, gel electrophoresis, - obtaining a separated sample comprising at least the one or more protein(s) of interest, - digesting the separated sample using, for example, a protease, - analyzing the digested sample using mass spectrometry analysis, and - identifying unique candidate peptide markers that correspond to a protein.
In certain embodiments, the labeled protein and/or peptide sample with peptide fragments and/or protein corresponding to one or more candidate peptide markers for a protein may comprise at least some amino acid sequences with 100% identity to at least a portion of the protein of interest from the biological cample.
In a further embodiment, the biological sample may be any biological sample of interest. By way of example, the biological sample may be a biopsy or other tissue sample. The biological sample may be from a muscle tissue, a brain tissue, a tissue biospsied in clinical trials, blood, urine, cerebrospinal fluid or other biological sample of interest.
In another embodiment, the biological sample may be spiked with a quantity of labeled protein.
The labeled protein, may be labeled with 13C6-Lysine, 13C6-15N2-Lysine, 13C6-15N4- Arginine, combinations thereof, or using other appropriate protein labeling techniques (e.g. 15N labeling or any other amino acid) as will be known to those of skill in the art.
In a further embodiment, at least a portion of the labeled protein may be synthetically prepared using any appropriate method as will be known to a person skilled in the art.
In yet another embodiment, at least a portion of the labeled protein may be derived from a labeled animal. In a further embodiment, the animal may be a mouse.
In certain embodiments, a labeled animal may be a custom "heavy" mouse colony, termed SILAM or SILAC Mouse (stable isotopic labeling by amino acid in a mouse/mammal). In an embodiment, the SILAM or SILAC Mouse may be generated by feeding mice a custom diet containing 13C6-Lysine at 1%. In one embodiment, a pregnant dam may be fed with 'heavy' diet until a litter (F1 generation) is obtained and continued through weaning of the pups. After weaning, the pups may be continued on 'heavy' diet through breeding and generation of a F2 litter. Label incorporation may be monitored for specific organs and specific proteins by mass spectrometry. In some non-limiting embodiments, labeling efficiency may be better than 96% by F2 generation, including skeletal muscle. Other metabolic labeling method of mouse include feeding with 15N labeled Spirulina where all the nitrogen attoms in a protein are replaced with heavy nitrogen atoms In yet another embodiment, the biological sample may be extracted protein from a biopsied tissue. Extraction may be performed using any appropriate method as will be known to one of skill in the art. In a non-limiting embodiment, the protein may be extracted using RIPA buffer (ThermoScientific) or a modified Laemmli sample buffer containing 10% SDS (10%
SDS, 75 mM Tris-HC1, pH 6.8, 10 mM EDTA, 20% glycerol, 50 mM DTT). In some embodiments, the SDS-containing buffer may be preferable.
In certain embodiments, gel electrophorsis, or other appropriate protein separationtechniques known to those skilled in the art such as capillary electrophoresis, HPLC, FPLC, or other methods may be used to separate a biological sample based on weight, size, shape, charge, or other propery.
In some embodiments, the protein from the biological sample may be digested or fragmented using any appropriate technique as will be known to those skilled in the art.
By way of example, a trypsin digestion, which may be an in-gel trypsin digestion, may be performed to digest protein in the biological sample.
In a further embodiment, the biological sample may be spiked with labeled protein/peptide post-digestion. In an alternative embodiment, the biological sample may be spiked with labeled protein/peptide pre-digestion. In a further embodiment, the biological sample may be spiked with a known quantity of labeled protein and/or peptide.
In certain embodiments of a method provided herein, the biological sample spiked with labeled protein and/or peptide may be analyzed by mass spectrometry. In some embodiments, mass spectrometry may be used to identify peptide fragments, and corresponding labeled peptide fragments, from a protein of interest. In some embodiments, the identified labeled and unlabeled peptide pairs may be selected as candidate peptide markers for a protein of interest. In additional emobodiments, the labeled and unlabeled peptide pairs detected using mass spectrometry may be used to quantitate one or more proteins in a biological sample.
A wide variety of mass spectrometry (MS) techniques are known in the art, and the extracted samples may be analyzed using any suitable method known in the art. For example, and without wishing to be limiting in any manner, extracts of biological samples are amenable to analysis on essentially any mass spectrometry platform, either by direct injection or following chromatographic separation. Chromatographic separation may involve, by way of example, reverse phase (for example, C18) chromatography, or any other appropriate technique as will be known to those of skill in the art. Typical mass spectrometers are comprised of a source which ionizes molecules within the sample, and a detector for detecting the ionized molecules or fragments of molecules. Non-limiting examples of common sources include electron impact, electrospray ionization (ES I), atmospheric pressure chemical ionization (APCI), atmospheric pressure photo ionization (APPI), matrix assisted laser desorption ionization (MALDI), surface enhanced laser desorption ionization (SELDI), and derivations thereof. Common mass separation and detection systems can include quadrupole, quadrupole ion trap, linear ion trap, time-of-flight (TOF), magnetic sector, ion cyclotron (FTMS), Orbitrap, Q
Exactive, and derivations and combinations thereof. In some non-limiting embodiments, MS
analysis may be performed using one or both of LTQ-Orbitrap-XL and/or Q Exactive analysis.
In an embodiment, analysis of mass spectrometry data, for example to identify peptide fragments from a protein of interest, may be performed. Analysis may be assissted using, for example, computer software, or any other appropriate technique as will be known to one skilled in the art.

Examples of analysis software may include Sequest in the Biowords Browser software (Thermo), Proteome Discoverer 1.3 (ThermoFisher Scientific), Skyline Targeted Proteomics (developed by MacCoss lab/
https://skyline.gs.washington.edu/labkey/project/home/software/Skyline/begin.vi ew ) and Pinpoint software. MS/MS techniques, or tandem mass spectrometry, which may involve a fragmentation step, may be used during MS sample analysis, and may provide additional peptide fragments and/or data useful for the methods provided herein.
Without wishing to be bound by theory, a protein of interest may be quantified according to an embodiment of a method described herein by comparing the signal intensity of one or more peptide fragments of a protein of interest from a biological sample to corresponding labeled peptide fragments, which may be present in the sample in known amounts. In some non-limiting embodiments, a titration or standard curve may be generated to assist in quantification and to determine limits of detection.
In some embodiments, the protein of interest from the biological sample may be a protein linked to a particular disease. For example, the protein of interest to be quantified may be dystrophin, and the associated disease may be DMD. As will be recognized by those skilled in the art, any of a wide variety of proteins may be quantitated using methods as provided herein, many of which may be linked to a disease or other physiological condition. In some embodiments, a method as provided herein may be used to determine changes in protein levels as a result of disease progression, changes in protein levels as a result of treatment with a drug, or changes in protein levels as a result of other changes affecting a patient.
Those skilled in the art will recognize that a variety of mass spectrometric analysis techniques and instruments may be used to carry out embodiments of the methods provided herein. The examples provided herein are for illustrative purposes, and are not intended to be limiting in any way.
The following examples are provided for the purposes of illustration, and may demonstrate embodiments of at least some of the methods provided herein.
EXAMPLE 1:
Materials and Methods Muscle biopsies All human muscle biopsies used in this study were previously banked in a laboratory in accordance with an Institutional Review Board approved protocol at Children's National Medical Center (CNMC) and after obtaining patients written informed consent. Only excess specimens after diagnosis were used. Diagnosis was previously performed at the Center for Genetic Medicine at Children's National Medical Center. Banked specimens were deidentified and only age, gender, diagnosis and phenotype were reported. Total protein extracts of muscle biopsies from healthy subjects were obtained from Dr. David Rowlands at Massey University, Wellington, New Zealand.
Custom peptides Custom dystrophin peptides LLDLLEGLTGQK, LLVEELPLR, IFLTEQPLEGLEK and filamin c peptide VYNVTYTVK with 13C6-15N2-Lysine and 13C6-15N4- Arginine were purchased from New England Peptide (Gardner, MA). Peptides were suspended in 50%
molecular grade acetonitrile containing 0.1% TFA and spiked into samples prior to mass spectrometric analyses.

SILAM/SILAC mouse Custom "heavy" C57BL6 mice, termed SILAM or SILAC Mouse (stable isotopic labeling by amino acid in a mouse/mammal) were generated in-houseand handled according to Institutional Animal Care and Use Committee guidelines at the Children's National Medical Center. Mice were fed a custom diet containing 13C6-Lysine (Cambridge Isotope Laboratories, Andover, MA) at 1%, adhering to laboratory mouse nutritional standards. A pregnant dam was fed with 'heavy' diet until a litter (F1 generation) was obtained and continued through weaning of the pups. After weaning, the pups were continued on 'heavy' diet through breeding and generation of a F2 litter.
Label incorporation was monitored for specific organs and specific proteins by mass spectrometry. Labeling efficiency was better than 96% by F2 generation, including skeletal muscle [8]. This labeling efficiency was similar to labeling efficiencies obtained by others [9].
SILAC labeled skeletal muscles were harvested, flash frozen in liquid nitrogen chilled isopentane and stored at -80 C until analysis as previously described [8].
Muscle protein preparation Approximately 50 serial sections were prepared from each of the human muscle biopsies and SILAC mouse gastrocnemius muscle using a cryostat set at 10 lim thickness.
Muscle sections were directly placed into a microcentrifuge tube on dry ice. Total protein extraction from the muscle samples was performed using a handheld homogenizer either in a RIPA
buffer (ThermoScientific) or a modified Laemmli sample buffer containing 10% SDS (10%
SDS, 75 mM Tris-HC1, pH 6.8, 10 mM EDTA, 20% glycerol, 50 mM DTT) [10].Protein concentration was determined using a BCA assay (Pierce, Thermo Scientific).

Dystrophin quantitation using mass spectrometry with stable isotope spike-in strategy Two approaches were evaluated to quantitate dystrophin in skeletal muscle extracts (Figure 1). In the first approach, called post-digestion spike-in approach hereafter, aliquots of 50 ug total protein from each muscle extract was diluted in LDS buffer (Invitrogen, Carlsbad, CA) and further fractionated by SDS-PAGE on a 3-8% Tris-Acetate midi gel (Invitrogen) for 1 hour at 160 V. Gels were stained with BioSafe commassie (BioRad) for 1 hour. The upper section of the gel (300 to 450 kDa) containing dystrophin protein and other skeletal muscle proteins was excised and processed for in-gel digestion as previously described [11] using proteomics grade trypsin (Promega, Madison, WI). Peptides were extracted from the gel and spiked with known amounts (14 nM, 40 nM, 80 nM and 160 nM) of custom synthesized stable isotope labeled dystrophin peptides as well as an internal control filamin c peptide. In the second approach, called pre- digestion spike-in approach hereafter, aliquots of 50 ug of total protein from each muscle extract were spiked with 25 ug of muscle extract prepared from 13C6-Lysine labeled SILAC mouse. The mixture was then fractionated by SDS-PAGE on a 3-8% Tris-Acetate gel and gel bands in the 300-450 lcDa were processed as above. To determine the limit of detection (LOD) and limit of quantitation (LOQ) of dystrophin protein in a complex muscle extract we used a muscle extract from a DMD patient, completely lacking dystrophin protein, and mixed at different ratios with a muscle extract from a healthy donor that expresses dystrophin as follows:
DMD to normal 100%/0%, 95%/5%, 90%/10%, 75%/25%, 50%/50%, 25%/75%, 10%/90%, 5%/95%, 0%/100%. The final protein content in each mixture was kept constant at 50 Rg. Each sample was then spiked with 25 lig of muscle extract prepared from 13C6-Lys labeled SILAM

mouse to quantitate human dystrophin. Samples were analyzed using two different types of mass spectrometry instruments. For analysis by LTQ-Orbitrap-XL (Thermo), concentrated peptides from each spiked sample above were dissolved in 10 I, of 0.1% TFA solution and 6 [IL was injected via an autosampler onto a Symmetry C18 trap column (5 pm, 300 gm i.d., 23 mm, Waters) for 10 min at a flow rate of 10 gm/min, 100% A. The sample was subsequently separated by a C18 reverse-phase column (3 gm, 200A, 100 gmx15 cm, Magic C18, Michrom Bioresources) at a flow rate of 330 nL/min using an Eksigent nano-hplc system (Dublin, CA).
The mobile phases consisted of water with 0.1% formic acid (A) and 90%
acetonitrile (B). A 65 minute linear gradient from 5 to 40% B was employed. Eluted peptides were introduced into the mass spectrometer via a Michrom Bioresources CaptiveSpray. The spray voltage was set at 1.4 kV and the heated capillary at 200 C. The LTQ-Orbitrap-XL was operated in data-dependent mode with dynamic exclusion in which one cycle of experiments consisted of a full-MS in the Orbitrap (300-2000 m/z) survey scan in profile mode, resolution 30,000, and five subsequent MS/MS scans in the LTQ of the most intense peaks in centroid mode using collision-induced dissociation with the collision gas (helium) and normalized collision energy value set at 35%.
For Q Exactive analysis, concentrated peptides from each spiked sample above were redissoleved in 20 pi, of 90:10 water:acetonitrile with 0.1% TFA containing 2.5 fmol/gt of trainer peptide mixture. Sample were then injected via autosampler followed by separation on a HALO C18 column (75 gm ID, 10 cm, 2.7 gm) with a gradient of 0 to 35% (A: 0.1%
formic acid water, B: 0.1% formic acid acetonitrile) at a flow rate of 400 nL/min on a Thermo Scientific Easy 1000 connected to a nanoESI flex source. For the peptide coverage discovery experiment, the Q Exactive was operated with a full scan (380-1500 m/z) at 70,000 resolution followed by MS/MS of the top ten most abundant ions at 17,500 resolution. For quantitative acquisition, the Q Exactive was operated with a full scan (380-1500 m/z) at 35,000 resolution followed by timed targeted MS/MS of dystrophin and internal stable isotope labeled standard peptides at 35,000 resolution.
Protein identification and quantitation LTQ-Orbitrap XL Raw files were searched using Sequest in the Bioworks Browser (Thermo) software against a tryptic human database with 2 missed cleavages, 50 ppm mass accuracy, 1.5 Da fragment mass tolerance. Spiked peptides were identified and elution times documented.
Dystrophin was quantitated by comparing the unlabeled to the spiked-in heavy isotope profile for each peptide. Q Exactive Raw files were searched with Proteome Discoverer 1.3 (ThermoFisher Scientific) using SEQUEST and the human refseq. Database (release 47, ftp://ftp.ncbi.nih.gov/refseq/H_sapiens/mRNA_Prot/, with 34,340 entries).
Search parameters allowed trypsin to cleave after Lysine and Arginine with 2 missed cleavages.
Precursor ion mass tolerance was set to 10 ppm and fragment ion mass tolerance was 20 ppm. The dynamic modification of methionine (oxidation = 15.995 Da) and lysine (13C6 = 6.020 Da), was accepted on up to 4 residues per peptide. Within the Proteome Discoverer Software, SILAC pairs were identified using the "2 plex" workflow node, and all peptides were rescored using the Percolator algorithm node. Finally, peptides were filtered at 1% FDR. SILAC
quantification from 25% and 75% normal were compared and proteins showing a consistent ratio were considered as controls.
Peak areas and area ratios were calculated with Pinpoint software using recreated ion chromatograms at 25 ppm from the full scan MS/MS. The ratios of the integrated areas for endogenous peptides and [13C6 lys] labeled peptides were calculated to obtain peptide measures using multiple y-ion fragments per peptide. The average of these peptide ratios determined the relative amount of each protein.
High SDS containing buffer enabled efficient dystrophin extraction from skeletal muscle biopsies.
Dystrophin protein is a low abundant protein, accounting for only 0.002% of total muscle protein. Since no amplification technologies exist for protein detection by mass spectrometry, efficient dystrophin extraction was essential. In addition to efficient extraction, enrichment of dystrophin protein from other more abundant muscle proteins prior to mass spectrometry was required in order to reduce the sample dynamic range and thereby ensure consistent detection of dystrophin. We evaluated a mild (RIPA buffer) and strong (10% SDS) buffer for muscle protein extraction. As expected the 10% SDS modified Laemmli buffer extracted approximately 10 times more total protein than the RIPA buffer from the same amount of muscle tissue. Indeed, about 8 [tg and 54 lig of total proteins were extracted from 1 mg of fresh muscle tissue using RIPA and 10% SDS modified Laemmli buffer, respectively. The increased extraction efficiency of the SDS buffer also increased the dynamic range of the sample by extracting more of the highly abundant skeletal muscle proteins such as myosins, titin and nebulin.
To overcome the dynamic range limitations, total muscle extract from each of the RIPA and SDS
preparation was further separated on a 3-8% Tris-Acetate gel. The region on the gel corresponding to the migration zone of dystrophin and/or truncated Becker-like dystrophin (300-450 kDa) was excised, and processed for mass spectrometry analysis as described above.
Dystrophin protein was identified by 19 and 50 peptides when muscle sample was extracted with RIPA and 10%
SDS modified Laemmli buffers, respectively (Table 1).

Table 1 Peptide # of missed SEQ ID
NO:
cleavages VLM*DLQNQK 0 VM*VGDLEDINEMIIK 0 VM*VGDLEDINEM*IIKQK 1 SDSSQPM*LLR 0 QAEGLSEDGAAM*AVEPTQIQLSKR 1 KLQDVSM*K 1 LQDVSM*KFR 1 ATM*QDLEQR 0 DQAANLM*ANR 0 SAVEGM*PSNLDSEVAWGK 0 Dystrophin quantitation by mass spectrometry Two approaches to quantitate dystrophin protein in total muscle protein extracts were evaluated(Figure 1): (i) Post-Digestion spike-in approach with stable isotope labeled custom synthesized standard dystrophin peptides; and (ii) Pre-Digestion spike-in approach with stable isotope labeled mouse muscle protein extract prior to gel separation and in-gel digestion.
Post-digestion spike-in approach For the post-digestion spike-in approach, three stable isotope labeled dystrophin peptides were custom synthesized. The sequences of these peptides were chosen based on their consistent and reproducible detection by LC-MS/MS following in-gel digestion of SDSPAGE
fractionated muscle extracts, different retention times, amino acid content (e.g. absence of highly modifiable residues such as cysteine and methionine), as well as the location within the dystrophin sequence (e.g. distributed throughout the N-terminal, middle and C-terminal domain).
Additionally, a stable isotope labeled peptide for filamin c was also custom synthesized and used as an internal standard. The sequences of the standard peptides, their retention time, observed molecular masses as well as their location within the dystrophin sequence were determined. First the post-digestion spike-in approach was optimized for the amount of stable isotope labeled standard peptides to be used for spike-in. In-gel digested dystrophin containing bands were prepared from replicate SDS-PAGE fractionation of 50 1,tg of muscle protein extracts of a healthy donor and spiked with varying amounts of stable isotope labeled standard peptides (14 nM, 40 nM, 80 nM
and 160 nM). Figure 2 shows MS spectra of the unlabeled peptide from the endogenous dystrophin and its corresponding heavy stable isotope spiked-in standard at varying concentrations. From this preliminary study, the optimal amount of stable isotope labeled peptides to spike-in ranged between 14 and 40 nM. Spiking amounts below 14 nM
resulted in poor signal to noise spectra while spiking amounts above 40 nM resulted in increased dynamic range between the standard peptide and the endogenous peptide ion intensities reducing the linear range for quantitation. To test the reproducibility of the post-digestion spike-in approach, triplicate extraction experiments performed on the same muscle biopsy obtained from a healthy donor were processed and spiked with an optimal amount of 30 nM of stable isotope labeled standard peptide mixture. Figure 3 shows the reproducibility of the triplicate assay with a CV of less than 7%. Unfortunately, the reproducibility of the experiment did not hold across the three different dystrophin targeted peptides for a titration curve of endogenous dystrophin protein including the internal control protein filamin c (Figure 4). This was attributed to the inherent variability of in-gel digestion. Therefore, the post-digestion spike-in approach suffered from high sample handling errors.

Pre-digestion spike-in approach In order to overcome in-gel digestion variability a pre-digestion spike-in approach was evaluated using 13C6-Lysine fully labeled dystrophin protein obtained from muscle extracts prepared from a SILAC mouse. In this method the sample is spiked at the protein level prior to electrophoresis and in-gel digestion, thus minimizing variation due to sample handling and greatly improving reproducibility. Since production of a fully labeled human dystrophin protein using transfection technology and over-expression in a labeled culture system was challenging due to the low transfection rate of the largest human gene [12], use of 13C6- Lysine labeled dystrophin prepared from a SILAC mouse was employed [9,13]. Mouse dystrophin and human dystrophin have 91% sequence homology. Previously a fully 13C6-Lysine labeled SILAC mouse had been generated [8]. Skeletal muscle from the SILAC mouse was sectioned by cryostat, total protein containing 0.002% of fully labeled dystrophin were extracted using the 10% SDS
modified Laemmli buffer then used as a spike-in standard in human muscle extracts.
Spiked human muscle extracts were further fractionated by SDS-PAGE and processed for mass spectrometry analysis using the Q Exactive instrument as described above. In a discovery run, 43 unique dystrophin peptides were detected with good coverage throughout the entire dystrophin sequence. Of these 43 unique peptides, five terminated in lysine and had 100%
sequence homology with mouse tryptic peptides and therefore were used to quantitate dystrophin in human muscle extracts. In addition to these dystrophin overlapping peptides between human and mouse, other lysine terminating peptides belonging to several other skeletal muscle proteins also had 100% sequence homology between human and mouse. This enabled the evaluation and selection of appropriate internal standards for accurate dystrophin quantitation.
Limit of detection and limit of quantitation of dystrophin protein in total muscle extract To evaluate the LOD and LOQ of the pre-digestion spike-in approach, targeted mass spectrometry analysis was used on the five dystrophin peptides detected above as well as a few internal control peptides from myomesin and filamin c. Dystrophin protein was targeted for quantitation in the following combination of normal and DMD muscle extracts:
0%/100%, 5%/95%, 10%/90%, 25/75%, 50/50%, 75/25%, 90/10%, 95/5%, 100/0%. Each mixture had a final protein content of 50 g. The range of dystrophin protein expression, from 0% to 100% of normal, is thus artificially generated to represent possible amounts of dystrophin protein in Becker patients or in Duchenne patients receiving treatments aiming to restore dystrophin expression [3-7]. Each combination mixture above (50 ug final total protein) was then spiked with SILAC 13C6-Lysine labeled SILAC mouse muscle extract (25 ,g). Samples were fractionated on a 3-8% Tris-Acetate gel, bands in the dystrophin protein region (300-450 kDa) were excised, in-gel digested and analyzed by LC-MS/MS on a Q Exactive mass spectrometer using a timed targeted MS/MS method. Unlabeled and labeled dystrophin, filmain c and myomesin peptides from both the human muscle extract and the spike-in SILAC
mouse labeled extract were targeted for MS/MS analysis. Selected transition ions were used for quantitation in each sample. The average ratio of labeled to unlabeled peptide intensities for dystrophin, filamin c and myomesin were plotted against the different muscle combination mixtures resulting in a calibration curve with an R2 of 0.99 (Figure 5). While the amount of dystrophin increased with increasing % of normal muscle extract in the mixtures, two muscle specific proteins, filamin c and myomesin, remained relatively unchanged. These two proteins are therefore ideal candidates as internal controls. Note that filamin c and myomesin did show a slight increase in abundance as the % of normal increased (Figure 5), and this is expected since the amount of muscle present in dystrophic tissue is slightly decreased and is replaced by fibrotic tissue (e.g. hallmark of DMD

pathogenesis) [14]. Therefore, monitoring of internal standards across the curve allows for improved accuracy and normalization.
Absolute quantitation of dystrophin in Becker muscular dystrophy patients The absolute amount of dystrophin in muscle biopsies from normal donors (n =
12) and Becker muscular dystrophy patient donors (n = 5) was determined. Dystrophin in normal muscle ranged from 0.001 to 0.004% of total striated muscle, consistent with previous findings [2]. The Becker samples also showed a wide range of dystrophin expression at approximately 10%
of the level found in normal muscle (Figure 6). Dystrophin protein represents approximately 0.002% of total striated muscle protein and since the amount of spike-in standard is known, we estimated the total amount of dystrophin in healthy individuals to be 75 15 ng per mg of muscle while in Becker patients the amount can range from 0 to 7 ng per mg of muscle (Figure 6).
Extension of mass spectrometry SILAC methods to multiple proteins.
The methods for quantitation of dystrophin, where alignments of peptides showing 100%
homology between mouse SILAC skeletal muscle tissue proteins and human skeletal muscle tissue proteins, was extended to a survey of all paired mouse/human peptides (Tables 3-6).
Muscle proteins were extracted using two different solubilization buffers (RIPA, SDS), fractionated on SDS-PAGE gels, mouse and human muscle samples mixed (as described above) and gel fragments subjected to trypsin digestion with detection of 100%
conserved peptides on the Q-exactive mass spectrometer (Table 2; Table S2 [spreadsheet]).
Table 2:
RIPA Normal RI PA DIVID SDS Normal SDS DMD

Number of paired mouse/human 2,428 --, 2 X400 ,281 511 peptides identified õ
From this data generation, between 2,281 to 4,400 100% homologous mouse/human peptide pairs were identified, enabling accurate quantitation of 1,172 proteins from skeletal muscle (Table 7). By extension, similar data would be expected to be obtained from any other mixed human ¨ mouse SILAC tissue pair, resulting in the ability to quantitate a wide range of human proteins from a wide range of clinical tissue samples.
Table 2: Tissue from normal subjects extracted using a RIPA buffer Sequence Human # SEQ ID
Protein Missed NO:
Uniprot ID Cleavag es GNK

QETSFTK

GSGK

GK

El DAALQK Q0ZGT2 0 LTfVLTTHHHWDHAGGNEK Q16775 0 El EPSSSTTTASVTK Q8N3K9 0 lEAEPIQFTK Q8WZ42 0 lEIPDLELADDLKK Q8WZ42 1 GIGIENIHYLNDGLWHMK Q9ULC4 ' 0 Table 4: Tissue from DMD subjects extracted using a RIPA buffer Sequence Human # SEQ ID
Protein Mi NO:
Uniprot ss ID ed CI
ea va ge S

, DAGEGLLAVQITDPEGKPK P21333 . 0 El EELQSQAQALSQEGK 001082 0 lEALPSDISIDEGK Q8WZ42 0 lEAEPIQFTK Q8WZ42 0 lEIPDLELADDLKK Q8WZ42 1 AlAVTVQEMVTK Q9Y490 0 Table 5: Tissue from normal subjects extracted using a SDS buffer Sequence Human # SEQ ID
Protein Mi NO:
Uniprot ss ID ed CI
ea va ge S

