CA2381927A1 - Herbicide-tolerant protoporphyrinogen oxidase - Google Patents
Herbicide-tolerant protoporphyrinogen oxidase Download PDFInfo
- Publication number
- CA2381927A1 CA2381927A1 CA002381927A CA2381927A CA2381927A1 CA 2381927 A1 CA2381927 A1 CA 2381927A1 CA 002381927 A CA002381927 A CA 002381927A CA 2381927 A CA2381927 A CA 2381927A CA 2381927 A1 CA2381927 A1 CA 2381927A1
- Authority
- CA
- Canada
- Prior art keywords
- amino acid
- delta
- protox
- sequence
- plant
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/001—Oxidoreductases (1.) acting on the CH-CH group of donors (1.3)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8201—Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation
- C12N15/8214—Plastid transformation
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8274—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for herbicide resistance
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Biomedical Technology (AREA)
- Organic Chemistry (AREA)
- Biotechnology (AREA)
- Zoology (AREA)
- General Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Cell Biology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Biophysics (AREA)
- Medicinal Chemistry (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The present invention provides novel DNA sequences coding for protoporphyrinogen oxidase (protox) enzymes from soybean, wheat, cotton, sug ar beet, oilseed rape, rice, sorghum, and sugar cane. In addition, the present invention teaches modified forms of protox enzymes that are herbicide tolerant. Plants expressing herbicide tolerant protox enzymes taught herein are also provided. These plants may be engineered for resistance to protox inhibitors via mutation of the native protox gene to a resistant form or the y may be transformed with a gene encoding a herbicide tolerant form of a plant protox enzyme.
Description
HERBICIDE-TOLERANT PROTOPORPHYRINOGEN OXIDASE
The present invention relates to DNA molecules encoding herbicide-tolerant forms of the enzyme protoporphyrinogen oxidase ("protox"). The invention further relates to herbicide-tolerant plants as well as methods for tissue culture selection and herbicide application based on these herbicide-tolerant forms of protox.
The present invention provides modified forms of plant protoporphyrinogen oxidase (protox) enzymes that are resistant to compounds that inhibit unmodified naturally occurring plant protox enzymes, and DNA molecules coding for such inhibitor-resistant plant protox enzymes.
For clarity, certain terms used in the specification are defined and presented as follows:
Associated With l Operatively LinkeaF refers to two DNA sequences that are related physically or functionally. For example, a promoter or regulatory DNA sequence is said to be "associated with" a DNA sequence that codes for an RNA or a protein if the two sequences are operatively linked, or situated such that the regulator DNA
sequence will affect the expression level of the coding or structural DNA sequence.
Chimeric Gene: a recombinant DNA sequence in which a promoter or regulatory DNA
sequence is operatively linked to, or associated with, a DNA sequence that codes for an mRNA or which is expressed as a protein, such that the regulator DNA sequence is able to regulate transcription or expression of the associated DNA sequence. The regulator DNA
sequence of the chimeric gene is not normally operatively linked to the associated DNA
sequence as found in nature.
Coding DNA Sequence: a DNA sequence that is translated in an organism to produce a protein.
Corresponding To: in the context of the present invention, "corresponding to"
means that when the amino acid sequences of various protox enzymes are aligned with each other, such as in Table 1 A, the amino acids that "correspond to" certain enumerated positions in Table 1 A are those that align with these positions in Table 1 A, but that are not necessarily in these exact numerical positions relative to the particular protox enzyme's amino acid sequence. Likewise, when the amino acid sequence of a particular protox enzyme (for example, the soybean protox enzyme) is aligned with the amino acid sequence of a reference protox enzyme (for example, the Arabidopsis protox-1 sequence given in SEQ ID N0:2), the amino acids in the soybean protox sequence that "correspond to" certain enumerated positions of SEQ ID N0:2 are those that align with these positions of SEQ ID
N0:2, but are not necessarily in these exact numerical positions of the soybean protox enzyme's amino acid sequence.
Herbicide: a chemical substance used to kill or suppress the growth of plants, plant cells, plant seeds, or plant tissues.
Heterologous DNA Sequence: a DNA sequence not naturally associated with a host cell into which it is introduced, including non-naturally occurring multiple copies of a naturally occurring DNA sequence.
Homologous DNA Sequence: a DNA sequence naturally associated with a host cell into which it is introduced.
Homoplasmic. refers to a plant, plant tissue or plant cell, wherein all of the plastids are genetically identical. In different tissues or stages of development, the plastids may take different forms, e.g., chloroplasts, proplastids, etioplasts, amyloplasts, chromoplasts, and so forth.
Inhibitor. a chemical substance that inactivates the enzymatic activity of a protein such as a biosynthetic enzyme, receptor, signal transduction protein, structural gene product, or transport protein that is essential to the growth or survival of the plant. In the context of the instant invention, an inhibitor is a chemical substance that inactivates the enzymatic activity of protox. The term "herbicide" is used herein to define an inhibitor when applied to plants, plant cells, plant seeds, or plant tissues.
Isolated: in the context of the present invention, an isolated nucleic acid molecule or an isolated enzyme is a nucleic acid molecule or enzyme that, by the hand of man, exists apart from its native environment and is therefore not a product of nature. An isolated nucleic acid molecule or enzyme may exist in a purified form or may exist in a non-native environment such as, for example, a transgenic host cell.
Minimal Promoter. promoter elements, particularly a TATA element, that are inactive or that have greatly reduced promoter activity in the absence of upstream activation. In the presence of a suitable transcrption factor, the minimal promoter functions to permit transcription.
Modified Enryme Activity. enzyme activity different from that which naturally occurs in a plant (i.e. enzyme activity that occurs naturally in the absence of direct or indirect manipulation of such activity by man), which is tolerant to inhibitors that inhibit the naturally occurring enzyme activity.
Nucleic Acid Molecule: a linear segment of single- or double-stranded DNA or RNA
that can be isolated from any source. In the context of the present invention, the nucleic acid molecule is preferably a segment of DNA.
Plant. refers to any plant or part of a plant at any stage of development.
Therein are also included cuttings, cell or tissue cultures and seeds. As used in conjunction with the present invention, the term "plant tissue" includes, but is not limited to, whole plants, plant cells, plant organs, plant seeds, protoplasts, callus, cell cultures, and any groups of plant cells organized into structural and/or functional units.
Plastome: the genome of a plastid.
Protox i: chloroplast protox.
Protox 2. mitochondrial protox.
Significant Increase: an increase in enzymatic activity that is larger than the margin of error inherent in the measurement technique, preferably an increase by about 2-fold or greater of the activity of the wild-type enzyme in the presence of the inhibitor, more preferably an increase by about 5-fold or greater, and most preferably an increase by about 10-fold or greater.
Substantially Similar. with respect to nucleic acids, a nucleic acid molecule that has at least 60 percent sequence identity with a reference nucleic acid molecule. In a preferred embodiment, a substantially similar DNA sequence is at least 80% identical to a reference DNA sequence; in a more preferred embodiment, a substantially similar DNA
sequence is at least 90% identical to a reference DNA sequence; and in a most preferred embodiment, a substantially similar DNA sequence is at least 95% identical to a reference DNA sequence.
A substantially similar nucleotide sequence typically hybridizes to a reference nucleic acid molecule, or fragments thereof, under the following conditions: hybridization at 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50°C; wash with 2X SSC, 1 SDS, at 50°C. With respect to proteins or peptides, a substantially similar amino acid sequence is an amino acid sequence that is at least 90% identical to the amino acid sequence of a reference protein or peptide and has substantially the same activity as the reference protein or peptide.
Tolerance l Resistance: the ability to continue normal growth or function when exposed to an inhibitor or herbicide.
The present invention relates to DNA molecules encoding herbicide-tolerant forms of the enzyme protoporphyrinogen oxidase ("protox"). The invention further relates to herbicide-tolerant plants as well as methods for tissue culture selection and herbicide application based on these herbicide-tolerant forms of protox.
The present invention provides modified forms of plant protoporphyrinogen oxidase (protox) enzymes that are resistant to compounds that inhibit unmodified naturally occurring plant protox enzymes, and DNA molecules coding for such inhibitor-resistant plant protox enzymes.
For clarity, certain terms used in the specification are defined and presented as follows:
Associated With l Operatively LinkeaF refers to two DNA sequences that are related physically or functionally. For example, a promoter or regulatory DNA sequence is said to be "associated with" a DNA sequence that codes for an RNA or a protein if the two sequences are operatively linked, or situated such that the regulator DNA
sequence will affect the expression level of the coding or structural DNA sequence.
Chimeric Gene: a recombinant DNA sequence in which a promoter or regulatory DNA
sequence is operatively linked to, or associated with, a DNA sequence that codes for an mRNA or which is expressed as a protein, such that the regulator DNA sequence is able to regulate transcription or expression of the associated DNA sequence. The regulator DNA
sequence of the chimeric gene is not normally operatively linked to the associated DNA
sequence as found in nature.
Coding DNA Sequence: a DNA sequence that is translated in an organism to produce a protein.
Corresponding To: in the context of the present invention, "corresponding to"
means that when the amino acid sequences of various protox enzymes are aligned with each other, such as in Table 1 A, the amino acids that "correspond to" certain enumerated positions in Table 1 A are those that align with these positions in Table 1 A, but that are not necessarily in these exact numerical positions relative to the particular protox enzyme's amino acid sequence. Likewise, when the amino acid sequence of a particular protox enzyme (for example, the soybean protox enzyme) is aligned with the amino acid sequence of a reference protox enzyme (for example, the Arabidopsis protox-1 sequence given in SEQ ID N0:2), the amino acids in the soybean protox sequence that "correspond to" certain enumerated positions of SEQ ID N0:2 are those that align with these positions of SEQ ID
N0:2, but are not necessarily in these exact numerical positions of the soybean protox enzyme's amino acid sequence.
Herbicide: a chemical substance used to kill or suppress the growth of plants, plant cells, plant seeds, or plant tissues.
Heterologous DNA Sequence: a DNA sequence not naturally associated with a host cell into which it is introduced, including non-naturally occurring multiple copies of a naturally occurring DNA sequence.
Homologous DNA Sequence: a DNA sequence naturally associated with a host cell into which it is introduced.
Homoplasmic. refers to a plant, plant tissue or plant cell, wherein all of the plastids are genetically identical. In different tissues or stages of development, the plastids may take different forms, e.g., chloroplasts, proplastids, etioplasts, amyloplasts, chromoplasts, and so forth.
Inhibitor. a chemical substance that inactivates the enzymatic activity of a protein such as a biosynthetic enzyme, receptor, signal transduction protein, structural gene product, or transport protein that is essential to the growth or survival of the plant. In the context of the instant invention, an inhibitor is a chemical substance that inactivates the enzymatic activity of protox. The term "herbicide" is used herein to define an inhibitor when applied to plants, plant cells, plant seeds, or plant tissues.
Isolated: in the context of the present invention, an isolated nucleic acid molecule or an isolated enzyme is a nucleic acid molecule or enzyme that, by the hand of man, exists apart from its native environment and is therefore not a product of nature. An isolated nucleic acid molecule or enzyme may exist in a purified form or may exist in a non-native environment such as, for example, a transgenic host cell.
Minimal Promoter. promoter elements, particularly a TATA element, that are inactive or that have greatly reduced promoter activity in the absence of upstream activation. In the presence of a suitable transcrption factor, the minimal promoter functions to permit transcription.
Modified Enryme Activity. enzyme activity different from that which naturally occurs in a plant (i.e. enzyme activity that occurs naturally in the absence of direct or indirect manipulation of such activity by man), which is tolerant to inhibitors that inhibit the naturally occurring enzyme activity.
Nucleic Acid Molecule: a linear segment of single- or double-stranded DNA or RNA
that can be isolated from any source. In the context of the present invention, the nucleic acid molecule is preferably a segment of DNA.
Plant. refers to any plant or part of a plant at any stage of development.
Therein are also included cuttings, cell or tissue cultures and seeds. As used in conjunction with the present invention, the term "plant tissue" includes, but is not limited to, whole plants, plant cells, plant organs, plant seeds, protoplasts, callus, cell cultures, and any groups of plant cells organized into structural and/or functional units.
Plastome: the genome of a plastid.
Protox i: chloroplast protox.
Protox 2. mitochondrial protox.
Significant Increase: an increase in enzymatic activity that is larger than the margin of error inherent in the measurement technique, preferably an increase by about 2-fold or greater of the activity of the wild-type enzyme in the presence of the inhibitor, more preferably an increase by about 5-fold or greater, and most preferably an increase by about 10-fold or greater.
Substantially Similar. with respect to nucleic acids, a nucleic acid molecule that has at least 60 percent sequence identity with a reference nucleic acid molecule. In a preferred embodiment, a substantially similar DNA sequence is at least 80% identical to a reference DNA sequence; in a more preferred embodiment, a substantially similar DNA
sequence is at least 90% identical to a reference DNA sequence; and in a most preferred embodiment, a substantially similar DNA sequence is at least 95% identical to a reference DNA sequence.
A substantially similar nucleotide sequence typically hybridizes to a reference nucleic acid molecule, or fragments thereof, under the following conditions: hybridization at 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50°C; wash with 2X SSC, 1 SDS, at 50°C. With respect to proteins or peptides, a substantially similar amino acid sequence is an amino acid sequence that is at least 90% identical to the amino acid sequence of a reference protein or peptide and has substantially the same activity as the reference protein or peptide.
Tolerance l Resistance: the ability to continue normal growth or function when exposed to an inhibitor or herbicide.
Transformation: a process for introducing heterologous DNA into a cell, tissue, or plant. Transformed cells, tissues, or plants are understood to encompass not only the end product of a transformation process, but also transgenic progeny thereof.
Transit Peptide: a signal polypeptide that is translated in conjunction with a protein encoded by a DNA molecule, forming a polypeptide precursor. In the process of transport to a selected site within the cell, a chloroplast for example, the transit peptide can be cleaved from the remainder of the polypeptide precursor to provide an active or mature protein.
Transformeoh. refers to an organism such as a plant into which a heterologous DNA
molecule has been introduced. The DNA molecule can be stably integrated into the genome of the plant, wherein the genome of the plant encompasses the nuclear genome, the plastid genome and the mitochondria) genome. In a transformed plant, the DNA molecule can also be present as an extrachromosomal molecule. Such an extrachromosomal molecule can be auto-replicating. A "non-transformed" plant refers to a wild-type organism, i.e., a plant, which does not contain the heterologous DNA molecule.
Transplastome: a transformed plastid genome.