EDAEKK

I<AYDLQSDALYK P20929 1 I<ADVIPVHYYLIPPPTK P29144 1 MQVDQEEPHVEEQQQQTPAENI<AESEEMETSQAGSK P34932 1 QMSSFVQNGSTFvK P35573 0 AlVSAPFGK Q15149 0 El EPSSSTTTASVTK Q8N3K9 0 lEAEPIQFTK Q8WZ42 0 EllADGLK Q8WZ42 0 lEALPSDISIDEGK Q8WZ42 0 lEIPDLELADDLKK Q8WZ42 1 LLGSI El DHTQYKFGHTK Q9Y623 1 Table 6: Tissue from DMD subjects extracted using a SDS buffer lEAQNQPFDAK P11055 0 GH'VFEESQVAGTPMFVVK P13639 0 Q L \NDTANTVK P13807 0 GNF'TVEVDLHTAK P13929 0 LS\NDQEK P13929 0 LS\NDQEKVDK P13929 1 YGF'QYGHPPPPPPPPEYGPHADSPVLMVYGLDQSK P14866 0 ND'YKLVTDTPVYVQAVK P20929 1 TIH'VMPDTPEIMLAK P20929 0 NAKLVGQS1lAYLQK P53621 1 LVGQS1lAYLQKK P53621 1 I<AIIIFVPVPQLK P62081 1 lEAEPIQFTK Q8WZ42 0 lEIPDLELADDLKK Q8WZ42 1 lEALPSDISIDEGK Q8WZ42 0 Table 7: Proteins identified UniProt UniProt Entry Protein names ID name A0AVT1 UBA6_HUMAN Ubiquitin-like modifier-activating enzyme 6 (Ubiquitin-activating enzyme 6) (Monocyte protein 4) (MOP-4) (Ubiquitin-activating enzyme El-like protein 2) (El-L2) A4UGR9 XIRP2_HUMAN Xin actin-binding repeat-containing protein 2 (Beta-xin) (Cardiomyopathy-associated protein 3) (Xeplin) A5YM72 CRNS1_HUMAN Carnosine synthase 1 (EC 6.3.2.11) (ATP-grasp domain-containing protein 1) A6NDG6 PGP_HUMAN Phosphoglycolate phosphatase (PGP) (PGPase) (EC
3.1.3.18) A6NMY6 AXA2L_HUMAN Putative annexin A2-like protein (Annexin A2 pseudogene 2) (Lipocortin ll pseudogene) A6NNS2 DRS7C_HUMAN Dehydrogenase/reductase SDR family member 7C (EC 1.1.-A8MU46 SMTL1_HUMAN Smoothelin-like protein 1 000148 DX39A_HUMAN ATP-dependent RNA helicase DDX39A (EC 3.6.4.13) (DEAD
box protein 39) (Nuclear RNA helicase URH49) 000151 PDLI1_HUMAN PDZ and LIM domain protein 1 (C-terminal LIM domain protein 1) (Elfin) (LIM domain protein CLP-36) 000159 MY01C_HUMAN Unconventional myosin-lc (Myosin I beta) (MMI-beta) (MM1b) 000217 NDUS8_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-23kD) (CI-23kD) (NADH-ubiquinone oxidoreductase 23 kDa subunit) (TYKY subunit) 000231 PSD11_HUMAN 26S proteasome non-ATPase regulatory subunit 11 (26S
proteasome regulatory subunit RPN6) (26S proteasome regulatory subunit S9) (26S
proteasome regulatory subunit p44.5) 000232 PSD12_HUMAN 265 proteasome non-ATPase regulatory subunit 12 (26S
proteasome regulatory subunit RPN5) (26S proteasome regulatory subunit p55) 000330 ODPX_HUMAN Pyruvate dehydrogenase protein X component, mitochondria!
(Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex) (E3-binding protein) (E3BP) (Lipoyl-containing pyruvate dehydrogenase complex component X) (proX) 000410 IP05_HUMAN Importin-5 (Imp5) (Importin subunit beta-3) (Karyopherin beta-3) (Ran-binding protein 5) (RanBP5) 000423 EMAL1_HUMAN Echinoderm microtubule-associated protein-like 1 (EMAP-1) (HuEMAP-1) 000429 DNM1L_HUMAN Dynamin-l-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) 000483 NDUA4_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4 (Complex I-MLRQ) (CI-MLRQ) (NADH-ubiquinone oxidoreductase MLRQ subunit) 000487 PSDE_HUMAN 26S proteasome non-ATPase regulatory subunit 14 (EC
3.4.19.-) (26S
proteasome regulatory subunit RPN11) (26S proteasome-associated PAD1 homolog 1) 000499 BIN1_HUMAN Myc box-dependent-interacting protein 1 (Amphiphysin II) (Amphiphysin-like protein) (Box-dependent myc-interacting protein 1) (Bridging integrator 1) 000505 IMA4_HUMAN Importin subunit alpha-4 (Importin alpha Q2) (Qip2) (Karyopherin subunit alpha-3) (SRP1-gamma) 000571 DDX3X_HUMAN ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (DEAD
box protein 3, X-chromosomal) (DEAD box, X isoform) (Helicase-like protein 2) (HLP2) 000629 IMA3_HUMAN Importin subunit alpha-3 (Importin alpha 01) (Qip1) (Karyopherin subunit alpha-4) 000748 EST2_HUMAN Cocaine esterase (EC 3.1.1.84) (Carboxylesterase 2) (CE-2) (hCE-2) (EC
3.1.1.1) (Methylumbelliferyl-acetate deacetylase 2) (EC 3.1.1.56) 000757 F16P2_HUMAN Fructose-1,6-bisphosphatase isozyme 2 (FBPase 2) (EC
3.1.3.11) (0-fructose-1,6-bisphosphate 1-phosphohydrolase 2) 014558 HSPB6_HUMAN Heat shock protein beta-6 (HspB6) (Heat shock 20 kDa-like protein p20) 014744 ANM5_HUMAN Protein arginine N-methyltransferase 5 (EC 2.1.1.1 (72 kDa ICI-binding protein) (Histone-arginine N-methyltransferase PRMT5) (EC
2.1.1.125) (Jak-binding protein 1) (Shk1 kinase-binding protein 1 homolog) (SKB1 homolog) (SKB1Hs) [Cleaved into: Protein arginine N-methyltransferase 5, N-terminally processed]
014786 NRP1_HUMAN Neuropilin-1 (Vascular endothelial cell growth factor 165 receptor) (CD
antigen CD304) 014818 PSA7_HUMAN Proteasome subunit alpha type-7 (EC 3.4.25.1) (Proteasome subunit RC6-1) (Proteasome subunit XAPC7) 014880 MGST3_HUMAN Microsomal glutathione S-transferase 3 (Microsomal GST-3) (EC
2.5.1.18) (Microsomal 651-111) 014958 CASQ2_HUMAN Calsequestrin-2 (Calsequestrin, cardiac muscle isoform) 014980 XP01_HUMAN Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog) 014983 AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (SERCA1) (SR
Ca(2+)-ATPase 1) (EC 3.6.3.8) (Calcium pump 1) (Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase) 015061 SYNEM_HUMAN Synemin (Desmuslin) 015143 ARC1B_HUMAN Actin-related protein 2/3 complex subunit 1B (Arp2/3 complex 41 kDa subunit) (p41-ARC) 015144 ARPC2_HUMAN Actin-related protein 2/3 complex subunit 2 (Arp2/3 complex 34 kDa subunit) (p34-ARC) 015273 TELT_HUMAN Telethonin (Titin cap protein) 015371 ElF3D_HUMAN Eukaryotic translation initiation factor 3 subunit D
(eIF3d) (Eukaryotic translation initiation factor 3 subunit 7) (eIF-3-zeta) (eIF3 p66) 015460 P4HA2_HUMAN Prolyl 4-hydroxylase subunit alpha-2 (4-PH alpha-2) (EC 1.14.11.2) (Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-2) 015511 ARPC5_HUMAN Actin-related protein 2/3 complex subunit 5 (Arp2/3 complex 16 kDa subunit) (p16-ARC) 043143 DHX15_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA
helicase DHX15 (EC 3.6.4.13) (ATP-dependent RNA helicase #46) (DEAH box protein 15) 043175 SERA_HUMAN D-3-phosphoglycerate dehydrogenase (3-PGDH) (EC
1.1.1.95) 043181 NDUS4_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial (Complex 1-18 kDa) (CI-18 kDa) (Complex I-AQDQ) (CI-AQDQ) (NADH-ubiquinone oxidoreductase 18 kDa subunit) 043242 PSMD3_HUMAN 26S proteasome non-ATPase regulatory subunit 3 (265 proteasome regulatory subunit RPN3) (26S proteasome regulatory subunit 53) (Proteasome subunit p58) 043390 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R (hnRNP R) 043396 TXNL1_HUMAN Thioredoxin-like protein 1 (32 kDa thioredoxin-related protein) 043488 ARK72_HUMAN Aflatoxin B1 aldehyde reductase member 2 (EC
1.1.1.n11) (AFB1 aldehyde reductase 1) (AFB1-AR 1) (Aldoketoreductase 7) (Succinic semialdehyde reductase) (SSA reductase) 043615 TIM44_HUMAN Mitochondrial import inner membrane translocase subunit TIM44 043639 NCK2_HUMAN Cytoplasmic protein NCK2 (Growth factor receptor-bound protein 4) (NCK adaptor protein 2) (Nck-2) (SH2/SH3 adaptor protein NCK-beta) 043681 ASNA_HUMAN ATPase ASNA1 (EC 3.6.-.-) (Arsenical pump-driving ATPase) (Arsenite-stimulated ATPase) (Transmembrane domain recognition complex 40 kDa ATPase subunit) (hARSA-I) (hASNA-I) 043707 ACTN4_HUMAN Alpha-actinin-4 (F-actin cross-linking protein) (Non-muscle alpha-actinin 4) 043708 MAAI_HUMAN Maleylacetoacetate isomerase (MAAI) (EC 5.2.1.2) (GSTZ1-1) (Glutathione S-transferase zeta 1) (EC 2.5.1.18) 043747 AP1G1_HUMAN AP-1 complex subunit gamma-1 (Adapter-related protein complex 1 subunit gamma-1) (Adaptor protein complex AP-1 subunit gamma-1) (Clathrin assembly protein complex 1 gamma-1 large chain) (Gamma1-adaptin) (Golgi adaptor HAVAP1 adaptin subunit gamma-1) 043776 SYNC_HUMAN Asparagine--tRNA ligase, cytoplasmic (EC 6.1.1.22) (Asparaginyl-tRNA
synthetase) (AsnRS) 043837 IDH3B_HUMAN Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial (EC
1.1.1.41) (Isocitric dehydrogenase subunit beta) (NAD(+)-specific ICDH
subunit beta) 043852 CALU_HUMAN Calumenin (Crocalbin) (IEF SSP 9302) 043920 NDUS5_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 (Complex 1-15 kDa) (CI-15 kDa) (NADH-ubiquinone oxidoreductase 15 kDa subunit) 060237 MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B (Myosin phosphatase-targeting subunit 2) (Myosin phosphatase target subunit 2) 060271 JIP4_HUMAN C-Jun-amino-terminal kinase-interacting protein 4 (JIP-4) (JNK-interacting protein 4) (Cancer/testis antigen 89) (CT89) (Human lung cancer oncogene 6 protein) (HLC-6) (JNK-associated leucine-zipper protein) (JLP) (Mitogen-activated protein kinase 8-interacting protein 4) (Proliferation-inducing protein 6) (Protein highly expressed in testis) (PHET) (Sperm surface protein) (Sperm-associated antigen 9) (Sperm-specific protein) (Sunday driver 1) 060313 OPA1_HUMAN Dynamin-like 120 kDa protein, mitochondrial (EC
3.6.5.5) (Optic atrophy protein 1) [Cleaved into: Dynamin-like 120 kDa protein, form Si]
060506 HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) (Glycine- and tyrosine-rich RNA-binding protein) (GRY-RBP) (NS1-associated protein 1) (Synaptotagmin-binding, cytoplasmic RNA-interacting protein) 060662 KLH41_HUMAN Kelch-like protein 41 (Kel-like protein 23) (Kelch repeat and BIB
domain-containing protein 10) (Kelch-related protein 1) (Sarcosin) 060664 PLIN3_HUMAN Perilipin-3 (47 kDa mannose 6-phosphate receptor-binding protein) (47 kDa MPR-binding protein) (Cargo selection protein TIP47) (Mannose-6-phosphate receptor-binding protein 1) (Placental protein 17) (PP17) 060701 UGDH_HUMAN UDP-glucose 6-dehydrogenase (UDP-Glc dehydrogenase) (UDP-G1cDH) (UDPGDH) (EC 1.1.1.22) 060749 SNX2_HUMAN Sorting nexin-2 (Transformation-related gene 9 protein) (TRG-9) 060763 US01_HUMAN General vesicular transport factor p115 (Protein US01 homolog) (Transcytosis-associated protein) (TAP) (Vesicle-docking protein) 060841 IF2P_HUMAN Eukaryotic translation initiation factor 5B (eIF-5B) (Translation initiation factor IF-2) 060884 DNJA2_HUMAN DnaJ homolog subfamily A member 2 (Cell cycle progression restoration gene 3 protein) (Dnj3) (Dj3) (HIRA-interacting protein 4) (Renal carcinoma antigen NY-REN-14) 075027 ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial (ATP-binding cassette transporter 7) (ABC transporter 7 protein) 075083 WDR1_HUMAN WD repeat-containing protein 1 (Actin-interacting protein 1) (AIP1) (NORI-1) 075112 LDB3_HUMAN LIM domain-binding protein 3 (Protein cypher) (Z-band alternatively spliced PDZ-motif protein) 075116 ROCK2_HUMAN Rho-associated protein kinase 2 (EC 2.7.11.1) (Rho kinase 2) (Rho-associated, coiled-coil-containing protein kinase 2) (Rho-associated, coiled-coil-containing protein kinase II) (ROCK-II) (p164 ROCK-2) 075155 CAND2_HUMAN Cu!lin-associated NEDD8-dissociated protein 2 (CuIlin-associated and neddylation-dissociated protein 2) (Epididymis tissue protein Li 169) (TBP-interacting protein of 120 kDa B) (TBP-interacting protein 120B) (p120 CAND2) 075208 COQ9_HUMAN Ubiquinone biosynthesis protein COQ9, mitochondrial 075251 NDUS7_HUMAN NADH dehydrogenase (ubiquinone] iron-sulfur protein 7, mitochondrial (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-20kD) (CI-20kD) (NADH-ubiquinone oxidoreductase 20 kDa subunit) (PSST subunit) 075298 RTN2_HUMAN Reticulon-2 (Neuroendocrine-specific protein-like 1) (NSP-like protein 1) (Neuroendocrine-specific protein-like I) (NSP-like protein I) (NSPLI) 075306 NDUS2_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-49kD) (CI-49kD) (NADH-ubiquinone oxidoreductase 49 kDa subunit) 075323 NIPS2_HUMAN Protein NipSnap homolog 2 (NipSnap2) (Glioblastoma-amplified sequence) 075369 FLNB_HUMAN Filamin-B (FLN-B) (ABP-278) (ABP-280 homolog) (Actin-binding-like protein) (Beta-filamin) (Filamin homolog 1) (Fh1) (Filamin-3) (Thyroid autoantigen) (Truncated actin-binding protein) (Truncated ABP) 075390 CISY_HUMAN Citrate synthase, mitochondrial (EC 2.3.3.1) 075431 MTX2_HUMAN Metaxin-2 (Mitochondrial outer membrane import complex protein 2) 075436 VP26A_HUMAN Vacuolar protein sorting-associated protein 26A
(Vesicle protein sorting 26A) (hVPS26) 075489 NDUS3_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-30kD) (CI-30kD) (NADH-ubiquinone oxidoreductase 30 kDa subunit) 075643 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase (EC 3.6.4.13) (Activating signal cointegrator 1 complex subunit 3-like 1) (BRR2 homolog) (U5 snRNP-specific 200 kDa protein) (U5-200KD) 075746 CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12) 075822 ElF3J_HUMAN Eukaryotic translation initiation factor 3 subunit J
(eIF3j) (Eukaryotic translation initiation factor 3 subunit 1) (eIF-3-alpha) (eIF3 p35) 075874 IDHC_HUMAN Isocitrate dehydrogenase [NADP] cytoplasmic (IDH) (EC
1.1.1.42) (Cytosolic NADP-isocitrate dehydrogenase) (IDP) (NADP(+)-specific ICDH) (Oxalosuccinate decarboxylase) 075923 DYSF_HUMAN Dysferlin (Dystrophy-associated fer-1-like protein) (Fer-1-like protein 1) 075947 ATP5H_HUMAN ATP synthase subunit d, mitochondria! (ATPase subunit d) 075955 FLOT1_HUMAN Flotillin-1 075964 ATP5L_HUMAN ATP synthase subunit g, mitochondria! (ATPase subunit g) 076003 GLRX3_HUMAN Glutaredoxin-3 (PKC-interacting cousin of thioredoxin) (PICOT) (PKC-theta-interacting protein) (PKCq-interacting protein) (Thioredoxin-like protein 2) 094760 DDAH1_HUMAN N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 (DDAH-1) (Dimethylarginine dimethylaminohydrolase 1) (EC 3.5.3.18) (DDAHI) (Dimethylargininase-1) 094826 TOM7O_HUMAN Mitochondrial import receptor subunit TOM70 (Mitochondrial precursor proteins import receptor) (Translocase of outer membrane 70 kDa subunit) 094903 PROSC_HUMAN Praline synthase co-transcribed bacterial homolog protein 094905 ERLN2_HUMAN Erlin-2 (Endoplasmic reticulum lipid raft-associated protein 2) (Stomatin-prohibitin-flotillin-HfIC/K domain-containing protein 2) (SPFH domain-containing protein 2) 094911 ABCA8_HUMAN ATP-binding cassette sub-family A member 8 094979 SC31A_HUMAN Protein transport protein Sec31A (ABP125) (ABP130) (SEC31-like protein 1) (SEC31-related protein A) (Web1-like protein) 095140 MFN2_HUMAN Mitofusin-2 (EC 3.6.5.-) (Transmembrane GTPase MFN2) 095182 NDUA7_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 (Complex I-B14.5a) (CI-614.5a) (NADH-ubiquinone oxidoreductase subunit B14.5a) 095202 LETM1_HUMAN LETM1 and EF-hand domain-containing protein 1, mitochondria!
(Leucine zipper-EF-hand-containing transmembrane protein 1) 095292 VAPB_HUMAN Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C) 095299 NDUAA_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial (Complex I-42kD) (CI-42kD) (NADH-ubiquinone oxidoreductase 42 kDa subunit) 095359 TACC2_HUMAN Transforming acidic coiled-coil-containing protein 2 (Anti-Zuai-1) (AZU-1) 095373 IP07_HUMAN lmportin-7 (Imp7) (Ran-binding protein 7) (RanBP7) 095425 SVIL_HUMAN Supervillin (Archvillin) (p205/p250) 095573 ACSL3_HUMAN Long-chain-fatty-acid--CoA ligase 3 (EC 6.2.1.3) (Long-chain acyl-CoA
synthetase 3) (LACS 3) 095747 OXSR1_HUMAN Serine/threonine-protein kinase OSR1 (EC 2.7.11.1) (Oxidative stress-responsive 1 protein) 095810 SDPR_HUMAN Serum deprivation-response protein (Cavin-2) (PS-p68) (Phosphatidylserine-binding protein) 095817 BAG3_HUMAN BAG family molecular chaperone regulator 3 (BAG-3) (BcI-2-associated athanogene 3) (BcI-2-binding protein Bis) (Docking protein CAIR-1) 095831 AlFMl_HUMAN Apoptosis-inducing factor 1, mitochondrial (EC 1.1.1.-) (Programmed cell death protein 8) 096000 NDUBA_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 (Complex I-PDSW) (CI-PDSW) (NADH-ubiquinone oxidoreductase PDSW subunit) P00338 LDHA_HUMAN L-lactate dehydrogenase A chain (LDH-A) (EC 1.1.1.27) (Cell proliferation-inducing gene 19 protein) (LDH muscle subunit) (LDH-M) (Renal carcinoma antigen NY-REN-59) P00352 AL1A1_HUMAN Retinal dehydrogenase 1 (RALDH 1) (RaIDH1) (EC
1.2.1.36) (ALDH-E1) (ALHDII) (Aldehyde dehydrogenase family 1 member Al) (Aldehyde dehydrogenase, cytosolic) P00367 DHE3_HUMAN Glutamate dehydrogenase 1, mitochondria! (GDH 1) (EC
1.4.1.3) P00390 GSHR_HUMAN Glutathione reductase, mitochondrial (GR) (GRase) (EC
1.8.1.7) P00403 COX2_HUMAN Cytochrome c oxidase subunit 2 (Cytochrome c oxidase polypeptide II) P00441 SODC_HUMAN Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) (Superoxide dismutase 1) (hSodl) P00450 CERU_HUMAN Ceruloplasmin (EC 1.16.3.1) (Ferroxidase) P00488 F13A_HUMAN Coagulation factor XIII A chain (Coagulation factor XIlla) (EC 2.3.2.13) (Protein-glutamine gamma-glutamyltransferase A chain) (Transglutaminase A chain) P00505 AATM_HUMAN Aspartate aminotransferase, mitochondrial (mAspAT) (EC 2.6.1.1) (EC
2.6.1.7) (Fatty acid-binding protein) (FABP-1) (Glutamate oxaloacetate transaminase 2) (Kynurenine aminotransferase 4) (Kynurenine aminotransferase IV) (Kynurenine--oxoglutarate transaminase 4) (Kynurenine--oxoglutarate transaminase IV) (Plasma membrane-associated fatty acid-binding protein) (FABPpm) (Transaminase A) P00558 PGKl_HUMAN Phosphoglycerate kinase 1 (EC 2.7.2.3) (Cell migration-inducing gene protein) (Primer recognition protein 2) (PRP 2) P00568 KADl_HUMAN Adenylate kinase isoenzyme 1 (AK 1) (EC 2.7.4.3) (ATP-AMP
transphosphorylase 1) (ATP:AMP phosphotransferase) (Adenylate mono phosphate kinase) (Myokinase) P00734 THRB_HUMAN Prothrombin (EC 3.4.21.5) (Coagulation factor II) [Cleaved into:
Activation peptide fragment 1; Activation peptide fragment 2;
Thrombin light chain; Thrombin heavy chain]
P00738 HPT_HUMAN Haptoglobin (Zonulin) [Cleaved into: Haptoglobin alpha chain;
Haptoglobin beta chain]
P00746 CFAD_HUMAN Complement factor D (EC 3.4.21.46) (Adipsin) (C3 convertase activator) (Properdin factor D) P00751 CFAB_HUMAN Complement factor B (EC 3.4.21.47) (C3/C5 convertase) (Glycine-rich beta glycoprotein) (GBG) (PBF2) (Properdin factor B) [Cleaved into:
Complement factor B Ba fragment; Complement factor B Bb fragment]
P00915 CAHl_HUMAN Carbonic anhydrase 1 (EC 4.2.1.1) (Carbonate dehydratase I) (Carbonic anhydrase B) (CAB) (Carbonic anhydrase I) (CA-I) P00918 CAH2_HUMAN Carbonic anhydrase 2 (EC 4.2.1.1) (Carbonate dehydratase II) (Carbonic anhydrase C) (CAC) (Carbonic anhydrase II) (CA-II) P01008 ANT3_HUMAN Antithrombin-III (ATIII) (Serpin Cl) P01009 AlAT_HUMAN Alpha-1-antitrypsin (Alpha-1 protease inhibitor) (Alpha-1-antiproteinase) (Serpin Al) [Cleaved into: Short peptide from AAT
(SPAAT)]
P01011 AACT_HUMAN Alpha-1-antichymotrypsin (ACT) (Cell growth-inhibiting gene 24/25 protein) (Serpin A3) [Cleaved into: Alpha-1-antichymotrypsin His-Pro-less]
P01019 ANGT_HUMAN Angiotensinogen (Serpin A8) [Cleaved into: Angiotensin-1 (Angiotensin 1-10) (Angiotensin I) (Ang I); Angiotensin-2 (Angiotensin 1-8) (Angiotensin II) (Ang II); Angiotensin-3 (Angiotensin 2-8) (Angiotensin III) (Ang III) (Des-Asp[1]-angiotensin II); Angiotensin-4 (Angiotensin 3-8) (Angiotensin IV) (Ang IV); Angiotensin 1-9; Angiotensin 1-7;
Angiotensin 1-5; Angiotensin 1-4]
P01023 A2MG_HUMAN Alpha-2-macroglobulin (Alpha-2-M) (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5) P01024 CO3_HUMAN Complement C3 (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1) [Cleaved into: Complement C3 beta chain;
Complement C3 alpha chain; C3a anaphylatoxin; Acylation stimulating protein (ASP) (C3adesArg); Complement C3b alpha' chain;
Complement C3c alpha' chain fragment 1; Complement C3dg fragment; Complement C3g fragment; Complement C3d fragment;
Complement C3f fragment; Complement C3c alpha' chain fragment 2]
P01834 IGKC_HUMAN Ig kappa chain C region P01857 IGHG1_HUMAN Ig gamma-1 chain C region P01859 IGHG2_HUMAN Ig gamma-2 chain C region P02042 HBD_HUMAN Hemoglobin subunit delta (Delta-globin) (Hemoglobin delta chain) P02100 HBE_HUMAN Hemoglobin subunit epsilon (Epsilon-globin) (Hemoglobin epsilon chain) P02144 MYG_HUMAN Myoglobin P02452 C01A1_HUMAN Collagen alpha-1(I) chain (Alpha-1 type I collagen) P02461 CO3A1_HUMAN Collagen alpha-1(III) chain P02511 CRYAB_HUMAN Alpha-crystallin B chain (Alpha(B)-crystallin) (Heat shock protein beta-5) (HspB5) (Renal carcinoma antigen NY-REN-27) (Rosenthal fiber component) P02533 K1C14_HUMAN Keratin, type I cytoskeletal 14 (Cytokeratin-14) (CK-14) (Keratin-14) (K14) P02538 K2C6A_HUMAN Keratin, type II cytoskeletal 6A (Cytokeratin-6A) (CK-6A) (Cytokeratin-6D) (CK-6D) (Keratin-6A) (K6A) (Type-II keratin Kb6) (allergen Hom s 5) P02545 LMNA_HUMAN Prelamin-A/C [Cleaved into: Lamin-A/C (70 kDa lamin) (Renal carcinoma antigen NY-REN-32)]
P02549 SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 (Erythroid alpha-spectrin) P02585 TNNC2_HUMAN Troponin C, skeletal muscle P02647 APOAl_HUMAN Apolipoprotein A-I (Apo-Al) (ApoA-I) (Apolipoprotein Al) [Cleaved into:
Truncated apolipoprotein A-I (Apolipoprotein A-I(1-242))]
P02671 FIBA_HUMAN Fibrinogen alpha chain [Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain]

P02675 FIBB_HUMAN Fibrinogen beta chain [Cleaved into: Fibrinopeptide B; Fibrinogen beta chain]
P02679 FIBG_HUMAN Fibrinogen gamma chain P02748 C09_HUMAN Complement component C9 [Cleaved into: Complement component C9a; Complement component C9b]
P02751 FINC_HUMAN Fibronectin (FN) (Cold-insoluble globulin) (CIG) [Cleaved into:
Anastellin; Ugl-Y1; Ugl-Y2; Ugl-Y3]
P02763 AlAGl_HUMAN Alpha-l-acid glycoprotein 1 (AGP 1) (Orosomucoid-1) (OMD 1) P02766 TTHY_HUMAN Transthyretin (ATTR) (Prealbumin) (TBPA) P02768 ALBU_HUMAN Serum albumin P02771 FETA_HUMAN Alpha-fetoprotein (Alpha-1-fetoprotein) (Alpha-fetoglobulin) P02774 VTDB_HUMAN Vitamin D-binding protein (DBP) (VDB) (Gc-globulin) (Group-specific component) P02786 TFRl_HUMAN Transferrin receptor protein 1 (TR) (TfR) (TfR1) (Trfr) (T9) (p90) (CD
antigen CD71) [Cleaved into: Transferrin receptor protein 1, serum form (sTfR)]
P02787 TRFE_HUMAN Serotransferrin (Transferrin) (Beta-1 metal-binding globulin) (Siderophilin) P02794 FRIH_HUMAN Ferritin heavy chain (Ferritin H subunit) (EC
1.16.3.1) (Cell proliferation-inducing gene 15 protein) P03915 NU5M_HUMAN NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH
dehydrogenase subunit 5) P04040 CATA_HUMAN Catalase (EC 1.11.1.6) P04075 ALDOA_HUMAN Fructose-bisphosphate aldolase A (EC 4.1.2.13) (Lung cancer antigen NY-LU-1) (Muscle-type aldolase) P04080 CYTB_HUMAN Cystatin-B (CPI-B) (Liver thiol proteinase inhibitor) (Stefin-B) P04083 ANXAl_HUMAN Annexin Al (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (P35) P04114 APOB_HUMAN Apolipoprotein B-100 (Apo B-100) [Cleaved into:
Apolipoprotein B-48 (Apo B-48)]
P04179 SODM_HUMAN Superoxide dismutase [Mn], mitochondrial (EC
1.15.1.1) P04196 HRG_HUMAN Histidine-rich glycoprotein (Histidine-proline-rich glycoprotein) (HPRG) P04217 A1BG_HUMAN Alpha-1B-glycoprotein (Alpha-1-B glycoprotein) P04259 K2C6B_HUMAN Keratin, type II cytoskeletal 6B (Cytokeratin-6B) (CK-6B) (Keratin-6B) (K6B) (Type-II keratin Kb10) P04264 K2C1_HUMAN Keratin, type II cytoskeletal 1 (67 kDa cytokeratin) (Cytokeratin-1) (CK-1) (Hair alpha protein) (Keratin-1) (K1) (Type-II keratin Kbl) P04406 G3P_HUMAN Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) (EC
1.2.1.12) (Peptidyl-cysteine S-nitrosylase GAPDH) (EC 2.6.99.-) P04632 CPNSl_HUMAN Calpain small subunit 1 (CSS1) (Calcium-activated neutral proteinase small subunit) (CANP small subunit) (Calcium-dependent protease small subunit) (CDPS) (Calcium-dependent protease small subunit 1) (Calpain regulatory subunit) P04792 HSPB1_HUMAN Heat shock protein beta-1 (HspB1) (28 kDa heat shock protein) (Estrogen-regulated 24 kDa protein) (Heat shock 27 kDa protein) (HSP
27) (Stress-responsive protein 27) (SRP27) P04843 RPNl_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (EC 2.4.99.18) (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit) (Ribophorin I) (RPN-I) (Ribophorin-1) P04844 RPN2_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (EC 2.4.99.18) (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit) (RIBIIR) (Ribophorin II) (RPN-II) (Ribophorin-2) P05023 AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 (Na(+)/K(+) ATPase alpha-1 subunit) (EC 3.6.3.9) (Sodium pump subunit alpha-1) P05026 AT1B1_HUMAN Sodium/potassium-transporting ATPase subunit beta-1 (Sodium/potassium-dependent ATPase subunit beta-1) P05090 APOD_HUMAN Apolipoprotein D (Apo-D) (ApoD) P05091 ALDH2_HUMAN Aldehyde dehydrogenase, mitochondria! (EC 1.2.1.3) (ALDH class 2) (ALDH-E2) (ALDHI) P05155 IC1_HUMAN Plasma protease C1 inhibitor (C1 Inh) (C1Inh) (C1 esterase inhibitor) (C1-inhibiting factor) (Serpin G1) P05165 PCCA_HUMAN Propionyl-CoA carboxylase alpha chain, mitochondrial (PCCase subunit alpha) (EC 6.4.1.3) (Propanoyl-CoA:carbon dioxide ligase subunit alpha) P05166 PCCB_HUMAN Propionyl-CoA carboxylase beta chain, mitochondrial (PCCase subunit beta) (EC 6.4.1.3) (Propanoyl-CoA:carbon dioxide ligase subunit beta) P05198 IF2A_HUMAN Eukaryotic translation initiation factor 2 subunit 1 (Eukaryotic translation initiation factor 2 subunit alpha) (eIF-2-alpha) (eIF-2A) (eIF-2alpha) P05387 RLA2_HUMAN 605 acidic ribosomal protein P2 (Renal carcinoma antigen NY-REN-44) P05388 RLAO_HUMAN 60S acidic ribosomal protein PO (60S ribosomal protein L10E) P05413 FABPH_HUMAN Fatty acid-binding protein, heart (Fatty acid-binding protein 3) (Heart-type fatty acid-binding protein) (H-FABP) (Mammary-derived growth inhibitor) (MDGI) (Muscle fatty acid-binding protein) (M-FABP) P05455 LA_HUMAN Lupus La protein (La autoantigen) (La ribonucleoprotein) (Sjoegren syndrome type B antigen) (SS-B) P05556 ITB1_HUMAN Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein 11a) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29) P05976 MYL1_HUMAN Myosin light chain 1/3, skeletal muscle isoform (MLC1/MLC3) (MLC1F/MLC3F) (Myosin light chain alkali 1/2) (Myosin light chain A1/A2) P06319 LV605_HUMAN Ig lambda chain V-VI region EB4 P06396 GELS_HUMAN Gelsolin (AGEL) (Actin-depolymerizing factor) (ADF) (Brevin) P06576 ATPB_HUMAN ATP synthase subunit beta, mitochondrial (EC
3.6.3.14) P06681 CO2_HUMAN Complement C2 (EC 3.4.21.43) (C3/C5 convertase) [Cleaved into:
Complement C2b fragment; Complement C2a fragment]
P06702 S10A9_HUMAN Protein 5100-A9 (Calgranulin-B) (Calprotectin L1H
subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9) P06730 IF4E_HUMAN Eukaryotic translation initiation factor 4E (eIF-4E) (e1F4E) (eIF-4F 25 kDa subunit) (mRNA cap-binding protein) P06732 KCRM_HUMAN Creatine kinase M-type (EC 2.7.3.2) (Creatine kinase M
chain) (M-CK) [Cleaved into: Creatine kinase M-type, N-terminally processed]