Nucleotides are indicated by their bases by the following standard abbreviations: adenine (A), cytosine (C), thymine (T), and guanine (G). Amino acids are likewise indicated by the following standard abbreviations: alanine (ala; A), arginine (Arg; R), asparagine (Asn; N) , aspartic acid (Asp; D), cysteine (Cys; C), glutamine (Gln; Q), glutamic acid (Glu; E), glycine (Gly; G), histidine (His; H), isoleucine (1)e; I), leucine (Leu; L), lysine (lys; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Thr; T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val; V). Furthermore (Xaa;
X) represents any amino acid.
The present invention discloses modified forms of plant protoporphyrinogen oxidase (protox) enzymes that are resistant to compounds that inhibit unmodified naturally occurring plant protox enzymes, and DNA molecules coding for such inhibitor-resistant plant protox enzymes.
Thus, in one aspect the present invention discloses a DNA molecule encoding a plant protox enzyme that is capable of being incorporated into a DNA construct used to transform a plant containing wild-type, herbicide-sensitive protox, wherein the DNA
molecule has at least one point mutation relative to a wild-type DNA molecule encoding plant protox such that upon transformation with the DNA construct the plant contains the DNA
molecule, which renders the plant resistant to the application of a herbicide that inhibits naturally occurring plant protox.
Transit Peptide: a signal polypeptide that is translated in conjunction with a protein encoded by a DNA molecule, forming a polypeptide precursor. In the process of transport to a selected site within the cell, a chloroplast for example, the transit peptide can be cleaved from the remainder of the polypeptide precursor to provide an active or mature protein.
Transformeoh. refers to an organism such as a plant into which a heterologous DNA
molecule has been introduced. The DNA molecule can be stably integrated into the genome of the plant, wherein the genome of the plant encompasses the nuclear genome, the plastid genome and the mitochondria) genome. In a transformed plant, the DNA molecule can also be present as an extrachromosomal molecule. Such an extrachromosomal molecule can be auto-replicating. A "non-transformed" plant refers to a wild-type organism, i.e., a plant, which does not contain the heterologous DNA molecule.
Transplastome: a transformed plastid genome.
Nucleotides are indicated by their bases by the following standard abbreviations: adenine (A), cytosine (C), thymine (T), and guanine (G). Amino acids are likewise indicated by the following standard abbreviations: alanine (ala; A), arginine (Arg; R), asparagine (Asn; N) , aspartic acid (Asp; D), cysteine (Cys; C), glutamine (Gln; Q), glutamic acid (Glu; E), glycine (Gly; G), histidine (His; H), isoleucine (1)e; I), leucine (Leu; L), lysine (lys; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Thr; T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val; V). Furthermore (Xaa;
X) represents any amino acid.
The present invention discloses modified forms of plant protoporphyrinogen oxidase (protox) enzymes that are resistant to compounds that inhibit unmodified naturally occurring plant protox enzymes, and DNA molecules coding for such inhibitor-resistant plant protox enzymes.
Thus, in one aspect the present invention discloses a DNA molecule encoding a plant protox enzyme that is capable of being incorporated into a DNA construct used to transform a plant containing wild-type, herbicide-sensitive protox, wherein the DNA
molecule has at least one point mutation relative to a wild-type DNA molecule encoding plant protox such that upon transformation with the DNA construct the plant contains the DNA
molecule, which renders the plant resistant to the application of a herbicide that inhibits naturally occurring plant protox.
In particular, the present invention relates to a nucleic acid molecule comprising a nucleotide sequence that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is resistant to an inhibitor of the naturally occurring form of said enzyme, wherein said modified enzyme comprises at least one of the following amino acid sub-sequences:
(a) ICAO,eF, wherein ~,8 is an amino acid other than alanine, (b) Q~,sH, wherein 0~9 is an amino acid other than leucine, (c) APD~F, wherein 0~ is an amino acid other than arginine, but especially leucine or cysteine, (d) F02S, wherein D2 is leucine, (e) Y~G, wherein ~ is isoleucine, (f) O~IG, wherein 0~ is histidine or alanine, (g) TO~sG, wherein ~~g is an amino acid other than leucine and YVO1~G, wherein 0"
is an amino acid other than alanine, wherein the nucleotide sequence that encodes the naturally occurring form of said enzyme is derived from a plant.
In a preferred embodiment the invention relates to a nucleic acid molecule comprising a nucleotide sequence that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is resistant to an inhibitor of the naturally occurring form of said enzyme, wherein said modified enzyme comprises at least one amino acid sub-sequence selected from the group consisting of:
(a) IfA018F, wherein 0~8 is an amino acid other than alanine, (b) QD,9H, wherein 019 is an amino acid other than leucine, (c) AP01F, wherein 0, is an amino acid other than arginine, but especially leucine, (d) F02S, wherein D2 is leucine, (e) Y~G, wherein ~ is isoleucine, (f) O~IG, wherein ~~ is histidine or alanine, (g) TO~6G, wherein 0,6 is an amino acid other than leucine and YV01~G, wherein 0~~
is an amino acid other than alanine, wherein said nucleotide sequence that encodes said modified enzyme hybridizes to any one of the nucleotide sequences set forth in SEQ ID N0:1, SEQ ID N0:5, SEQ ID
N0:9, SEQ ID N0:11, SEQ ID N0:15, SEQ ID N0:17, SEQ ID N0:19, SEQ ID N0:21, SEQ ID
N0:23 or SEQ ID N0:36 under the following conditions:
hybridization in 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50 C; and (ii) wash in 2X SSC, 1 % SDS at 50 C.
Further preferred is a nucleic acid molecule comprising a nucleotide sequence that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is resistant to an inhibitor of the naturally occurring form of said enzyme, wherein said modified enzyme comprises at least one of the following amino acid sub-sequences:
(a) KAD,BF, wherein 0,8 is an amino acid other than alanine, (b) Q019H, wherein 0~9 is an amino acid other than leucine, (c) APD,F, wherein ~~ is leucine, (d) ~~IG, wherein 0~ is histidine, wherein the nucleotide sequence that encodes the naturally occurring form of said enzyme is derived from a plant.
Preferred is a nucleic acid molecule, wherein said modified enzyme comprises the amino acid sub-sequence KAO~eF, wherein D,e is an amino acid other than alanine.
Further preferred is a nucleic acid molecule, wherein 0,8 is threonine or valine.
Also preferred is a nucleic acid molecule, wherein said modified enzyme comprises the amino acid sub-sequence Q~,9H, wherein 0,9 is an amino acid other than leucine.
Also preferred is a nucleic acid molecule, wherein O,9 is serine.
Also preferred is a nucleic acid molecule, wherein said modified enzyme comprises the amino acid sub-sequence AP~~F, wherein ~~ is leucine or cysteine.
Also preferred is a nucleic acid molecule, wherein said modified enzyme comprises the amino acid sub-sequence O~IG, wherein 0~ is histidine or alanine, but especially histidine.
Also preferred is a nucleic acid molecule, wherein said modified enzyme comprises the amino acid sub-sequence T~,6G, wherein O~g is serine, and the amino acid sub-sequence YV~"G, wherein O1, is threonine.
The invention further provides a nucleic acid molecule, wherein modified enzyme according to the invention further comprises at least one additional amino acid sub-sequence selected from the group consisting of:
(e) Q0"S, wherein O" is an amino acid other than proline;
(f) IGG012, wherein 0,2 is an amino acid other than threonine;
(g) SWXL0~3, wherein 0,3 is an amino acid other than serine;
(a) ICAO,eF, wherein ~,8 is an amino acid other than alanine, (b) Q~,sH, wherein 0~9 is an amino acid other than leucine, (c) APD~F, wherein 0~ is an amino acid other than arginine, but especially leucine or cysteine, (d) F02S, wherein D2 is leucine, (e) Y~G, wherein ~ is isoleucine, (f) O~IG, wherein 0~ is histidine or alanine, (g) TO~sG, wherein ~~g is an amino acid other than leucine and YVO1~G, wherein 0"
is an amino acid other than alanine, wherein the nucleotide sequence that encodes the naturally occurring form of said enzyme is derived from a plant.
In a preferred embodiment the invention relates to a nucleic acid molecule comprising a nucleotide sequence that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is resistant to an inhibitor of the naturally occurring form of said enzyme, wherein said modified enzyme comprises at least one amino acid sub-sequence selected from the group consisting of:
(a) IfA018F, wherein 0~8 is an amino acid other than alanine, (b) QD,9H, wherein 019 is an amino acid other than leucine, (c) AP01F, wherein 0, is an amino acid other than arginine, but especially leucine, (d) F02S, wherein D2 is leucine, (e) Y~G, wherein ~ is isoleucine, (f) O~IG, wherein ~~ is histidine or alanine, (g) TO~6G, wherein 0,6 is an amino acid other than leucine and YV01~G, wherein 0~~
is an amino acid other than alanine, wherein said nucleotide sequence that encodes said modified enzyme hybridizes to any one of the nucleotide sequences set forth in SEQ ID N0:1, SEQ ID N0:5, SEQ ID
N0:9, SEQ ID N0:11, SEQ ID N0:15, SEQ ID N0:17, SEQ ID N0:19, SEQ ID N0:21, SEQ ID
N0:23 or SEQ ID N0:36 under the following conditions:
hybridization in 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50 C; and (ii) wash in 2X SSC, 1 % SDS at 50 C.
Further preferred is a nucleic acid molecule comprising a nucleotide sequence that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is resistant to an inhibitor of the naturally occurring form of said enzyme, wherein said modified enzyme comprises at least one of the following amino acid sub-sequences:
(a) KAD,BF, wherein 0,8 is an amino acid other than alanine, (b) Q019H, wherein 0~9 is an amino acid other than leucine, (c) APD,F, wherein ~~ is leucine, (d) ~~IG, wherein 0~ is histidine, wherein the nucleotide sequence that encodes the naturally occurring form of said enzyme is derived from a plant.
Preferred is a nucleic acid molecule, wherein said modified enzyme comprises the amino acid sub-sequence KAO~eF, wherein D,e is an amino acid other than alanine.
Further preferred is a nucleic acid molecule, wherein 0,8 is threonine or valine.
Also preferred is a nucleic acid molecule, wherein said modified enzyme comprises the amino acid sub-sequence Q~,9H, wherein 0,9 is an amino acid other than leucine.
Also preferred is a nucleic acid molecule, wherein O,9 is serine.
Also preferred is a nucleic acid molecule, wherein said modified enzyme comprises the amino acid sub-sequence AP~~F, wherein ~~ is leucine or cysteine.
Also preferred is a nucleic acid molecule, wherein said modified enzyme comprises the amino acid sub-sequence O~IG, wherein 0~ is histidine or alanine, but especially histidine.
Also preferred is a nucleic acid molecule, wherein said modified enzyme comprises the amino acid sub-sequence T~,6G, wherein O~g is serine, and the amino acid sub-sequence YV~"G, wherein O1, is threonine.
The invention further provides a nucleic acid molecule, wherein modified enzyme according to the invention further comprises at least one additional amino acid sub-sequence selected from the group consisting of:
(e) Q0"S, wherein O" is an amino acid other than proline;
(f) IGG012, wherein 0,2 is an amino acid other than threonine;
(g) SWXL0~3, wherein 0,3 is an amino acid other than serine;
(h) L~,4Y, wherein 0,4 is an amino acid other than asparagine;
(i) GO,SXGL, wherein 0,5 is an amino acid other than tyrosine.
Preferred is a nucleic acid molecule, wherein said additional sub-sequence is Q~"S, wherein D" is an amino acid other than proline.
Further preferred is a nucleic acid molecule, wherein O" is leucine.
Also preferred is a nucleic acid molecule, wherein said additional sub-sequence is IGG0,2, wherein 0,2 is an amino acid other than threonine.
Also preferred is a nucleic acid molecule, wherein 0,2 is isoleucine or alanine.
Also preferred is a nucleic acid molecule, wherein said additional sub-sequence is SWXL0,3, wherein 0,3 is an amino acid other than serine.
Also preferred is a nucleic acid molecule, wherein D,3 is leucine.
Also preferred is a nucleic acid molecule, wherein said additional sub-sequence is L0,4Y, wherein D,4 is an amino acid other than asparagine.
Also preferred is a nucleic acid molecule, wherein D,4 is serine.
Also preferred is a nucleic acid molecule, wherein said additional sub-sequence is GO,SXGL, wherein D,5 is an amino acid other than tyrosine.
Also preferred is a nucleic acid molecule, wherein 0,5 is cysteine.
Especially preferred is a nucleic acid molecule encoding a plant protox enzyme that is capable of being incorporated into a DNA construct used to transform a plant containing wild-type, herbicide-sensitive protox, wherein the nucleic acid molecule has at least one point mutation relative to a wild-type DNA molecule encoding plant protox as mentioned hereinbefore such that upon transformation with the DNA construct the plant contains the DNA molecule, which renders the plant resistant to the application of a herbicide that inhibits naturally occurring plant protox, wherein said nucleic acid molecule can be obtained from a plant selected from the group consisting of Arabidopsis, maize, wheat, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, and sugar cane.
Sequences of such DNA molecules are set forth in SEQ ID NOs: 9 (wheat), 11 (soybean), 15 (cotton), 17 (sugar beet), 19 (oilseed rape), 21 (rice), 23 (sorghum), and 36 (sugar cane).
Preferred is a nucleic acid molecule which can be obtained from maize or cotton.
Also comprised by the present invention is a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is encoded by any of the nucleotide sequences according to the invention mentioned hereinbefore.
_7_ The present invention further includes chimeric genes and modified forms of naturally occurring protox genes that can express the inhibitor-resistant plant protox enzymes in plants.
In particular, the present invention relates to a chimeric gene comprising a promoter that is active in a plant operatively linked to a nucleic acid molecule according to the invention.
The invention further includes recombinant vector molecules comprising a chimeric gene according to the invention.
Genes encoding inhibitor-resistant plant protox enzymes can be used to confer resistance to protox-inhibitory herbicides in whole plants and as a selectable marker in plant cell transformation methods. Accordingly, the present invention also includes plants, including the descendants thereof, plant tissues and plant seeds containing plant expressible genes encoding these modified protox enzymes. These plants, plant tissues and plant seeds are resistant to protox-inhibitors at levels that normally are inhibitory to the naturally occurring protox activity in the plant.
In particular, the invention relates to a plant cell comprising the nucleic acid molecule according to the invention.
The invention further relates to a plant, plant tissue, plant cell, or plant seed, including the progeny thereof, comprising the nucleic acid molecule according to the invention, wherein said nucleic acid molecule is expressed in said plant, plant tissue, plant cell, or plant seed and confers tolerance thereupon to an inhibitor of naturally occurring protox activity.
Plants encompassed by the invention especially include those that would be potential targets for protox inhibiting herbicides, particularly agronomically important crops such as maize and other cereal crops such as barley, wheat, sorghum, rye, oats, turf and forage grasses, millet and rice. Also comprised are other crop plants such as sugar cane, soybean, cotton, sugar beet, oilseed rape and tobacco.
Preferred is a plant, plant tissue, plant cell, or plant seed, including the progeny thereof, wherein said plant, plant tissue, plant cell, or plant seed is selected from the group consisting of Arabidopsis, soybean, cotton, sugar beet, oilseed rape, maize, wheat, sorghum, rice, and sugar cane comprising the nucleic acid molecule according to the invention.
The present invention also relates to plastid transformation and to the expression of a nucleic acid molecule according to the invention in a plant plastid. In a preferred embodiment, a modified plant protox enzyme as described hereinbefore is expressed in plant plastids to obtain herbicide resistant plants.
_g_ In particular, the invention relates to a chimeric gene comprising a promoter functional in a plant plastid, preferably a clpP gene promoter, operatively linked to the nucleic acid molecule according to the invention,.
In a further embodiment, the present invention is directed to a chimeric gene comprising: (a) a DNA molecule isolated from a plant, which in its native state encodes a polypeptide that comprises a plastid transit peptide, and a mature enzyme that is natively targeted to a plastid of the plant by the plastid transit peptide, wherein the DNA molecule is modified such that it does not encode a functional plastid transit peptide;
and (b) a promoter capable of expressing the DNA molecule in a plastid, wherein the promoter is operatively linked to the DNA molecule according to the invention. The DNA molecule may be modified in that at least a portion of the native plastid transit peptide coding sequence is absent from the DNA molecule. Alternatively, the DNA molecule may be modified in that one or more nucleotides of the native plastid transit peptide coding sequence are mutated, thereby rendering an encoded plastid transit peptide nonfunctional. The present invention also relates to plants homoplasmic for chloroplast genomes containing such chimeric genes. In a preferred embodiment, the DNA molecule encodes an enzyme that is naturally inhibited by a herbicidal compound. In this case, such plants are resistant to a herbicide that naturally inhibits the enzyme encoded by a DNA molecule according to the present invention.
A further embodiment of the invention relates to a plastid transformation vector comprising some or all of the elements mentioned hereinbefore including a nucleic acid molecule according to the invention.
Further comprised is a plant plastid comprising a plastid transformation vector according to the invention.
The present invention is also directed to plants made resistant to a herbicide by transforming their plastid genome with a DNA molecule according to the present invention and to methods for obtaining such plants. The invention thus further relates to a plant, plant tissue, plant cell, or plant seed, including the progeny thereof, comprising a plant plastid according to the invention, wherein said modified plant protox enzyme is expressed in said plant, plant tissue, plant cell, or plant seed and confers upon said plant, plant tissue, plant cell, or plant seed tolerance to an inhibitor of naturally occurring protox activity.
The present invention is directed further to methods for the production of plants, including plant material, such as for example plant tissues, protoplasts, cells, calli, organs, plant seeds, embryos, pollen, egg cells, zygotes, together with any other propagating material and plant parts, such as for example flowers, stems, fruits, leaves, roots originating in transgenic plants or their progeny previously transformed by means of the process of the invention, which produce an inhibitor-resistant form of the plant protox enzyme provided herein. Such plants may be stably transformed with a structural gene encoding the resistant protox, or prepared by direct selection techniques whereby herbicide resistant lines are isolated, characterized and developed.
The present invention further provides a method for selecting plant cells transformed with a DNA molecule of the invention that encodes a herbicide-tolerant form of plant protox. The method comprises introducing the DNA molecule into plant cells whose growth is sensitive to inhibition by herbicides to which the protox encoded by the DNA molecule is resistant, thus forming a transformed plant cell. The transformed plant cell whose growth is resistant to the selected herbicide is identified by selection at a herbicide concentration that inhibits the growth of untransformed plant cells.
The present invention also provides a novel method for selecting a transplastomic plant cell, comprising the steps of introducing the above-described chimeric gene into the plastome of a plant cell; expressing the encoded enzyme in the plastids of the plant cell;
and selecting a cell that is resistant to a herbicidal compound that naturally inhibits the activity of the enzyme, whereby the resistant cell comprises transformed plastids. In a preferred embodiment, the enzyme is naturally inhibited by a herbicidal compound and the transgenic plant is able to grow on an amount of the herbicidal compound that naturally inhibits the activity of the enzyme.
In another aspect, the present invention is directed to a method for controlling unwanted vegetation growing at a locus where a herbicide-tolerant, agronomically useful plant, which is transformed with a DNA molecule according to the present invention that encodes a herbicide-tolerant form of plant protox, has been cultivated. The method comprises applying to the locus to be protected an effective amount of herbicide that inhibits naturally occurring protox activity. In particular, the present invention is directed to a method for controlling the growth of undesired vegetation, which comprises applying to a population of the above-described plants an effective amount of an inhibitor of the enzyme.
In preferred embodiment, the invention relates to a method for controlling the growth of undesired vegetation, wherein said protox-inhibiting herbicide is selected from the group consisting of an aryluracil, a diphenylether, an oxidiazole, an imide, preferably an imide having formula V, VI, VII, Vlla, VIII, IX, IXa, or Ixb, a phenyl pyrazole, preferably a phenyl pyrazole having formula XXIV, a pyridyl pyrazole, preferably a pyridyl pyrazole having formula XXllla or XXlllb, a pyridine derivative, a 3-substituted-2-aryl-4,5,6,7-tetrahydroindazole, a phenopylate and O-phenylpyrrolidino- and piperidinocarbamate analogs of said phenopylate.
The invention further relates to a method for selectively suppressing the growth of weeds in a field containing a crop of planted crop seeds or plants, comprising the steps of:
(a) planting herbicide tolerant crops or crop seeds, which are plants or plant seeds according to the invention; and (b) applying to the crops or crop seeds and the weeds in the field a protox-inhibiting herbicide in amounts that inhibit naturally occurring protox activity, wherein the herbicide suppresses the growth of the weeds without significantly suppressing the growth of the crops.
In one aspect, the present invention is directed to an isolated DNA molecule that encodes protoporphyrinogen oxidase (referred to herein as "protox) from sugar cane. The partial DNA coding sequence and corresponding amino acid sequence for a sugar cane protox enzyme are provided as SEQ ID NOs:36 and 37, respectively.
Further comprised by the present invention are, therefore, isolated DNA
molecules encoding the protoporphyrinogen oxidase (protox) enzyme protein from a sugar cane plant, wherein the protein comprises the amino acid sequence given in SEQ ID NO: 37.
In another aspect, the present invention is directed to an isolated DNA
molecule that encodes a sugar cane protox enzyme and that comprises a nucleotide sequence that hybridizes to the coding sequence shown in SEQ ID N0:36 under the following hybridization and wash conditions:
(a) hybridization in 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50 C; and (b) wash in 2X SSC, 1 % SDS at 50 C.The present invention is further directed to probes and methods for detecting the presence of genes encoding inhibitor-resistant forms of the plant protox enzyme and quantitating levels of inhibitor-resistant protox transcripts in plant tissue. These methods may be used to identify or screen for plants or plant tissue containing and/or expressing a gene encoding an inhibitor-resistant form of the plant protox enzyme as disclosed herein.
The entire protox sequences according to the invention or portions thereof may be used as probes capable of specifically hybridizing to protox coding sequences and messenger RNA's. To achieve specific hybridization under a variety of conditions, such probes include sequences that are unique among protox coding sequences and are preferably at least 10 nucleotides in length, and most preferably at least 20 nucleotides in length. Such probes may be used to amplify and analyze protox coding sequences from a chosen organism via the well known process of polymerase chain reaction (PCR).
This technique may be useful to isolate additional protox coding sequences from a desired organism or as a diagnostic assay to determine the presence of protox coding sequences in an organism.
Factors that affect the stability of hybrids determine the stringency of the hybridization. One such factor is the melting temperature Tm, which can be easily calculated according to the formula provided in DNA PROBES, George H. Keller and Mark M.
Manak , Macmillan Publishers Ltd, 1993, Section one: Molecular Hybridization Technology; page 8 ff.
. The preferred hybridization temperature is in the range of about 25°C
below the calculated melting temperature Tm and preferably in the range of about 12-15°C below the calculated melting temperature Tm and in the case of oligonucleotides in the range of about 5-10°C below the melting temperature Tm.
Comprised by the present invention are DNA molecules that hybridize to a DNA
molecule according to the invention as defined hereinbefore, but preferably to an oligonucleotide probe obtainable from the DNA molecule comprising a contiguous portion of the sequence of the protoporphyrinogen oxidase (protox) enzyme at least 10 nucleotides in length, under moderately stringent conditions.
The invention further embodies the use of a nucleotide probe capable of specifically hybridizing to a plant protox gene or mRNA of at least 10 nucleotides length in a polymerase chain reaction (PCR).
In a further embodiment, the present invention provides probes capable of specifically hybridizing to a eukaryotic DNA sequence encoding a protoporphyrinogen oxidase activity or to the respective mRNA and methods for detecting the DNA sequences in eukaryotic organisms using the probes according to the invention.
Protox specific hybridization probes according to the invention may also be used to map the location of the native eukaryotic protox genes) in the genome of a chosen organism using standard techniques based on the selective hybridization of the probe to genomic protox sequences. These techniques include, but are not limited to, identification of DNA polymorphisms identified or contained within the protox probe sequence, and use of such polymorphisms to follow segregation of the protox gene relative to other markers of known map position in a mapping population derived from self fertilization of a hybrid of two polymorphic parental lines (see e.g. Helentjaris et al., Plant Mol. Biol. 5:
109 (1985).
_12_ Sommer et al. Biotechniques 12: 82 (1992); D'Ovidio et al., Plant Mol. Biol.
15: 169 (1990)).
While any eukaryotic protox sequence is contemplated to be useful as a probe for mapping protox genes from any eukaryotic organism, preferred probes are those protox sequences from organisms more closely related to the chosen organism, and most preferred probes are those protox sequences from the chosen organism. Mapping of protox genes in this manner is contemplated to be particularly useful in plants for breeding purposes. For instance, by knowing the genetic map position of a mutant protox gene that confers herbicide resistance, flanking DNA markers can be identified from a reference genetic map (see, e.g., Helentjaris, Trends Genet. 3: 217 (1987)). During introgression of the herbicide resistance trait into a new breeding line, these markers can then be used to monitor the extent of protox-linked flanking chromosomal DNA still present in the recurrent parent after each round of back-crossing.
Protox specific hybridization probes according to the invention may also be used to quantitate levels of protox mRNA in an organism using standard techniques such as Northern blot analysis. This technique may be useful as a diagnostic assay to detect altered levels of protox expression that may be associated with particular adverse conditions such as autosomal dominant disorder in humans characterized by both neuropsychiatric symptoms and skin lesions, which are associated with decreased levels of protox activity (Brenner and Bloomer, New Engl. J. Med. 302: 765 (1980)).
A further embodiment of the invention is a method of producing a DNA molecule comprising a DNA portion encoding a protein having protoporphyrinogen oxidase (protox) enzyme activity comprising:
(a) preparing a nucleotide probe capable of specifically hybridizing to a plant protox gene or mRNA, wherein the probe comprises a contiguous portion of the coding sequence for a protox protein according to the present invention of at least 10 nucleotides length;
(b) probing for other protox coding sequences in populations of cloned genomic DNA fragments or cDNA fragments from a chosen organism using the nucleotide probe prepared according to step (a); and (c) isolating and multiplying a DNA molecule comprising a DNA portion encoding a protein having protoporphyrinogen oxidase (protox) enzyme activity.
A further embodiment of the invention is a method of isolating a DNA molecule from any plant comprising a DNA portion encoding a protein having protoporphyrinogen oxidase (protox) enzyme activity.
(a) preparing a nucleotide probe capable of specifically hybridizing to a plant protox gene or mRNA, wherein the probe comprises a contiguous portion of the coding sequence for a protox protein according to the present invention of at least 10 nucleotides length;
(b) probing for other protox coding sequences in populations of cloned genomic DNA fragments or cDNA fragments from a chosen organism using the nucleotide probe prepared according to step (a); and (c) isolating a DNA molecule comprising a DNA portion encoding a protein having protoporphyrinogen oxidase (protox) enzyme activity.
The invention further comprises a method of producing an essentially pure DNA
sequence coding for a protein exhibiting protoporphyrinogen oxidase (protox) enzyme activity, which method comprises:
(a) preparing a genomic or a cDNA library from a suitable source organism using an appropriate cloning vector;
(b) hybridizing the library with a probe molecule according to the present invention; and (c) identifying positive hybridizations of the probe to the DNA clones from the library that is clones potentially containing the nucleotide sequence corresponding to the amino acid sequence for protoporphyrinogen oxidase (protox).
The invention further comprises a method of producing an essentially pure DNA
sequence coding for a protein exhibiting protoporphyrinogen oxidase (protox) enzyme activity, which method comprises:
(a) preparing total DNA from a genomic or a cDNA library;
(b) using the DNA of step (a) as a template for PCR reaction with primers representing low degeneracy portions of the amino acid sequence of protoporphyrinogen oxidase (protox) according to the present invention.
A further object of the invention is an assay to identify inhibitors of protoporphyrinogen oxidase (protox) enzyme activity that comprises:
(a) incubating a first sample of a protoporphyrinogen oxidase (protox) according to the present invention and its substrate;
(b) measuring an uninhibited reactivity of the protoporphyrinogen oxidase (protox) from step (a);
(c) incubating a first sample of protoporphyrinogen oxidase (protox) and its substrate in the presence of a second sample comprising an inhibitor compound;
(d) measuring an inhibited reactivity of the protoporphyrinogen oxidase (protox) enzyme from step (c); and (e) comparing the inhibited reactivity to the uninhibited reactivity of protoporphyrinogen oxidase (protox) enzyme.
A further object of the invention is an assay to identify inhibitor-resistant protoporphyrinogen oxidase (protox) mutants that comprises:
(a) incubating a first sample of protoporphyrinogen oxidase (protox) enzyme and its substrate in the presence of a second sample comprising a protoporphyrinogen oxidase (protox) enzyme inhibitor;
(b) measuring an unmutated reactivity of the protoporphyrinogen oxidase (protox) enzyme from step (a);
(c) incubating a first sample of a mutated protoporphyrinogen oxidase (protox) enzyme and its substrate in the presence of a second sample comprising protoporphyrinogen oxidase (protox) enzyme inhibitor;
(d) measuring a mutated reactivity of the mutated protoporphyrinogen oxidase (protox) enzyme from step (c); and (e) comparing the mutated reactivity to the unmutated reactivity of the protoporphyrinogen oxidase (protox) enzyme.