P06733 ENOA_HUMAN Alpha-enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (C-myc promoter-binding protein) (Enolase 1) (MBP-1) (MPB-1) (Non-neural enolase) (NNE) (Phosphopyruvate hydratase) (Plasminogen-binding protein) P06737 PYGL_HUMAN Glycogen phosphorylase, liver form (EC 2.4.1.1) P06744 G6PI_HUMAN Glucose-6-phosphate isomerase (GPI) (EC 5.3.1.9) (Autocrine motility factor) (AMF) (Neuroleukin) (NLK) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Sperm antigen 36) (SA-36) P06748 NPM_HUMAN Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein N038) (Numatrin) P06753 TPM3_HUMAN Tropomyosin alpha-3 chain (Gamma-tropomyosin) (Tropomyosin-3) (Tropomyosin-5) (hTM5) P06899 H2B1J_HUMAN Histone H2B type 1-J (Histone H2B.1) (Histone H2B.r) (H2B/r) P07099 HYEP_HUMAN Epoxide hydrolase 1 (EC 3.3.2.9) (Epoxide hydratase) (Microsomal epoxide hydrolase) P07108 ACBP_HUMAN Acyl-CoA-binding protein (ACBP) (Diazepam-binding inhibitor) (DBI) (Endozepine) (EP) P07195 LDHB_HUMAN L-lactate dehydrogenase B chain (LDH-B) (EC 1.1.1.27) (LDH heart subunit) (LDH-H) (Renal carcinoma antigen NY-REN-46) P07203 GPX1_HUMAN Glutathione peroxidase 1 (GPx-1) (GSHPx-1) (EC
1.11.1.9) (Cellular glutathione peroxidase) P07237 PDIA1_HUMAN Protein disulfide-isomerase (PDI) (EC 5.3.4.1) (Cellular thyroid hormone-binding protein) (Prolyl 4-hydroxylase subunit beta) (p55) P07305 H10_HUMAN Histone H1.0 (Histone H1') (Histone H1(0)) [Cleaved into: Histone H1.0, N-terminally processed]
P07339 CATD_HUMAN Cathepsin D (EC 3.4.23.5) [Cleaved into: Cathepsin D
light chain;
Cathepsin D heavy chain]
P07355 ANXA2_HUMAN Annexin A2 (Annexin II) (Annexin-2) (Calpactin I
heavy chain) (Calpactin-1 heavy chain) (Chromobindin-8) (Lipocortin II) (Placental anticoagulant protein IV) (PAP-IV) (Protein I) (p36) P07384 CAN1_HUMAN Calpain-1 catalytic subunit (EC 3.4.22.52) (Calcium-activated neutral proteinase 1) (CANP 1) (Calpain mu-type) (Calpain-1 large subunit) (Cell proliferation-inducing gene 30 protein) (Micromolar-calpain) (muCANP) P07437 TBEIS_HUMAN Tubulin beta chain (Tubulin beta-5 chain) P07451 CAH3_HUMAN Carbonic anhydrase 3 (EC 4.2.1.1) (Carbonate dehydratase III) (Carbonic anhydrase III) (CA-Ill) P07585 PGS2_HUMAN Decorin (Bone proteoglycan II) (PG-S2) (PG40) P07737 PROF1_HUMAN Profilin-1 (Epididymis tissue protein Li 184a) (Profilin I) P07814 SYEP_HUMAN Bifunctional glutamate/proline-ARNA ligase (Bifunctional aminoacyl-tRNA synthetase) (Cell proliferation-inducing gene 32 protein) (Glutamatyl-prolyl-tRNA synthetase) [Includes: Glutamate--tRNA ligase (EC 6.1.1.17) (Glutamyl-tRNA synthetase) (GluRS); Proline--tRNA ligase (EC 6.1.1.15) (Prolyl-tRNA synthetase)]
P07900 HS90A_HUMAN Heat shock protein HSP 90-alpha (Heat shock 86 kDa) (HSP 86) (HSP86) (Renal carcinoma antigen NY-REN-38) P07942 LAMB1_HUMAN Laminin subunit beta-1 (Laminin B1 chain) (Laminin-1 subunit beta) (Laminin-10 subunit beta) (Laminin-12 subunit beta) (Laminin-2 subunit beta) (Laminin-6 subunit beta) (Laminin-8 subunit beta) P07951 TPM2_HUMAN Tropomyosin beta chain (Beta-tropomyosin) (Tropomyosin-2) P07954 FUMH_HUMAN Fumarate hydratase, mitochondrial (Fumarase) (EC
4.2.1.2) P08107 HSP71_HUMAN Heat shock 70 kDa protein 1A/1B (Heat shock 70 kDa protein 1/2) (HSP70-1/HSP70-2) (HSP70.1/HSP70.2) P08123 C01A2_HUMAN Collagen alpha-2(I) chain (Alpha-2 type I collagen) P08133 ANXA6_HUMAN Annexin A6 (67 kDa calelectrin) (Annexin VI) (Annexin-6) (Calphobindin-II) (CPB-II) (Chromobindin-20) (Lipocortin VI) (Protein III) (p68) (p70) P08237 K6PF_HUMAN 6-phosphofructokinase, muscle type (EC 2.7.1.11) (Phosphofructo-1-kinase isozyme A) (PFK-A) (Phosphofructokinase-M) (Phosphofructokinase 1) (Phosphohexokinase) P08238 HS90B_HUMAN Heat shock protein HSP 90-beta (HSP 90) (Heat shock 84 kDa) (HSP 84) (HSP84) P08240 SRPR_HUMAN Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha) P08559 ODPA_HUMAN Pyruvate dehydrogenase El component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I) P08574 CY1_HUMAN Cytochrome c1, heme protein, mitochondrial (Complex III subunit 4) (Complex III subunit IV) (Cytochrome b-c1 complex subunit 4) (Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit) (Cytochrome c-1) P08590 MYL3_HUMAN Myosin light chain 3 (Cardiac myosin light chain 1) (CMLC1) (Myosin light chain 1, slow-twitch muscle B/ventricular isoform) (MLC1SB) (Ventricular/slow twitch myosin alkali light chain) P08603 CFAH_HUMAN Complement factor H (H factor 1) P08670 VIME_HUMAN Vimentin P08697 A2AP_HUMAN Alpha-2-antiplasmin (Alpha-2-AP) (Alpha-2-plasmin inhibitor) (Alpha-2-PI) (Serpin F2) P08758 ANXAS_HUMAN Annexin A5 (Anchorin CII) (Annexin V) (Annexin-5) (Calphobindin I) (CBP-I) (Endonexin II) (Lipocortin V) (Placental anticoagulant protein 4) (PP4) (Placental anticoagulant protein I) (PAP-I) (Thromboplastin inhibitor) (Vascular anticoagulant-alpha) (VAC-alpha) P08779 K1C16_HUMAN Keratin, type I cytoskeletal 16 (Cytokeratin-16) (CK-16) (Keratin-16) (K16) P08865 RSSA_HUMAN 40S ribosomal protein SA (37 kDa laminin receptor precursor) (37LRP) (37/67 kDa laminin receptor) (LRP/LR) (67 kDa laminin receptor) (67LR) (Colon carcinoma laminin-binding protein) (Laminin receptor 1) (LamR) (Laminin-binding protein precursor p40) (LBP/p40) (Multidrug resistance-associated protein MGr1-Ag) (NEM/1CHD4) P09104 ENOG_HUMAN Gamma-enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-Iyase) (Enolase 2) (Neural enolase) (Neuron-specific enolase) (NSE) P09211 GSTP1_HUMAN Glutathione S-transferase P (EC 2.5.1.18) (GST class-pi) (GSTP1-1) P09382 LEG1_HUMAN Galectin-1 (Gal-1) (14 kDa laminin-binding protein) (HLBP14) (14 kDa lectin) (Beta-galactoside-binding lectin L-14-1) (Galaptin) (HBL) (HPL) (Lactose-binding lectin 1) (Lectin galactoside-binding soluble 1) (Putative MAPK-activating protein PM12) (S-Lac lectin 1) P09417 DHPR_HUMAN Dihydropteridine reductase (EC 1.5.1.34) (HDHPR) (Quinoid dihydropteridine reductase) P09429 HMGBl_HUMAN High mobility group protein B1 (High mobility group protein 1) (HMG-1) P09488 GSTMl_HUMAN Glutathione S-transferase Mu 1 (EC 2.5.1.18) (GST HB
subunit 4) (GST
class-mu 1) (GSTM1-1) (GSTMla-la) (GSTM1b-lb) (GTH4) P09493 TPMl_HUMAN Tropomyosin alpha-1 chain (Alpha-tropomyosin) (Tropomyosin-1) P09525 ANXA4_HUMAN Annexin A4 (35-beta calcimedin) (Annexin IV) (Annexin-4) (Carbohydrate-binding protein p33/p41) (Chromobindin-4) (Endonexin I) (Lipocortin IV) (P32.5) (PP4-X) (Placental anticoagulant protein II) (PAP-II) (Protein II) P09622 DLDH_HUMAN Dihydrolipoyl dehydrogenase, mitochondrial (EC
1.8.1.4) (Dihydrolipoamide dehydrogenase) (Glycine cleavage system L
protein) P09651 ROAl_HUMAN Heterogeneous nuclear ribonucleoprotein Al (hnRNP Al) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein Al) P09871 C1S_HUMAN Complement Cls subcomponent (EC 3.4.21.42) (Cl esterase) (Complement component 1 subcomponent s) [Cleaved into:
Complement Cls subcomponent heavy chain; Complement Cls subcomponent light chain]
P09874 PARPl_HUMAN Poly [ADP-ribose] polymerase 1 (PARP-1) (EC 2.4.2.30) (ADP-ribosyltransferase diphtheria toxin-like 1) (ARTD1) (NAD(+) ADP-ribosyltransferase 1) (ADPRT 1) (Poly[ADP-ribose] synthase 1) P09936 UCHLl_HUMAN Ubiquitin carboxyl-terminal hydrolase isozyme Ll (UCH-L1) (EC
3.4.19.12) (EC 6.-.-.-) (Neuron cytoplasmic protein 9.5) (PGP 9.5) (PG P9.5) (Ubiquitin thioesterase L1) P09960 LKHA4_HUMAN Leukotriene A-4 hydrolase (LTA-4 hydrolase) (EC
3.3.2.6) (Leukotriene A(4) hydrolase) P09972 ALDOC_HUMAN Fructose-bisphosphate aldolase C (EC 4.1.2.13) (Brain-type aldolase) POCOL4 CO4A_HUMAN Complement C4-A (Acidic complement C4) (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2) [Cleaved into:
Complement C4 beta chain; Complement C4-A alpha chain; C4a anaphylatoxin; C4b-A; C4d-A; Complement C4 gamma chain]
POCOL5 CO4B_HUMAN Complement C4-B (Basic complement C4) (C3 and PZP-Iike alpha-2-macroglobulin domain-containing protein 3) [Cleaved into:
Complement C4 beta chain; Complement C4-B alpha chain; C4a anaphylatoxin; C4b-B; C4d-B; Complement C4 gamma chain]
POCGO5 LAC2_HUMAN Ig lambda-2 chain C regions POCG48 UBC_HUMAN Polyubiquitin-C [Cleaved into: Ubiquitin]
POCW22 RS17L_HUMAN 405 ribosomal protein 517-like P10301 RRAS_HUMAN Ras-related protein R-Ras (p23) P10412 H14_HUMAN Histone H1.4 (Histone Hlb) (Histone Hls-4) P10515 0DP2_HUMAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (EC 2.3.1.12) (70 kDa mitochondrial autoantigen of primary biliary cirrhosis) (PBC) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex) (M2 antigen complex 70 kDa subunit) (Pyruvate dehydrogenase complex component E2) (PDC-E2) (PDCE2) P10599 THIO_HUMAN Thioredoxin (Trx) (ATL-derived factor) (ADF) (Surface-associated sulphydryl protein) (SASP) P10606 COX5B_HUMAN Cytochrome c oxidase subunit 58, mitochondria!
(Cytochrome c oxidase polypeptide Vb) P10636 TAU_HUMAN Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau) P10644 KAPO_HUMAN cAMP-dependent protein kinase type I-alpha regulatory subunit (Tissue-specific extinguisher 1) (TSE1) [Cleaved into: cAMP-dependent protein kinase type I-alpha regulatory subunit, N-terminally processed]
P10809 CH6O_HUMAN 60 kDa heat shock protein, mitochondrial (60 kDa chaperonin) (Chaperonin 60) (CPN60) (Heat shock protein 60) (HSP-60) (Hsp60) (HuCHA60) (Mitochondrial matrix protein P1) (P60 lymphocyte protein) P10916 MLRV_HUMAN Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MLC-2) (MLC-2v) P11021 GRP78_HUMAN 78 kDa glucose-regulated protein (GRP-78) (Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78) (Heat shock 70 kDa protein 5) (Immunoglobulin heavy chain-binding protein) (BiP) P11047 LAMCl_HUMAN Laminin subunit gamma-1 (Laminin 82 chain) (Laminin-1 subunit gamma) (Laminin-10 subunit gamma) (Laminin-11 subunit gamma) (Laminin-2 subunit gamma) (Laminin-3 subunit gamma) (Laminin-4 subunit gamma) (Laminin-6 subunit gamma) (Laminin-7 subunit gamma) (Laminin-8 subunit gamma) (Laminin-9 subunit gamma) (S-laminin subunit gamma) (S-LAM gamma) P11055 MYH3_HUMAN Myosin-3 (Muscle embryonic myosin heavy chain) (Myosin heavy chain 3) (Myosin heavy chain, fast skeletal muscle, embryonic) (SMHCE) P11142 HSP7C_HUMAN Heat shock cognate 71 kDa protein (Heat shock 70 kDa protein 8) P11177 ODPB_HUMAN Pyruvate dehydrogenase El component subunit beta, mitochondria!
(PDHE1-B) (EC 1.2.4.1) P11182 ODB2_HUMAN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondria! (EC 2.3.1.168) (Branched-chain alpha-keto acid dehydrogenase complex component E2) (BCKAD-E2) (BCKADE2) (Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex) (Dihydrolipoamide branched chain transacylase) (Dihydrolipoyllysine-residue (2-methylpropanoyptransferase) P11217 PYGM_HUMAN Glycogen phosphorylase, muscle form (EC 2.4.1.1) (Myophosphorylase) P11277 SPTBl_HUMAN Spectrin beta chain, erythrocytic (Beta-I spectrin) P11279 LAMPl_HUMAN Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a) P11310 ACADM_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondria!
(MCAD) (EC 1.3.8.7) P11413 G6PD _HUMAN Glucose-6-phosphate 1-dehydrogenase (G6PD) (EC
1.1.1.49) P11498 PYC_HUMAN Pyruvate carboxylase, mitochondria! (EC 6.4.1.1) (Pyruvic carboxylase) (PCB) P11532 DMD_HUMAN Dystrophin P11586 C1TC_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic (Cl-THF
synthase) [Cleaved into: C-1-tetrahydrofolate synthase, cytoplasmic, N-terminally processed] [Includes: Methylenetetrahydrofolate dehydrogenase (EC
1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9);
Formyltetrahydrofolate synthetase (EC 6.3.4.3)]
P11766 ADHX_HUMAN Alcohol dehydrogenase class-3 (EC 1.1.1.1) (Alcohol dehydrogenase 5) (Alcohol dehydrogenase class chi chain) (Alcohol dehydrogenase class-III) (Glutathione-dependent formaldehyde dehydrogenase) (FALDH) (FDH) (GSH-FDH) (EC 1.1.1.-) (S-(hydroxymethyl)glutathione dehydrogenase) (EC 1.1.1.284) P11940 PABPl_HUMAN Polyadenylate-binding protein 1 (PABP-1) (Poly(A)-binding protein 1) P12081 SYHC_HUMAN Histidine--tRNA ligase, cytoplasmic (EC 6.1.1.21) (Histidyl-tRNA
synthetase) (HisRS) P12109 C06A1_HUMAN Collagen alpha-1(VI) chain P12110 C06A2_HUMAN Collagen alpha-2(VI) chain P12111 C06A3_HUMAN Collagen alpha-3(VI) chain P12235 ADTl_HUMAN ADP/ATP translocase 1 (ADP,ATP carrier protein 1) (ADP,ATP carrier protein, heart/skeletal muscle isoform Ti) (Adenine nucleotide translocator 1) (ANT 1) (Solute carrier family 25 member 4) P12268 IMDH2_HUMAN Inosine-5'-monophosphate dehydrogenase 2 (IMP
dehydrogenase 2) (IMPD 2) (IMPDH 2) (EC 1.1.1.205) (IMPDH-II) P12270 TPR_HUMAN Nucleoprotein TPR (Megator) (NPC-associated intranuclear protein) (Translocated promoter region protein) P12277 KCRB_HUMAN Creatine kinase B-type (EC 2.7.3.2) (B-CK) (Creatine kinase B chain) P12694 ODBA_HUMAN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial (EC
1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase El component alpha chain) (BCKDE1A) (BCKDH El-alpha) P12814 ACTNl_HUMAN Alpha-actinin-1 (Alpha-actinin cytoskeletal isoform) (F-actin cross-linking protein) (Non-muscle alpha-actinin-1) P12882 MYHl_HUMAN Myosin-1 (Myosin heavy chain 1) (Myosin heavy chain 2x) (MyHC-2x) (Myosin heavy chain Ilx/d) (MyHC-1Ix/d) (Myosin heavy chain, skeletal muscle, adult 1) P12883 MYH7_HUMAN Myosin-7 (Myosin heavy chain 7) (Myosin heavy chain slow isoform) (MyHC-slow) (Myosin heavy chain, cardiac muscle beta isoform) (MyHC-beta) P12956 XRCC6_HUMAN X-ray repair cross-complementing protein 6 (EC 3.6.4.-) (EC 4.2.99.-) (5'-deoxyribose-5-phosphate lyase Ku70) (5'-dRP lyase Ku70) (70 kDa subunit of Ku antigen) (ATP-dependent DNA helicase 2 subunit 1) (ATP-dependent DNA helicase II 70 kDa subunit) (CTC box-binding factor 75 kDa subunit) (CTC75) (CTCBF) (DNA repair protein XRCC6) (Lupus Ku autoantigen protein p70) (Ku70) (Thyroid-lupus autoantigen) (TLAA) (X-ray repair complementing defective repair in Chinese hamster cells 6) P13010 XRCC5_HUMAN X-ray repair cross-complementing protein 5 (EC 3.6.4.-) (86 kDa subunit of Ku antigen) (ATP-dependent DNA helicase 2 subunit 2) (ATP-dependent DNA helicase II 80 kDa subunit) (CTC box-binding factor 85 kDa subunit) (CTC85) (CTCBF) (DNA repair protein XRCC5) (Ku80) (Ku86) (Lupus Ku autoantigen protein p86) (Nuclear factor IV) (Thyroid-lupus autoantigen) (TLAA) (X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)) P13073 C0X41_HUMAN Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (Cytochrome c oxidase polypeptide IV) (Cytochrome c oxidase subunit IV isoform 1) (COX IV-1) P13533 MYH6_HUMAN Myosin-6 (Myosin heavy chain 6) (Myosin heavy chain, cardiac muscle alpha isoform) (MyHC-alpha) P13535 MYH8_HUMAN Myosin-8 (Myosin heavy chain 8) (Myosin heavy chain, skeletal muscle, perinatal) (MyHC-perinatal) P13639 EF2_HUMAN Elongation factor 2 (EF-2) P13645 K1C10_HUMAN Keratin, type I cytoskeletal 10 (Cytokeratin-10) (CK-