A further object of the invention is a protox enzyme inhibitor obtained by a method according to the invention.
For recombinant production of the enzyme in a host organism, the protox coding sequence according to the present invention may be inserted into an expression cassette designed for the chosen host and introduced into the host where it is recombinantly produced. The choice of specific regulatory sequences such as promoter, signal sequence, 5' and 3' untranslated sequences, and enhancer, is within the level of skill of the routineer in the art. The resultant molecule, containing the individual elements linked in proper reading frame, may be inserted into a vector capable of being transformed into the host cell.
Suitable expression vectors and methods for recombinant production of proteins are well known for host organisms such as E. coli (see, e.g. Studier and Moffatt, J.
Mol. Biol. 189:
113 (1986); Brosius, DNA 8: 759 (1989)), yeast (see, e.g., Schneider and Guarente, Meth.
Enzymol. i94: 373 (1991 )) and insect cells (see, e.g., Luckow and Summers, BiolTechnol.
6: 47 (1988)). Specific examples include plasmids such as pBluescript (Stratagene, La Jolla, CA), pFLAG (International Biotechnologies, Inc., New Haven, CT), pTrcHis (Invitrogen, La Jolla, CA), and baculovirus expression vectors, e.g., those derived from the genome of Aufographica califomica nuclear polyhedrosis virus (AcMNPV). A
preferred baculovirus/insect system is pV111392/Sf21 cells (Invitrogen, La Jolla, CA).
Recombinantly produced eukaryotic protox enzyme is useful for a variety of purposes.
For example, it may be used to supply protox enzymatic activity in vitro. It may also be used in an in vitro assay to screen known herbicidal chemicals whose target has not been identified to determine if they inhibit protox. Such an in vifro assay may also be used as a more general screen to identify chemicals that inhibit protox activity and that are therefore herbicide candidates. Recombinantly produced eukaryotic protox enzyme may also be used in an assay to identify inhibitor-resistant protox mutants (see International application no.
PCT/IB95/00452 filed June 8, 1995, published Dec. 21, 1995 as WO 95/34659, incorporated by reference herein in its entirety). Alternatively, recombinantly produced protox enzyme may be used to further characterize its association with known inhibitors in order to rationally design new inhibitory herbicides as well as herbicide tolerant forms of the enzyme.
In another aspect, the present invention teaches modifications that can be made to the amino acid sequence of any eukaryotic protoporphyrinogen oxidase (referred to herein as "protox") enzyme to yield an inhibitor-resistant form of this enzyme.
Preferably, the eukaryotic protox enzyme is a plant protox enzyme. The present invention is directed to inhibitor-resistant protox enzymes having the modifications taught herein, to DNA molecules encoding these modified enzymes, and to chimeric genes capable of expressing these modified enzymes in plants.
The present invention discloses an isolated DNA molecule encoding a modified eukaryotic protoporphyrinogen oxidase (protox) having at least one amino acid modification, wherein the amino acid modification has the property of conferring resistance to a protox inhibitor, that is wherein the modified protox is tolerant to an inhibitor in amounts that inhibit the naturally occurring eukaryotic protox. As used herein "inhibit" refers to a reduction in enzymatic activity observed in the presence of a subject compound compared to the level of activity observed in the absence of the subject compound, wherein the percent level of reduction is preferably at least 10%, more preferably at least 50%, and most preferably at least 90%.
In particular, a DNA molecule is disclosed encoding a modified eukaryotic protoporphyrinogen oxidase (protox) that is a plant protox, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity, particularly a protox selected from the group consisting of an Arabidopsis protox enzyme, a maize protox enzyme, a wheat protox enzyme, a soybean protox enzyme, a cotton protox enzyme, a sugar beet protox enzyme, an oilseed rape protox enzyme, a rice protox enzyme, a sorghum protox enzyme, and a sugar cane protox enzyme having at least one amino acid modification, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity.
As used herein, the expression "substantially conserved amino acid sequences refers to regions of amino acid homology between polypeptides comprising protox enzymes from different sources. In the present invention, seventeen substantially conserved amino acid sub-sequences, designated 1-19 respectively, are shown in Table 1 B. One skilled in the art could align the amino acid sequences of protox enzymes from different sources, as has been done in Table 1 A, to identify the sub-sequences therein that make up the substantially conserved amino acid sequences defined herein. Stated another way, a given sub-sequence from one source "corresponds to" a homologous subsequence from a different source. The skilled person could then determine whether the identified sub-sequences have the characteristics disclosed and claimed in the present application.
Therefore, the present invention discloses a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes an enzyme having protoporphyrinogen oxidase (protox) activity, wherein the nucleic acid molecule is capable of being incorporated into a nucleic acid construct used to transform a plant containing wild-type, herbicide-sensitive protox, wherein the nucleotide sequence has at least one point mutation relative to a wild-type nucleotide sequence encoding plant protox, such that upon transformation with the nucleic acid construct the plant is rendered herbicide-tolerant.
A preferred embodiment of the present invention is directed to a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises at least one of the following amino acid sub-sequences:
(a) APA,F, wherein O, is an amino acid other than arginine, but especially leucine or cysteine;
(b) FMS, wherein ~ is leucine;
(c) Y~G, wherein ~ is isoleucine;
(d) O,IG, wherein 0, is histidine or alanine;
(e) KA018F, wherein 0,a is an amino acid other than alanine;
(f) QO,9H, wherein 019 is an amino acid other than leucine;
(g) TD,6G, wherein 0,6 is an amino acid other than leucine and YVO"G, wherein 0,~ is an amino acid other than alanine.
(Table 1B; sub-sequences 1-10 and 18-19, and 16-17).
Preferred is a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence APO~F, wherein 0~ is leucine or cysteine.
Preferred is a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence F02S, wherein 02 is leucine.
Preferred is a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence YA3G, wherein ~ is an isoleucine.
Preferred is a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence ~~IG, wherein 0~ is histidine or alanine, bur especially histidine.
Further preferred is a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence KAO,eF, wherein 0,8 is an amino acid other than alanine. Most preferably, 0~8 is threonine or valine.
Preferred is a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence QO,9H, wherein 0,9 is an amino acid other than leucine. Most preferably, 0,9 is serine.
Another preferred embodiment of the present invention is directed to a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises at least one of the following amino acid sub-sequences:
(a) I(AO,eF, wherein 0~8 is an amino acid other than alanine, (b) QO~9H, wherein 0,9 is an amino acid other than leucine, (c) AP01F, wherein 0, is an aminoc acid other than arginine, but especially leucine or cysteine, (d) F02S, wherein 02 is leucine (e) Y~G, wherein ~ is isoleucine (f) O~IG, wherein 0~ is histidine or alanine, (g) T~16G, wherein 0,6 is an amino acid other than leucine and YVD,~G, wherein 0,~ is an amino acid other than alanine, (Table 1 B; sub-sequences 1-10 and 18-19; and 16-17), and wherein the modified enzyme further comprises at least one additional amino acid sub-sequence selected from the group consisting of:
(c) (d)Q~"S, wherein 0~1 is an amino acid other than proline;
(d) (e) IGG012, wherein 0,2 is an amino acid other than threonine;
(e) SWXL~~3, wherein 0~3 is an amino acid other than serine;
(f) 1~,4Y, wherein 0~4 is an amino acid other than asparagine; and (g) G0~5XGL, wherein D,5 is an amino acid other than tyrosine.
Another preferred embodiment of the present invention is directed to a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises: the amino acid sub-sequence D,IG, wherein 0, is an amino acid other than tyrosine; the amino acid sub-sequences IGG~,2, wherein D,2 is an amino acid other than threonine; and the amino acid sub-sequence SWXL0,3, wherein 0,3 is an amino acid other than serine. Most preferably, 0, is isoleucine, O,2 is isoleucine, and 0~3 is leucine.
Yet another preferred embodiment of the present invention is directed to a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the nucleotide sequence is further characterized in that at least one of the following conditions is met:
(a) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence APO~F, wherein 0, is leucine;
(b) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence F02S, wherein 02 is leucine;
(c) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence Y~G, wherein ~ is isoleucine;
(d) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence O,IG, wherein 0, is alanine or histidine;
(e) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence Y~G, wherein ~ is an amino acid other than alanine, but preferably cysteine or isoleucine, more preferably isoleucine, and the nucleic acid sequence also has a sequence that encodes one of the group consisting of:
(1) sub-sequence QO,~S, wherein O1, is an amino acid other than proline, (2) sub-sequence IGG0~2, wherein ~~2 is an amino acid other than threonine, (3) sub-sequence SWXL~~3, wherein 0,3 is an amino acid other than serine, (4) sub-sequence t~~4Y, wherein 0,4 is an amino acid other than asparagine, and (5) sub-sequence GO,SXGL, wherein 0,5 is an amino acid other than tyrosine;
(f) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence ~~IG, wherein ~~ is an amino acid other than tyrosine, but preferably threonine, alanine or histidine, more preferably alanine or histidine and most preferably histidine, and the nucleic acid sequence also has a sequence that encodes one of the group consisting of:
(1 ) sub-sequence QO,~S, wherein 0" is an amino acid other than proline, (2) sub-sequence IGG~,2, wherein D,2 is an amino acid other than threonine, (3) sub-sequence SWXL~,3, wherein 0,3 is an amino acid other than serine, (4) sub-sequence L0,4Y, wherein 0,4 is an amino acid other than asparagine, and (5) sub-sequence GD,SXGL, wherein 015 is an amino acid other than tyrosine; and (g) the nucleic has a sequence that encodes amino acid sub-sequence TO~6G, wherein 0,6 is an amino acid other than leucine, and the nucleic acid sequence also has a sequence that encodes amino acid sub-sequence YVe"G, wherein 01, is an amino acid other than alanine.
(h) KAO,eF, wherein ~~e is an amino acid other than alanine;
(i) QO19H, wherein O,9 is an amino acid other than leucine.
Preferably, said nucleic acid sequence has a sequence that encodes amino acid sub-sequence TO,6G, wherein 0~6 is an amino acid other than leucine, and said nucleic acid sequence also has a sequence that encodes amino acid sub-sequence YVD"G, wherein 0,~ is an amino acid other than alanine. Preferably, the nucleic acid sequence has a sequence that encodes amino acid sub-sequence T~~6G, wherein 0,g is serine, and said nucleic acid sequence also has a sequence that encodes amino acid sub-sequence YVD»G, wherein 0" is threonine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the arginine occurring at the position corresponding to amino acid 88 of SEQ ID N0:6 is replaced with another amino acid, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity. Particularly preferred is the DNA molecule wherein the arginine is replaced with a leucine or cysteine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the cysteine occurring at the position corresponding to amino acid 159 of SEQ ID N0:6 is replaced with a leucine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the alanine occurring at the position corresponding to amino acid 175 of SE4 ID N0:6 is replaced with another amino acid, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity. Particularly preferred is a DNA molecule wherein the alanine is replaced with a valine or threonine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the leucine occurring at the position corresponding to amino acid 337 of SEQ ID N0:6 is replaced with another amino acid, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity. Particularly preferred is a DNA molecule wherein the leucine is replaced with a serine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the tyrosine occurring at the position corresponding to amino acid 428 of SEQ ID N0:16 is replaced with a histidine or alanine, preferably a histidine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the alanine occurring at the position corresponding to amino acid 220 of SEQ ID N0:2 is replaced with a isoleucine or a tyrosine, preferably a isoleucine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the tyrosine occurring at the position corresponding to amino acid 426 of SEQ ID N0:2 is replaced with a alanine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the leucine occurring at the position corresponding to amino acid 347 of SEQ ID N0:6 is replaced with a serine and the alanine occurring at the position corresponding to amino acid 453 of SEQ ID N0:6 is replaced with a threonine.
The present invention further discloses a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox having a first amino acid substitution and a second amino acid substitution; the first amino acid substitution having the property of conferring resistance to a protox inhibitor; and the second amino acid substitution having the property of enhancing the resistance conferred by the first amino acid substitution but especially a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox, wherein the plant is selected from the group consisting of maize, wheat, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, sugar cane, and Arabidopsis. Preferred is a DNA molecule wherein the first amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the arginine at amino acid 88 of SEQ ID
N0:6the position corresponding to the alanine at amino acid 175 of SEQ ID
N0:6;
and (c) the position corresponding to the leucine at amino acid 337 of SEQ ID
N0:6.
Particularly preferred is a DNA molecule wherein the first amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the arginine at amino acid 88 of SEQ ID
N0:6;
(b) the position corresponding to the alanine at amino acid 164 of SEQ ID
N0:6;
(c) the position corresponding to the glycine at amino acid 165 of SEQ ID
N0:6;
(d) the position corresponding to the tyrosine at amino acid 370 of SEQ ID
N0:6;
(e) the position corresponding to the cysteine at amino acid 159 of SEQ ID
N0:6;
(f) the position corresponding to the isoleucine at amino acid 419 of SEQ ID
N0:6.
(g) the position corresponding to the valine at amino acid 356 of SEQ ID
N0:10;
(h) the position corresponding to the serine at amino acid 421 of SEQ ID
N0:10;
(i) the position corresponding to the valine at amino acid 502 of SEQ ID
N0:10;
(j) the position corresponding to the alanine at amino acid 211 of SEQ ID
N0:10;
(k) the position corresponding to the glycine at amino acid 212 of SEQ ID
NO:10;
(I) the position corresponding to the isoleucine at amino acid 466 of SEQ ID
N0:10;
(m) the position corresponding to the proline at amino acid 369 of SEQ ID
N0:12;
(n) the position corresponding to the alanine at amino acid 226 of SEQ ID
N0:12;
(o) the position corresponding to the tyrosine at amino acid 432 of SEQ ID
N0:12;
(p) . the position corresponding to the valine at amino acid 517 of SEQ ID
N0:12;
(q) the position corresponding to the tyrosine at amino acid 428 of SEQ ID
N0:16;
(r) the position corresponding to the proline at amino acid 365 of SEQ ID
N0:16;
(s) the position corresponding to the tyrosine at amino acid 449 of SEQ ID
N0:18;
(t) the position corresponding to the alanine at amino acid 175 of SEQ ID
N0:6;
and (u) the position corresponding to the leucine at amino acid 337 of SEQ ID
N0:6;
and wherein the second amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the serine at amino acid 305 of SEQ ID N0:2;
(b) the position corresponding to the threonine at amino acid 249 of SEQ ID
N0:2;
(c) the position corresponding to the proline at amino acid 118 of SEQ ID
N0:2;
(d) the position corresponding to the asparagine at amino acid 425 of SEQ ID
N0:2; and (e) the position corresponding to the tyrosine at amino acid 498 of SEQ ID
N0:2.