10) (Keratin-10) (K10) P13646 K1C13_HUMAN Keratin, type I cytoskeletal 13 (Cytokeratin-13) (CK-13) (Keratin-13) (K13) P13647 K2C5_HUMAN Keratin, type II cytoskeletal 5 (58 kDa cytokeratin) (Cytokeratin-5) (CK-5) (Keratin-5) (K5) (Type-II keratin Kb5) P13667 PDIA4_HUMAN Protein disulfide-isomerase A4 (EC 5.3.4.1) (Endoplasmic reticulum resident protein 70) (ER protein 70) (ERp70) (Endoplasmic reticulum resident protein 72) (ER protein 72) (ERp-72) (ERp72) P13693 TCTP_HUMAN Translationally-controlled tumor protein (TCTP) (Fortilin) (Histamine-releasing factor) (HRF) (p23) P13716 HEM2_HUMAN Delta-aminolevulinic acid dehydratase (ALADH) (EC
4.2.1.24) (Porphobilinogen synthase) P13796 PLSL_HUMAN Plastin-2 (L-plastin) (LC64P) (Lymphocyte cytosolic protein 1) (LCP-1) P13797 PLST_HUMAN Plastin-3 (T-plastin) P13798 ACPH_HUMAN Acylamino-acid-releasing enzyme (AARE) (EC 3.4.19.1) (Acyl-peptide hydrolase) (APH) (Acylaminoacyl-peptidase) (Oxidized protein hydrolase) (OPH) P13804 ETFA_HUMAN Electron transfer flavoprotein subunit alpha, mitochondria! (Alpha-ETF) P13805 TNNT1_HUMAN Troponin T, slow skeletal muscle (TnTs) (Slow skeletal muscle troponin T) (sTnT) P13807 GYS1_HUMAN Glycogen [starch] synthase, muscle (EC 2.4.1.11) P13861 KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit P13929 ENOB_HUMAN Beta-enolase (EC 4.2.1.11) (2-phospho-D-glycerate hydro-lyase) (Enolase 3) (Muscle-specific enolase) (MSE) (Skeletal muscle enolase) P14314 GLU2B_HUMAN Glucosidase 2 subunit beta (80K-H protein) (Glucosidase II subunit beta) (Protein kinase C substrate 60.1 kDa protein heavy chain) (PKCSH) P14324 FPPS_HUMAN Farnesyl pyrophosphate synthase (FPP synthase) (FPS) (EC 2.5.1.10) ((2E,6E)-farnesyl diphosphate synthase) (Dimethylallyltranstransferase) (EC 2.5.1.1) (Farnesyl diphosphate synthase) (Geranyltranstransferase) P14415 AT1B2_HUMAN Sodium/potassium-transporting ATPase subunit beta-2 (Adhesion molecule in glia) (AMOG) (Sodium/potassium-dependent ATPase subunit beta-2) P14550 AK1A1_HUMAN Alcohol dehydrogenase (NADP(+)] (EC 1.1.1.2) (Aldehyde reductase) (Aldo-keto reductase family 1 member Al) P14618 KPYM_HUMAN Pyruvate kinase PKM (EC 2.7.1.40) (Cytosolic thyroid hormone-binding protein) (CTHBP) (Opa-interacting protein 3) (01P-3) (Pyruvate kinase 2/3) (Pyruvate kinase muscle isozyme) (Thyroid hormone-binding protein 1) (THBP1) (Tumor M2-PK) (p58) P14621 ACYP2_HUMAN Acylphosphatase-2 (EC 3.6.1.7) (Acylphosphatase, muscle type isozyme) (Acylphosphate phosphohydrolase 2) P14625 ENPL_HUMAN Endoplasmin (94 kDa glucose-regulated protein) (GRP-94) (Heat shock protein 90 kDa beta member 1) (Tumor rejection antigen 1) (gp96 homolog) P14649 MYL6B_HUMAN Myosin light chain 6B (Myosin light chain 1 slow-twitch muscle A
isoform) (MLC1sa) (Smooth muscle and nonmuscle myosin light chain alkali 6B) P14735 IDE_HUMAN Insulin-degrading enzyme (EC 3.4.24.56) (Abeta-degrading protease) (Insulin protease) (Insulinase) (Insulysin) P14866 HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L (hnRNP L) P14868 SYDC_HUMAN Aspartate--tRNA ligase, cytoplasmic (EC 6.1.1.12) (Aspartyl-tRNA
synthetase) (AspRS) (Cell proliferation-inducing gene 40 protein) P14923 PLAK_HUMAN Junction plakoglobin (Catenin gamma) (Desmoplakin111) (Desmoplakin-3) P14927 QCR7_HUMAN Cytochrome b-cl complex subunit 7 (Complex III subunit 7) (Complex III subunit VII) (QP-C) (Ubiquinol-cytochrome c reductase complex 14 kDa protein) P15090 FABP4_HUMAN Fatty acid-binding protein, adipocyte (Adipocyte lipid-binding protein) (ALBP) (Adipocyte-type fatty acid-binding protein) (A-FABP) (AFABP) (Fatty acid-binding protein 4) P15121 ALDR_HUMAN Aldose reductase (AR) (EC 1.1.1.21) (Aldehyde reductase) (Aldo-keto reductase family 1 member B1) P15144 AMPN_HUMAN Aminopeptidase N (AP-N) (hAPN) (EC 3.4.11.2) (Alanyl aminopeptidase) (Aminopeptidase M) (AP-M) (Microsomal aminopeptidase) (Myeloid plasma membrane glycoprotein CD13) (gp150) (CD antigen CD13) P15170 ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
(Eukaryotic peptide chain release factor subunit 3a) (eRF3a) (G1 to S
phase transition protein 1 homolog) P15259 PGAM2_HUMAN Phosphoglycerate mutase 2 (EC 3.1.3.13) (EC 5.4.2.1) (EC 5.4.2.4) (BPG-dependent PGAM 2) (Muscle-specific phosphoglycerate mutase) (Phosphoglycerate mutase isozyme M) (PGAM-M) P15374 UCHL3_HUMAN Ubiquitin carboxyl-terminal hydrolase isozyme L3 (UCH-L3) (EC
3.4.19.12) (Ubiquitin thioesterase L3) P15531 NDKA_HUMAN Nucleoside diphosphate kinase A (NDK A) (NDP kinase A) (EC 2.7.4.6) (Granzyme A-activated DNase) (GAAD) (Metastasis inhibition factor nm23) (Tumor metastatic process-associated protein) (nm23-H1) P15880 RS2_HUMAN 405 ribosomal protein S2 (405 ribosomal protein 54) (Protein LLRep3) P15924 DESP_HUMAN Desmoplakin (DP) (250/210 kDa paraneoplastic pemphigus antigen) P16083 NQ02_HUMAN Ribosyldihydronicotinamide dehydrogenase [quinone] (EC
1.10.99.2) (NRH dehydrogenase [quinone] 2) (NRH:quinone oxidoreductase 2) (Quinone reductase 2) (QR2) P16152 CBR1_HUMAN Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (15-hydroxyprostaglandin dehydrogenase [NADP(+)]) (EC 1.1.1.197) (NADPH-dependent carbonyl reductase 1) (Prostaglandin 9-ketoreductase) (Prostaglandin-E(2) 9-reductase) (EC 1.1.1.189) P16157 ANK1_HUMAN Ankyrin-1 (ANK-1) (Ankyrin-R) (Erythrocyte ankyrin) P16219 ACADS_HUMAN Short-chain specific acyl-CoA dehydrogenase, mitochondrial (SCAD) (EC 1.3.8.1) (Butyryl-CoA dehydrogenase) P16284 PECA1_HUMAN Platelet endothelial cell adhesion molecule (PECAM-1) (EndoCAM) (GPIIA') (PECA1) (CD antigen CD31) P16298 PP2BB_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit beta isoform) P16401 H15_HUMAN Histone H1.5 (Histone H1a) (Histone H1b) (Histone His-3) P16403 H12_HUMAN Histone H1.2 (Histone H1c) (Histone Hid) (Histone His-1) P16615 AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) (SR
Ca(2+)-ATPase 2) (EC 3.6.3.8) (Calcium pump 2) (Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform) (Endoplasmic reticulum class 1/2 Ca(2+) ATPase) P16671 CD36_HUMAN Platelet glycoprotein 4 (Fatty acid translocase) (FAT) (GlycoproteinIllb) (GPIIIB) (Leukocyte differentiation antigen CD36) (PAS IV) (PAS-4) (Platelet collagen receptor) (Platelet glycoprotein IV) (GPIV) (Thrombospondin receptor) (CD antigen CD36) P16930 FAAA_HUMAN Fumarylacetoacetase (FAA) (EC 3.7.1.2) (Beta-diketonase) (Fumarylacetoacetate hydrolase) P16989 YBOX3_HUMAN Y-box-binding protein 3 (Cold shock domain-containing protein A) (DNA-binding protein A) (Single-strand DNA-binding protein NF-GMB) P17174 AATC_HUMAN Aspartate aminotransferase, cytoplasmic (cAspAT) (EC
2.6.1.1) (EC
2.6.1.3) (Cysteine aminotransferase, cytoplasmic) (Cysteine transaminase, cytoplasmic) (cCAT) (Glutamate oxaloacetate transaminase 1) (Transaminase A) P17540 KCRS_HUMAN Creatine kinase S-type, mitochondria! (EC 2.7.3.2) (Basic-type mitochondrial creatine kinase) (Mib-CK) (Sarcomeric mitochondrial creatine kinase) (S-MtCK) P17612 KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha (PKA C-alpha) (EC 2.7.11.11) P17655 CAN2_HUMAN Calpain-2 catalytic subunit (EC 3.4.22.53) (Calcium-activated neutral proteinase 2) (CANP 2) (Calpain M-type) (Calpain large polypeptide L2) (Calpain-2 large subunit) (Millimolar-calpain) (M-calpain) P17661 DESM_HUMAN Desmin P17980 PRS6A_HUMAN 26S protease regulatory subunit 6A (265 proteasome AAA-ATPase subunit RPT5) (Proteasome 265 subunit ATPase 3) (Proteasome subunit P50) (Tat-binding protein 1) (TBP-1) P17987 TCPA_HUMAN T-complex protein 1 subunit alpha (TCP-1-alpha) (CCT-alpha) P18206 VINC_HUMAN Vinculin (Metavinculin) (MV) P18621 RL17_HUMAN 60S ribosomal protein L17 (60S ribosomal protein L23) (PD-1) P18669 PGAM1_HUMAN Phosphoglycerate mutase 1 (EC 3.1.3.13) (EC 5.4.2.1) (EC 5.4.2.4) (BPG-dependent PGAM 1) (Phosphoglycerate mutase isozyme B) (PGAM-B) P19013 K2C4_HUMAN Keratin, type II cytoskeletal 4 (Cytokeratin-4) (CK-4) (Keratin-4) (K4) (Type-II keratin Kb4) P19338 NUCL_HUMAN Nucleolin (Protein C23) P19367 HXK1_HUMAN Hexokinase-1 (EC 2.7.1.1) (Brain form hexokinase) (Hexokinase type I) (HK I) P19404 NDUV2_HUMAN NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial (EC
1.6.5.3) (EC 1.6.99.3) (NADH-ubiquinone oxidoreductase 24 kDa subunit) P19823 ITIH2_HUMAN Inter-alpha-trypsin inhibitor heavy chain H2 (ITI
heavy chain H2) (ITI-HC2) (Inter-alpha-inhibitor heavy chain 2) (Inter-alpha-trypsin inhibitor complex component II) (Serum-derived hyaluronan-associated protein) (SHAP) P20042 IF2B_HUMAN Eukaryotic translation initiation factor 2 subunit 2 (Eukaryotic translation initiation factor 2 subunit beta) (eIF-2-beta) P20073 ANXA7_HUMAN Annexin A7 (Annexin VII) (Annexin-7) (Synexin) P20339 RAB5A_HUMAN Ras-related protein Rab-5A
P20472 PRVA_HUMAN Parvalbumin alpha P20674 COX5A_HUMAN Cytochrome c oxidase subunit 5A, mitochondria!
(Cytochrome c oxidase polypeptide Va) P20700 LMNB1_HUMAN Lamin-B1 P20774 MIME_HUMAN Mimecan (Osteoglycin) (Osteoinductive factor) (01F) P20807 CAN3_HUMAN Calpain-3 (EC 3.4.22.54) (Calcium-activated neutral proteinase 3) (CANP 3) (Calpain L3) (Calpain p94) (Muscle-specific calcium-activated neutral protease 3) (New calpain 1) (nCL-1) P20929 NEBU_HUMAN Nebulin P21266 GSTM3_HUMAN Glutathione S-transferase Mu 3 (EC 2.5.1.18) (GST
class-mu 3) (GSTM3-3) (hGSTM3-3) P21281 VATB2_HUMAN V-type proton ATPase subunit B, brain isoform (V-ATPase subunit B 2) (Endomembrane proton pump 58 kDa subunit) (H057) (Vacuolar proton pump subunit B 2) P21291 CSRP1_HUMAN Cysteine and glycine-rich protein 1 (Cysteine-rich protein 1) (CRP) (CRP1) P21333 FLNA_HUMAN Filamin-A (FLN-A) (Actin-binding protein 280) (ABP-280) (Alpha-filamin) (Endothelial actin-binding protein) (Filamin-1) (Non-muscle filamin) P21399 ACOC_HUMAN Cytoplasmic aconitate hydratase (Aconitase) (EC
4.2.1.3) (Citrate hydro-lyase) (Ferritin repressor protein) (Iron regulatory protein 1) (IRP1) (Iron-responsive element-binding protein 1) (IRE-BP 1) P21695 GPDA_HUMAN Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic (G PD-C) (GPDH-C) (EC 1.1.1.8) P21796 VDAC1_HUMAN Voltage-dependent anion-selective channel protein 1 (VDAC-1) (hVDAC1) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin) (Porin 31HL) (Porin 31HM) P21810 PGS1_HUMAN Biglycan (Bone/cartilage proteoglycan I) (PG-S1) P21817 RYR1_HUMAN Ryanodine receptor 1 (RYR-1) (RyR1) (Skeletal muscle calcium release channel) (Skeletal muscle ryanodine receptor) (Skeletal muscle-type ryanodine receptor) (Type 1 ryanodine receptor) P21912 DHSB_HUMAN Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondria! (EC 1.3.5.1) (Iron-sulfur subunit of complex II) (Ip) P21980 TGM2_HUMAN Protein-glutamine gamma-glutamyltransferase 2 (EC
2.3.2.13) (Tissue transglutaminase) (Transglutaminase C) (TG(C)) (TGC) (TGase C) (Transglutaminase H) (TGase H) (Transglutaminase-2) (TGase-2) P22033 MUTA_HUMAN Methylmalonyl-CoA mutase, mitochondrial (MCM) (EC
5.4.99.2) (Methylmalonyl-CoA isomerase) P22059 OSBPl_HUMAN Oxysterol-binding protein 1 P22061 PIMT_HUMAN Protein-L-isoaspartate(D-aspartate) 0-methyltransferase (P1 MT) (EC
2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) P22102 PUR2_HUMAN Trifunctional purine biosynthetic protein adenosine-3 [Includes:
Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (Glycinamide ribonucleotide synthetase) (GARS) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidine cyclo-ligase (EC
6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase); Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART)]
P22105 TENX_HUMAN Tenascin-X (TN-X) (Hexabrachion-like protein) P22234 PUR6_HUMAN Multifunctional protein ADE2 [Includes:
Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC
6.3.2.6) (SAICAR synthetase); Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21) (AIR carboxylase) (AIRC)]
P22314 UBAl_HUMAN Ubiquitin-like modifier-activating enzyme 1 (Protein A1S9) (Ubiquitin-activating enzyme El) P22392 NDKB_HUMAN Nucleoside diphosphate kinase B (NDK B) (NDP kinase B) (EC 2.7.4.6) (C-myc purine-binding transcription factor PUF) (Histidine protein kinase NDKB) (EC 2.7.13.3) (nm23-H2) P22626 ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 (hnRNP
A2/61) P22695 QCR2_HUMAN Cytochrome b-cl complex subunit 2, mitochondria!
(Complex III
subunit 2) (Core protein II) (Ubiquinol-cytochrome-c reductase complex core protein 2) P22897 MRCl_HUMAN Macrophage mannose receptor 1 (MMR) (C-type lectin domain family 13 member D) (C-type lectin domain family 13 member D-like) (Macrophage mannose receptor 1-like protein 1) (CD antigen CD206) P23109 AMPDl_HUMAN AMP deaminase 1 (EC 3.5.4.6) (AMP deaminase isoform M) (Myoadenylate deaminase) P23229 ITA6_HUMAN Integrin alpha-6 (CD49 antigen-like family member F) (VLA-6) (CD
antigen CD49f) [Cleaved into: Integrin alpha-6 heavy chain; Integrin alpha-6 light chain]
P23246 SFPQ_HUMAN Splicing factor, proline- and glutamine-rich (100 kDa DNA-pairing protein) (hPOMp100) (DNA-binding p52/p100 complex, 100 kDa subunit) (Polypyrimidine tract-binding protein-associated-splicing factor) (PSF) (PTB-associated-splicing factor) P23284 PPIB_ HUMAN Peptidyl-prolyl cis-trans isomerase B (PPlase B) (EC
5.2.1.8) (CYP-S1) (Cyclophilin B) (Rotamase B) (S-cyclophilin) (SCYLP) P23297 SlOAl_HUMAN Protein S100-Al (S-100 protein alpha chain) (S-100 protein subunit alpha) (S100 calcium-binding protein Al) P23327 SRCH_HUMAN Sarcoplasmic reticulum histidine-rich calcium-binding protein P23381 SYWC_HUMAN Tryptophan--tRNA ligase, cytoplasmic (EC 6.1.1.2) (Interferon-induced protein 53) (IFP53) (Tryptophanyl-tRNA synthetase) (TrpRS) (hWRS) [Cleaved into: Tl-TrpRS; T2-TrpRS]
P23396 RS3_HUMAN 40S ribosomal protein S3 P23526 SAHH_HUMAN Adenosylhomocysteinase (AdoHcyase) (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase) P23528 C0F1_HUMAN Cofilin-1 (18 kDa phosphoprotein) (p18) (Cofilin, non-muscle isoform) P23634 AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 (PMCA4) (EC
3.6.3.8) (Matrix-remodeling-associated protein 1) (Plasma membrane calcium ATPase isoform 4) (Plasma membrane calcium pump isoform 4) P23786 CPT2_HUMAN Carnitine 0-palmitoyltransferase 2, mitochondrial (EC
2.3.1.21) (Carnitine palmitoyltransferase II) (CPT II) P24043 LAMA2_HUMAN Laminin subunit alpha-2 (Laminin M chain) (Laminin-12 subunit alpha) (Laminin-2 subunit alpha) (Laminin-4 subunit alpha) (Merosin heavy chain) P24298 ALATl_HUMAN Alanine aminotransferase 1 (ALT1) (EC 2.6.1.2) (Glutamate pyruvate transaminase 1) (GPT 1) (Glutamic--alanine transaminase 1) (Glutamic--pyruvic transaminase 1) P24534 EF1B_HUMAN Elongation factor 1-beta (EF-1-beta) P24539 AT5F1_HUMAN ATP synthase subunit b, mitochondrial (ATPase subunit b) P24752 THIL_HUMAN Acetyl-CoA acetyltransferase, mitochondrial (EC
2.3.1.9) (Acetoacetyl-CoA thiolase) (12) P25189 MYPO_HUMAN Myelin protein PO (Myelin peripheral protein) (MPP) (Myelin protein zero) P25325 THTM_HUMAN 3-mercaptopyruvate sulfurtransferase (MST) (EC
2.8.1.2) P25705 ATPA_HUMAN ATP synthase subunit alpha, mitochondria!
P25787 PSA2_HUMAN Proteasome subunit alpha type-2 (EC 3.4.25.1) (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) (Proteasome component C3) P25788 PSA3_HUMAN Proteasome subunit alpha type-3 (EC 3.4.25.1) (Macropain subunit C8) (Multicatalytic endopeptidase complex subunit C8) (Proteasome component C8) P26038 MOES_HUMAN Moesin (Membrane-organizing extension spike protein) P26440 IVD_HUMAN Isovaleryl-CoA dehydrogenase, mitochondria! (IVD) (EC
1.3.8.4) P26599 PTBPl_HUMAN Polypyrimidine tract-binding protein 1 (PTB) (57 kDa RNA-binding protein PPTB-1) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP
I) P26639 SYTC_HUMAN Threonine--tRNA ligase, cytoplasmic (EC 6.1.1.3) (Threonyl-tRNA
synthetase) (ThrRS) P26640 SYVC_HUMAN Valine--tRNA ligase (EC 6.1.1.9) (Protein G7a) (Valyl-tRNA synthetase) (VaIRS) P26641 EF1G_HUMAN Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma) P27338 AOFB_HUMAN Amine oxidase [flavin-containing] B (EC 1.4.3.4) (Monoamine oxidase type B) (MAO-B) P27635 RL1O_HUMAN 60S ribosomal protein L10 (Laminin receptor homolog) (Protein QM) (Tumor suppressor QM) P27797 CALR_HUMAN Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) (grp60) P27816 MAP4_HUMAN Microtubule-associated protein 4 (MAP-4) P27824 CALX_HUMAN Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90) P28066 PSA5_HUMAN Proteasome subunit alpha type-5 (EC 3.4.25.1) (Macropain zeta chain) (Multicatalytic endopeptidase complex zeta chain) (Proteasome zeta chain) P28070 PSB4_HUMAN Proteasome subunit beta type-4 (EC 3.4.25.1) (26 kDa prosomal protein) (HsBPROS26) (PROS-26) (Macropain beta chain) (Multicatalytic endopeptidase complex beta chain) (Proteasome beta chain) (Proteasome chain 3) (H5N3) P28072 PSB6_HUMAN Proteasome subunit beta type-6 (EC 3.4.25.1) (Macropain delta chain) (Multicatalytic endopeptidase complex delta chain) (Proteasome delta chain) (Proteasome subunit Y) P28074 PSB5_HUMAN Proteasome subunit beta type-5 (EC 3.4.25.1) (Macropain epsilon chain) (Multicatalytic endopeptidase complex epsilon chain) (Proteasome chain 6) (Proteasome epsilon chain) (Proteasome subunit MB1) (Proteasome subunit X) P28161 GSTM2_HUMAN Glutathione S-transferase Mu 2 (EC 2.5.1.18) (GST class-mu 2) (GSTM2-2) P28289 TMODl_HUMAN Tropomodulin-1 (Erythrocyte tropomodulin) (E-Tmod) P28330 ACADL_HUMAN Long-chain specific acyl-CoA dehydrogenase, mitochondrial (LCAD) (EC
1.3.8.8) P28331 NDUSl_HUMAN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondria' (EC
1.6.5.3) (EC 1.6.99.3) (Complex I-75kD) (CI-75kD) P28838 AMPL_HUMAN Cytosol aminopeptidase (EC 3.4.11.1) (Leucine aminopeptidase 3) (LAP-3) (Leucyl aminopeptidase) (Peptidase S) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase) P29144 TPP2_HUMAN Tripeptidyl-peptidase 2 (TPP-2) (EC 3.4.14.10) (Tripeptidyl aminopeptidase) (Tripeptidyl-peptidase II) (TPP-II) P29218 IMPAl_HUMAN Inositol monophosphatase 1 (IMP 1) (IMPase 1) (EC 3.1.3.25) (Inosito1-1(or 4)-monophosphatase 1) (Lithium-sensitive myo-inositol monophosphatase Al) P29401 TKT_HUMAN Transketolase (TK) (EC 2.2.1.1) P29475 NOSl_HUMAN Nitric oxide synthase, brain (EC 1.14.13.39) (Constitutive NOS) (NC-NOS) (NOS type I) (Neuronal NOS) (N-NOS) (nNOS) (Peptidyl-cysteine S-nitrosylase NOS1) (bNOS) P29692 EF1D_HUMAN Elongation factor 1-delta (EF-1-delta) (Antigen NY-00-4) P30038 AL4A1_HUMAN Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial (P5C
dehydrogenase) (EC 1.5.1.12) (Aldehyde dehydrogenase family 4 member Al) P30040 ERP29_HUMAN Endoplasmic reticulum resident protein 29 (ERp29) (Endoplasmic reticulum resident protein 28) (ERp28) (Endoplasmic reticulum resident protein 31) (ERp31) P30041 PRDX6_HUMAN Peroxiredoxin-6 (EC 1.11.1.15) (1-Cys peroxiredoxin) (1-Cys PRX) (24 kDa protein) (Acidic calcium-independent phospholipase A2) (aiPLA2) (EC 3.1.14 (Antioxidant protein 2) (Liver 2D page spot 40) (Non-selenium glutathione peroxidase) (NSGPx) (EC 1.11.1.9) (Red blood cells page spot 12) P30042 ES1_HUMAN ES1 protein homolog, mitochondrial (Protein GT335) (Protein KNP-I) P30044 PRDX5_HUMAN Peroxiredoxin-5, mitochondrial (EC
1.11.1.15) (Alu corepressor 1) (Antioxidant enzyme 8166) (AOEB166) (Liver tissue 2D-page spot 71B) (PLP) (Peroxiredoxin V) (Prx-V) (Peroxisomal antioxidant enzyme) (TPx type VI) (Thioredoxin peroxidase PMP20) (Thioredoxin reductase) P30048 PRDX3_HUMAN Thioredoxin-dependent peroxide reductase, mitochondria! (EC
1.11.1.15) (Antioxidant protein 1) (AOP-1) (HBC189) (Peroxiredoxin III) (Prx-III) (Peroxiredoxin-3) (Protein MER5 homolog) P30049 ATPD_HUMAN ATP synthase subunit delta, mitochondrial (F-ATPase delta subunit) P30084 ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial (EC
4.2.1.17) (Enoyl-CoA
hydratase 1) (Short-chain enoyl-CoA hydratase) (SCEH) P30085 KCY_HUMAN UMP-CMP kinase (EC 2.7.4.14) (Deoxycytidylate kinase) (CK) (dCMP
kinase) (Uridine monophosphate/cytidine monophosphate kinase) (UMP/CMP kinase) (UMP/CMPK) P30086 PEBP1_HUMAN Phosphatidylethanolamine-binding protein 1 (PEBP-1) (HCNPpp) (Neuropolypeptide h3) (Prostatic-binding protein) (Rat kinase inhibitor protein) (RKIP) [Cleaved into: Hippocampal cholinergic neurostimulating peptide (HCNP)]
P30101 PDIA3_HUMAN Protein disulfide-isomerase A3 (EC 5.3.4.1) (58 kDa glucose-regulated protein) (58 kDa microsomal protein) (p58) (Disulfide isomerase ER-60) (Endoplasmic reticulum resident protein 57) (ER protein 57) (ERp57) (Endoplasmic reticulum resident protein 60) (ER protein 60) (ERp60) P30153 2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A
alpha isoform (Medium tumor antigen-associated 61 kDa protein) (PP2A subunit A isoform PR65-alpha) (PP2A subunit A isoform R1-alpha) P30419 NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97) (Myristoyl-CoA:protein N-myristoyltransferase 1) (NMT 1) (Type I N-myristoyltransferase) (Peptide N-myristoyltransferase 1) P30519 HMOX2_HUMAN Heme oxygenase 2 (H0-2) (EC 1.14.99.3) P30566 PUR8_HUMAN Adenylosuccinate lyase (ASL) (EC 4.3.2.2) (Adenylosuccinase) (ASase) P30622 CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 (Cytoplasmic linker protein 1) (Cytoplasmic linker protein 170 alpha-2) (CLIP-170) (Reed-Sternberg intermediate filament-associated protein) (Restin) P30711 GSTT1_HUMAN Glutathione S-transferase theta-1 (EC
2.5.1.18) (GST class-theta-1) (Glutathione transferase T1-1) P30837 AL1B1_HUMAN Aldehyde dehydrogenase X, mitochondrial (EC
1.2.1.3) (Aldehyde dehydrogenase 5) (Aldehyde dehydrogenase family 1 member B1) P31040 DHSA_HUMAN Succinate dehydrogenase [ubiquinone]
flavoprotein subunit, mitochondrial (EC 1.3.5.1) (Flavoprotein subunit of complex II) (Fp) P31150 GDIA_HUMAN Rab GDP dissociation inhibitor alpha (Rab GDI
alpha) (Guanosine diphosphate dissociation inhibitor 1) (GDI-1) (Oligophrenin-2) (Protein XAP-4) P31153 METK2_HUMAN S-adenosylmethionine synthase isoform type-2 (AdoMet synthase 2) (EC 2.5.1.6) (Methionine adenosyltransferase 2) (MAT 2) (Methionine adenosyltransferase II) (MAT-II) P31415 CASQl_HUMAN Calsequestrin-1 (Calmitin) (Calsequestrin, skeletal muscle isoform) P31689 DNJAl_HUMAN DnaJ homolog subfamily A member 1 (DnaJ protein homolog 2) (HSDJ) (Heat shock 40 kDa protein 4) (Heat shock protein J2) (H51-2) (Human DnaJ protein 2) (hDj-2) P31930 QCRl_HUMAN Cytochrome b-cl complex subunit 1, mitochondrial (Complex III
subunit 1) (Core protein I) (Ubiquinol-cytochrome-c reductase complex core protein 1) P31937 3HIDH_HUMAN 3-hydroxyisobutyrate dehydrogenase, mitochondrial (HIBADH) (EC
1.1.1.31) P31939 PUR9_HUMAN Bifunctional purine biosynthesis protein PURH
[Includes:
Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC
2.1.2.3) (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase) (AICAR transformylase); IMP cyclohydrolase (EC
3.5.4.10) (ATIC) (IMP synthase) (Inosinicase)]
P31943 HNRHl_HUMAN Heterogeneous nuclear ribonucleoprotein H (hnRNP H) [Cleaved into:
Heterogeneous nuclear ribonucleoprotein H, N-terminally processed]
P31946 1433B_HUMAN 14-3-3 protein beta/alpha (Protein 1054) (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein beta/alpha, N-terminally processed]
P31948 STIPl_HUMAN Stress-induced-phosphoprotein 1 (STI1) (Hsc70/Hsp90-organizing protein) (Hop) (Renal carcinoma antigen NY-REN-11) (Transformation-sensitive protein IEF SSP 3521) P31949 SlOAB_HUMAN Protein S100-A11 (Calgizzarin) (Metastatic lymph node gene 70 protein) (MLN 70) (Protein S100-C) (5100 calcium-binding protein All) P32119 PRDX2_HUMAN Peroxiredoxin-2 (EC 1.11.1.15) (Natural killer cell-enhancing factor B) (NKEF-B) (PRP) (Thiol-specific antioxidant protein) (TSA) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) P32969 RL9_HUMAN 60S ribosomal protein L9 P33121 ACSLl_HUMAN Long-chain-fatty-acid--CoA ligase 1 (EC 6.2.1.3) (Acyl-CoA synthetase 1) (ACS1) (Long-chain acyl-CoA synthetase 1) (LACS 1) (Long-chain acyl-CoA synthetase 2) (LACS 2) (Long-chain fatty acid-CoA ligase 2) (Palmitoyl-CoA ligase 1) (Palmitoyl-CoA ligase 2) P33176 KINH_HUMAN Kinesin-1 heavy chain (Conventional kinesin heavy chain) (Ubiquitous kinesin heavy chain) (UKHC) P34896 GLYC_HUMAN Serine hydroxymethyltransferase, cytosolic (SHMT) (EC
2.1.2.1) (Glycine hydroxymethyltransferase) (Serine methylase) P34897 GLYM_HUMAN Serine hydroxymethyltransferase, mitochondrial (SHMT) (EC 2.1.2.1) (Glycine hydroxymethyltransferase) (Serine methylase) P34932 H5P74_HUMAN Heat shock 70 kDa protein 4 (HSP7ORY) (Heat shock 70-related protein APG-2) P34949 MPI_HUMAN Mannose-6-phosphate isomerase (EC 5.3.1.8) (Phosphohexomutase) (Phosphomannose isomerase) (PMI) P35221 CTNAl_HUMAN Catenin alpha-1 (Alpha E-catenin) (Cadherin-associated protein) (Renal carcinoma antigen NY-REN-13) P35232 PHB_HUMAN Prohibitin P35237 SPB6_HUMAN Serpin B6 (Cytoplasmic antiproteinase) (CAP) (Peptidase inhibitor 6) (PI-6) (Placental thrombin inhibitor) P35241 RADI_HUMAN Radixin P35527 K1C9_HUMAN Keratin, type Icytoskeletal 9 (Cytokeratin-9) (CK-9) (Keratin-9) (K9) P35573 GDE_HUMAN Glycogen debranching enzyme (Glycogen debrancher) [Includes: 4-alpha-glucanotransferase (EC 2.4.1.25) (Oligo-1,4-1,4-glucantransferase); Amylo-alpha-1,6-glucosidase (Amylo-1,6-glucosidase) (EC 3.2.1.33) (Dextrin 6-alpha-D-glucosidase)]
P35579 MYH9_HUMAN Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle 11a) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain 11a) (NMMHC II-a) (NMMHC-IIA) P35606 COPB2_HUMAN Coatomer subunit beta' (Beta'-coat protein) (Beta'-COP) (p102) P35609 ACTN2_HUMAN Alpha-actinin-2 (Alpha-actinin skeletal muscle isoform 2) (F-actin cross-linking protein) P35611 ADDA_HUMAN Alpha-adducin (Erythrocyte adducin subunit alpha) P35613 BASI_HUMAN Basigin (5F7) (Collagenase stimulatory factor) (Extracellular matrix metalloproteinase inducer) (EMMPRIN) (Leukocyte activation antigen M6) (OK blood group antigen) (Tumor cell-derived collagenase stimulatory factor) (TCSF) (CD antigen CD147) P35637 FUS HUMAN RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein) P35749 MYH11_HUMAN Myosin-11 (Myosin heavy chain 11) (Myosin heavy chain, smooth muscle isoform) (SMMHC) P35813 PPM1A_HUMAN Protein phosphatase 1A (EC 3.1.3.16) (Protein phosphatase 2C isoform alpha) (PP2C-alpha) (Protein phosphatase IA) P35908 K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal (Cytokeratin-2e) (CK-2e) (Epithelial keratin-2e) (Keratin-2 epidermis) (Keratin-2e) (K2e) (Type-II
keratin Kb2) P35998 PRS7_HUMAN 26S protease regulatory subunit 7 (265 proteasome AAA-ATPase subunit RPT1) (Proteasome 26S subunit ATPase 2) (Protein MSS1) P36269 GGT5_HUMAN Gamma-glutamyltransferase 5 (GGT 5) (EC 2.3.2.2) (Gamma-glutamyl transpeptidase-related enzyme) (GGT-rel) (Gamma-glutamyltransferase-like activity 1) (Gamma-glutamyltranspeptidase 5) (Glutathione hydrolase 5) (EC 3.4.19.13) (Leukotriene-C4 hydrolase) (EC 3.4.19.14) [Cleaved into: Gamma-glutamyltransferase 5 heavy chain; Gamma-glutannyltransferase 5 light chain]
P36542 ATPG_HUMAN ATP synthase subunit gamma, mitochondria! (F-ATPase gamma subunit) P36578 RL4_HUMAN 60S ribosomal protein L4 (605 ribosomal protein L1) P36776 LONM_HUMAN Lon protease homolog, mitochondrial (EC 3.4.21.-) (LONHs) (Lon protease-like protein) (LONP) (Mitochondrial ATP-dependent protease Lon) (Serine protease 15) P36871 PGM1_HUMAN Phosphoglucomutase-1 (PGM 1) (EC 5.4.2.2) (Glucose phosphomutase 1) P36873 PP1G_HUMAN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PP-1G) (EC 3.1.3.16) (Protein phosphatase 1C catalytic subunit) P36955 PEDF_HUMAN Pigment epithelium-derived factor (PEDF) (Cell proliferation-inducing gene 35 protein) (EPC-1) (Serpin Fl) P36957 0D02_HUMAN Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (OGDC-E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (E2K) P36959 GMPR1_HUMAN GMP reductase 1 (EC 1.7.1.7) (Guanosine 5'-monophosphate oxidoreductase 1) (Guanosine monophosphate reductase 1) P37802 TAGL2_HUMAN Transgelin-2 (Epididymis tissue protein Li 7e) (SM22-alpha homolog) P37837 TALDO_HUMAN Transaldolase (EC 2.2.1.2) P37840 SYUA_HUMAN Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP) P38117 ETFB_HUMAN Electron transfer flavoprotein subunit beta (Beta-ETF) P38159 RBMX_HUMAN RNA-binding motif protein, X chromosome (Glycoprotein p43) (Heterogeneous nuclear ribonucleoprotein G) (hnRNP G) [Cleaved into: RNA-binding motif protein, X chromosome, N-terminally processed]
P38606 VATA_HUMAN V-type proton ATPase catalytic subunit A (V-ATPase subunit A) (EC
3.6.3.14) (V-ATPase 69 kDa subunit) (Vacuolar ATPase isoform VA68) (Vacuolar proton pump subunit alpha) P38646 GRP75_HUMAN Stress-70 protein, mitochondrial (75 kDa glucose-regulated protein) (GRP-75) (Heat shock 70 kDa protein 9) (Mortalin) (MOT) (Peptide-binding protein 74) (PBP74) P38919 IF4A3_HUMAN Eukaryotic initiation factor 4A-III (eIF-4A-111) (eIF4A-111) (EC 3.6.4.13) (ATP-dependent RNA helicase DDX48) (ATP-dependent RNA helicase elF4A-3) (DEAD box protein 48) (Eukaryotic initiation factor 4A-like NUK-34) (Eukaryotic translation initiation factor 4A isoform 3) (Nuclear matrix protein 265) (NMP 265) (hNMP 265) [Cleaved into: Eukaryotic initiation factor 4A-III, N-terminally processed]
P39019 RS19_HUMAN 40S ribosomal protein S19 P39023 RL3_HUMAN 60S ribosomal protein L3 (HIV-1 TAR RNA-binding protein B) (TARBP-B) P39059 COFA1_HUMAN Collagen alpha-1(XV) chain [Cleaved into: Restin (Endostatin-XV) (Related to endostatin) (Restin-I); Restin-2 (Restin-II); Restin-3 (Restin-III); Restin-4 (Restin-IV)]
P39656 05148_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit (DDOST 48 kDa subunit) (Oligosaccharyl transferase 48 kDa subunit) (EC 2.4.99.18) P40121 CAPG_HUMAN Macrophage-capping protein (Actin regulatory protein CAP-G) P40123 CAP2_HUMAN Adenylyl cyclase-associated protein 2 (CAP 2) P40227 = TCPZ_HUMAN 1-complex protein 1 subunit zeta (TCP-1-zeta) (Acute morphine dependence-related protein 2) (CCT-zeta-1) (HTR3) (Tcp20) P40429 RL13A_HUMAN 60S ribosomal protein L13a (23 kDa highly basic protein) P40925 MDHC_HUMAN Malate dehydrogenase, cytoplasmic (EC 1.1.1.37) (Cytosolic malate dehydrogenase) (Diiodophenylpyruvate reductase) (EC 1.1.1.96) P40926 MDHM_HUMAN Malate dehydrogenase, mitochondrial (EC 1.1.1.37) P40939 ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial (78 kDa gastrin-binding protein) (TP-alpha) [Includes: Long-chain enoyl-CoA hydratase (EC 4.2.1.17); Long chain 3-hydroxyacyl-CoA dehydrogenase (EC
1.1.1.211)]