Particularly preferred is a DNA molecule wherein the first amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the arginine at amino acid 88 of SEQ ID
N0:6;
(b) the position corresponding to the alanine at amino acid 175 of SEQ ID
N0:6;
and (c) the position corresponding to the leucine at amino acid 337 of SEQ ID
N0:6.
and .
wherein the second amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the serine at amino acid 305 of SEQ ID N0:2;
(b) the position corresponding to the threonine at amino acid 249 of SEQ ID
N0:2;
(c) the position corresponding to the proline at amino acid 118 of SEQ ID
N0:2;
(d) the position corresponding to the asparagine at amino acid 425 of SEQ ID
N0:2; and (d) the position corresponding to the tyrosine at amino acid 498 of SEQ ID
N0:2.Particularly preferred is a DNA molecule wherein the arginine occurring at the position corresponding to residue 88 of SEQ ID N0:6 is replaced with a cysteine or a leucine.
More preferred is a DNA molecule wherein the cysteine occurring at the position corresponding to residue 159 of SEQ ID N0:6 is replaced with an leucine.
Particularly preferred is a DNA molecule wherein the alanine occurring at the position corresponding to residue 175 of SEQ ID N0:6 is replaced with an amino acid selected from the group consisting of threonine and valine.
Particularly preferred is a DNA molecule wherein the leucine occurring at the position corresponding to residue 337 of SEQ ID N0:6 is replaced with a serine.
More preferred is a DNA molecule wherein the tyrosine occurring at the position corresponding to residue 428 of SEQ ID N0:16 is replaced with histidine or alanine.
The.present invention is still further directed to a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox having a double amino acid substitution, wherein both amino acid substitutions are required for there to be resistance to a protox inhibitor. Preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox, wherein the plant is selected from the group consisting of maize, wheat, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, sugar cane, and Arabidopsis. More preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox, wherein the plant is maize.
Preferred is a DNA molecule having a double amino acid substitution, wherein one amino acid substitution occurs at the position corresponding to the leucine at amino acid 347 of SEQ ID N0:6, and wherein the second amino acid substitution occurs at the position corresponding to the alanine at amino acid 453 of SEQ ID N0:6.
Particularly preferred is a DNA molecule having a double amino acid substitution, wherein a leucine occurring at the position corresponding to amino acid 347 of SEQ ID
N0:6 is replaced with a serine, and wherein an alanine occurring at the position corresponding to amino acid 453 of SEQ ID N0:6 is replaced with a threonine.
The present invention is further directed to a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the plant protox comprises an amino acid sequence selected from the group consisting of SEQ ID
NO: 37.
The present invention is further directed to expression cassettes and recombinant vectors comprising the expression cassettes comprising essentially a promoter, but especially a promoter that is active in a plant, operatively linked to a DNA
molecule encoding the protoporphyrinogen oxidase (protox) enzyme from a eukaryotic organism according to the invention. The expression cassette according to the invention may in addition further comprise a signal sequence operatively linked to the DNA
molecule, wherein the signal sequence is capable of targeting the protein encoded by the DNA
molecule into the chloroplast or the mitochondria.
The invention relates to a chimeric gene, which comprises an expression cassette comprising essentially a promoter, but especially a promoter that is active in a plant, operatively linked to a heterologous DNA molecule encoding a protoporphyrinogen oxidase (protox) enzyme from a eukaryotic organism according to the invention.
Preferred is a chimeric gene, wherein the DNA molecule encodes an protoporphyrinogen oxidase (protox) enzyme from sugar cane More preferred is a chimeric gene comprising a promoter active in a plant operatively linked to a heterologous DNA molecule encoding a protoporphyrinogen oxidase (protox) from sugar cane comprising the sequence set forth in SEQ ID N0:37.
Particularly preferred is a chimeric gene, wherein the DNA molecule encodes a Particularly preferred is a chimeric gene, wherein the DNA molecule encodes a protein from sugar cane having protox-1 activity, preferably wherein the protein comprises the amino acid sequence set forth in SEQ ID N0:37.
The invention also embodies a chimeric gene, which comprises an expression cassette comprising essentially a promoter, but especially a promoter that is active in a plant, operatively linked to the DNA molecule encoding an protoporphyrinogen oxidase (protox) enzyme from a eukaryotic organism according to the invention, which is resistant to herbicides at levels that inhibit the corresponding unmodified version of the enzyme.
Preferred is a chimeric gene, wherein the DNA molecule encodes an protoporphyrinogen oxidase (protox) enzyme from a plant selected from the group consisting of Arabidopsis, sugar cane, soybean, barley, cotton, tobacco, sugar beet, oilseed rape, maize, wheat, sorghum, rye, oats, turf and forage grasses, millet, forage and rice. More preferred is a chimeric gene, wherein the DNA molecule encodes an protoporphyrinogen oxidase (protox) enzyme from a plant selected from the group consisting of soybean, cotton, tobacco, sugar beet,. oilseed rape, maize, wheat, sorghum, rye, oats, turf grass, and rice.
Particularly preferred is a chimeric gene, wherein the DNA molecule encodes an protoporphyrinogen oxidase (protox) enzyme from a plant selected from the group consisting of Arabidopsis, soybean, cotton, sugar beet, oilseed rape, maize, wheat, sorghum, and rice.
Encompassed by the present invention is a chimeric gene comprising a promoter that is active in a plant operatively linked to the DNA molecule according to the invention encoding a modified protoporphyrinogen oxidase (protox) comprising a eukaryotic protox having at least one amino acid modification, wherein the amino acid modification has the property of conferring resistance to a protox inhibitor.
Also encompassed by the present invention is a chimeric gene comprising a promoter that is active in a plant operatively linked to the DNA molecule according to the invention encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox having a first amino acid substitution and a second amino acid substitution; the first amino acid substitution having the property of conferring resistance to a protox inhibitor; and the second amino acid substitution having the property of enhancing the resistance conferred by the first amino acid substitution. Preferred is the chimeric gene additionally comprising a signal sequence operatively linked to the DNA molecule, wherein the signal sequence is capable of targeting the protein encoded by the DNA molecule into the chloroplast or in the mitochondria.
The chimeric gene according to the invention may in addition further comprise a signal sequence operatively linked to the DNA molecule of the invention, wherein the signal sequence is capable of targeting the protein encoded by the DNA molecule into the chloroplast. The chimeric gene according to the invention may in addition further comprise a signal sequence operatively linked to the DNA molecule, wherein the signal sequence is capable of targeting the protein encoded by the DNA molecule into the mitochondria.
Also encompassed by the present invention is any of the DNA sequences mentioned herein before, which is stably integrated into a host genome.
The invention further relates to a recombinant DNA molecule comprising a plant protoporphyrinogen oxidase (protox) according to the invention or a functionally equivalent derivative thereof.
The invention further relates to a recombinant DNA vector comprising the recombinant DNA molecule of the invention.
_27_ A further object of the invention is a recombinant vector comprising the chimeric gene according to the invention, wherein the vector is capable of being stably transformed into a host cell.
A further object of the invention is a recombinant vector comprising the chimeric gene according to the invention, wherein the vector is capable of being stably transformed into a plant, plant seeds, plant tissue or plant cell. Preferred is a recombinant vector comprising the chimeric gene according to the invention, wherein the vector is capable of being stably transformed into a plant. The plant, plant seeds, plant tissue or plant cell stably transformed with the vector is capable of expressing the DNA molecule encoding a protoporphyrinogen oxidase (protox). Preferred is a recombinant vector, wherein the plant, plant seeds, plant tissue or plant cell stably transformed with the the vector is capable of expressing the DNA
molecule encoding a protoporphyrinogen oxidase (protox) from a plant that is resistant to herbicides at levels that inhibit the corresponding unmodified version of the enzyme.
Preferred is a recombinant vector comprising the chimeric gene of the invention comprising a promoter active in a plant operatively linked to a heterologous DNA molecule encoding a protoporphyrinogen oxidase (protox) from sugar cane comprising the sequence set forth in SEQ ID N0:37, wherein the vector is capable of being stably transformed into a host cell.
Also preferred is recombinant vector comprising the chimeric gene of the invention comprising a promoter that is active in a plant operatively linked to the DNA
molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox having a first amino acid substitution and a second amino acid substitution; the first amino acid substitution having the property of conferring resistance to a protox inhibitor; and the second amino acid substitution having the property of enhancing the resistance conferred by the first amino acid substitution, wherein the vector is capable of being stably transformed into a plant cell.
Also encompassed by the present invention is a host cell stably transformed with the vector according to the invention, wherein the host cell is capable of expressing the DNA
molecule. Preferred is a host cell selected from the group consisting of a plant cell, a bacterial cell, a yeast cell, and an insect cell.
The present invention is further directed to plants and the progeny thereof, plant tissue and plant seeds tolerant to herbicides that inhibit the naturally occurring protox activity in these plants, wherein the tolerance is conferred by a gene expressing a modified inhibitor-resistant protox enzyme as taught herein. Representative plants include any plants to which these herbicides may be applied for their normally intended purpose.
Preferred are agronomically important crops, i.e., angiosperms and gymnosperms such as Arabidopsis, sugar cane, soybean, barley, cotton, tobacco, sugar beet, oilseed rape, maize, wheat, sorghum, rye, oats, tomato, potato, turf and forage grasses, millet, forage, and rice and the like. More preferred are agronomically important crops, i.e., angiosperms and gymnosperms such as Arabidopsis, cotton, soybean, oilseed rape, sugar beet, maize, rice, wheat, barley, oats, rye, sorghum, millet, turf, forage, turf grasses. Particularly preferred are agronomically important crops, i.e., angiosperms and gymnosperms such as Arabidopsis, soybean, cotton, sugar beet, oilseed rape, maize, wheat, sorghum, and rice.
Preferred is a plant comprising the DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox having a first amino acid substitution and a second amino acid substitution; the first amino acid substitution having the property of conferring resistance to a protox inhibitor; and the second amino acid substitution having the property of enhancing the resistance conferred by the first amino acid substitution, wherein the DNA molecule is expressed in the plant and confers upon the plant tolerance to a herbicide in amounts that inhibit naturally occurring protox activity.
Preferred is a plant, wherein the DNA molecule replaces a corresponding naturally occurring protox coding sequence. Comprised by the present invention is a plant and the progeny thereof comprising the chimeric gene according to the invention, wherein the chimeric gene confers upon the plant tolerance to a herbicide in amounts that inhibit naturally occurring protox activity.
Encompassed by the present invention are transgenic plant tissue, including plants and the progeny thereof, seeds, and cultured tissue, stably transformed with at least one chimeric gene according to the invention. Preferred is transgenic plant tissue, including plants, seeds, and cultured tissue, stably transformed with at least one chimeric gene that comprises an expression cassette comprising essentially a promoter, but especially a promoter that is active in a plant, operatively linked to the DNA molecule encoding an protoporphyrinogen oxidase (protox) enzyme that is resistant to herbicides at levels that inhibit the corresponding unmodified version of the enzyme in the plant tissue.
The present invention is further directed to plants, plant tissue, plant seeds, and plant cells tolerant to herbicides that inhibit the naturally occurring protox activity in these plants, wherein the tolerance is conferred by increasing expression of wild-type herbicide-sensitive protox. This results in a level of a protox enzyme in the plant cell at least sufficient to overcome growth inhibition caused by the herbicide. The level of expressed enzyme generally is at least two times, preferably at least five times, and more preferably at least ten times the natively expressed amount. Increased expression may be due to multiple copies of a wild-type protox gene; multiple occurrences of the coding sequence within the gene (i.e. gene amplification) or a mutation in the non-coding, regulatory sequence of the endogenous gene in the plant cell. Plants having such altered gene activity can be obtained by direct selection in plants by methods known in the art (see, e.g.
U.S. Patent No.
5,162,602, and U.S. Patent No. 4,761,373, and references cited therein). These plants also may be obtained by genetic engineering techniques known in the art. Increased expression of a herbicide-sensitive protox gene can also be accomplished by stably transforming a plant cell with a recombinant or chimeric DNA molecule comprising a promoter capable of driving expression of an associated structural gene in a plant cell operatively linked to a homologous or heterologous structural gene encoding the protox enzyme.
The recombinant DNA molecules of the invention can be introduced into the plant cell in a number of art-recognized ways. Those skilled in the art will appreciate that the choice of method might depend on the type of plant, i.e. monocot or dicot, targeted for transformation. Suitable methods of transforming plant cells include microinjection (Crossway et al., BioTechniques 4320-334 (1986)), electroporation (Riggs et al, Proc. Natl.
Acad. Sci. USA 83:5602-5606 (1986), Agrobacterium mediated transformation (Hinchee et al., Biotechnology 6.915-921 (1988)), direct gene transfer (Paszkowski et aL, EMBO J.
32717-2722 (1984)), ballistic particle acceleration using devices available from Agracetus, Inc., Madison, Wisconsin and Dupont, Inc., Wilmington, Delaware (see, for example, Sanford et al., U.S. Patent 4,945,050; and McCabe et al., Biotechnology 6:923-926 (1988)), protoplast transformation/regeneration methods (see U.S. Patent No. 5,350,689 issued Sept. 27, 1994 to Ciba-Geigy Corp.), and pollen transformation (see U.S.
Patent No.
5,629,183). Also see, Weissinger etaG, Annual Rev. Genet. 22.421-477 (1988);
Sanford et al., Particulate Science and Technology 527-37 (1987)(onion); Christou et al., Plant PhysioL 87 671-674 (1988)(soybean); McCabe et al., BiolTechnology 6:923-926 (1988)(soybean); Datta et al., BiolTechnology 8:736-740 (1990)(rice); Klein et al., Proc.
Natl. Acad Sci. USA, 85:4305-4309 (1988)(maize); Klein et al., BiolTechnology (1988)(maize); Klein et al., Plant Physiol. 91:440-444 (1988)(maize); Fromm et al., BiolTechnology 833-839 (1990); Gordon-Kamm et al., Plant Ce112.603-618 (1990) (maize); and U.S. Patent Nos. 5,591,616 and 5,679,558 (rice).
Comprised within the scope of the present invention are transgenic plants, in particular transgenic fertile plants transformed by means of the aforedescribed processes and their asexual and/or sexual progeny, which still are resistant or at least tolerant to inhibition by a herbicide at levels that normally are inhibitory to the naturally occurring protox activity in the plant. Progeny plants also include plants with a different genetic background than the parent plant, which plants result from a backcrossing program and still comprise in their genome the herbicide resistance trait according to the invention. Very especially preferred are hybrid plants that are resistant or at least tolerant to inhibition by a herbicide at levels that normally are inhibitory to the naturally occurring protox activity in the plant.