P41091 IF2G_HUMAN Eukaryotic translation initiation factor 2 subunit 3 (Eukaryotic translation initiation factor 2 subunit gamma X) (eIF-2-gamma X) (eIF-2gX) P41219 PERI_HUMAN Peripherin (Neurofilament 4) P41250 SYG_HUMAN Glycine--tRNA ligase (EC 6.1.1.14) (Diadenosine tetraphosphate synthetase) (AP-4-A synthetase) (Glycyl-tRNA synthetase) (GlyRS) P41252 SYIC_HUMAN Isoleucine--tRNA ligase, cytoplasmic (EC 6.1.1.5) (Isoleucyl-tRNA
synthetase) (IRS) (1IeRS) P42126 ECI1_HUMAN Enoyl-CoA delta isomerase 1, mitochondrial (EC
5.3.3.8) (3,2-trans-enoyl-CoA isomerase) (Delta(3),Delta(2)-enoyl-CoA isomerase) (D3,D2-enoyl-CoA isomerase) (Dodecenoyl-CoA isomerase) P42704 LPPRC_HUMAN Leucine-rich PPR motif-containing protein, mitochondrial (130 kDa leucine-rich protein) (LRP 130) (GP130) P42765 THIM_HUMAN 3-ketoacyl-00A thiolase, mitochondrial (EC 2.3.1.16) (Acetyl-CoA
acyltransferase) (Beta-ketothiolase) (Mitochondrial 3-oxoacyl-CoA
thiolase) (Ti) P42766 RL35_HUMAN 605 ribosomal protein L35 P43034 LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha (Lissencephaly-1 protein) (LIS-1) (PAF acetylhydrolase 45 kDa subunit) (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha) P43155 CACP_HUMAN Carnitine 0-acetyltransferase (Carnitine acetylase) (EC 2.3.1.7) (Carnitine acetyltransferase) (CAT) (CrAT) P43243 MATR3_HUMAN Matrin-3 P43304 GPDM_HUMAN Glycerol-3-phosphate dehydrogenase, mitochondria! (GPD-M) (GPDH-M) (EC 1.1.5.3) (mtGPD) P43490 NAMPT_HUMAN Nicotinamide phosphoribosyltransferase (NAmPRTase) (Nampt) (EC
2.4.2.12) (Pre-B-cell colony-enhancing factor 1) (Pre-B cell-enhancing factor) (Visfatin) P43686 PRS6B_HUMAN 265 protease regulatory subunit 6B (26S proteasome AAA-ATPase subunit RPT3) (MB67-interacting protein) (MIP224) (Proteasome 26S
subunit ATPase 4) (Tat-binding protein 7) (TBP-7) P45378 TNNT3_HUMAN Troponin T, fast skeletal muscle (TnTf) (Beta-TnTF) (Fast skeletal muscle troponin T) (fTnT) P45880 VDAC2_HUMAN Voltage-dependent anion-selective channel protein 2 (VDAC-2) (hVDAC2) (Outer mitochondrial membrane protein porin 2) P45974 UBP5_HUMAN Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.4.19.12) (Deubiquitinating enzyme 5) (lsopeptidase T) (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) P45985 MP2K4_HUMAN Dual specificity mitogen-activated protein kinase kinase 4 (MAP kinase kinase 4) (MAPKK 4) (EC 2.7.12.2) (JNK-activating kinase 1) (MAPK/ERK
kinase 4) (MEK 4) (SAPK/ERK kinase 1) (SEK1) (Stress-activated protein kinase kinase 1) (SAPK kinase 1) (SAPKK-1) (SAPKK1) (c-Jun N-terminal kinase kinase 1) (JNKK) P46020 KPB1_HUMAN Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform (Phosphorylase kinase alpha M subunit) P46459 NSF_HUMAN Vesicle-fusing ATPase (EC 3.6.4.6) (N-ethylmaleimide-sensitive fusion protein) (NEM-sensitive fusion protein) (Vesicular-fusion protein NSF) P46734 MP2K3_HUMAN Dual specificity mitogen-activated protein kinase kinase 3 (MAP kinase kinase 3) (MAPKK 3) (EC 2.7.12.2) (MAPK/ERK kinase 3) (MEK 3) (Stress-activated protein kinase kinase 2) (SAPK kinase 2) (SAPKK-2) (SAPKK2) P46777 RL5_HUMAN 60S ribosomal protein L5 P46782 RS5_HUMAN 40S ribosomal protein S5 [Cleaved into: 40S ribosomal protein 55, N-terminally processed]
P46783 RS10_HUMAN 40S ribosomal protein S10 P46821 MAP1B_HUMAN Microtubule-associated protein 1B (MAP-1B) [Cleaved into: MAP1B
heavy chain; MAP1 light chain LC1]
P46939 UTRO_HUMAN Utrophin (Dystrophin-related protein 1) (DRP-1) P46940 IQGAl_HUMAN Ras GTPase-activating-like protein IQGAP1 (p195) P46976 GLYG_HUMAN Glycogenin-1 (GN-1) (GN1) (EC 2.4.1.186) P47755 CAZA2_HUMAN F-actin-capping protein subunit alpha-2 (CapZ alpha-2) P47756 CAPZB_HUMAN F-actin-capping protein subunit beta (CapZ beta) P47897 SYQ_HUMAN Glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA
synthetase) (GInRS) P47985 UCRI_HUMAN Cytochrome b-cl complex subunit Rieske, mitochondrial (EC 1.10.2.2) (Complex III subunit 5) (Cytochrome b-cl complex subunit 5) (Rieske iron-sulfur protein) (RISP) (Ubiquinol-cytochrome c reductase iron-sulfur subunit) [Cleaved into: Cytochrome b-cl complex subunit 11 (Complex III subunit IX) (Ubiquinol-cytochrome c reductase 8 kDa protein)]
P48047 ATPO_HUMAN ATP synthase subunit 0, mitochondrial (Oligomycin sensitivity conferral protein) (OSCP) P48147 PPCE_HUMAN Prolyl endopeptidase (PE) (EC 3.4.21.26) (Post-proline cleaving enzyme) P48163 MAOX_HUMAN NADP-dependent malic enzyme (NADP-ME) (EC 1.1.1.40) (Malic enzyme 1) P48444 COPD_HUMAN Coatomer subunit delta (Archain) (Delta-coat protein) (Delta-COP) P48556 PSMD8_HUMAN 26S proteasome non-ATPase regulatory subunit 8 (26S
proteasome regulatory subunit RPN12) (26S proteasome regulatory subunit S14) (P31) P48643 TCPE_HUMAN 1-complex protein 1 subunit epsilon (TCP-1-epsilon) (CCT-epsilon) P48681 NEST_HUMAN Nestin P48735 IDHP_HUMAN Isocitrate dehydrogenase [NADP], mitochondrial (IDH) (EC 1.1.1.42) (ICD-M) (IDP) (NADP(+)-specific ICDH) (Oxalosuccinate decarboxylase) P48788 TNNI2_HUMAN Troponin I, fast skeletal muscle (Troponin I, fast-twitch isoform) P49189 AL9A1_HUMAN 4-trimethylaminobutyraldehyde dehydrogenase (TMABADH) (EC
1.2.1.47) (Aldehyde dehydrogenase E3 isozyme) (Aldehyde dehydrogenase family 9 member Al) (EC 1.2.1.3) (Gamma-aminobutyraldehyde dehydrogenase) (EC 1.2.1.19) (R-aminobutyraldehyde dehydrogenase) P49327 FAS_HUMAN Fatty acid synthase (EC 2.3.1.85) [Includes: [Acyl-carrier-protein] S-acetyltransferase (EC 2.3.1.38); [Acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39); 3-oxoacyl-[acyl-carrier-protein]
synthase (EC 2.3.1.41); 3-oxoacyl-[acyl-carrier-protein] reductase (EC
1.1.1.100); 3-hydroxyacyl-[acyl-carrier-protein] dehydratase (EC
4.2.1.59); EnoyNacyl-carrier-protein] reductase (EC 1.3.1.39); Oleoyl-[acyl-carrier-protein] hydrolase (EC 3.1.2.14)]
P49368 TCPG_HUMAN 1-complex protein 1 subunit gamma (TCP-1-gamma) (CC-gamma) (hTRiC5) P49411 EFTU_HUMAN Elongation factor Tu, mitochondria' (EF-Tu) (P43) P49419 AL7A1_HUMAN Alpha-aminoadipic semialdehyde dehydrogenase (Alpha-AASA
dehydrogenase) (EC 1.2.1.31) (Aldehyde dehydrogenase family 7 member Al) (EC 1.2.1.3) (Antiquitin-1) (Betaine aldehyde dehydrogenase) (EC 1.2.1.8) (Deltal-piperideine-6-carboxylate dehydrogenase) (P6c dehydrogenase) P49588 SYAC_HUMAN Alanine--tRNA ligase, cytoplasmic (EC 6.1.1.7) (Alanyl-tRNA
synthetase) (AlaRS) (Renal carcinoma antigen NY-REN-42) P49591 SYSC_HUMAN Serine--tRNA ligase, cytoplasmic (EC 6.1.1.11) (Seryl-tRNA synthetase) (SerRS) (Seryl-tRNA(Ser/Sec) synthetase) P49720 PSB3_HUMAN Proteasome subunit beta type-3 (EC 3.4.25.1) (Proteasome chain 13) (Proteasome component C10-11) (Proteasome theta chain) P49721 PSB2_HUMAN Proteasome subunit beta type-2 (EC 3.4.25.1) (Macropain subunit C7-I) (Multicatalytic endopeptidase complex subunit C7-I) (Proteasome component C7-I) P49748 ACADV_HUMAN Very long-chain specific acyl-CoA dehydrogenase, mitochondrial (VLCAD) (EC 1.3.8.9) P49755 TMEDA_HUMAN Transmembrane emp24 domain-containing protein 10 (21 kDa transmembrane-trafficking protein) (S31111125) (S311125) (Tmp-21-1) (Transmembrane protein Tmp21) (p23) (p24 family protein delta-1) (p24deltal) (p24delta) P49773 HINTl_HUMAN Histidine triad nucleotide-binding protein 1 (EC 3.-.-.-) (Adenosine 5'-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1) P49821 NDUV1_HUMAN NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondria' (EC
1.6.5.3) (EC 1.6.99.3) (Complex I-51kD) (CI-51kD) (NADH
dehydrogenase flavoprotein 1) (NADH-ubiquinone oxidoreductase 51 kDa subunit) P50213 IDH3A_HUMAN Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial (EC
1.1.1.41) (Isocitric dehydrogenase subunit alpha) (NAD(+)-specific ICDH subunit alpha) P50395 GDIB_HUMAN Rab GDP dissociation inhibitor beta (Rab GDI beta) (Guanosine diphosphate dissociation inhibitor 2) (GDI-2) P50454 SERPH_HUMAN Serpin H1 (47 kDa heat shock protein) (Arsenic-transactivated protein 3) (A5TP3) (Cell proliferation-inducing gene 14 protein) (Collagen-binding protein) (Colligin) (Rheumatoid arthritis-related antigen RA-A47) P50461 CSRP3_HUMAN Cysteine and glycine-rich protein 3 (Cardiac LIM
protein) (Cysteine-rich protein 3) (CRP3) (LIM domain protein, cardiac) (Muscle LIM protein) P50502 FlOAl_HUMAN Hsc70-interacting protein (Hip) (Aging-associated protein 2) (Progesterone receptor-associated p48 protein) (Protein FAM10A1) (Putative tumor suppressor 5113) (Renal carcinoma antigen NY-REN-33) (Suppression of tumorigenicity 13 protein) P50570 DYN2_HUMAN Dynamin-2 (EC 3.6.5.5) P50579 MAP2_HUMAN Methionine aminopeptidase 2 (MAP 2) (MetAP 2) (EC
3.4.11.18) (Initiation factor 2-associated 67 kDa glycoprotein) (p67) (p67eIF2) (Peptidase M) P50990 TCPQ_HUMAN T-complex protein 1 subunit theta (TCP-1-theta) (CCT-theta) (Renal carcinoma antigen NY-REN-15) P50991 TCPD_HUMAN 1-complex protein 1 subunit delta (TCP-1-delta) (CCT-delta) (Stimulator of TAR RNA-binding) P50993 AT1A2_HUMAN Sodium/potassium-transporting ATPase subunit alpha-2 (Na(+)/K(+) ATPase alpha-2 subunit) (EC 3.6.3.9) (Sodium pump subunit alpha-2) P50995 ANX11_HUMAN Annexin All (56 kDa autoantigen) (Annexin XI) (Annexin-11) (Calcyclin-associated annexin 50) (CAP-50) P51114 FXRl_HUMAN Fragile X mental retardation syndrome-related protein 1 (hFXR1p) P51149 RAB7A_HUMAN Ras-related protein Rab-7a P51452 DUS3_HUMAN Dual specificity protein phosphatase 3 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase VHR) (Vaccinia Hl-related phosphatase) (VHR) P51553 IDH3G_HUMAN Isocitrate dehydrogenase [NAD] subunit gamma, mitochondria! (EC
1.1.1.41) (lsocitric dehydrogenase subunit gamma) (NAD(+)-specific ICDH subunit gamma) P51648 AL3A2_HUMAN Fatty aldehyde dehydrogenase (EC 1.2.1.3) (Aldehyde dehydrogenase 10) (Aldehyde dehydrogenase family 3 member A2) (Microsomal aldehyde dehydrogenase) P51649 SSDH_HUMAN Succinate-semialdehyde dehydrogenase, mitochondrial (EC 1.2.1.24) (Aldehyde dehydrogenase family 5 member Al) (NAD(+)-dependent succinic semialdehyde dehydrogenase) P51659 DHB4_HUMAN Peroxisomal multifunctional enzyme type 2 (MFE-2) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-bifunctional protein) (DBP) (Multifunctional protein 2) (MPF-2) [Cleaved into: (3R)-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.n12); Enoyl-CoA hydratase 2 (EC 4.2.1.107) (EC 4.2.1.119) (3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase)]
P51665 PSMD7_HUMAN 265 proteasome non-ATPase regulatory subunit 7 (265 proteasome regulatory subunit RPN8) (265 proteasome regulatory subunit 512) (Moy34 protein homolog) (Proteasome subunit p40) P51692 STA5B_HUMAN Signal transducer and activator of transcription 5B
P51812 KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 (S6K-alpha-3) (EC
2.7.11.1) (90 kDa ribosomal protein S6 kinase 3) (p90-RSK 3) (p9ORSK3) (Insulin-stimulated protein kinase 1) (ISPK-1) (MAP kinase-activated protein kinase lb) (MAPK-activated protein kinase lb) (MAPKAP kinase lb) (MAPKAPK-1b) (Ribosomal S6 kinase 2) (RSK-2) (pp9ORSK2) P51858 HDGF_HUMAN Hepatoma-derived growth factor (HDGF) (High mobility group protein 1-like 2) (HMG-1L2) P51884 LUM_HUMAN Lumican (Keratan sulfate proteoglycan lumican) (KSPG
lumican) P51888 PRELP_HUMAN Prolargin (Proline-arginine-rich end leucine-rich repeat protein) P51911 CNNl_HUMAN Calponin-1 (Basic calponin) (Calponin H1, smooth muscle) P51991 ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) P52179 MY0M1_HUMAN Myomesin-1 (190 kDa connectin-associated protein) (190 kDa titin-associated protein) (Myomesin family member 1) P52209 6PGD_HUMAN 6-phosphogluconate dehydrogenase, decarboxylating (EC
1.1.1.44) P52272 HNRPM_HUMAN Heterogeneous nuclear ribonucleoprotein M (hnRNP M) P52294 IMA5_HUMAN Importin subunit alpha-5 (Karyopherin subunit alpha-1) (Nucleoprotein interactor 1) (NPI-1) (RAG cohort protein 2) (SRP1-beta) P52564 MP2K6_HUMAN Dual specificity mitogen-activated protein kinase kinase 6 (MAP kinase kinase 6) (MAPKK 6) (EC 2.7.12.2) (MAPK/ERK kinase 6) (MEK 6) (Stress-activated protein kinase kinase 3) (SAPK kinase 3) (SAPKK-3) (SAPKK3) P52565 GDIR1_HUMAN Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI alpha) P52789 HXK2_HUMAN Hexokinase-2 (EC 2.7.1.1) (Hexokinase type II) (HK II) (Muscle form hexokinase) P52888 THOP1_HUMAN Thimet oligopeptidase (EC 3.4.24.15) (Endopeptidase 24.15) (MP78) P52907 CAZA1_HUMAN F-actin-capping protein subunit alpha-1 (CapZ alpha-1) P53041 PPP5_HUMAN Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT) P53396 ACLY_HUMAN ATP-citrate synthase (EC 2.3.3.8) (ATP-citrate (pro-S-)-Iyase) (ACL) (Citrate cleavage enzyme) P53597 SUCA_HUMAN Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondria!
(EC 6.2.1.4) (EC 6.2.1.5) (Succinyl-CoA synthetase subunit alpha) (SCS-alpha) P53611 PGTB2_HUMAN Geranylgeranyl transferase type-2 subunit beta (EC 2.5.1.60) (Geranylgeranyl transferase type II subunit beta) (GGTase-II-beta) (Rab geranyl-geranyltransferase subunit beta) (Rab GG transferase beta) (Rab GGTase beta) (Rab geranylgeranyltransferase subunit beta) (Type II protein geranyl-geranyltransferase subunit beta) P53618 COPB_HUMAN Coatomer subunit beta (Beta-coat protein) (Beta-COP) P53621 COPA_HUMAN Coatomer subunit alpha (Alpha-coat protein) (Alpha-COP) (HEP-COP) (HEPCOP) [Cleaved into: Xenin (Xenopsin-related peptide); Proxenin]
P53778 MK12_HUMAN Mitogen-activated protein kinase 12 (MAP
kinase 12) (MAPK 12) (EC
2.7.11.24) (Extracellular signal-regulated kinase 6) (ERK-6) (Mitogen-activated protein kinase p38 gamma) (MAP kinase p38 gamma) (Stress-activated protein kinase 3) P53992 SC24C_HUMAN Protein transport protein Sec24C (SEC24-related protein C) P54136 SYRC_HUMAN Arginine--tRNA ligase, cytoplasmic (EC
6.1.1.19) (Arginyl-tRNA
synthetase) (ArgRS) P54289 CA2D1_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-1 (Voltage-gated calcium channel subunit alpha-2/delta-1) [Cleaved into: Voltage-dependent calcium channel subunit alpha-2-1; Voltage-dependent calcium channel subunit delta-1]
P54296 MYOM2_HUMAN Myomesin-2 (165 kDa connectin-associated protein) (165 kDa titin-associated protein) (M-protein) (Myomesin family member 2) P54577 SYYC_HUMAN Tyrosine--tRNA ligase, cytoplasmic (EC
6.1.1.1) (Tyrosyl-tRNA
synthetase) (TyrRS) [Cleaved into: Tyrosine--tRNA ligase, cytoplasmic, N-terminally processed]
P54578 UBP14_HUMAN Ubiquitin carboxyl-terminal hydrolase 14 (EC
3.4.19.12) (Deubiquitinating enzyme 14) (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) P54619 AAKG1_HUMAN 5'-AMP-activated protein kinase subunit gamma-1 (AMPK
gamma1) (AMPK subunit gamma-1) (AMPKg) P54646 AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 (AMPK
subunit alpha-2) (EC 2.7.11.1) (Acetyl-CoA carboxylase kinase) (ACACA
kinase) (EC 2.7.11.27) (Hydroxymethylglutaryl-CoA reductase kinase) (HMGCR kinase) (EC 2.7.11.31) P54652 HSP72_HUMAN Heat shock-related 70 kDa protein 2 (Heat shock 70 kDa protein 2) P54727 RD23B_HUMAN UV excision repair protein RAD23 homolog B (HR23B) (hHR23B) (XP-C
repair-complementing complex 58 kDa protein) (p58) P54819 KAD2_HUMAN Adenylate kinase 2, mitochondrial (AK 2) (EC 2.7.4.3) (ATP-AMP
transphosphorylase 2) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) [Cleaved into: Adenylate kinase 2, mitochondrial, N-terminally processed]
P54920 SNAA_HUMAN Alpha-soluble NSF attachment protein (SNAP-alpha) (N-ethylmaleimide-sensitive factor attachment protein alpha) P55010 IF5_HUMAN Eukaryotic translation initiation factor 5 (eIF-5) P55036 PSMD4_HUMAN 265 proteasome non-ATPase regulatory subunit 4 (26S
proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein) P55060 XP02_HUMAN Exportin-2 (Exp2) (Cellular apoptosis susceptibility protein) (Chromosome segregation 1-like protein) (Importin-alpha re-exporter) P55072 TERA_HUMAN Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) P55083 MFAP4_HUMAN Microfibril-associated glycoprotein 4 P55084 ECHB_HUMAN Trifunctional enzyme subunit beta, mitochondrial (TP-beta) [Includes:
3-ketoacyl-CoA thiolase (EC 2.3.1.16) (Acetyl-CoA acyltransferase) (Beta-ketothiolase)]
P55209 NP1L1_HUMAN Nucleosome assembly protein 1-like 1 (NAP-1-related protein) (hNRP) P55268 LAMB2_HUMAN Laminin subunit beta-2 (Laminin B1s chain) (Laminin-

11 subunit beta) (Laminin-14 subunit beta) (Laminin-15 subunit beta) (Laminin-3 subunit beta) (Laminin-4 subunit beta) (Laminin-7 subunit beta) (Laminin-9 subunit beta) (S-laminin subunit beta) (S-LAM beta) P55290 CAD13_HUMAN Cadherin-13 (Heart cadherin) (H-cadherin) (P105) (Truncated cadherin) (T-cad) (T-cadherin) P55786 PSA_HUMAN Puromycin-sensitive aminopeptidase (PSA) (EC
3.4.11.14) (Cytosol alanyl aminopeptidase) (AAP-S) P55809 SCOT1_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial (EC
2.8.3.5) (3-oxoacid CoA-transferase 1) (Somatic-type succinyl-CoA:3-oxoacid CoA-transferase) (SCOT-s) P55822 SH3BG_HUMAN SH3 domain-binding glutamic acid-rich protein (SH3BGR
protein) (21-glutamic acid-rich protein) (21-GARP) P55884 ElF3B_HUMAN Eukaryotic translation initiation factor 3 subunit B
(eIF3b) (Eukaryotic translation initiation factor 3 subunit 9) (Prt1 homolog) (hPrt1) (eIF-3-eta) (eIF3 p110) (eIF3 p116) P56192 SYMC_HUMAN Methionine--tRNA ligase, cytoplasmic (EC 6.1.1.10) (Methionyl-tRNA
synthetase) (MetRS) P56199 ITA1_HUMAN Integrin alpha-1 (CD49 antigen-like family member A) (Laminin and collagen receptor) (VLA-1) (CD antigen CD49a) P56385 ATP5I_HUMAN ATP synthase subunit e, mitochondrial (ATPase subunit e) P60174 TPIS_HUMAN Triosephosphate isomerase (TIM) (EC 5.3.1.1) (Triose-phosphate isomerase) P60228 ElF3E_HUMAN Eukaryotic translation initiation factor 3 subunit E
(eIF3e) (Eukaryotic translation initiation factor 3 subunit 6) (Viral integration site protein INT-6 homolog) (eIF-3 p48) P60660 MYL6_HUMAN Myosin light polypeptide 6 (17 kDa myosin light chain) (LC17) (Myosin light chain 3) (MLC-3) (Myosin light chain alkali 3) (Myosin light chain A3) (Smooth muscle and nonmuscle myosin light chain alkali 6) P60709 ACTB_HUMAN Actin, cytoplasmic 1 (Beta-actin) [Cleaved into:
Actin, cytoplasmic 1, N-terminally processed]
P60842 IF4A1_HUMAN Eukaryotic initiation factor 4A-I (eIF-4A-I) (eIF4A-I) (EC 3.6.4.13) (ATP-dependent RNA helicase elF4A-1) P60866 RS2O_HUMAN 40S ribosomal protein S20 P60891 PRPS1_HUMAN Ribose-phosphate pyrophosphokinase 1 (EC 2.7.6.1) (PPRibP) (Phosphoribosyl pyrophosphate synthase I) (PRS-I) P60900 PSA6_HUMAN Proteasome subunit alpha type-6 (EC 3.4.25.1) (27 kDa prosomal protein) (PROS-27) (p27K) (Macropain iota chain) (Multicatalytic endopeptidase complex iota chain) (Proteasome iota chain) P60903 S10AA_HUMAN Protein S100-A10 (Calpactin I light chain) (Calpactin-1 light chain) (Cellular ligand of annexin II) (S100 calcium-binding protein A10) (p10 protein) (p11) P60953 CDC42_HUMAN Cell division control protein 42 homolog (G25K GTP-binding protein) P61019 RAB2A_HUMAN Ras-related protein Rab-2A
P61020 RAB5B_HUMAN Ras-related protein Rab-5B
P61026 RAB1O_HUMAN Ras-related protein Rab-10 P61088 UBE2N_HUMAN Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19) (Bendless-like ubiquitin-conjugating enzyme) (Ubc13) (UbcH13) (Ubiquitin carrier protein N) (Ubiquitin-protein ligase N) P61106 RAB14_HUMAN Ras-related protein Rab-14 P61158 ARP3_HUMAN Actin-related protein 3 (Actin-like protein 3) P61163 ACTZ_HUMAN Alpha-centractin (Centractin) (ARP1) (Actin-RPV) (Centrosome-associated actin homolog) P61201 CSN2_HUMAN COP9 signalosome complex subunit 2 (SGN2) (Signalosome subunit 2) (Alien homolog) (JAB1-containing signalosome subunit 2) (Thyroid receptor-interacting protein 15) (TR-interacting protein 15) (TRIP-15) P61221 ABCE1_HUMAN ATP-binding cassette sub-family E member 1 (2'-5'-oligoadenylate-binding protein) (HuHP68) (RNase L inhibitor) (Ribonuclease 4 inhibitor) (RNS4I) P61247 RS3A_HUMAN 40S ribosomal protein S3a (v-fos transformation effector protein) (Fte-1) P61313 RL15_HUMAN 605 ribosomal protein L15 P61353 RL27_HUMAN 60S ribosomal protein L27 P61604 CH1O_HUMAN 10 kDa heat shock protein, mitochondrial (Hsp10) (10 kDa chaperonin) (Chaperonin 10) (CPN10) (Early-pregnancy factor) (EPF) P61970 NTF2_HUMAN Nuclear transport factor 2 (NTF-2) (Placental protein 15) (PP15) P61978 HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (Transformation up-regulated nuclear protein) (TUNP) P61981 1433G_HUMAN 14-3-3 protein gamma (Protein kinase C inhibitor protein 1) (KCIP-1) [Cleaved into: 14-3-3 protein gamma, N-terminally processed]
P62081 RS7_HUMAN 40S ribosomal protein S7 P62140 PP1B_HUMAN Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PP-18) (PPP1CD) (EC 3.1.3.16) (EC 3.1.3.53) P62158 CALM_HUMAN Calmodulin (CaM) P62191 PRS4_HUMAN 26S protease regulatory subunit 4 (P26s4) (26S
proteasome AAA-ATPase subunit RPT2) (Proteasome 26S subunit ATPase 1) P62195 PRS8_HUMAN 26S protease regulatory subunit 8 (26S proteasome AAA-ATPase subunit RPT6) (Proteasome 265 subunit ATPase 5) (Proteasome subunit p45) (Thyroid hormone receptor-interacting protein 1) (TRIP1) (p45/SUG) P62241 RS8_HUMAN 405 ribosomal protein 58 P62244 RS15A_HUMAN 405 ribosomal protein S15a P62249 RS16_HUMAN 40S ribosomal protein S16 P62258 1433E_HUMAN 14-3-3 protein epsilon (14-3-3E) P62269 RS18_HUMAN 405 ribosomal protein S18 (Ke-3) (Ke3) P62277 RS13_HUMAN 405 ribosomal protein 513 P62280 RS11_HUMAN 405 ribosomal protein S11 P62333 PRS1O_HUMAN 26S protease regulatory subunit 10B (26S proteasome AAA-ATPase subunit RPT4) (Proteasome 265 subunit ATPase 6) (Proteasome subunit p42) P62495 ERF1_HUMAN Eukaryotic peptide chain release factor subunit 1 (Eukaryotic release factor 1) (eRF1) (Protein CI1) (TB3-1) P62701 RS4X_HUMAN 40S ribosomal protein S4, X isoform (SCR10) (Single copy abundant mRNA protein) P62750 RL23A_HUMAN 60S ribosomal protein L23a P62805 H4_HUMAN Histone H4 P62820 RAB1A_HUMAN Ras-related protein Rab-1A (YPT1-related protein) P62826 RAN_HUMAN GTP-binding nuclear protein Ran (Androgen receptor-associated protein 24) (GTPase Ran) (Ras-like protein TC4) (Ras-related nuclear protein) P62829 RL23_HUMAN 605 ribosomal protein L23 (60S ribosomal protein L17) P62851 RS25_HUMAN 405 ribosomal protein S25 P62873 GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 (Transducin beta chain 1) P62888 RL3O_HUMAN 605 ribosomal protein L30 P62906 RL10A_HUMAN 605 ribosomal protein L10a (CSA-19) (Neural precursor cell expressed developmentally down-regulated protein 6) (NEDD-6) P62913 RL11_HUMAN 605 ribosomal protein L11 (CLL-associated antigen KW-