The transgenic plant according to the invention may be a dicotyledonous or a monocotyledonous plant. Preferred are monocotyledonous plants of the Graminaceae family involving Lolium, Zea, Triticum, Triticale, Sorghum, Saccharum, Bromus, Oryzae, Avena, Hordeum, Secale and Setaria plants. More preferred are transgenic maize, wheat, barley, sorghum, rye, oats, sugar cane, turf and forage grasses, millet and rice. Especially preferred are maize, wheat, sorghum, rye, oats, turf grasses and rice.
Among the dicotyledonous plants Arabidopsis, soybean, cotton, sugar beet, oilseed rape, tobacco, tomato, potato, and sunflower are more preferred herein.
Especially preferred are soybean, cotton, tobacco, sugar beet, tomato, potato, and oilseed rape.
The expression 'progeny' is understood to embrace both, "asexually" and "sexually"
generated progeny of transgenic plants. This definition is also meant to include all mutants and variants obtainable by means of known processes, such as for example cell fusion or mutant selection and that still exhibit the characteristic properties of the initial transformed plant, together with all crossing and fusion products of the transformed plant material. This also includes progeny plants that result from a backcrossing program, as long as the progeny plants still contain the herbicide resistant trait according to the invention.
Another object of the invention concerns the proliferation material of transgenic plants.
The proliferation material of transgenic plants is defined relative to the invention as any plant material that may be propagated sexually or asexually in vivo or in vitro. Particularly preferred within the scope of the present invention are protoplasts, cells, calli, tissues, organs, seeds, embryos, pollen, egg cells, zygotes, together with any other propagating material obtained from transgenic plants.
Parts of plants, such as for example flowers, stems, fruits, leaves, roots originating in transgenic plants or their progeny previously transformed by means of the process of the invention and therefore consisting at least in part of transgenic cells, are also an object of the present invention.
A further object of the invention is a method of producing plants, protoplasts, cells, calli, tissues, organs, seeds, embryos, pollen, egg cells, zygotes, together with any other propagating material, parts of plants, such as for example flowers, stems, fruits, leaves, roots originating in transgenic plants or their progeny previously transformed by means of the process of the invention, which therefore produce an inhibitor resistant form of a plant protox enzyme by transforming the plant, plant parts with the DNA according to the invention. Preferred is a method of producing a host cell comprising an isolated DNA
molecule encoding a protein from a eukaryote having protoporphyrinogen oxidase (protox) activity comprising transforming the host cell with a recombinant vector molecule according to the invention. Further preferred is a method of producing a plant cell comprising an isolated DNA molecule encoding a protein from a eukaryote having protoporphyrinogen oxidase (protox) activity comprising transforming the plant cell with a recombinant vector molecule according to the invention. Preferred is a method of producing transgenic progeny of a transgenic parent plant comprising an isolated DNA molecule encoding a protein from a eukaryote having protoporphyrinogen oxidase (protox) activity comprising transforming the parent plant with a recombinant vector molecule according to the invention and transferring the herbicide tolerant trait to the progeny of the transgenic parent plant involving known plant breeding techniques.
Preferred is a method for the production of plants, plant tissues, plant seeds and plant parts, which produce an inhibitor-resistant form of the plant protox enzyme, wherein the plants, plant tissues, plant seeds and plant parts have been stably transformed with a structural gene encoding the resistant protox enzyme. Particularly preferred is a method for the production of plants, plant tissues, plant seeds and plant parts, wherein the plants, plant tissues, plant seeds and plant parts have been stably transformed with the DNA
according to the invention. Especially preferred is a method for the production of the plants, plant tissues, plant seeds and plant parts, which produce an inhibitor-resistant form of the plant protox enzyme, wherein the plants, plant tissues, plant seeds and plant parts have been prepared by direct selection techniques whereby herbicide resistant lines are isolated, characterized and developed.
The genetic properties engineered into the transgenic seeds and plants described above are passed on by sexual reproduction or vegetative growth and can thus be maintained and propagated in progeny plants. Generally the maintenance and propagation make use of known agricultural methods developed to fit specific purposes such as tilling, sowing or harvesting. Specialized processes such as hydroponics or greenhouse technologies can also be applied. As the growing crop is vulnerable to attack and damages caused by insects or infections as well as to competition by weed plants, measures are undertaken to control weeds, plant diseases, insects, nematodes, and other adverse conditions to improve yield. These include mechanical measures such a tillage of the soil or removal of weeds and infected plants, as well as the application of agrochemicals such as herbicides, fungicides, gametocides, nematicides, growth regulants, ripening agents and insecticides.
Use of the advantageous genetic properties of the transgenic plants and seeds according to the invention can further be made in plant breeding that aims at the development of plants with improved properties such as tolerance of pests, herbicide tolerance, or stress tolerance, improved nutritional value, increased yield, or improved structure causing less loss from lodging or shattering. The various breeding steps are characterized by well-defined human intervention such as selecting the lines to be crossed, directing pollination of the parental lines, or selecting appropriate progeny plants.
Depending on the desired properties different breeding measures are taken. The relevant techniques are well known in the art and include but are not limited to hybridization, inbreeding, backcross breeding, multiline breeding, variety blend, interspecific hybridization, aneuploid techniques, etc. Hybridization techniques also include the sterilization of plants to yield male or female sterile plants by mechanical, chemical or biochemical means. Cross pollination of a male sterile plant with pollen of a different line assures that the genome of the male sterile but female fertile plant will uniformly obtain properties of both parental lines.
Thus, the transgenic seeds and plants according to the invention can be used for the breeding of improved plant lines that for example increase the effectiveness of conventional methods such as herbicide or pesticide treatment or allow to dispense with the methods due to their modified genetic properties. Alternatively new crops with improved stress tolerance can be obtained that, due to their optimized genetic "equipment', yield harvested product of better quality than products that were not able to tolerate comparable adverse developmental conditions.
In seeds production germination quality and uniformity of seeds are essential product characteristics, whereas germination quality and uniformity of seeds harvested and sold by the farmer is not important. As it is difficult to keep a crop free from other crop and weed seeds, to control seedbome diseases, and to produce seed with good germination, fairly extensive and well-defined seed production practices have been developed by seed producers, who are experienced in the art of growing, conditioning and marketing of pure seed. Thus, it is common practice for the farmer to buy certified seed meeting specific quality standards instead of using seed harvested from his own crop.
Propagation material to be used as seeds is customarily treated with a protectant coating comprising herbicides, insecticides, fungicides, bactericides, nematicides, molluscicides or mixtures thereof.
Customarily used protectant coatings comprise compounds such as captan, carboxin, thiram (TMTD~), methalaxyl (Apron~), and pirimiphos-methyl (Actellic~). If desired these compounds are formulated together with further carriers, surfactants or application-promoting adjuvants customarily employed in the art of formulation to provide protection against damage caused by bacterial, fungal or animal pests. The protectant coatings may be applied by impregnating propagation material with a liquid formulation or by coating with a combined wet or dry formulation. Other methods of application are also possible such as treatment directed at the buds or the fruit.
It is thus a further object of the present invention to provide plant propagation material for cultivated plants, but especially plant seed that is treated with an seed protectant coating customarily used in seed treatment.
It is a further aspect of the present invention to provide new agricultural methods such as the methods exemplified above, which are characterized by the use of transgenic plants, transgenic plant material, or transgenic seed according to the present invention. Comprised by the present invention is an agricultural method, wherein a transgenic plant or the progeny thereof is used comprising a chimeric gene according to the invention in an amount sufficient to express herbicide resistant forms of herbicide target proteins in a plant to confer tolerance to the herbicide.
To breed progeny from plants transformed according to the method of the present invention, a method such as that which follows may be used: maize plants produced as described in the examples set forth below are grown in pots in a greenhouse or in soil, as is known in the art, and permitted to flower. Pollen is obtained from the mature tassel and used to pollinate the ears of the same plant, sibling plants, or any desirable maize plant.
Similarly, the ear developing on the transformed plant may be pollinated by pollen obtained from the same plant, sibling plants, or any desirable maize plant. Transformed progeny obtained by this method may be distinguished from non-transformed progeny by the presence of the introduced genes) and/or accompanying DNA (genotype), or the phenotype conferred. The transformed progeny may similarly be selfed or crossed to other plants, as is normally done with any plant carrying a desirable trait.
Similarly, tobacco or other transformed plants produced by this method may be selfed or crossed as is known in the art in order to produce progeny with desired characteristics. Similarly, other transgenic organisms produced by a combination of the methods known in the art and this invention may be bred as is known in the art in order to produce progeny with desired characteristics.
The modified inhibitor-resistant protox enzymes of the invention have at least one amino acid substitution, addition or deletion relative to their naturally occurring counterpart (i.e. inhibitor-sensitive forms that occur naturally in a plant without being manipulated, either directly via recombinant DNA methodology or indirectly via selective breeding, etc., by man).
Amino acid positions that may be modified to yield an inhibitor-resistant form of the protox enzyme, or enhance inhibitor resistance, are indicated in bold type in Table 1A in the context of plant protox-1 sequences from Arabidopsis, maize, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, wheat, and sugar cane. The skilled artisan will appreciate that equivalent changes may be made to any plant protox gene having a structure sufficiently similar to the protox enzyme sequences shown herein to allow alignment and identification of those amino acids that are modified according to the invention to generate inhibitor-resistant forms of the enzyme. Such additional plant protox genes may be obtained using standard techniques as described in International application no.
PCT/IB95/00452 filed June 8, 1995, published Dec. 21, 1995 as WO 95/34659 whose relevant parts are herein incorporated by reference.
DNA molecules encoding the herbicide resistant protox coding sequences taught herein may be genetically engineered for optimal expression in a crop plant.
This may include altering the coding sequence of the resistance allele for optimal expression in the crop species of interest. Methods for modifying coding sequences to achieve optimal expression in a particular crop species are well known (see, e.g. Perlak et al., Proc. Natl.
Acad. Sci. USA 88: 3324 (1991 ); Koziel et al., Bioltechnol. 11: 194 (1993)).
Genetically engineering a protox coding sequence for optimal expression may also include operatively linking the appropriate regulatory sequences (i.e.
promoter, signal sequence, transcriptional terminators). Examples of promoters capable of functioning in plants or plant cells (i.e., those capable of driving expression of the associated structural genes such as protox in plant cells) include the cauliflower mosaic virus (CaMV) 19S or 35S
promoters and CaMV double promoters; nopaline synthase promoters;
pathogenesis-related (PR) protein promoters; small subunit of ribulose bisphosphate carboxylase (ssuRUBISCO) promoters, heat shock protein promoter from Brassica with reference to EPA 0 559 603 (hsp80 promoter), Arabidopsis actin promoter and the SuperMas promoter with reference to WO 95/14098 and the like. Preferred promoters will be those that confer high level constitutive expression or, more preferably, those that confer specific high level expression in the tissues susceptible to damage by the herbicide.
Preferred promoters are the rice actin promoter (McElroy et al., Mol. Gen.
Genet. 231: 150 (1991 )), maize ubiquitin promoter (EP 0 342 926; Taylor et aL, Plant Cell Rep. 12: 491 (1993)), and the PR-1 promoter from tobacco, Arabidopsis, or maize (see U.S.
Patent No.
5,614,395 to Ryals et al., incorporated by reference herein in its entirety).
The promoters themselves may be modified to manipulate promoter strength to increase protox expression, in accordance with art-recognized procedures.
The inventors have also discovered that another preferred promoter for use with the inhibitor-resistant protox coding sequences is the promoter associated with the native protox gene (i.e. the protox promoter; see copending, co-owned U.S. Patent Application No.
08/808,323, entitled "Promoters from Protoporphyrinogen Oxidase Genes", incorporated by reference herein in its entirety.) The promoter sequence from an Arabidopsis protox-1 gene is set forth in SEQ ID N0:13, the promoter sequence from a maize protox-1 gene is set forth in SEQ ID N0:14, and the promoter sequence from a sugar beet protox-1 gene is set forth in SEQ ID N0:26.
Since the protox promoter itself is suitable for expression of inhibitor-resistant protox coding sequences, the modifications taught herein may be made directly on the native protox gene present in the plant cell genome~without the need to construct a chimeric gene with heterologous regulatory sequences. Such modifications can be made via directed mutagenesis techniques such as homologous recombination and selected for based on the resulting herbicide-resistance phenotype (see, e.g. Example 10, Pazkowski et al., EMBO J.
(i) GO,SXGL, wherein 0,5 is an amino acid other than tyrosine.
Preferred is a nucleic acid molecule, wherein said additional sub-sequence is Q~"S, wherein D" is an amino acid other than proline.
Further preferred is a nucleic acid molecule, wherein O" is leucine.
Also preferred is a nucleic acid molecule, wherein said additional sub-sequence is IGG0,2, wherein 0,2 is an amino acid other than threonine.
Also preferred is a nucleic acid molecule, wherein 0,2 is isoleucine or alanine.
Also preferred is a nucleic acid molecule, wherein said additional sub-sequence is SWXL0,3, wherein 0,3 is an amino acid other than serine.
Also preferred is a nucleic acid molecule, wherein D,3 is leucine.
Also preferred is a nucleic acid molecule, wherein said additional sub-sequence is L0,4Y, wherein D,4 is an amino acid other than asparagine.
Also preferred is a nucleic acid molecule, wherein D,4 is serine.
Also preferred is a nucleic acid molecule, wherein said additional sub-sequence is GO,SXGL, wherein D,5 is an amino acid other than tyrosine.
Also preferred is a nucleic acid molecule, wherein 0,5 is cysteine.
Especially preferred is a nucleic acid molecule encoding a plant protox enzyme that is capable of being incorporated into a DNA construct used to transform a plant containing wild-type, herbicide-sensitive protox, wherein the nucleic acid molecule has at least one point mutation relative to a wild-type DNA molecule encoding plant protox as mentioned hereinbefore such that upon transformation with the DNA construct the plant contains the DNA molecule, which renders the plant resistant to the application of a herbicide that inhibits naturally occurring plant protox, wherein said nucleic acid molecule can be obtained from a plant selected from the group consisting of Arabidopsis, maize, wheat, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, and sugar cane.
Sequences of such DNA molecules are set forth in SEQ ID NOs: 9 (wheat), 11 (soybean), 15 (cotton), 17 (sugar beet), 19 (oilseed rape), 21 (rice), 23 (sorghum), and 36 (sugar cane).
Preferred is a nucleic acid molecule which can be obtained from maize or cotton.
Also comprised by the present invention is a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is encoded by any of the nucleotide sequences according to the invention mentioned hereinbefore.
_7_ The present invention further includes chimeric genes and modified forms of naturally occurring protox genes that can express the inhibitor-resistant plant protox enzymes in plants.
In particular, the present invention relates to a chimeric gene comprising a promoter that is active in a plant operatively linked to a nucleic acid molecule according to the invention.
The invention further includes recombinant vector molecules comprising a chimeric gene according to the invention.
Genes encoding inhibitor-resistant plant protox enzymes can be used to confer resistance to protox-inhibitory herbicides in whole plants and as a selectable marker in plant cell transformation methods. Accordingly, the present invention also includes plants, including the descendants thereof, plant tissues and plant seeds containing plant expressible genes encoding these modified protox enzymes. These plants, plant tissues and plant seeds are resistant to protox-inhibitors at levels that normally are inhibitory to the naturally occurring protox activity in the plant.
In particular, the invention relates to a plant cell comprising the nucleic acid molecule according to the invention.
The invention further relates to a plant, plant tissue, plant cell, or plant seed, including the progeny thereof, comprising the nucleic acid molecule according to the invention, wherein said nucleic acid molecule is expressed in said plant, plant tissue, plant cell, or plant seed and confers tolerance thereupon to an inhibitor of naturally occurring protox activity.
Plants encompassed by the invention especially include those that would be potential targets for protox inhibiting herbicides, particularly agronomically important crops such as maize and other cereal crops such as barley, wheat, sorghum, rye, oats, turf and forage grasses, millet and rice. Also comprised are other crop plants such as sugar cane, soybean, cotton, sugar beet, oilseed rape and tobacco.
Preferred is a plant, plant tissue, plant cell, or plant seed, including the progeny thereof, wherein said plant, plant tissue, plant cell, or plant seed is selected from the group consisting of Arabidopsis, soybean, cotton, sugar beet, oilseed rape, maize, wheat, sorghum, rice, and sugar cane comprising the nucleic acid molecule according to the invention.
The present invention also relates to plastid transformation and to the expression of a nucleic acid molecule according to the invention in a plant plastid. In a preferred embodiment, a modified plant protox enzyme as described hereinbefore is expressed in plant plastids to obtain herbicide resistant plants.
_g_ In particular, the invention relates to a chimeric gene comprising a promoter functional in a plant plastid, preferably a clpP gene promoter, operatively linked to the nucleic acid molecule according to the invention,.
In a further embodiment, the present invention is directed to a chimeric gene comprising: (a) a DNA molecule isolated from a plant, which in its native state encodes a polypeptide that comprises a plastid transit peptide, and a mature enzyme that is natively targeted to a plastid of the plant by the plastid transit peptide, wherein the DNA molecule is modified such that it does not encode a functional plastid transit peptide;
and (b) a promoter capable of expressing the DNA molecule in a plastid, wherein the promoter is operatively linked to the DNA molecule according to the invention. The DNA molecule may be modified in that at least a portion of the native plastid transit peptide coding sequence is absent from the DNA molecule. Alternatively, the DNA molecule may be modified in that one or more nucleotides of the native plastid transit peptide coding sequence are mutated, thereby rendering an encoded plastid transit peptide nonfunctional. The present invention also relates to plants homoplasmic for chloroplast genomes containing such chimeric genes. In a preferred embodiment, the DNA molecule encodes an enzyme that is naturally inhibited by a herbicidal compound. In this case, such plants are resistant to a herbicide that naturally inhibits the enzyme encoded by a DNA molecule according to the present invention.
A further embodiment of the invention relates to a plastid transformation vector comprising some or all of the elements mentioned hereinbefore including a nucleic acid molecule according to the invention.
Further comprised is a plant plastid comprising a plastid transformation vector according to the invention.
The present invention is also directed to plants made resistant to a herbicide by transforming their plastid genome with a DNA molecule according to the present invention and to methods for obtaining such plants. The invention thus further relates to a plant, plant tissue, plant cell, or plant seed, including the progeny thereof, comprising a plant plastid according to the invention, wherein said modified plant protox enzyme is expressed in said plant, plant tissue, plant cell, or plant seed and confers upon said plant, plant tissue, plant cell, or plant seed tolerance to an inhibitor of naturally occurring protox activity.
The present invention is directed further to methods for the production of plants, including plant material, such as for example plant tissues, protoplasts, cells, calli, organs, plant seeds, embryos, pollen, egg cells, zygotes, together with any other propagating material and plant parts, such as for example flowers, stems, fruits, leaves, roots originating in transgenic plants or their progeny previously transformed by means of the process of the invention, which produce an inhibitor-resistant form of the plant protox enzyme provided herein. Such plants may be stably transformed with a structural gene encoding the resistant protox, or prepared by direct selection techniques whereby herbicide resistant lines are isolated, characterized and developed.
The present invention further provides a method for selecting plant cells transformed with a DNA molecule of the invention that encodes a herbicide-tolerant form of plant protox. The method comprises introducing the DNA molecule into plant cells whose growth is sensitive to inhibition by herbicides to which the protox encoded by the DNA molecule is resistant, thus forming a transformed plant cell. The transformed plant cell whose growth is resistant to the selected herbicide is identified by selection at a herbicide concentration that inhibits the growth of untransformed plant cells.
The present invention also provides a novel method for selecting a transplastomic plant cell, comprising the steps of introducing the above-described chimeric gene into the plastome of a plant cell; expressing the encoded enzyme in the plastids of the plant cell;
and selecting a cell that is resistant to a herbicidal compound that naturally inhibits the activity of the enzyme, whereby the resistant cell comprises transformed plastids. In a preferred embodiment, the enzyme is naturally inhibited by a herbicidal compound and the transgenic plant is able to grow on an amount of the herbicidal compound that naturally inhibits the activity of the enzyme.
In another aspect, the present invention is directed to a method for controlling unwanted vegetation growing at a locus where a herbicide-tolerant, agronomically useful plant, which is transformed with a DNA molecule according to the present invention that encodes a herbicide-tolerant form of plant protox, has been cultivated. The method comprises applying to the locus to be protected an effective amount of herbicide that inhibits naturally occurring protox activity. In particular, the present invention is directed to a method for controlling the growth of undesired vegetation, which comprises applying to a population of the above-described plants an effective amount of an inhibitor of the enzyme.
In preferred embodiment, the invention relates to a method for controlling the growth of undesired vegetation, wherein said protox-inhibiting herbicide is selected from the group consisting of an aryluracil, a diphenylether, an oxidiazole, an imide, preferably an imide having formula V, VI, VII, Vlla, VIII, IX, IXa, or Ixb, a phenyl pyrazole, preferably a phenyl pyrazole having formula XXIV, a pyridyl pyrazole, preferably a pyridyl pyrazole having formula XXllla or XXlllb, a pyridine derivative, a 3-substituted-2-aryl-4,5,6,7-tetrahydroindazole, a phenopylate and O-phenylpyrrolidino- and piperidinocarbamate analogs of said phenopylate.
The invention further relates to a method for selectively suppressing the growth of weeds in a field containing a crop of planted crop seeds or plants, comprising the steps of:
(a) planting herbicide tolerant crops or crop seeds, which are plants or plant seeds according to the invention; and (b) applying to the crops or crop seeds and the weeds in the field a protox-inhibiting herbicide in amounts that inhibit naturally occurring protox activity, wherein the herbicide suppresses the growth of the weeds without significantly suppressing the growth of the crops.
In one aspect, the present invention is directed to an isolated DNA molecule that encodes protoporphyrinogen oxidase (referred to herein as "protox) from sugar cane. The partial DNA coding sequence and corresponding amino acid sequence for a sugar cane protox enzyme are provided as SEQ ID NOs:36 and 37, respectively.
Further comprised by the present invention are, therefore, isolated DNA
molecules encoding the protoporphyrinogen oxidase (protox) enzyme protein from a sugar cane plant, wherein the protein comprises the amino acid sequence given in SEQ ID NO: 37.
In another aspect, the present invention is directed to an isolated DNA
molecule that encodes a sugar cane protox enzyme and that comprises a nucleotide sequence that hybridizes to the coding sequence shown in SEQ ID N0:36 under the following hybridization and wash conditions:
(a) hybridization in 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50 C; and (b) wash in 2X SSC, 1 % SDS at 50 C.The present invention is further directed to probes and methods for detecting the presence of genes encoding inhibitor-resistant forms of the plant protox enzyme and quantitating levels of inhibitor-resistant protox transcripts in plant tissue. These methods may be used to identify or screen for plants or plant tissue containing and/or expressing a gene encoding an inhibitor-resistant form of the plant protox enzyme as disclosed herein.
The entire protox sequences according to the invention or portions thereof may be used as probes capable of specifically hybridizing to protox coding sequences and messenger RNA's. To achieve specific hybridization under a variety of conditions, such probes include sequences that are unique among protox coding sequences and are preferably at least 10 nucleotides in length, and most preferably at least 20 nucleotides in length. Such probes may be used to amplify and analyze protox coding sequences from a chosen organism via the well known process of polymerase chain reaction (PCR).
This technique may be useful to isolate additional protox coding sequences from a desired organism or as a diagnostic assay to determine the presence of protox coding sequences in an organism.
Factors that affect the stability of hybrids determine the stringency of the hybridization. One such factor is the melting temperature Tm, which can be easily calculated according to the formula provided in DNA PROBES, George H. Keller and Mark M.
Manak , Macmillan Publishers Ltd, 1993, Section one: Molecular Hybridization Technology; page 8 ff.
. The preferred hybridization temperature is in the range of about 25°C
below the calculated melting temperature Tm and preferably in the range of about 12-15°C below the calculated melting temperature Tm and in the case of oligonucleotides in the range of about 5-10°C below the melting temperature Tm.
Comprised by the present invention are DNA molecules that hybridize to a DNA
molecule according to the invention as defined hereinbefore, but preferably to an oligonucleotide probe obtainable from the DNA molecule comprising a contiguous portion of the sequence of the protoporphyrinogen oxidase (protox) enzyme at least 10 nucleotides in length, under moderately stringent conditions.
The invention further embodies the use of a nucleotide probe capable of specifically hybridizing to a plant protox gene or mRNA of at least 10 nucleotides length in a polymerase chain reaction (PCR).
In a further embodiment, the present invention provides probes capable of specifically hybridizing to a eukaryotic DNA sequence encoding a protoporphyrinogen oxidase activity or to the respective mRNA and methods for detecting the DNA sequences in eukaryotic organisms using the probes according to the invention.
Protox specific hybridization probes according to the invention may also be used to map the location of the native eukaryotic protox genes) in the genome of a chosen organism using standard techniques based on the selective hybridization of the probe to genomic protox sequences. These techniques include, but are not limited to, identification of DNA polymorphisms identified or contained within the protox probe sequence, and use of such polymorphisms to follow segregation of the protox gene relative to other markers of known map position in a mapping population derived from self fertilization of a hybrid of two polymorphic parental lines (see e.g. Helentjaris et al., Plant Mol. Biol. 5:
109 (1985).
_12_ Sommer et al. Biotechniques 12: 82 (1992); D'Ovidio et al., Plant Mol. Biol.
15: 169 (1990)).
While any eukaryotic protox sequence is contemplated to be useful as a probe for mapping protox genes from any eukaryotic organism, preferred probes are those protox sequences from organisms more closely related to the chosen organism, and most preferred probes are those protox sequences from the chosen organism. Mapping of protox genes in this manner is contemplated to be particularly useful in plants for breeding purposes. For instance, by knowing the genetic map position of a mutant protox gene that confers herbicide resistance, flanking DNA markers can be identified from a reference genetic map (see, e.g., Helentjaris, Trends Genet. 3: 217 (1987)). During introgression of the herbicide resistance trait into a new breeding line, these markers can then be used to monitor the extent of protox-linked flanking chromosomal DNA still present in the recurrent parent after each round of back-crossing.
Protox specific hybridization probes according to the invention may also be used to quantitate levels of protox mRNA in an organism using standard techniques such as Northern blot analysis. This technique may be useful as a diagnostic assay to detect altered levels of protox expression that may be associated with particular adverse conditions such as autosomal dominant disorder in humans characterized by both neuropsychiatric symptoms and skin lesions, which are associated with decreased levels of protox activity (Brenner and Bloomer, New Engl. J. Med. 302: 765 (1980)).
A further embodiment of the invention is a method of producing a DNA molecule comprising a DNA portion encoding a protein having protoporphyrinogen oxidase (protox) enzyme activity comprising:
(a) preparing a nucleotide probe capable of specifically hybridizing to a plant protox gene or mRNA, wherein the probe comprises a contiguous portion of the coding sequence for a protox protein according to the present invention of at least 10 nucleotides length;
(b) probing for other protox coding sequences in populations of cloned genomic DNA fragments or cDNA fragments from a chosen organism using the nucleotide probe prepared according to step (a); and (c) isolating and multiplying a DNA molecule comprising a DNA portion encoding a protein having protoporphyrinogen oxidase (protox) enzyme activity.
A further embodiment of the invention is a method of isolating a DNA molecule from any plant comprising a DNA portion encoding a protein having protoporphyrinogen oxidase (protox) enzyme activity.
(a) preparing a nucleotide probe capable of specifically hybridizing to a plant protox gene or mRNA, wherein the probe comprises a contiguous portion of the coding sequence for a protox protein according to the present invention of at least 10 nucleotides length;
(b) probing for other protox coding sequences in populations of cloned genomic DNA fragments or cDNA fragments from a chosen organism using the nucleotide probe prepared according to step (a); and (c) isolating a DNA molecule comprising a DNA portion encoding a protein having protoporphyrinogen oxidase (protox) enzyme activity.
The invention further comprises a method of producing an essentially pure DNA
sequence coding for a protein exhibiting protoporphyrinogen oxidase (protox) enzyme activity, which method comprises:
(a) preparing a genomic or a cDNA library from a suitable source organism using an appropriate cloning vector;
(b) hybridizing the library with a probe molecule according to the present invention; and (c) identifying positive hybridizations of the probe to the DNA clones from the library that is clones potentially containing the nucleotide sequence corresponding to the amino acid sequence for protoporphyrinogen oxidase (protox).
The invention further comprises a method of producing an essentially pure DNA
sequence coding for a protein exhibiting protoporphyrinogen oxidase (protox) enzyme activity, which method comprises:
(a) preparing total DNA from a genomic or a cDNA library;
(b) using the DNA of step (a) as a template for PCR reaction with primers representing low degeneracy portions of the amino acid sequence of protoporphyrinogen oxidase (protox) according to the present invention.