12) P62917 RL8_HUMAN 60S ribosomal protein L8 P62937 PPIA_HUMAN Peptidyl-prolyl cis-trans isomerase A (PPlase A) (EC
5.2.1.8) (Cyclophilin A) (Cyclosporin A-binding protein) (Rotamase A) [Cleaved into: Peptidyl-prolyl cis-trans isomerase A, N-terminally processed]
P63000 RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 (Cell migration-inducing gene 5 protein) (Ras-like protein TC25) (p21-Rac1) P63010 AP2B1_HUMAN AP-2 complex subunit beta (AP105B) (Adapter-related protein complex 2 beta subunit) (Adaptor protein complex AP-2 subunit beta) (Beta-2-adaptin) (Beta-adaptin) (Clathrin assembly protein complex 2 beta large chain) (Plasma membrane adaptor HA2/AP2 adaptin beta subunit) P63104 1433Z_HUMAN 14-3-3 protein zeta/delta (Protein kinase C inhibitor protein 1) (KCIP-1) P63151 2ABA_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B
alpha isoform (PP2A subunit B isoform B55-alpha) (PP2A subunit B
isoform PR55-alpha) (PP2A subunit B isoform R2-alpha) (PP2A subunit B isoform alpha) P63208 SKP1_HUMAN S-phase kinase-associated protein 1 (Cyclin-A/CDK2-associated protein p19) (Organ of Corti protein 2) (OCP-2) (Organ of Corti protein II) (OCP-II) (RNA polymerase II elongation factor-like protein) (5111) (Transcription elongation factor B) (p19A) (p19skp1) P63241 IF5A1_HUMAN Eukaryotic translation initiation factor 5A-1 (elF-5A-1) (elF-5A1) (Eukaryotic initiation factor 5A isoform 1) (eIF-5A) (Rev-binding factor) (eIF-4D) P63244 GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 (Cell proliferation-inducing gene 21 protein) (Guanine nucleotide-binding protein subunit beta-like protein 12.3) (Human lung cancer oncogene 7 protein) (HLC-7) (Receptor for activated C kinase) (Receptor of activated protein kinase C 1) (RACK1) P63316 TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles (TN-C) P67775 PP2AA_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform (PP2A-alpha) (EC 3.1.3.16) (Replication protein C) (RP-C) P67809 YBOX1_HUMAN Nuclease-sensitive element-binding protein 1 (CCAAT-binding transcription factor I subunit A) (CBF-A) (DNA-binding protein B) (DBPB) (Enhancer factor I subunit A) (EFI-A) (Y-box transcription factor) (Y-box-binding protein 1) (YB-1) P68036 UB2L3_HUMAN Ubiquitin-conjugating enzyme E2 L3 (EC 6.3.2.19) (L-UBC) (UbcH7) (Ubiquitin carrier protein L3) (Ubiquitin-conjugating enzyme E2-F1) (Ubiquitin-protein ligase L3) P68104 EF1A1_HUMAN Elongation factor 1-alpha 1 (EF-1-alpha-1) (Elongation factor Tu) (EF-Tu) (Eukaryotic elongation factor 1 A-1) (eEF1A-1) (Leukocyte receptor cluster member 7) P68133 ACTS HUMAN Actin, alpha skeletal muscle (Alpha-actin-1) P68366 TBA4A_HUMAN Tubulin alpha-4A chain (Alpha-tubulin 1) (Testis-specific alpha-tubulin) (Tubulin H2-alpha) (Tubulin alpha-1 chain) P68371 TBB4B_HUMAN Tubulin beta-4B chain (Tubulin beta-2 chain) (Tubulin beta-2C chain) P68431 H31_HUMAN Histone H3.1 (Histone H3/a) (Histone H3/b) (Histone H3/c) (Histone H3/d) (Histone H3/f) (Histone H3/h) (Histone H3/i) (Histone H3/j) (Histone H3/k) (Histone H3/1) P68871 HBB_HUMAN Hemoglobin subunit beta (Beta-globin) (Hemoglobin beta chain) [Cleaved into: LVV-hemorphin-7]
P69849 NOM03_HUMAN Nodal modulator 3 (pM5 protein 3) P69905 HBA_HUMAN Hemoglobin subunit alpha (Alpha-globin) (Hemoglobin alpha chain) P78344 IF4G2_HUMAN Eukaryotic translation initiation factor 4 gamma 2 (eIF-4-gamma 2) (eIF-4G 2) (eIF4G 2) (Death-associated protein 5) (DAP-5) (p97) P78347 GTF2I_HUMAN General transcription factor II-I (GTFII-I) (TFII-I) (Bruton tyrosine kinase-associated protein 135) (BAP-135) (BTK-associated protein 135) (SRF-Phoxl-interacting protein) (SPIN) (Williams-Beuren syndrome chromosomal region 6 protein) P78371 TCPB_HUMAN T-complex protein 1 subunit beta (TCP-1-beta) (CCT-beta) P78417 GSTOl_HUMAN Glutathione S-transferase omega-1 (GSTO-1) (EC 2.5.1.18) (Glutathione S-transferase omega 1-1) (GSTO 1-1) (Glutathione-dependent dehydroascorbate reductase) (EC 1.8.5.1) (Monomethylarsonic acid reductase) (MMA(V) reductase) (EC
1.20.4.2) (S-(Phenacyl)glutathione reductase) (SPG-R) P78527 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit (DNA-PK catalytic subunit) (DNA-PKcs) (EC 2.7.11.1) (DNPK1) (p460) P81605 DCD_HUMAN Dermcidin (EC 3.4.-.-) (Preproteolysin) [Cleaved into: Survival-promoting peptide; DCD-1]
P83111 LACTB_HUMAN Serine beta-lactamase-like protein LACTB, mitochondria! (EC 3.4.-.-) P98160 PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein (HSPG) (Perlecan) (PLC) [Cleaved into: Endorepellin; LG3 peptide]
P99999 CYC_HUMAN Cytochrome c 000013 EM55_HUMAN 55 kDa erythrocyte membrane protein (p55) (Membrane protein, palmitoylated 1) 000169 PIPNA_HUMAN Phosphatidylinositol transfer protein alpha isoform (PI-TP-alpha) (Ptdlns transfer protein alpha) (PtdInsTP alpha) Q00325 MPCP_HUMAN Phosphate carrier protein, mitochondrial (Phosphate transport protein) (PTP) (Solute carrier family 25 member 3) 000341 VIGLN_HUMAN Vigilin (High density lipoprotein-binding protein) (HDL-binding protein) 000610 CLHl_HUMAN Clathrin heavy chain 1 (Clathrin heavy chain on chromosome 17) (CLH-17) Q00688 FKBP3_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP3 (PPlase FKBP3) (EC 5.2.1.8) (25 kDa FK506-binding protein) (25 kDa FKBP) (FKBP-25) (FK506-binding protein 3) (FKBP-3) (Immunophilin FKBP25) (Rapamycin-selective 25 kDa immunophilin) (Rotamase) 000765 REEP5_HUMAN Receptor expression-enhancing protein 5 (Polyposis locus protein 1) (Protein TB2) 000839 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U
(hnRNP U) (Scaffold attachment factor A) (SAF-A) (p120) (pp120) Q00872 MYPC1_HUMAN Myosin-binding protein C, slow-type (Slow MyBP-C) (C-protein, skeletal muscle slow isoform) 001082 SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 (Beta-II spectrin) (Fodrin beta chain) (Spectrin, non-erythroid beta chain 1) Q01105 SET_HUMAN Protein SET (HLA-DR-associated protein II) (Inhibitor of granzyme A-activated DNase) (IGAAD) (PHAPII) (Phosphatase 2A inhibitor I2PP2A) (I-2PP2A) (Template-activating factor I) (TAF-I) Q01518 CAPl_HUMAN Adenylyl cyclase-associated protein 1 (CAP 1) Q01995 TAGL_HUMAN Transgelin (22 kDa actin-binding protein) (Protein WS3-10) (Smooth muscle protein 22-alpha) (SM22-alpha) 002218 ODOl_HUMAN 2-oxoglutarate dehydrogenase, mitochondria!
(EC 1.2.4.2) (2-oxoglutarate dehydrogenase complex component El) (OGDC-E1) (Alpha-ketoglutarate dehydrogenase) Q02252 MMSA_HUMAN Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondria! (MMSDH) (Malonate-semialdehyde dehydrogenase [acylating]) (EC 1.2.1.18) (EC 1.2.1.27) (Aldehyde dehydrogenase family 6 member Al) 002413 DSGl_HUMAN Desmoglein-1 (Cadherin family member 4) (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) 002641 CACBl_HUMAN Voltage-dependent L-type calcium channel subunit beta-1 (CAB1) (Calcium channel voltage-dependent subunit beta 1) Q02790 FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 (PPlase FKBP4) (EC 5.2.1.8) (51 kDa FK506-binding protein) (FKBP51) (52 kDa FK506-binding protein) (52 kDa FKBP) (FKBP-52) (59 kDa immunophilin) (p59) (FK506-binding protein 4) (FKBP-4) (FKBP59) (HSP-binding immunophilin) (HBI) (Immunophilin FKBP52) (Rotamase) [Cleaved into: Peptidyl-prolyl cis-trans isomerase FKBP4, N-terminally processed]
Q02809 PLODl_HUMAN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 (EC
1.14.11.4) (Lysyl hydroxylase 1) (LH1) Q02818 NUCBl_HUMAN Nucleobindin-1 (CALNUC) 002952 AKAl2_HUMAN A-kinase anchor protein 12 (AKAP-12) (A-kinase anchor protein 250 kDa) (AKAP 250) (Gravin) (Myasthenia gravis autoantigen) Q02978 M20M_HUMAN Mitochondria! 2-oxoglutarate/malate carrier protein (OGCP) (Solute carrier family 25 member 11) 003135 CAVl_HUMAN Caveolin-1 Q03252 LMNB2_HUMAN Lamin-B2 Q04446 GLGB_HUMAN 1,4-alpha-glucan-branching enzyme (EC 2.4.1.18) (Brancher enzyme) (Glycogen-branching enzyme) Q04637 IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (eIF-4-gamma 1) (eIF-4G 1) (eIF-4G1) (p220) 004695 K1C17_HUMAN Keratin, type I cytoskeletal 17 (39.1) (Cytokeratin-17) (CK-17) (Keratin-17) (K17) 004760 LGUL_HUMAN Lactoylglutathione lyase (EC 4.4.1.5) (Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 004828 AK1C1_HUMAN Aldo-keto reductase family 1 member Cl (EC 1.1.1.-) (20-alpha-hydroxysteroid dehydrogenase) (20-alpha-HSD) (EC 1.1.1.149) (Chlordecone reductase homolog HAKRC) (Dihydrodiol dehydrogenase 1/2) (DD1/DD2) (High-affinity hepatic bile acid-binding protein) (HBAB) (Indanol dehydrogenase) (EC 1.1.1.112) (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase) (EC 1.3.1.20) 005086 UBE3A_HUMAN Ubiquitin-protein ligase E3A (EC 6.3.2.-) (E6AP
ubiquitin-protein ligase) (Human papillomavirus E6-associated protein) (Oncogenic protein-associated protein E6-AP) (Renal carcinoma antigen NY-REN-54) 005639 EF1A2_HUMAN Elongation factor 1-alpha 2 (EF-1-alpha-2) (Eukaryotic elongation factor 1 A-2) (eEF1A-2) (Statin-S1) 005682 CALD1 _HUMAN Caldesmon (CDM) 005707 COEA1 _HUMAN Collagen alpha-1(XIV) chain (Undulin) 006323 PSMEl_HUMAN Proteasome activator complex subunit 1 (11S regulator complex subunit alpha) (REG-alpha) (Activator of multicatalytic protease subunit 1) (Interferon gamma up-regulated 1-5111 protein) (IGUP I-5111) (Proteasome activator 28 subunit alpha) (PA28a) (PA28alpha) Q06830 PRDX1_HUMAN Peroxiredoxin-1 (EC 1.11.1.15) (Natural killer cell-enhancing factor A) (NKEF-A) (Proliferation-associated gene protein) (PAG) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) Q07065 CKAP4_HUMAN Cytoskeleton-associated protein 4 (63-kDa cytoskeleton-linking membrane protein) (Climp-63) (p63) 007666 KHDR1_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68) 007954 LRP1_HUMAN Prolow-density lipoprotein receptor-related protein 1 (LRP-1) (Alpha-2-macroglobulin receptor) (A2MR) (Apolipoprotein E receptor) (APOER) (CD antigen CD91) [Cleaved into: Low-density lipoprotein receptor-related protein 1 85 kDa subunit (LRP-85); Low-density lipoprotein receptor-related protein 1 515 kDa subunit (LRP-515); Low-density lipoprotein receptor-related protein 1 intracellular domain (LRPICD)]
007955 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 (Alternative-splicing factor 1) (ASF-1) (Splicing factor, arginine/serine-rich 1) (pre-mRNA-splicing factor SF2, P33 subunit) Q08043 ACTN3_HUMAN Alpha-actinin-3 (Alpha-actinin skeletal muscle isoform 3) (F-actin cross-linking protein) Q08209 PP2BA_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit alpha isoform) Q08211 DHX9_HUMAN ATP-dependent RNA helicase A (RHA) (EC 3.6.4.13) (DEAH box protein 9) (Leukophysin) (LKP) (Nuclear DNA helicase II) (NDH II) Q08257 QOR_HUMAN Quinone oxidoreductase (EC 1.6.5.5) (NADPH:quinone reductase) (Zeta-crystallin) 009028 RBBP4_HUMAN Histone-binding protein RBBP4 (Chromatin assembly factor 1 subunit C) (CAF-1 subunit C) (Chromatin assembly factor I p48 subunit) (CAF-I
48 kDa subunit) (CAF-I p48) (Nucleosome-remodeling factor subunit RBAP48) (Retinoblastoma-binding protein 4) (RBBP-4) (Retinoblastoma-binding protein p48) 009666 AH N K_H U MAN Neuroblast differentiation-associated protein AHNAK (Desmoyokin) QOVAK6 LMOD3_HUMAN Leiomodin-3 (Leiomodin, fetal form) QOZGT2 NEXN_HUMAN Nexilin (F-actin-binding protein) (Nelin) 012846 STX4_HUMAN Syntaxin-4 (Renal carcinoma antigen NY-REN-31) 012882 DPYD_HUMAN Dihydropyrimidine dehydrogenase [NADP(+)] (DHPDHase) (DPD) (EC
1.3.1.2) (Dihydrothymine dehydrogenase) (Dihydrouracil dehydrogenase) 012888 TP53B_HUMAN Tumor suppressor p53-binding protein 1 (53BP1) (p53-binding protein 1) (p53BP1) 012905 ILF2_HUMAN Interleukin enhancer-binding factor 2 (Nuclear factor of activated 1-cells 45 kDa) 012906 ILF3_HUMAN Interleukin enhancer-binding factor 3 (Double-stranded RNA-binding protein 76) (DRBP76) (M-phase phosphoprotein 4) (MPP4) (Nuclear factor associated with dsRNA) (NFAR) (Nuclear factor of activated 1-cells 90 kDa) (NF-AT-90) (Translational control protein 80) (TCP80) 012931 TRAP1_HUMAN Heat shock protein 75 kDa, mitochondrial (HSP 75) (TNFR-associated protein 1) (Tumor necrosis factor type 1 receptor-associated protein) (TRAP-1) Q13011 ECH1_HUMAN Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial (EC 5.3.3.-) Q13033 STRN3_HUMAN Striatin-3 (Cell cycle autoantigen SG2NA) (S/G2 antigen) Q13045 FLII_HUMAN Protein flightless-1 homolog 013057 COASY_HUMAN Bifunctional coenzyme A synthase (CoA synthase) (NBP) (P0V-2) [Includes: Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT); Dephospho-CoA kinase (DPCK) (EC
2.7.1.24) (Dephosphocoenzyme A kinase) (DPCOAK)]
013061 TRDN_HUMAN Triadin 013098 CSN1_HUMAN COP9 signalosome complex subunit 1 (SGN1) (Signalosome subunit 1) (G protein pathway suppressor 1) (GPS-1) (JAB1-containing signalosome subunit 1) (Protein MFH) Q13126 MTAP_HUMAN S-methyl-5'-thioadenosine phosphorylase (EC 2.4.2.28) (5'-methylthioadenosine phosphorylase) (MTA phosphorylase) (MTAP) (MTAPase) Q13148 TADBP_HUMAN TAR DNA-binding protein 43 (TDP-43) 013162 PRDX4_HUMAN Peroxiredoxin-4 (EC 1.11.1.15) (Antioxidant enzyme A0E372) (A0E37-2) (Peroxiredoxin IV) (Prx-IV) (Thioredoxin peroxidase A0372) (Thioredoxin-dependent peroxide reductase A0372) 013177 PAK2_HUMAN Serine/threonine-protein kinase PAK 2 (EC 2.7.11.1) (Gamma-PAK) (PAK65) (S6/H4 kinase) (p21-activated kinase 2) (PAK-2) (p58) [Cleaved into: PAK-2p27 (p27); PAK-2p34 (p34) (C-t-PAK2)]
013200 PSMD2_HUMAN 26S proteasome non-ATPase regulatory subunit 2 (265 proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S
proteasome subunit p97) (Protein 55.11) (Tumor necrosis factor type 1 receptor-associated protein 2) 013228 SBP1_HUMAN Selenium-binding protein 1 (56 kDa selenium-binding protein) (SBP56) (SP56) 013247 SRSF6_HUMAN Serine/arginine-rich splicing factor 6 (Pre-mRNA-splicing factor SRP55) (Splicing factor, arginine/serine-rich 6) 013263 TIF1B_HUMAN Transcription intermediary factor 1-beta (TI Fl-beta)(E3 SUMO-protein ligase TRIM28) (EC 6.3.2.-) (KRAB-associated protein 1) (KAP-1) (KRAB-interacting protein 1) (KRIP-1) (Nuclear corepressor KAP-1) (RING
finger protein 96) (Tripartite motif-containing protein 28) 013283 G3BP1_HUMAN Ras GTPase-activating protein-binding protein 1 (G3BP-1) (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent DNA helicase VIII) (hDH VIII) (GAP SH3 domain-binding protein 1) Q13310 PABP4_HUMAN Polyadenylate-binding protein 4 (PABP-4) (Poly(A)-binding protein 4) (Activated-platelet protein 1) (APP-1) (Inducible poly(A)-binding protein) (iPABP) Q13326 SGCG_HUMAN Gamma-sarcoglycan (Gamma-SG) (35 kDa dystrophin-associated glycoprotein) (35DAG) Q13347 ElF3I_HUMAN Eukaryotic translation initiation factor 3 subunit I
(eIF3i) (Eukaryotic translation initiation factor 3 subunit 2) (TGF-beta receptor-interacting protein 1) (TRIP-1) (eIF-3-beta) (eIF3 p36) Q13409 DC1I2_HUMAN Cytoplasmic dynein 1 intermediate chain 2 (Cytoplasmic dynein intermediate chain 2) (Dynein intermediate chain 2, cytosolic) (DH IC-2) Q13423 NNTM_HUMAN NAD(P) transhydrogenase, mitochondrial (EC 1.6.1.2) (Nicotinamide nucleotide transhydrogenase) (Pyridine nucleotide transhydrogenase) Q13424 SNTAl_HUMAN Alpha-l-syntrophin (59 kDa dystrophin-associated protein Al acidic component 1) (Pro-TGF-alpha cytoplasmic domain-interacting protein 1) (TACIP1) (Syntrophin-1) Q13425 SNTB2_HUMAN Beta-2-syntrophin (59 kDa dystrophin-associated protein Al basic component 2) (Syntrophin-3) (SNT3) (Syntrophin-like) (SNTL) Q13442 HAP28_HUMAN 28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1) Q13554 KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II
subunit beta (CaM kinase II subunit beta) (CaMK-II subunit beta) (EC 2.7.11.17) 013555 KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II
subunit gamma (CaM kinase II subunit gamma) (CaMK-II subunit gamma) (EC
2.7.11.17) Q13557 KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II
subunit delta (CaM kinase II subunit delta) (CaMK-II subunit delta) (EC 2.7.11.17) Q13561 DCTN2_HUMAN Dynactin subunit 2 (50 kDa dynein-associated polypeptide) (Dynactin complex 50 kDa subunit) (DCTN-50) (p50 dynamitin) 013564 ULAl_HUMAN NEDD8-activating enzyme El regulatory subunit (Amyloid beta precursor protein-binding protein 1, 59 kDa) (APP-BP1) (Amyloid protein-binding protein 1) (Proto-oncogene protein 1) 013576 IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 013616 CULl_HUMAN CuIlin-1 (CUL-1) Q13617 CUL2_HUMAN CuIlin-2 (CUL-2) Q13618 CUL3_HUMAN CuIlin-3 (CUL-3) 013619 CUL4A_HUMAN CuIlin-4A (CUL-4A) Q13642 FHLl_HUMAN Four and a half LIM domains protein 1 (FHL-1) (Skeletal muscle LIM-protein 1) (SLIM) (SLIM-1) Q13698 CAC1S_HUMAN Voltage-dependent L-type calcium channel subunit alpha-15 (Calcium channel, L type, alpha-1 polypeptide, isoform 3, skeletal muscle) (Voltage-gated calcium channel subunit alpha Cav1.1) 013765 NACA_HUMAN Nascent polypeptide-associated complex subunit alpha (NAC-alpha) (Alpha-NAC) (allergen Horn s 2) 013813 SPINl_HUMAN Spectrin alpha chain, non-erythrocytic 1 (Alpha-II
spectrin) (Fodrin alpha chain) (Spectrin, non-erythroid alpha subunit) Q13838 DX39B_HUMAN Spliceosome RNA helicase DDX39B (EC 3.6.4.13) (56 kDa associated protein) (ATP-dependent RNA helicase p47) (DEAD box protein UAP56) (HLA-B-associated transcript 1 protein) 013867 BLMH_HUMAN Bleomycin hydrolase (BH) (BLM hydrolase) (BMH) (EC
3.4.22.40) Q13884 SNTBl_HUMAN Beta-l-syntrophin (59 kDa dystrophin-associated protein Al basic component 1) (DAPA1B) (BSYN2) (Syntrophin-2) (Tax interaction protein 43) (TIP-43) 013885 TBB2A_HUMAN Tubulin beta-2A chain (Tubulin beta classlla) Q14103 HNRPD_HUMAN Heterogeneous nuclear ribonucleoprotein DO (hnRNP DO) (AU-rich element RNA-binding protein 1) Q14108 SCRB2_HUMAN Lysosome membrane protein 2 (85 kDa lysosomal membrane sialoglycoprotein) (LGP85) (CD36 antigen-like 2) (Lysosome membrane protein 11) (LIMP 11) (Scavenger receptor class B member 2) (CD antigen CD36) Q14118 DAG1_HUMAN Dystroglycan (Dystrophin-associated glycoprotein 1) [Cleaved into:
Alpha-dystroglycan (Alpha-DG); Beta-dystroglycan (Beta-DG)]
014134 TRI29_HUMAN Tripartite motif-containing protein 29 (Ataxia telangiectasia group D-associated protein) Q14152 ElF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A
(eIF3a) (Eukaryotic translation initiation factor 3 subunit 10) (eIF-3-theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) Q14157 UBP2L_HUMAN Ubiquitin-associated protein 2-like (Protein NICE-4) 014195 DPYL3_HUMAN Dihydropyrimidinase-related protein 3 (DRP-3) (Collapsin response mediator protein 4) (CRMp-4) (Unc-33-like phosphoprotein 1) (ULIP-1) Q14203 DCTN1_HUMAN Dynactin subunit 1 (150 kDa dynein-associated polypeptide) (DAP-150) (DP-150) (p135) (p150-glued) 014204 DYHC1_HUMAN Cytoplasmic dynein 1 heavy chain 1 (Cytoplasmic dynein heavy chain 1) (Dynein heavy chain, cytosolic) Q14240 IF4A2_HUMAN Eukaryotic initiation factor 4A-11(eIF-4A-II) (eIF4A-11) (EC 3.6.4.13) (ATP-dependent RNA helicase elF4A-2) Q14254 FLOT2_HUMAN Flotillin-2 (Epidermal surface antigen) (ESA) (Membrane component chromosome 17 surface marker 1) 014257 RCN2_HUMAN Reticulocalbin-2 (Calcium-binding protein ERC-55) (E6-binding protein) (E6BP) Q14315 FLNC_HUMAN Filamin-C (FLN-C) (FLNc) (ABP-280-like protein) (ABP-L) (Actin-binding-like protein) (Filamin-2) (Gamma-filamin) 014324 MYPC2_HUMAN Myosin-binding protein C, fast-type (Fast MyBP-C) (C-protein, skeletal muscle fast isoform) 014353 GAMT_HUMAN Guanidinoacetate N-methyltransferase (EC 2.1.1.2) Q14624 ITIH4_HUMAN Inter-alpha-trypsin inhibitor heavy chain H4 (Ill heavy chain H4) (ITI-HC4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (Gp120) (PK-120) [Cleaved into: 70 kDa inter-alpha-trypsin inhibitor heavy chain H4; 35 kDa inter-alpha-trypsin inhibitor heavy chain H4]
014683 SMC1A_HUMAN Structural maintenance of chromosomes protein 1A (SMC
protein 1A) (SMC-1-alpha) (SMC-1A) (Sb1.8) 014697 GANAB_HUMAN Neutral alpha-glucosidase AB (EC 3.2.1.84) (Alpha-glucosidase 2) (Glucosidase II subunit alpha) 014738 2A5D_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform (PP2A B subunit isoform B'-delta) (PP2A B subunit isoform 656-delta) (PP2A B subunit isoform PR61-delta) (PP2A B
subunit isoform R5-delta) 014764 MVP_HUMAN Major vault protein (MVP) (Lung resistance-related protein) 014894 CRYM_HUMAN Thiomorpholine-carboxylate dehydrogenase (EC 1.5.1.25) (Mu-crystallin homolog) (NADP-regulated thyroid-hormone-binding protein) (ketimine reductase) 014974 IMB1_HUMAN Importin subunit beta-1 (Importin-90) (Karyopherin subunit beta-1) (Nuclear factor p97) (Pore targeting complex 97 kDa subunit) (PTAC97) Q14BN4 SLMAP_HUMAN Sarcolemmal membrane-associated protein (Sarcolemmal-associated protein) 015018 F175B_HUMAN BRISC complex subunit Abrol (Abraxas brother protein 1) (Protein FAM175B) Q15019 SEPT2_HUMAN Septin-2 (Neural precursor cell expressed developmentally down-regulated protein 5) (NEDD-5) Q15029 U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component (Elongation factor Tu GTP-binding domain-containing protein 2) (SNU114 homolog) (hSNU114) (U5 snRNP-specific protein, 116 kDa) (U5-116 kDa) Q15056 IF4H_HUMAN Eukaryotic translation initiation factor 4H (eIF-4H) (Williams-Beuren syndrome chromosomal region 1 protein) Q15063 POSTN_HUMAN Periostin (PN) (Osteoblast-specific factor 2) (05F-2) 015075 EEAl_HUMAN Early endosome antigen 1 (Endosome-associated protein p162) (Zinc finger FYVE domain-containing protein 2) 015084 PDIA6_HUMAN Protein disulfide-isomerase A6 (EC 5.3.4.1) (Endoplasmic reticulum protein 5) (ER protein 5) (ERp5) (Protein disulfide isomerase P5) (Thioredoxin domain-containing protein 7) 015111 PLCLl_HUMAN Inactive phospholipase C-like protein 1 (PLC-L1) (Phospholipase C-deleted in lung carcinoma) (Phospholipase C-related but catalytically inactive protein) (PRIP) 015124 PGM5_HUMAN Phosphoglucomutase-like protein 5 (Aciculin) (Phosphoglucomutase-related protein) (PGM-RP) Q15149 PLEC_HUMAN Plectin (PCN) (PLTN) (Hemidesmosomal protein 1) (HD1) (Plectin-1) 015172 2A5A_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform (PP2A B subunit isoform B'-alpha) (PP2A B subunit isoform B56-alpha) (PP2A B subunit isoform PR61-alpha) (PR6lalpha) (PP2A B subunit isoform R5-alpha) Q15181 IPYR_HUMAN Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) Q15233 NONO _HUMAN Non-POU domain-containing octamer-binding protein (Non protein) (54 kDa nuclear RNA- and DNA-binding protein) (55 kDa nuclear protein) (DNA-binding p52/p100 complex, 52 kDa subunit) (NMT55) (p54(nrb)) (p54nrb) 015257 PTPA_HUMAN Serine/threonine-protein phosphatase 2A activator (EC
5.2.1.8) (PP2A, subunit B', PR53 isoform) (Phosphotyrosyl phosphatase activator) (PTPA) (Serine/threonine-protein phosphatase 2A regulatory subunit 4) (Serine/threonine-protein phosphatase 2A regulatory subunit B') 015276 RABEl_HUMAN Rab GTPase-binding effector protein 1 (Rabaptin-4) (Rabaptin-5) (Rabaptin-5alpha) (Renal carcinoma antigen NY-REN-17) 015365 PCBPl_HUMAN Poly(rC)-binding protein 1 (Alpha-CP1) (Heterogeneous nuclear ribonucleoprotein El) (hnRNP El) (Nucleic acid-binding protein SUB2.3) 015366 PCBP2_HUMAN Poly(rC)-binding protein 2 (Alpha-CP2) (Heterogeneous nuclear ribonucleoprotein E2) (hnRNP E2) 015404 RSUl_HUMAN Ras suppressor protein 1 (RSP-1) (Rsu-1) 015413 RYR3_HUMAN Ryanodine receptor 3 (RYR-3) (RyR3) (Brain ryanodine receptor-calcium release channel) (Brain-type ryanodine receptor) (Type 3 ryanodine receptor) Q15435 PP1R7_HUMAN Protein phosphatase 1 regulatory subunit 7 (Protein phosphatase 1 regulatory subunit 22) Q15436 SC23A_HUMAN Protein transport protein Sec23A (SEC23-related protein A) Q15555 MARE2_HUMAN Microtubule-associated protein RP/EB family member 2 (APC-binding protein EB2) (End-binding protein 2) (EB2) Q15582 BGH3_HUMAN Transforming growth factor-beta-induced protein ig-h3 (Beta ig-h3) (Kerato-epithelin) (RGD-containing collagen-associated protein) (RGD-CAP) Q15717 ELAV1_HUMAN ELAV-like protein 1 (Hu-antigen R) (HuR) 015746 MYLK_HUMAN Myosin light chain kinase, smooth muscle (MLCK) (smMLCK) (EC
2.7.11.18) (Kinase-related protein) (KRP) (Telokin) [Cleaved into:
Myosin light chain kinase, smooth muscle, deglutamylated form]
Q15772 SPEG_HUMAN Striated muscle preferentially expressed protein kinase (EC 2.7.11.1) (Aortic preferentially expressed protein 1) (APEG-1) Q16134 ETFD_HUMAN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial (ETF-QO) (ETF-ubiquinone oxidoreductase) (EC 1.5.5.1) (Electron-transferring-flavoprotein dehydrogenase) (ETF
dehydrogenase) Q16181 SEPT7_HUMAN Septin-7 (CDC10 protein homolog) Q16363 LAMA4_HUMAN Laminin subunit alpha-4 (Laminin-14 subunit alpha) (Laminin-8 subunit alpha) (Laminin-9 subunit alpha) Q16531 DDB1_HUMAN DNA damage-binding protein 1 (DDB p127 subunit) (DNA
damage-binding protein a) (DDBa) (Damage-specific DNA-binding protein 1) (HBV X-associated protein 1) (XAP-1) (UV-damaged DNA-binding factor) (UV-damaged DNA-binding protein 1) (UV-DDB 1) (XPE-binding factor) (XPE-BF) (Xeroderma pigmentosum group E-complementing protein) (XPCe) Q16543 CDC37_HUMAN Hsp90 co-chaperone Cdc37 (Hsp90 chaperone protein kinase-targeting subunit) (p50Cdc37) [Cleaved into: Hsp90 co-chaperone Cdc37, N-terminally processed]
Q16555 DPYL2_HUMAN Dihydropyrimidinase-related protein 2 (DRP-2) (Collapsin response mediator protein 2) (CRMP-2) (N2A3) (Unc-33-like phosphoprotein 2) (ULIP-2) Q16576 RBBP7_HUMAN Histone-binding protein RBBP7 (Histone acetyltransferase type B
subunit 2) (Nucleosome-remodeling factor subunit RBAP46) (Retinoblastoma-binding protein 7) (RBBP-7) (Retinoblastoma-binding protein p46) 016630 CPSF6_HUMAN Cleavage and polyadenylation specificity factor subunit 6 (Cleavage and polyadenylation specificity factor 68 kDa subunit) (CF1m68) (CPSF
68 kDa subunit) (Pre-mRNA cleavage factor Im 68 kDa subunit) (Protein HPBRII-4/7) Q16658 FSCN1_HUMAN Fascin (55 kDa actin-bundling protein) (Singed-like protein) (p55) 016698 DECR_HUMAN 2,4-dienoyl-CoA reductase, mitochondrial (EC
1.3.1.34) (2,4-dienoyl-CoA reductase [NADPH]) (4-enoyl-00A reductase [NADPH]) 016718 NDUA5_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 (Complex I subunit B13) (Complex I-13kD-B) (CI-13kD-B) (NADH-ubiquinone oxidoreductase 13 kDa-B subunit) Q16775 GL02_HUMAN Hydroxyacylglutathione hydrolase, mitochondrial (EC
3.1.2.6) (Glyoxalase II) (Glx II) Q16795 NDUA9_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondria! (Complex I-39kD) (CI-39kD) (NADH-ubiquinone oxidoreductase 39 kDa subunit) 016816 PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform (PHK-gamma-M) (EC 2.7.11.19) (Phosphorylase kinase subunit gamma-1) (Serine/threonine-protein kinase PHKG1) (EC 2.7.11.1) (EC
2.7.11.26) Q16821 PPR3A_HUMAN Protein phosphatase 1 regulatory subunit 3A (Protein phosphatase 1 glycogen-associated regulatory subunit) (Protein phosphatase type-1 glycogen targeting subunit) (RG1) Q16836 HCDH_HUMAN Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial (HCDH) (EC
1.1.1.35) (Medium and short-chain L-3-hydroxyacyl-coenzyme A
dehydrogenase) (Short-chain 3-hydroxyacyl-CoA dehydrogenase) Q16851 UGPA_HUMAN UTP--glucose-1-phosphate uridylyltransferase (EC
2.7.7.9) (UDP-glucose pyrophosphorylase) (UDPGP) (UGPase) 016881 TRXR1_HUMAN Thioredoxin reductase 1, cytoplasmic (TR) (EC
1.8.1.9) (Gene associated with retinoic and interferon-induced mortality 12 protein) (GRIM-12) (Gene associated with retinoic and IFN-induced mortality 12 protein) (KM-102-derived reductase-like factor) (Thioredoxin red uctase TR1) Q16891 IMMT_HUMAN Mitochondrial inner membrane protein (Cell proliferation-inducing gene 4/52 protein) (Mitofilin) (p87/89) Q2TBA0 KLH4O_HUMAN Kelch-like protein 40 (Kelch repeat and BIB domain-containing protein 5) (Sarcosynapsin) Q32P28 P3H1_HUMAN Prolyl 3-hydroxylase 1 (EC 1.14.11.7) (Growth suppressor 1) (Leucine-and proline-enriched proteoglycan 1) (Leprecan-1) Q3LXA3 DHAK_HUMAN Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing) [Includes: ATP-dependent dihydroxyacetone kinase (DHA
kinase) (EC 2.7.1.28) (EC 2.7.1.29) (Glycerone kinase) (Triokinase) (Triose kinase); FAD-AMP lyase (cyclizing) (EC 4.6.1.15) (FAD-AMP
lyase (cyclic FMN forming)) (FMN cyclase)]
Q53GG5 PDLI3_HUMAN PDZ and LIM domain protein 3 (Actinin-associated LIM
protein) (Alpha-actinin-2-associated LIM protein) Q562R1 ACTBL_HUMAN Beta-actin-like protein 2 (Kappa-actin) Q58WW2 DCAF6_HUMAN DDB1- and CUL4-associated factor 6 (Androgen receptor complex-associated protein) (ARCAP) (I0 motif and WD repeat-containing protein 1) (Nuclear receptor interaction protein) (NRIP) Q5BKX8 MURC_HUMAN Muscle-related coiled-coil protein (Muscle-restricted coiled-coil protein) Q5D862 FILA2_HUMAN Filaggrin-2 (FLG-2) (Intermediate filament-associated and psoriasis-susceptibility protein) (Ifapsoriasin) Q5JRX3 PREP_HUMAN Presequence protease, mitochondria! (hPreP) (EC
3.4.24.-) (Pitrilysin metalloproteinase 1) (Metalloprotease 1) (hMP1) Q5SSJ5 HP1B3_HUMAN Heterochromatin protein 1-binding protein 3 (Protein HP1-BP74) Q5T440 CAF17_HUMAN Putative transferase CAF17, mitochondrial (EC 2.1.-.-) (Iron-sulfur cluster assembly factor homolog) 05T4S7 UBR4_HUMAN E3 ubiquitin-protein ligase UBR4 (EC 6.3.2.-) (600 kDa retinoblastoma protein-associated factor) (N-recognin-4) (Retinoblastoma-associated factor of 600 kDa) (R8AF600) (p600) (Zinc finger UBR1-type protein 1) Q5VST9 OBSCN_HUMAN Obscurin (EC 2.7.11.1) (Obscurin-RhoGEF) (Obscurin-myosin light chain kinase) (Obscurin-MLCK) Q5VTT5 MYOM3_HUMAN Myomesin-3 (Myomesin family member 3) Q5VWP3 MLIP_HUMAN Muscular LM NA-interacting protein (Muscular-enriched A-type laminin-interacting protein) Q5VYK3 ECM29_HUMAN Proteasome-associated protein ECM29 homolog (Ecm29) Q6DKJ4 NXN_HUMAN Nucleoredoxin (EC 1.8.1.8) Q6IBSO TWF2_HUMAN Twinfilin-2 (A6-related protein) (hA6RP) (Protein tyrosine kinase 9-like) (Twinfilin-1-like protein) Q6IQ22 RAB12_HUMAN Ras-related protein Rab-12 Q6NVY1 HIBCH_HUMAN 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial (EC
3.1.2.4) (3-hydroxyisobutyryl-coenzyme A hydrolase) (HIB-CoA hydrolase) (HIBYL-CoA-H) Q6NZI2 PTRF_HUMAN Polymerase I and transcript release factor (Cavin-1) Q6PCB7 S27A1_HUMAN Long-chain fatty acid transport protein 1 (FATP-1) (Fatty acid transport protein 1) (EC 6.2.14 (Solute carrier family 27 member 1) Q6QEF8 COR06_HUMAN Coronin-6 (Coronin-like protein E) (Clipin-E) 06Y288 B3GLT_HUMAN Beta-1,3-glucosyltransferase (Beta3G1c-T) (EC 2.4.14 (Beta-3-glycosyltransferase-like) Q6YN16 HSDL2_HUMAN Hydroxysteroid dehydrogenase-like protein 2 (EC 1.-.-.-) Q6ZMU5 TRI72_HUMAN Tripartite motif-containing protein 72 (Mitsugumin-53) (Mg53) Q702N8 XIRP1_HUMAN Xin actin-binding repeat-containing protein 1 (Cardiomyopathy-associated protein 1) Q7KZF4 SND1_HUMAN Staphylococcal nuclease domain-containing protein 1 (100 kDa coactivator) (EBNA2 coactivator p100) (Tudor domain-containing protein 11) (p100 co-activator) Q7L2H7 ElF3M_HUMAN Eukaryotic translation initiation factor 3 subunit M
(eIF3m) (Fetal lung protein 85) (hFL-B5) (PCI domain-containing protein 1) Q7L5N1 CSN6_HUMAN COP9 signalosome complex subunit 6 (SGN6) (Signalosome subunit 6) (JAM-containing signalosome subunit 6) (M0V34 homolog) (Vpr-interacting protein) (hVIP) Q7Z3B4 NUP54_HUMAN Nucleoporin p54 (54 kDa nucleoporin) Q7Z3D6 CN159_HUMAN UPF0317 protein C14orf159, mitochondrial Q7Z406 MYH14_HUMAN Myosin-14 (Myosin heavy chain 14) (Myosin heavy chain, non-muscle 11c) (Non-muscle myosin heavy chain 11c) (NMHC II-C) Q7Z460 CLAP1_HUMAN CLIP-associating protein 1 (Cytoplasmic linker-associated protein 1) (Multiple asters homolog 1) (Protein Orbit homolog 1) (hOrbit1) 07Z6Z7 HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 (EC 6.3.2.-) (ARF-binding protein 1) (ARF-BP1) (HECT, UBA and WWE domain-containing protein 1) (Homologous to E6AP carboxyl terminus homologous protein 9) (HectH9) (Large structure of UREB1) (LASU1) (Mcl-1 ubiquitin ligase E3) (Mule) (Upstream regulatory element-binding protein 1) (URE-B1) (U RE-binding protein 1) Q86TC9 MYPN_HUMAN Myopalladin (145 kDa sarcomeric protein) Q86TD4 SRCA_HUMAN Sarcalumenin Q86TX2 ACOT1_HUMAN Acyl-coenzyme A thioesterase 1 (Acyl-CoA thioesterase 1) (EC 3.1.2.2) (CTE-I) (CTE-lb) (Inducible cytosolic acyl-coenzyme A thioester hydrolase) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) Q86UP2 KTN1_HUMAN Kinectin (CG-1 antigen) (Kinesin receptor) Q86VP6 CAND1_HUMAN Cullin-associated NEDD8-dissociated protein 1 (CuIlin-associated and neddylation-dissociated protein 1) (TBP-interacting protein of 120 kDa A) (TBP-interacting protein 120A) (p120 CANDI.) Q86VS8 HOOK3_HUMAN Protein Hook homolog 3 (h-hook3) (hHK3) Q8IVN3 MSTN1_HUMAN Musculoskeletal embryonic nuclear protein 1 08IWX7 UN45B_HUMAN Protein unc-45 homolog B (Unc-45B) (SMUNC45) Q8IZP2 ST134_HUMAN Putative protein FAM10A4 (Suppression of tumorigenicity 13 pseudogene 4) Q8N142 PURA1_HUMAN Adenylosuccinate synthetase isozyme 1 (AMPSase 1) (AdSS 1) (EC
6.3.4.4) (Adenylosuccinate synthetase, basic isozyme) (Adenylosuccinate synthetase, muscle isozyme) (M-type adenylosuccinate synthetase) (IMP--aspartate ligase 1) Q8N163 K1967_HUMAN DBIRD complex subunit KIAA1967 (Deleted in breast cancer gene 1 protein) (DBC-1) (DBC.1) (p30 DBC) Q8N1G4 LRC47_HUMAN Leucine-rich repeat-containing protein 47 Q8N335 GPD1L_HUMAN Glycerol-3-phosphate dehydrogenase 1-like protein (GPD1-L) (EC
1.1.1.8) Q8N3K9 CMYA5_HUMAN Cardiomyopathy-associated protein 5 (Dystrobrevin-binding protein 2) (Genethonin-3) (Myospryn) (SPRY domain-containing protein 2) (Tripartite motif-containing protein 76) Q8N3L3 TXLNB_HUMAN Beta-taxilin (Muscle-derived protein 77) (hMDP77) Q8N3V7 SYNPO_HUMAN Synaptopodin Q8N8N7 PTGR2_HUMAN Prostaglandin reductase 2 (PRG-2) (EC 1.3.1.48) (15-oxoprostaglandin

13-reductase) (Zinc-binding alcohol dehydrogenase domain-containing protein 1) Q8NB12 SMYD1_HUMAN Histone-lysine N-methyltransferase SMYD1 (EC
2.1.1.43) (SET and MYND domain-containing protein 1) Q8NBF2 NHLC2_HUMAN NHL repeat-containing protein 2 Q8NBS9 TXNDS_HUMAN Thioredoxin domain-containing protein 5 (Endoplasmic reticulum resident protein 46) (ER protein 46) (ERp46) (Thioredoxin-like protein p46) Q8NC51 PAIRB_HUMAN Plasminogen activator inhibitor 1 RNA-binding protein (PAI1 RNA-binding protein 1) (PAI-RBP1) (SERPINE1 mRNA-binding protein 1) Q8NCN5 PDPR_HUMAN Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial (PDPr) Q8NCW5 NNRE_HUMAN NAD(P)H-hydrate epimerase (EC 5.1.99.6) (Apolipoprotein A-I-binding protein) (Al-BP) (NAD(P)HX epimerase) (YjeF N-terminal domain-containing protein 1) (YjeF_N1) Q8NDH3 PEPL1_HUMAN Probable aminopeptidase NPEPL1 (EC 3.4.11.-) (Aminopeptidase-like 1) 08NE71 ABCF1_HUMAN ATP-binding cassette sub-family F member 1 (ATP-binding cassette 50) (TNF-alpha-stimulated ABC protein) Q8NHH9 ATLA2_HUMAN Atlastin-2 (EC 3.6.5.-) (ADP-ribosylation factor-like protein 6-interacting protein 2) (ARL-6-interacting protein 2) (Aip-2) Q8NI60 ADCK3_HUMAN Chaperone activity of bc1 complex-like, mitochondrial (Chaperone-ABC1-like) (EC 2.7.11.-) (aarF domain-containing protein kinase 3) Q8TCAO LRC20_HUMAN Leucine-rich repeat-containing protein 20 Q8TD19 NEK9_HUMAN Serine/threonine-protein kinase Nek9 (EC 2.7.11.1) (Nercc1 kinase) (Never in mitosis A-related kinase 9) (NimA-related protein kinase 9) (NimA-related kinase 8) (Nek8) Q8TD30 ALAT2_HUMAN Alanine aminotransferase 2 (ALT2) (EC 2.6.1.2) (Glutamate pyruvate transaminase 2) (GPT 2) (Glutamic--alanine transaminase 2) (Glutamic--pyruvic transaminase 2) Q8WTS6 SETD7_HUMAN Histone-lysine N-methyltransferase SETD7 (EC
2.1.1.43) (Histone H3-K4 methyltransferase SETD7) (H3-K4-HMTase SETD7) (Lysine N-methyltransferase 7) (SET domain-containing protein 7) (SET7/9) 08WU90 ZC3HF_HUMAN Zinc finger CCCH domain-containing protein 15 (DRG
family-regulatory protein 1) (Likely ortholog of mouse immediate early response erythropoietin 4) Q8WUM4 PDC6I_HUMAN Programmed cell death 6-interacting protein (PDCD6-interacting protein) (ALG-2-interacting protein 1) (ALG-2-interacting protein X) (Hp95) Q8WVM8 SCFD1_HUMAN Sec1 family domain-containing protein 1 (SLY1 homolog) (Sly1p) (Syntaxin-binding protein 1-like 2) 08WW22 DNJA4_HUMAN DnaJ homolog subfamily A member 4 Q8WWV3 RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondria!
(NOGO-interacting mitochondrial protein) Q8WWY3 PRP31_HUMAN U4/U6 small nuclear ribonucleoprotein Prp31 (Pre-mRNA-processing factor 31) (Serologically defined breast cancer antigen NY-BR-99) (U4/U6 snRNP 61 kDa protein) (Protein 61K) (hPrp31) 08WZ42 TITIN_HUMAN Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14) Q92499 DDX1_HUMAN ATP-dependent RNA helicase DDX1 (EC 3.6.4.13) (DEAD
box protein 1) (DEAD box protein retinoblastoma) (DBP-RB) 092523 CPT1B_HUMAN Carnitine 0-palmitoyltransferase 1, muscle isoform (CPT1-M) (EC
2.3.1.21) (Carnitine 0-palmitoyltransferase I, muscle isoform) (CPT I) (CPTI-M) (Carnitine palm itoyltransferase 1B) (Carnitine palmitoyltransferase I-like protein) 092598 HS105_HUMAN Heat shock protein 105 kDa (Antigen NY-CO-25) (Heat shock 110 kDa protein) 092614 MY18A_HUMAN Unconventional myosin-XVIlla (Molecule associated with JAK3 N-terminus) (MAJN) (Myosin containing a PDZ domain) 092626 PXDN_HUMAN Peroxidasin homolog (EC 1.11.1.7) (Melanoma-associated antigen MG50) (Vascular peroxidase 1) (p53-responsive gene 2 protein) Q92629 SGCD_HUMAN Delta-sarcoglycan (Delta-SG) (35 kDa dystrophin-associated glycoprotein) (35DAG) Q92734 TFG_HUMAN Protein TFG (TRK-fused gene protein) 092769 HDAC2_HUMAN Histone deacetylase 2 (HD2) (EC 3.5.1.98) Q92841 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 (EC
3.6.4.13) (DEAD box protein 17) (DEAD box protein p72) (RNA-dependent helicase p72) Q92882 OSTF1_HUMAN Osteoclast-stimulating factor 1 Q92905 CSN5_HUMAN COP9 signalosome complex subunit 5 (SGN5) (Signalosome subunit 5) (EC 3.4.-.-) (Jun activation domain-binding protein 1) 092945 FUBP2_HUMAN Far upstream element-binding protein 2 (FUSE-binding protein 2) (KH
type-splicing regulatory protein) (KSRP) (p75) Q92973 TNP01_HUMAN Transportin-1 (Importin beta-2) (Karyopherin beta-2) (M9 region interaction protein) (MIP) Q92995 UBP13_HUMAN Ubiquitin carboxyl-terminal hydrolase 13 (EC
3.4.19.12) (Deubiquitinating enzyme 13) (Isopeptidase T-3) (ISOT-3) (Ubiquitin thioesterase 13) (Ubiquitin-specific-processing protease 13) Q93008 USP9X_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-X
(EC 3.4.19.12) (Deubiquitinating enzyme FAF-X) (Fat facets in mammals) (hFAM) (Fat facets protein-related, X-linked) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific protease 9, X chromosome) (Ubiquitin-specific-processing protease FAF-X) Q93034 CUL5_HUMAN CuIlin-5 (CU L-5)(Vasopressin-activated calcium-mobilizing receptor 1) (VACM-1) 093100 KPBB_HUMAN Phosphorylase b kinase regulatory subunit beta (Phosphorylase kinase subunit beta) Q969X5 ERGI1_HUMAN Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ER-Golgi intermediate compartment 32 kDa protein) (ERGIC-32) Q96A32 MLRS_HUMAN Myosin regulatory light chain 2, skeletal muscle isoform (Fast skeletal myosin light chain 2) (MLC2B) Q96A33 CCD47_HUMAN Coiled-coil domain-containing protein 47 Q96AC1 FERM2_HUMAN Fermitin family homolog 2 (Kindlin-2) (Mitogen-inducible gene 2 protein) (MIG-2) (Pleckstrin homology domain-containing family C
member 1) (PH domain-containing family C member 1) 096AE4 FUBP1_HUMAN Far upstream element-binding protein 1 (FBP) (FUSE-binding protein 1) (DNA helicase V) (hDH V) Q96AG4 LRC59_HUMAN Leucine-rich repeat-containing protein 59 (Ribosome-binding protein p34) (p34) 096AN5 TM143_HUMAN Transmembrane protein 143 Q96AQ6 PBIP1_HUMAN Pre-B-cell leukemia transcription factor-interacting protein 1 (Hematopoietic PBX-interacting protein) Q96AY3 FKB1O_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP10 (PPlase FKBP10) (EC
5.2.1.8) (65 kDa FK506-binding protein) (65 kDa FKBP) (FKBP-65) (FK506-binding protein 10) (FKBP-10) (Immunophilin FKBP65) (Rotamase) Q96BM9 ARL8A_HUMAN ADP-ribosylation factor-like protein 8A (ADP-ribosylation factor-like protein 10B) (Novel small G protein indispensable for equal chromosome segregation 2) Q96CM8 ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial (EC
6.2.1.-) 096CN7 ISOC1_HUMAN Isochorismatase domain-containing protein 1 096CW1 AP2M1_HUMAN AP-2 complex subunit mu (AP-2 mu chain) (Adapter-related protein complex 2 mu subunit) (Adaptin-mu2) (Adaptor protein complex AP-2 subunit mu) (Clathrin assembly protein complex 2 medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (HA2 50 kDa subunit) (Plasma membrane adaptor AP-2 50 kDa protein) Q96DG6 CMBL_HUMAN Carboxymethylenebutenolidase homolog (EC 3.1.-.-) Q96FW1 OTUB1_HUMAN Ubiquitin thioesterase OTUB1 (EC 3.4.19.12) (Deubiquitinating enzyme OTUB1) (OTU domain-containing ubiquitin aldehyde-binding protein 1) (Otubain-1) (hOTU1) (Ubiquitin-specific-processing protease OTUB1) Q96HC4 PDLI5_HUMAN PDZ and LIM domain protein 5 (Enigma homolog) (Enigma-like PDZ
and LIM domains protein) 096199 SUCB2_HUMAN Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial (EC
6.2.1.4) (GTP-specific succinyl-CoA synthetase subunit beta) (Succinyl-CoA synthetase beta-G chain) (SCS-betaG) Q96IU4 ABHEB_HUMAN Alpha/beta hydrolase domain-containing protein 14B
(Abhydrolase domain-containing protein 14B) (EC 3.-.-.-) (CCG1-interacting factor B) Q96K17 BT3L4_HUMAN Transcription factor BTF3 homolog 4 (Basic transcription factor 3-like 4) Q96K76 UBP47_HUMAN Ubiquitin carboxyl-terminal hydrolase 47 (EC
3.4.19.12) (Deubiquitinating enzyme 47) (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) Q96KK5 H2A1H_HUMAN Histone H2A type 1-H (Histone H2A/s) Q96KP1 EXOC2_HUMAN Exocyst complex component 2 (Exocyst complex component Sec5) 096KP4 CNDP2_HUMAN Cytosolic non-specific dipeptidase (EC 3.4.13.18) (CNDP dipeptidase 2) (Glutamate carboxypeptidase-like protein 1) (Peptidase A) 096MF2 STAC3_HUMAN SH3 and cysteine-rich domain-containing protein 3 Q96MG2 JSPR1_HUMAN Junctional sarcoplasmic reticulum protein 1 (Junctional-face membrane protein of 45 kDa homolog) (JP-45) Q96MM6 HS12B_HUMAN Heat shock 70 kDa protein 12B
Q96P63 SPB12_HUMAN Serpin B12 Q96P70 IP09_HUMAN Importin-9 (Imp9) (Ran-binding protein 9) (RanBP9) 096006 PLIN4_HUMAN Perilipin-4 (Adipocyte protein S3-12) Q96QK1 VPS35_HUMAN Vacuolar protein sorting-associated protein 35 (hVPS35) (Maternal-embryonic 3) (Vesicle protein sorting 35) 096RP9 EFGM_HUMAN Elongation factor G, mitochondria! (EF-Gmt) (Elongation factor G 1, mitochondria!) (mEF-G 1) (Elongation factor G1) (hEFG1) Q99460 PSMD1_HUMAN 26S proteasome non-ATPase regulatory subunit 1 (265 proteasome regulatory subunit RPN2) (26S proteasome regulatory subunit Si) (26S
proteasome subunit p112) 099497 PARK7_HUMAN Protein DJ-1 (EC 3.4.-.-) (Oncogene DJ1) (Parkinson disease protein 7) Q99536 VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog (EC
1.-.-.-) Q99541 PLIN2_HUMAN Perilipin-2 (Adipophilin) (Adipose differentiation-related protein) (ADRP) Q99613 ElF3C_HUMAN Eukaryotic translation initiation factor 3 subunit C
(eIF3c) (Eukaryotic translation initiation factor 3 subunit 8) (eIF3 p110) 099615 DNJC7_HUMAN Dna1 homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) Q99623 PHB2_HUMAN Prohibitin-2 (B-cell receptor-associated protein BAP37) (D-prohibitin) (Repressor of estrogen receptor activity) 099714 HCD2_HUMAN 3-hydroxyacyl-CoA dehydrogenase type-2 (EC 1.1.1.35) (17-beta-hydroxysteroid dehydrogenase 10) (17-beta-HSD 10) (EC 1.1.1.51) (3-hydroxy-2-methylbutyryl-CoA dehydrogenase) (EC 1.1.1.178) (3-hydroxyacyl-CoA dehydrogenase type II) (Endoplasmic reticulum-associated amyloid beta-peptide-binding protein) (Mitochondrial ribonuclease P protein 2) (Mitochondrial RNase P protein 2) (Short-chain type dehydrogenase/reductase XH98G2) (Type II HADH) Q99715 COCAl_HUMAN Collagen alpha-1(XII) chain Q99733 NP1L4_HUMAN Nucleosome assembly protein 1-like 4 (Nucleosome assembly protein 2) (NAP-2) Q99798 ACON_HUMAN Aconitate hydratase, mitochondrial (Aconitase) (EC
4.2.1.3) (Citrate hydro-lyase) 099807 C007_HUMAN Ubiquinone biosynthesis protein C007 homolog (Coenzyme Q
biosynthesis protein 7 homolog) (Timing protein clk-1 homolog) Q99816 TS101_HUMAN Tumor susceptibility gene 101 protein (ESCRT-I
complex subunit TSG101) 099832 TCPH_HUMAN 1-complex protein 1 subunit eta (TCP-1-eta) (CCT-eta) (HIV-1 Nef-interacting protein) 099873 ANMl_HUMAN Protein arginine N-methyltransferase 1 (EC 2.1.1.-) (Histone-arginine N-methyltransferase PRMT1) (EC 2.1.1.125) (Interferon receptor 1-bound protein 4) Q9BQ69 MACD1_HUMAN 0-acetyl-ADP-ribose deacetylase MACROD1 (EC 3.2.2.-) (EC 3.5.14 (MACRO domain-containing protein 1) (Protein LRP16) ([Protein ADP-ribosylglutamate] hydrolase) Q9BQE3 TBA1C_HUMAN Tubulin alpha-1C chain (Alpha-tubulin 6) (Tubulin alpha-6 chain) Q9BR39 JPH2_HUMAN Junctophilin-2 (JP-2) (Junctophilin type 2) Q9BRC7 PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 (hPLCD4) (EC 3.1.4.11) (Phosphoinositide phospholipase C-delta-4) (Phospholipase C-delta-4) (PLC-delta-4) Q9BSJ8 ESYTl_HUMAN Extended synaptotagmin-1 (E-Sytl) (Membrane-bound C2 domain-containing protein) Q9BSL1 UBACl_HUMAN Ubiquitin-associated domain-containing protein 1 (UBA domain-containing protein 1) (E3 ubiquitin-protein ligase subunit KPC2) (Glialblastoma cell differentiation-related protein 1) (Kipl ubiquitination-promoting complex protein 2) Q9BT78 CSN4_HUMAN COP9 signalosome complex subunit 4 (SGN4) (Signalosome subunit 4) (JAB1-containing signalosome subunit 4) Q9BUF5 TBB6_HUMAN Tubulin beta-6 chain (Tubulin beta class V) Q9BVA1 TBB2B_HUMAN Tubulin beta-2B chain Q9BW30 TPPP3_HUMAN Tubulin polymerization-promoting protein family member 3 (TPPP/p20) Q9BWH2 FUND2_HUMAN FUN14 domain-containing protein 2 (Cervical cancer proto-oncogene 3 protein) (HCC-3) (Hepatitis C virus core-binding protein 6) Q9BXK5 B2L13_HUMAN Bc1-2-like protein 13 (BcI2-L-13) (Bcl-rambo) (Protein Mill) Q9BXN1 ASPN_HUMAN Asporin (Periodontal ligament-associated protein 1) (PLAP-1) Q9BXP5 SRRT_HUMAN Serrate RNA effector molecule homolog (Arsenite-resistance protein 2) Q9BXS1 ID12_HUMAN Isopentenyl-diphosphate Delta-isomerase 2 (EC
5.3.3.2) (Isopentenyl pyrophosphate isomerase 2) (IPP isomerase 2) (IPP12) Q9BY32 ITPA_HUMAN Inosine triphosphate pyrophosphatase (ITPase) (Inosine triphosphatase) (EC 3.6.1.19) (Non-canonical purine NIP
pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) (Putative oncogene protein hIc14-06-p) Q9BYT8 NEUL_HUMAN Neurolysin, mitochondria! (EC 3.4.24.16) (Angiotensin-binding protein) (Microsomal endopeptidase) (MEP) (Mitochondrial oligopeptidase M) (Neurotensin endopeptidase) Q9BYV2 TRI54_HUMAN Tripartite motif-containing protein 54 (Muscle-specific RING finger protein) (MuRF) (Muscle-specific RING finger protein 3) (MuRF-3) (MuRF3) (RING finger protein 30) Q9BYV7 BCD02_HUMAN Beta,beta-carotene 9',10'-oxygenase (EC 1.13.11.71) (B-diox-II) (Beta-carotene dioxygenase 2) Q9BZQ8 NIBAN_HUMAN Protein Niban (Cell growth-inhibiting gene 39 protein) (Protein FAM129A) Q9GZS3 WDR61_HUMAN WD repeat-containing protein 61 (Meiotic recombination protein homolog) (SKI8 homolog) (Ski8) Q9GZV1 ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 (Skeletal muscle ankyrin repeat protein) (hArpp) Q9HOPO 5NT3A_HUMAN Cytosolic 5'-nucleotidase 3A (EC 3.1.3.5) (Cytosolic 5'-nucleotidase 3) (Cytosolic 5'-nucleotidase III) (cN-III) (Pyrimidine 5'-nucleotidase 1) (P5'N-1) (P5N-1) (PN-I) (Uridine 5'-monophosphate hydrolase 1) (p36) Q9HOR4 HDHD2_HUMAN Haloacid dehalogenase-like hydrolase domain-containing protein 2 Q9HOU4 RAB1B_HUMAN Ras-related protein Rab-1B
09H1E5 TMX4_HUMAN Thioredoxin-related transmembrane protein 4 (Thioredoxin domain-containing protein 13) Q9H223 EHD4_HUMAN EH domain-containing protein 4 (Hepatocellular carcinoma-associated protein 10/11) (PAST homolog 4) Q9H444 CHM4B_HUMAN Charged multivesicular body protein 4b (Chromatin-modifying protein 4b) (CHMP4b) (SNF7 homolog associated with Alix 1) (SNF7-2) (hSnf7-2) (Vacuolar protein sorting-associated protein 32-2) (Vps32-2) (hVps32-2) 09H479 FN3K_HUMAN Fructosamine-3-kinase (EC 2.7.14 Q9H4A4 AMPB_HUMAN Aminopeptidase B (AP-B) (EC 3.4.11.6) (Arginine aminopeptidase) (Arginyl aminopeptidase) 09H4M9 EHD1_HUMAN EH domain-containing protein 1 (PAST homolog 1) (hPAST1) (Testilin) Q9H6F2 TM38A_HUMAN Trimeric intracellular cation channel type A (TRIC-A) (TRICA) (Transmembrane protein 38A) Q9H7C9 AAMDC_HUMAN Mth938 domain-containing protein (Adipogenesis associated Mth938 domain-containing protein) Q9H8H3 MET7A_HUMAN Methyltransferase-like protein 7A (EC 2.1.1.-) (Protein AAM-B) Q9H987 SYP2L_HUMAN Synaptopodin 2-like protein Q9H993 CF211_HUMAN UPF0364 protein C6orf211 Q9HBLO TENS1_HUMAN Tensin-1 Q9HC38 GLOD4_HUMAN Glyoxalase domain-containing protein 4 Q9HCCO MCCB_HUMAN Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial (MCCase subunit beta) (EC 6.4.1.4) (3-methylcrotonyl-CoA carboxylase 2) (3-methylcrotonyl-CoA carboxylase non-biotin-containing subunit) (3-methylcrotonyl-CoA:carbon dioxide ligase subunit beta) Q9HCP6 HHATL_HUMAN Protein-cysteine N-palmitoyltransferase HHAT-like protein (Glycerol uptake/transporter homolog) (Hedgehog acyltransferase-like protein) Q9HDC5 JPH1_HUMAN Junctophilin-1 (JP-1) (Junctophilin type 1) Q9NP72 RAB18_HUMAN Ras-related protein Rab-18 Q9NP98 MYOZ1_HUMAN Myozenin-1 (Calsarcin-2) (Filamin-, actinin- and telethonin-binding protein) (Protein FATZ) Q9NPC6 MYOZ2_HUMAN Myozenin-2 (Calsarcin-1) (FATZ-related protein 2) Q9NQC3 RTN4_HUMAN Reticulon-4 (Foocen) (Neurite outgrowth inhibitor) (Nogo protein) (Neuroendocrine-specific protein) (NSP) (Neuroendocrine-specific protein C homolog) (RTN-x) (Reticulon-5) Q9NQW7 XPP1_HUMAN Xaa-Pro aminopeptidase 1 (EC 3.4.11.9) (Aminoacylproline aminopeptidase) (Cytosolic aminopeptidase P) (Soluble aminopeptidase P) (sAmp) (X-Pro aminopeptidase 1) (X-prolyl aminopeptidase 1, soluble) 09NR12 PDLI7_HUMAN PDZ and LIM domain protein 7 (LIM mineralization protein) (LMP) (Protein enigma) Q9NR19 ACSA_HUMAN Acetyl-coenzyme A synthetase, cytoplasmic (EC 6.2.1.1) (Acetate--CoA
ligase) (Acetyl-CoA synthetase) (ACS) (AceCS) (Acyl-CoA synthetase short-chain family member 2) (Acyl-activating enzyme) Q9NR31 SAR1A_HUMAN GTP-binding protein SAR1a (COPII-associated small GTPase) Q9NRX4 PHP14_HUMAN 14 kDa phosphohistidine phosphatase (EC 3.1.3.-) (Phosphohistidine phosphatase 1) (Protein janus-A homolog) Q9NSD9 SYFB_HUMAN Phenylalanine--tRNA ligase beta subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase beta subunit) (PheRS) Q9NSE4 SYIM_HUMAN Isoleucine--tRNA ligase, mitochondrial (EC 6.1.1.5) (Isoleucyl-tRNA
synthetase) (1IeRS) Q9NTJ4 MA2C1_HUMAN Alpha-mannosidase 2C1 (EC 3.2.1.24) (Alpha mannosidase 6A8B) (Alpha-D-mannoside mannohydrolase) (Mannosidase alpha class 2C
member 1) Q9N-115 SAC1_HUMAN Phosphatidylinositide phosphatase SAC1 (EC 3.1.3.-) (Suppressor of actin mutations 1-like protein) Q9NTK5 OLA1_HUMAN Obg-like ATPase 1 (DNA damage-regulated overexpressed in cancer 45) (D0C45) (GTP-binding protein 9) Q9NUB1 ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial (EC 6.2.1.1) (Acetate--CoA ligase 2) (Acetyl-CoA synthetase 2) (AceCS2) (Acyl-CoA
synthetase short-chain family member 1) CI9N1111 ABHDA_HUMAN Mycophenolic acid acyl-glucuronide esterase, mitochondrial (EC
3.1.1.93) (Alpha/beta hydrolase domain-containing protein 10) (Abhydrolase domain-containing protein 10) Q9NUQ9 FA49B_HUMAN Protein FAM49B (L1) Q9NUU7 DD19A_HUMAN ATP-dependent RNA helicase DDX19A (EC 3.6.4.13) (DDX19-like protein) (DEAD box protein 19A) Q9NVA2 SEP11_HUMAN Septin-11 Q9NVE7 PANK4_HUMAN Pantothenate kinase 4 (hPanK4) (EC 2.7.1.33) (Pantothenic acid kinase 4) Q9NWMO SMOX_HUMAN Spermine oxidase (EC 1.5.3.16) (Polyamine oxidase 1) (PAO-1) (PA0h1) Q9NX63 CHCH3_HUMAN Coiled-coil-helix-coiled-coil-helix domain-containing protein 3, mitochondrial Q9NXA8 SIR5_HUMAN NAD-dependent protein deacylase sirtuin-5, mitochondrial (EC 3.5.1.-) (Regulatory protein SIR2 homolog 5) (SIR2-like protein 5) Q9NY33 DPP3_HUMAN Dipeptidyl peptidase 3 (EC 3.4.14.4) (Dipeptidyl aminopeptidase III) (Dipeptidyl arylamidase III) (Dipeptidyl peptidase III) (DPP III) Q9NYL2 MLTK_HUMAN Mitogen-activated protein kinase kinase kinase MLT
(EC 2.7.11.25) (Human cervical cancer suppressor gene 4 protein) (HCCS-4) (Leucine zipper- and sterile alpha motif-containing kinase) (MLK-like mitogen-activated protein triple kinase) (Mixed lineage kinase-related kinase) (MLK-related kinase) (MRK) (Sterile alpha motif- and leucine zipper-containing kinase AZK) Q9NYU2 UGGG1_HUMAN UDP-glucose:glycoprotein glucosyltransferase 1 (UGT1) (hUGT1) (EC
2.4.1.-) (UDP--Glc:glycoprotein glucosyltransferase) (UDP-glucose ceramide glucosyltransferase-like 1) Q9NZ45 CISD1_HUMAN CDGSH iron-sulfur domain-containing protein 1 (MitoNEET) Q9NZA1 CLIC5_HUMAN Chloride intracellular channel protein 5 Q9NZB2 F120A_HUMAN Constitutive coactivator of PPAR-gamma-like protein 1 (Oxidative stress-associated Src activator) (Protein FAM120A) Q9NZN4 EHD2_HUMAN EH domain-containing protein 2 (PAST homolog 2) Q9NZQ9 TMOD4_HUMAN Tropomodulin-4 (Skeletal muscle tropomodulin) (Sk-Tmod) Q9NZU5 LMCD1_HUMAN LIM and cysteine-rich domains protein 1 (Dyxin) Q9P010 NDUAD_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (Cell death regulatory protein GRIM-19) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic and interferon-induced mortality 19 protein) (GRIM-19) (Gene associated with retinoic and IFN-induced mortality 19 protein) (NADH-ubiquinone oxidoreductase B16.6 subunit) Q9P0J1 PDP1_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial (PDP 1) (EC 3.1.3.43) (Protein phosphatase 2C) (Pyruvate dehydrogenase phosphatase catalytic subunit 1) (PDPC 1) Q9POLO VAPA_HUMAN Vesicle-associated membrane protein-associated protein A (VAMP-A) (VAMP-associated protein A) (VAP-A) (33 kDa VAMP-associated protein) (VAP-33) Q9P2B2 FPRP_HUMAN Prostaglandin F2 receptor negative regulator (CD9 partner 1) (CD9P-1) (Glu-Trp-Ile EWI motif-containing protein F) (EWI-F) (Prostaglandin F2-alpha receptor regulatory protein) (Prostaglandin F2-alpha receptor-associated protein) (CD antigen CD315) Q9P2E9 RRBPl_HUMAN Ribosome-binding protein 1 (180 kDa ribosome receptor homolog) (RRp) (ES/130-related protein) (Ribosome receptor protein) Q9P2R7 SUCB1_HUMAN Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial (EC
6.2.1.5) (ATP-specific succinyl-CoA synthetase subunit beta) (Renal carcinoma antigen NY-REN-39) (Succinyl-CoA synthetase beta-A chain) (SCS-betaA) Q9UBF9 MYOTI_HUMAN Myotilin (57 kDa cytoskeletal protein) (Myofibrillar titin-like Ig domains protein) (Titin immunoglobulin domain protein) 09U B07 GRHPR_HUMAN Glyoxylate reductase/hydroxypyruvate red uctase (EC
1.1.1.79) (EC
1.1.1.81) Q9UBX5 FBLN5_HUMAN Fibulin-5 (FIBL-5) (Developmental arteries and neural crest EGF-like protein) (Dance) (Urine p50 protein) (UP50) Q9UBY9 HSPB7_HUMAN Heat shock protein beta-7 (HspB7) (Cardiovascular heat shock protein) (cvHsp) Q9UG63 ABCF2_HUMAN ATP-binding cassette sub-family F member 2 (Iron-inhibited ABC
transporter 2) Q9UHD8 SEPT9_HUMAN Septin-9 (MLL septin-like fusion protein MSF-A) (MLL
septin-like fusion protein) (Ovarian/Breast septin) (0v/Br septin) (Septin D1) Q9UHG3 PCYOX_HUMAN Prenylcysteine oxidase 1 (EC 1.8.3.5) (Prenylcysteine lyase) Q9UHP9 SMPX_HUMAN Small muscular protein (Stretch-responsive skeletal muscle protein) Q9UHQ9 NB5R1_HUMAN NADH-cytochrome b5 reductase 1 (b5R.1) (EC 1.6.2.2) (Humb5R2) (NAD(P)H:quinone oxidoreductase type 3 polypeptide A2) Q9U109 NDUAC_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 (13 kDa differentiation-associated protein) (Complex I-B17.2) (CI-B17.2) (CIB17.2) (NADH-ubiquinone oxidoreductase subunit B17.2) Q9UIA9 XP07_HUMAN Exportin-7 (Exp7) (Ran-binding protein 16) Q9U117 KAD3_HUMAN GTP:AMP phosphotransferase AK3, mitochondrial (EC
2.7.4.10) (Adenylate kinase 3) (AK 3) (Adenylate kinase 3 alpha-like 1) Q9UIQ6 LCAP_HUMAN Leucyl-cystinyl aminopeptidase (Cystinyl aminopeptidase) (EC 3.4.11.3) (Insulin-regulated membrane aminopeptidase) (Insulin-responsive aminopeptidase) (IRAP) (Oxytocinase) (0Tase) (Placental leucine aminopeptidase) (P-LAP) [Cleaved into: Leucyl-cystinyl aminopeptidase, pregnancy serum form]
09UJ70 NAGK_HUMAN N-acetyl-D-glucosamine kinase (N-acetylglucosamine kinase) (EC
2.7.1.59) (GIcNAc kinase) Q9UKA9 PTBP2_HUMAN Polypyrimidine tract-binding protein 2 (Neural polypyrimidine tract-binding protein) (Neurally-enriched homolog of PTB) (PTB-like protein) Q9UKG1 DP13A_HUMAN DCC-interacting protein 13-alpha (Dip13-alpha) (Adapter protein containing PH domain, PTB domain and leucine zipper motif 1) Q9UKS6 PACN3_HUMAN Protein kinase C and casein kinase substrate in neurons protein 3 (SH3 domain-containing protein 6511) Q9UKV8 AG02_HUMAN Protein argonaute-2 (Argonaute2) (hAgo2) (EC
3.1.26.n2) (Argonaute RISC catalytic component 2) (Eukaryotic translation initiation factor 2C
2) (e1F-2C 2) (eIF2C 2) (PAZ Piwi domain protein) (PPD) (Protein slicer) Q9UKX2 MYH2_HUMAN Myosin-2 (Myosin heavy chain 2) (Myosin heavy chain 2a) (MyHC-2a) (Myosin heavy chain 11a) (MyHC-1Ia) (Myosin heavy chain, skeletal muscle, adult 2) Q9UKX3 MYH13_HUMAN Myosin-13 (Myosin heavy chain 13) (Myosin heavy chain, skeletal muscle, extraocular) (MyHC-eo) Q9ULC4 MCTS1_HUMAN Malignant 1-cell-amplified sequence 1 (MCT-1) (Multiple copies T-cell malignancies) Q9UMR2 DD19B_HUMAN ATP-dependent RNA helicase DDX19B (EC 3.6.4.13) (DEAD
box RNA
helicase DEAD5) (DEAD box protein 19B) Q9UMS4 PRP19_HUMAN Pre-mRNA-processing factor 19 (Nuclear matrix protein 200) (PRP19/PS04 homolog) (hPso4) (Senescence evasion factor) Q9UMS6 SYNP2_HUMAN Synaptopodin-2 (Genethonin-2) (Myopodin) Q9UN36 NDRG2_HUMAN Protein NDRG2 (N-myc downstream-regulated gene 2 protein) (Protein Syld709613) Q9UNH7 SNX6_HUMAN Sorting nexin-6 (TRAF4-associated factor 2) [Cleaved into: Sorting nexin-6, N-terminally processed]
Q9UNM6 PSD13_HUMAN 265 proteasome non-ATPase regulatory subunit 13 (26S
proteasome regulatory subunit RPN9) (26S proteasome regulatory subunit 511) (26S proteasome regulatory subunit p40.5) Q9UNS2 CSN3_HUMAN COP9 signalosome complex subunit 3 (SGN3) (Signalosome subunit 3) (JAB1-containing signalosome subunit 3) Q9UNZ2 NSF1C_HUMAN NSFL1 cofactor p47 (UBX domain-containing protein 2C) (p97 cofactor p47) Q9UPU5 UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 (EC
3.4.19.12) (Deubiquitinating enzyme 24) (Ubiquitin thioesterase 24) (Ubiquitin-specific-processing protease 24) Q9UQ80 PA2G4_HUMAN Proliferation-associated protein 2G4 (Cell cycle protein p38-2G4 homolog) (hG4-1) (ErbB3-binding protein 1) Q9UQM7 KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II
subunit alpha (CaM kinase II subunit alpha) (CaMK-II subunit alpha) (EC 2.7.11.17) Q9Y230 RUVB2_HUMAN RuvB-like 2 (EC 3.6.4.12) (48 kDa TATA box-binding protein-interacting protein) (48 kDa TBP-interacting protein) (51 kDa erythrocyte cytosolic protein) (ECP-51) (IN080 complex subunit J) (Repressing pontin 52) (Reptin 52) (TIP49b) (TIP60-associated protein 54-beta) (TAP54-beta) Q9Y235 ABEC2_HUMAN Probable C->U-editing enzyme APOBEC-2 (EC 3.5.4.-) Q9Y262 ElF3L_HUMAN Eukaryotic translation initiation factor 3 subunit L
(eIF31) (Eukaryotic translation initiation factor 3 subunit 6-interacting protein) (Eukaryotic translation initiation factor 3 subunit E-interacting protein) Q9Y263 PLAP_HUMAN Phospholipase A-2-activating protein (PLA2P) (PLAP) Q9Y265 RUVB1_HUMAN RuvB-like 1 (EC 3.6.4.12) (49 kDa TATA box-binding protein-interacting protein) (49 kDa TBP-interacting protein) (54 kDa erythrocyte cytosolic protein) (ECP-54) (IN080 complex subunit H) (Nuclear matrix protein 238) (NMP 238) (Pontin 52) (TIP49a) (TIP60-associated protein 54-alpha) (TAP54-alpha) Q9Y266 NUDC_HUMAN Nuclear migration protein nudC (Nuclear distribution protein C
homolog) Q9Y277 VDAC3_HUMAN Voltage-dependent anion-selective channel protein 3 (VDAC-3) (hVDAC3) (Outer mitochondrial membrane protein porin 3) Q9Y281 COF2_HUMAN Cofilin-2 (Cofilin, muscle isoform) 09Y285 SYFA_HUMAN Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (CML33) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS) 09Y2A7 NCKP1_HUMAN Nck-associated protein 1 (NAP 1) (Membrane-associated protein HEM-2) (p125Nap1) Q9Y2J8 PADI2_HUMAN Protein-arginine deiminase type-2 (EC 3.5.3.15) (PAD-H19) (Peptidylarginine deiminase II) (Protein-arginine deiminase type II) Q9Y2K3 MYH15_HUMAN Myosin-15 (Myosin heavy chain 15) Q9Y2Q3 GSTK1_HUMAN Glutathione S-transferase kappa 1 (EC 2.5.1.18) (GST
13-13) (GST class-kappa) (GSTK1-1) (hGSTK1) (Glutathione S-transferase subunit 13) 09Y2Z9 C006_HUMAN Ubiquinone biosynthesis monooxygenase COQ6 (EC
1.14.13.-) (Coenzyme 010 monooxygenase 6) Q9Y376 CAB39_HUMAN Calcium-binding protein 39 (M025alpha) (Protein Mo25) Q9Y394 DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 (EC 1.1.-.-) (Retinal short-chain dehydrogenase/reductase 4) (retSDR4) 09Y3D6 FIS1_HUMAN Mitochondrial fission 1 protein (FIS1 homolog) (hFis1) (Tetratricopeptide repeat protein 11) (TPR repeat protein 11) Q9Y3F4 STRAP_HUMAN Serine-threonine kinase receptor-associated protein (MAP activator with WD repeats) (UNR-interacting protein) (WD-40 repeat protein PT-WD) Q9Y310 RTCB_HUMAN tRNA-splicing ligase RtcB homolog (EC 6.5.1.3) Q9Y490 TLN1_HUMAN Talin-1 Q9Y4E8 UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 (EC
3.4.19.12) (Deubiquitinating enzyme 15) (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Unph-2) (Unph4) Q9Y4G6 TLN2_HUMAN Talin-2 Q9Y4L1 HYOU1_HUMAN Hypoxia up-regulated protein 1 (150 kDa oxygen-regulated protein) (ORP-150) (170 kDa glucose-regulated protein) (GRP-170) Q9Y4W6 AFG32_HUMAN AFG3-like protein 2 (EC 3.4.24.-) (Paraplegin-like protein) Q9Y512 SAM5O_HUMAN Sorting and assembly machinery component 50 homolog (Transformation-related gene 3 protein) (TRG-3) Q9Y5Z4 HEBP2_HUMAN Heme-binding protein 2 (Placental protein 23) (PP23) (Protein SOUL) Q9Y613 FHODl_HUMAN FH1/FH2 domain-containing protein 1 (Formin homolog overexpressed in spleen 1) (FHOS) (Formin homology 2 domain-containing protein 1) Q9Y623 MYH4 HUMAN Myosin-4 (Myosin heavy chain 2b) (MyHC-2b) (Myosin heavy chain 4) (Myosin heavy chain 11b) (MyHC-11b) (Myosin heavy chain, skeletal muscle, fetal) Q9Y678 COPG1_HUMAN Coatomer subunit gamma-1 (Gamma-1-coat protein) (Gamma-1-COP) Q9Y6B6 SAR1B_HUMAN GTP-binding protein SAR1b (GTP-binding protein B) (GTBPB) Q9Y6E2 BZW2_HUMAN Basic leucine zipper and W2 domain-containing protein 2 Q9Y6G9 DC1L1_HUMAN Cytoplasmic dynein 1 light intermediate chain 1 (LIC1) (Dynein light chain A) (DLC-A) (Dynein light intermediate chain 1, cytosolic) Q9Y6P5 SESN1_HUMAN Sestrin-1 (p53-regulated protein PA26) Modifications and other embodiments Various modifications and variations of the described mouse/human paired peptide quantitation methods and methods of their use as well as the concept of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention.
Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed is not intended to be limited to such specific embodiments. Various modifications of the described modes for carrying out the invention which are obvious to those skilled in the medical, biological, molecular biological, chemical or pharmacological arts or related fields are intended to be within the scope of the following claims.

Incorporation by Reference Each document, patent, patent application or patent publication cited by or referred to in this disclosure is incorporated by reference in its entirety, especially with respect to the specific subject matter surrounding the citation of the reference in the text. However, no admission is made that any such reference constitutes background art and the right to challenge the accuracy and pertinence of the cited documents is reserved.
References 1. Atkinson, Arthur J., Wayne A. Colburn, Victor G. DeGruttola, David L.
DeMets, Gregory J.
Downing, Daniel F. Hoth, John A. Oates et al. "Biomarkers and surrogate endpoints: Preferred definitions and conceptual framework*." Clinical Pharmacology & Therapeutics 69, no. 3 (2001): 89-95.
2. Hoffman EP, Brown RH Jr, Kunkel LM. Dystrophin: the protein product of the Duchenne muscular dystrophy locus. Cell. 1987; 51:919-928.
3. Sebahattin C, Virginia A, Michela G, Lucy F, Silvia T, et al. Exon skipping and dystrophin restoration in patients with Duchenne muscular dystrophy after systemic phosphorodiamidate morpholino oligomer treatment: an open-label, phase 2, dose- escalation study.
Lancet. 2011;
378:595-605.
4. Finkel RS. Read-through strategies for suppression of nonsense mutations in Duchenne/
Becker muscular dystrophy: aminoglycosides and ataluren (PTC124). J Child Neurol. 2010;
25:1158-1164.

5. Nelson SF, Crosbie RH, Miceli MC, Spencer MJ. Emerging genetic therapies to treat Duchenne muscular dystrophy. CUIT Opin Neurol. 2009; 22:532-538.
6. Hoffman EP, Bronson A, Levin AA, Takeda S, Yokota T, et al. Restoring dystrophin expression in duchenne muscular dystrophy muscle progress in exon skipping and stop codon read through. Am J Pathol. 2011; 179:12-22. [
7. Goemans NM, Tulinius M, van den Akker JT, Burm BE, Ekhart PF, et al.
Systemic administration of PRO051 in Duchenne's muscular dystrophy. N Engl J Med. 2011;
364:1513-1522.
8. Sharma N, Medikayala S, Defour A, Rayavarapu S, Brown KJ. Use of quantitative membrane proteomics identifies a novel role of mitochondria in healing injured muscles.
J Biol Chem.
2012; 287:30455-30467.
9. Kruger M, Moser M, Ussar S, Thievessen I, Luber CA, et al. SILAC mouse for quantitative proteomics uncovers kindlin-3 as an essential factor for red blood cell function. Cell. 2008;
134:353-364.
10. Hoffman EP, Fischbeck KH, Brown RH, Johnson M, Medori R, et al.
Characterization of dystrophin in musclebiopsy specimens from patients with Duchenne's or Becker's muscular dystrophy. N Engl J Med. 1988; 318:1363-1368.
11. Jensen ON, Wilm M, Shevchenko A, Mann M. Sample preparation methods for mass spectrometric peptide mapping directly from 2-DE gels. Methods Mol Biol. 1999;
112:513-530.

12. Tennyson CN, Klamut HJ, Worton RG. The human dystrophin gene requires 16 hours to be transcribed and is cotranscriptionally spliced. Nat Genet. 1995; 9:184-190.
13. McClatchy, DB.; Yates, JR, III. Stable Isotope Labeling of Mammals (SILAM). 2008.

14. Ardite E, Perdiguero E, Vidal B, Gutarra S, Serrano AL, et al. PAI-1-regulated miR-21 defines a novel age-associated fibrogenic pathway in muscular dystrophy. J
Cell Biol. 2012;
196:163-175.

15. Lederfein D, Levy Z, Augier N, Mornet D, Morris G et al., A 71-kilodalton protein is a major product of the Duchenne muscular dystrophy gene in brain and other nonmuscle tissues.
Proc Natl Acad Sci. 1992; 89:5346-5350.

16. van Essen AJ, Busch HFM, te Meerman GJ, ten Kate LP. Birth and population prevalence of Duchenne muscular dystrophy in The Netherlands. Hum Genet 1992; 88:258-266.

17. Bushby KMD, Gardner-Medwin D, Nicholson LVB, Johnson MA, Haggerty ID et al., The clinical, genetic and dystrophin characteristics of Becker muscular dystrophy.
J Neurol. 1993;
240:105-112.

18. Anthony K, Sebahattin C, Silvia T, Giorgio T, Lucy F et al., Dystrophin quantification and clinical correlations in Becker muscular dystrophy; implications for clinical trials. Brain. 2011;
134:3547-3559.

19. Yokota T, Lu QL, Partridge T, Kobayashi M, Nakamura A et al., Efficacy of systemic morpholinon exon skipping in Duchenne dystrophy dogs. Ann Neurol. 2009; 65:667-676.

20. Lu QL, Yokota T, Takeda S, Garcia L, Muntoni F et al. The status of exon skipping as a therapeutic approach to Duchenne muscular dystrophy. Mol Ther. 2011; 19:9-15.

Claims

1. A method for identifying candidate peptide markers for a protein from a biological sample of interest, the method comprising the steps of:
extracting proteins from the biological sample of interest and a corresponding biological sample from an animal that has been labeled with one or more stable isotopic amino acids;
mixing a quantity of protein from the biological sample of interest with a quantity of protein from the corresponding biological sample from the labeled animal to form a spiked sample;
separating the spiked sample based on a physical property;
digesting the proteins of interest using a protease;
subjecting the digested samples to mass spectrometry analysis; and identifying unique candidate peptide markers that correspond to a protein.

2. A method for quantifying expression of a biomarker from a biological sample obtained from a subject with a disease or disorder, the method comprising the steps of:
extracting proteins from the biological sample of interest;

mixing a known quantity of protein from the biological sample of interest with a known quantity of protein a the corresponding biological sample from a labeled animal or a labeled synthetic peptide corresponding to a protein of interest to form a spiked sample;
separating the spiked sample based on a physical property;
digesting the proteins of interest using a protease;
subjecting the digested samples to mass spectrometry analysis;
determining intensities of unique candidate peptide markers that correspond to a proteins of interest; and quantifying the amount of the protein of interest in the sample based on the relative intensity of the unique candidate peptide markers.

3. The method of claim 2, wherein the step of quantifying comprises comparing peak areas and area ratios of one or more unique candidate peptide markers from the biological sample of interest to the peak areas and area ratios of one or more labeled peptide markers.

4. The method of claim 2, wherein the step of quantifying comprises comparing the relative intensities to a standard curve generated by creating a series of dilutions of a biological sample from a normal subject with a biological sample from a subject with a disease or disorder, wherein the amount of total protein in the mixed sample remains constant;
mixing a known quantity of protein from the mixed sample with a known quantity of protein a corresponding biological sample from a labeled animal or a labeled synthetic peptide corresponding to a protein of interest to form a spiked sample; separating the spiked sample based on a physical property;
digesting the proteins of interest using a protease; subjecting the digested samples to mass spectrometry analysis; and generating a titration curve based on the intensities obtained for each sample.

5. A method for quantifying dystrophin expression from a biological sample obtained from a subject with Duchenne's Muscular Dystrophy, the method comprising the steps of:
extracting proteins from the biological sample of interest;
mixing a known quantity of total protein from the biological sample of interest with a known quantity of total protein a the corresponding biological sample from a labeled animal or a labeled synthetic peptide corresponding to dystrophin to form a spiked sample;
separating the spiked sample based on a physical property;
digesting the proteins of interest using a protease;
subjecting the digested samples to mass spectrometry analysis;
quantifying the amount of the protein of interest in the sample based on the relative intensity of the unique candidate peptide markers.

6. The method of claim 5, wherein the step of quantifying comprises comparing peak areas and area ratios of one or more unique candidate peptide markers from the biological sample of interest to the peak areas and area ratios of one or more labeled peptide markers.

7. The method of claim 5, wherein the step of quantifying comprises comparing the relative intensities to a standard curve generated by creating a series of dilutions of a biological sample from a normal subject with a biological sample from a subject with a disease or disorder, wherein the amount of total protein in the mixed sample remains constant;
mixing a known quantity of protein from the mixed sample with a known quantity of protein a corresponding biological sample from a labeled animal or a labeled synthetic peptide corresponding to a protein of interest to form a spiked sample; separating the spiked sample based on a physical property;
digesting the proteins of interest using a protease; subjecting the digested samples to mass spectrometry analysis; and generating a titration curve based on the intensities obtained for each sample.

8. The method of any one of claims 5-7, wherein the subject is being treated with a pharmaceutical composition.

9. The method of any one of claims 5-8, wherein the one or more peptides are selected from Table 1.

10. The method of claim 9, wherein the one or more peptides are selected from QAPIGGDFPAVQK, VLSQIDVAQK, IFLTEQPLEGLEK, TLNATGEEIIQQSSK, and VHALNNVNK.

11. The method of any one of claims 1-10, when the proteins are extracted using a buffer comprising 10% sodium-dodecyl sulfate (SDS).

12. The method of any one of claims 1-11, wherein the known quantity of total protein corresponding to the biological sample from a labeled animal is half the known quantity of total protein from the biological sample of interest.

13. The method of claim 12, wherein the known quantity of total protein corresponding to the biological sample of interest is 50 µg and the known quantity of total protein the corresponding to the biological sample from a labeled animal is 25 µg.

14. The method of any one of claims 1 to 10, wherein the protease is trypsin.

15. The method of any one of claims 1 to 14, wherein the spiked sample is separated based on size, charge, shape or a combination thereof using electrophoresis.

16. The method of claim 15, wherein the spiked sample is separated using gel electrophoresis.

17. The method of claim 16, further comprising the step of excising a portion of the gel containing the proteins of interest prior to the digesting step.