A further object of the invention is an assay to identify inhibitors of protoporphyrinogen oxidase (protox) enzyme activity that comprises:
(a) incubating a first sample of a protoporphyrinogen oxidase (protox) according to the present invention and its substrate;
(b) measuring an uninhibited reactivity of the protoporphyrinogen oxidase (protox) from step (a);
(c) incubating a first sample of protoporphyrinogen oxidase (protox) and its substrate in the presence of a second sample comprising an inhibitor compound;
(d) measuring an inhibited reactivity of the protoporphyrinogen oxidase (protox) enzyme from step (c); and (e) comparing the inhibited reactivity to the uninhibited reactivity of protoporphyrinogen oxidase (protox) enzyme.
A further object of the invention is an assay to identify inhibitor-resistant protoporphyrinogen oxidase (protox) mutants that comprises:
(a) incubating a first sample of protoporphyrinogen oxidase (protox) enzyme and its substrate in the presence of a second sample comprising a protoporphyrinogen oxidase (protox) enzyme inhibitor;
(b) measuring an unmutated reactivity of the protoporphyrinogen oxidase (protox) enzyme from step (a);
(c) incubating a first sample of a mutated protoporphyrinogen oxidase (protox) enzyme and its substrate in the presence of a second sample comprising protoporphyrinogen oxidase (protox) enzyme inhibitor;
(d) measuring a mutated reactivity of the mutated protoporphyrinogen oxidase (protox) enzyme from step (c); and (e) comparing the mutated reactivity to the unmutated reactivity of the protoporphyrinogen oxidase (protox) enzyme.
A further object of the invention is a protox enzyme inhibitor obtained by a method according to the invention.
For recombinant production of the enzyme in a host organism, the protox coding sequence according to the present invention may be inserted into an expression cassette designed for the chosen host and introduced into the host where it is recombinantly produced. The choice of specific regulatory sequences such as promoter, signal sequence, 5' and 3' untranslated sequences, and enhancer, is within the level of skill of the routineer in the art. The resultant molecule, containing the individual elements linked in proper reading frame, may be inserted into a vector capable of being transformed into the host cell.
Suitable expression vectors and methods for recombinant production of proteins are well known for host organisms such as E. coli (see, e.g. Studier and Moffatt, J.
Mol. Biol. 189:
113 (1986); Brosius, DNA 8: 759 (1989)), yeast (see, e.g., Schneider and Guarente, Meth.
Enzymol. i94: 373 (1991 )) and insect cells (see, e.g., Luckow and Summers, BiolTechnol.
6: 47 (1988)). Specific examples include plasmids such as pBluescript (Stratagene, La Jolla, CA), pFLAG (International Biotechnologies, Inc., New Haven, CT), pTrcHis (Invitrogen, La Jolla, CA), and baculovirus expression vectors, e.g., those derived from the genome of Aufographica califomica nuclear polyhedrosis virus (AcMNPV). A
preferred baculovirus/insect system is pV111392/Sf21 cells (Invitrogen, La Jolla, CA).
Recombinantly produced eukaryotic protox enzyme is useful for a variety of purposes.
For example, it may be used to supply protox enzymatic activity in vitro. It may also be used in an in vitro assay to screen known herbicidal chemicals whose target has not been identified to determine if they inhibit protox. Such an in vifro assay may also be used as a more general screen to identify chemicals that inhibit protox activity and that are therefore herbicide candidates. Recombinantly produced eukaryotic protox enzyme may also be used in an assay to identify inhibitor-resistant protox mutants (see International application no.
PCT/IB95/00452 filed June 8, 1995, published Dec. 21, 1995 as WO 95/34659, incorporated by reference herein in its entirety). Alternatively, recombinantly produced protox enzyme may be used to further characterize its association with known inhibitors in order to rationally design new inhibitory herbicides as well as herbicide tolerant forms of the enzyme.
In another aspect, the present invention teaches modifications that can be made to the amino acid sequence of any eukaryotic protoporphyrinogen oxidase (referred to herein as "protox") enzyme to yield an inhibitor-resistant form of this enzyme.
Preferably, the eukaryotic protox enzyme is a plant protox enzyme. The present invention is directed to inhibitor-resistant protox enzymes having the modifications taught herein, to DNA molecules encoding these modified enzymes, and to chimeric genes capable of expressing these modified enzymes in plants.
The present invention discloses an isolated DNA molecule encoding a modified eukaryotic protoporphyrinogen oxidase (protox) having at least one amino acid modification, wherein the amino acid modification has the property of conferring resistance to a protox inhibitor, that is wherein the modified protox is tolerant to an inhibitor in amounts that inhibit the naturally occurring eukaryotic protox. As used herein "inhibit" refers to a reduction in enzymatic activity observed in the presence of a subject compound compared to the level of activity observed in the absence of the subject compound, wherein the percent level of reduction is preferably at least 10%, more preferably at least 50%, and most preferably at least 90%.
In particular, a DNA molecule is disclosed encoding a modified eukaryotic protoporphyrinogen oxidase (protox) that is a plant protox, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity, particularly a protox selected from the group consisting of an Arabidopsis protox enzyme, a maize protox enzyme, a wheat protox enzyme, a soybean protox enzyme, a cotton protox enzyme, a sugar beet protox enzyme, an oilseed rape protox enzyme, a rice protox enzyme, a sorghum protox enzyme, and a sugar cane protox enzyme having at least one amino acid modification, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity.
As used herein, the expression "substantially conserved amino acid sequences refers to regions of amino acid homology between polypeptides comprising protox enzymes from different sources. In the present invention, seventeen substantially conserved amino acid sub-sequences, designated 1-19 respectively, are shown in Table 1 B. One skilled in the art could align the amino acid sequences of protox enzymes from different sources, as has been done in Table 1 A, to identify the sub-sequences therein that make up the substantially conserved amino acid sequences defined herein. Stated another way, a given sub-sequence from one source "corresponds to" a homologous subsequence from a different source. The skilled person could then determine whether the identified sub-sequences have the characteristics disclosed and claimed in the present application.
Therefore, the present invention discloses a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes an enzyme having protoporphyrinogen oxidase (protox) activity, wherein the nucleic acid molecule is capable of being incorporated into a nucleic acid construct used to transform a plant containing wild-type, herbicide-sensitive protox, wherein the nucleotide sequence has at least one point mutation relative to a wild-type nucleotide sequence encoding plant protox, such that upon transformation with the nucleic acid construct the plant is rendered herbicide-tolerant.
A preferred embodiment of the present invention is directed to a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises at least one of the following amino acid sub-sequences:
(a) APA,F, wherein O, is an amino acid other than arginine, but especially leucine or cysteine;
(b) FMS, wherein ~ is leucine;
(c) Y~G, wherein ~ is isoleucine;
(d) O,IG, wherein 0, is histidine or alanine;
(e) KA018F, wherein 0,a is an amino acid other than alanine;
(f) QO,9H, wherein 019 is an amino acid other than leucine;
(g) TD,6G, wherein 0,6 is an amino acid other than leucine and YVO"G, wherein 0,~ is an amino acid other than alanine.
(Table 1B; sub-sequences 1-10 and 18-19, and 16-17).
Preferred is a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence APO~F, wherein 0~ is leucine or cysteine.
Preferred is a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence F02S, wherein 02 is leucine.
Preferred is a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence YA3G, wherein ~ is an isoleucine.
Preferred is a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence ~~IG, wherein 0~ is histidine or alanine, bur especially histidine.
Further preferred is a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence KAO,eF, wherein 0,8 is an amino acid other than alanine. Most preferably, 0~8 is threonine or valine.
Preferred is a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence QO,9H, wherein 0,9 is an amino acid other than leucine. Most preferably, 0,9 is serine.
Another preferred embodiment of the present invention is directed to a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises at least one of the following amino acid sub-sequences:
(a) I(AO,eF, wherein 0~8 is an amino acid other than alanine, (b) QO~9H, wherein 0,9 is an amino acid other than leucine, (c) AP01F, wherein 0, is an aminoc acid other than arginine, but especially leucine or cysteine, (d) F02S, wherein 02 is leucine (e) Y~G, wherein ~ is isoleucine (f) O~IG, wherein 0~ is histidine or alanine, (g) T~16G, wherein 0,6 is an amino acid other than leucine and YVD,~G, wherein 0,~ is an amino acid other than alanine, (Table 1 B; sub-sequences 1-10 and 18-19; and 16-17), and wherein the modified enzyme further comprises at least one additional amino acid sub-sequence selected from the group consisting of:
(c) (d)Q~"S, wherein 0~1 is an amino acid other than proline;
(d) (e) IGG012, wherein 0,2 is an amino acid other than threonine;
(e) SWXL~~3, wherein 0~3 is an amino acid other than serine;
(f) 1~,4Y, wherein 0~4 is an amino acid other than asparagine; and (g) G0~5XGL, wherein D,5 is an amino acid other than tyrosine.
Another preferred embodiment of the present invention is directed to a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises: the amino acid sub-sequence D,IG, wherein 0, is an amino acid other than tyrosine; the amino acid sub-sequences IGG~,2, wherein D,2 is an amino acid other than threonine; and the amino acid sub-sequence SWXL0,3, wherein 0,3 is an amino acid other than serine. Most preferably, 0, is isoleucine, O,2 is isoleucine, and 0~3 is leucine.
Yet another preferred embodiment of the present invention is directed to a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the nucleotide sequence is further characterized in that at least one of the following conditions is met:
(a) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence APO~F, wherein 0, is leucine;
(b) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence F02S, wherein 02 is leucine;
(c) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence Y~G, wherein ~ is isoleucine;
(d) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence O,IG, wherein 0, is alanine or histidine;
(e) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence Y~G, wherein ~ is an amino acid other than alanine, but preferably cysteine or isoleucine, more preferably isoleucine, and the nucleic acid sequence also has a sequence that encodes one of the group consisting of:
(1) sub-sequence QO,~S, wherein O1, is an amino acid other than proline, (2) sub-sequence IGG0~2, wherein ~~2 is an amino acid other than threonine, (3) sub-sequence SWXL~~3, wherein 0,3 is an amino acid other than serine, (4) sub-sequence t~~4Y, wherein 0,4 is an amino acid other than asparagine, and (5) sub-sequence GO,SXGL, wherein 0,5 is an amino acid other than tyrosine;
(f) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence ~~IG, wherein ~~ is an amino acid other than tyrosine, but preferably threonine, alanine or histidine, more preferably alanine or histidine and most preferably histidine, and the nucleic acid sequence also has a sequence that encodes one of the group consisting of:
(1 ) sub-sequence QO,~S, wherein 0" is an amino acid other than proline, (2) sub-sequence IGG~,2, wherein D,2 is an amino acid other than threonine, (3) sub-sequence SWXL~,3, wherein 0,3 is an amino acid other than serine, (4) sub-sequence L0,4Y, wherein 0,4 is an amino acid other than asparagine, and (5) sub-sequence GD,SXGL, wherein 015 is an amino acid other than tyrosine; and (g) the nucleic has a sequence that encodes amino acid sub-sequence TO~6G, wherein 0,6 is an amino acid other than leucine, and the nucleic acid sequence also has a sequence that encodes amino acid sub-sequence YVe"G, wherein 01, is an amino acid other than alanine.
(h) KAO,eF, wherein ~~e is an amino acid other than alanine;
(i) QO19H, wherein O,9 is an amino acid other than leucine.
Preferably, said nucleic acid sequence has a sequence that encodes amino acid sub-sequence TO,6G, wherein 0~6 is an amino acid other than leucine, and said nucleic acid sequence also has a sequence that encodes amino acid sub-sequence YVD"G, wherein 0,~ is an amino acid other than alanine. Preferably, the nucleic acid sequence has a sequence that encodes amino acid sub-sequence T~~6G, wherein 0,g is serine, and said nucleic acid sequence also has a sequence that encodes amino acid sub-sequence YVD»G, wherein 0" is threonine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the arginine occurring at the position corresponding to amino acid 88 of SEQ ID N0:6 is replaced with another amino acid, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity. Particularly preferred is the DNA molecule wherein the arginine is replaced with a leucine or cysteine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the cysteine occurring at the position corresponding to amino acid 159 of SEQ ID N0:6 is replaced with a leucine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the alanine occurring at the position corresponding to amino acid 175 of SE4 ID N0:6 is replaced with another amino acid, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity. Particularly preferred is a DNA molecule wherein the alanine is replaced with a valine or threonine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the leucine occurring at the position corresponding to amino acid 337 of SEQ ID N0:6 is replaced with another amino acid, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity. Particularly preferred is a DNA molecule wherein the leucine is replaced with a serine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the tyrosine occurring at the position corresponding to amino acid 428 of SEQ ID N0:16 is replaced with a histidine or alanine, preferably a histidine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the alanine occurring at the position corresponding to amino acid 220 of SEQ ID N0:2 is replaced with a isoleucine or a tyrosine, preferably a isoleucine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the tyrosine occurring at the position corresponding to amino acid 426 of SEQ ID N0:2 is replaced with a alanine.
Also preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the leucine occurring at the position corresponding to amino acid 347 of SEQ ID N0:6 is replaced with a serine and the alanine occurring at the position corresponding to amino acid 453 of SEQ ID N0:6 is replaced with a threonine.
The present invention further discloses a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox having a first amino acid substitution and a second amino acid substitution; the first amino acid substitution having the property of conferring resistance to a protox inhibitor; and the second amino acid substitution having the property of enhancing the resistance conferred by the first amino acid substitution but especially a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox, wherein the plant is selected from the group consisting of maize, wheat, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, sugar cane, and Arabidopsis. Preferred is a DNA molecule wherein the first amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the arginine at amino acid 88 of SEQ ID
N0:6the position corresponding to the alanine at amino acid 175 of SEQ ID
N0:6;
and (c) the position corresponding to the leucine at amino acid 337 of SEQ ID
N0:6.
Particularly preferred is a DNA molecule wherein the first amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the arginine at amino acid 88 of SEQ ID
N0:6;
(b) the position corresponding to the alanine at amino acid 164 of SEQ ID
N0:6;
(c) the position corresponding to the glycine at amino acid 165 of SEQ ID
N0:6;
(d) the position corresponding to the tyrosine at amino acid 370 of SEQ ID
N0:6;
(e) the position corresponding to the cysteine at amino acid 159 of SEQ ID
N0:6;
(f) the position corresponding to the isoleucine at amino acid 419 of SEQ ID
N0:6.
(g) the position corresponding to the valine at amino acid 356 of SEQ ID
N0:10;
(h) the position corresponding to the serine at amino acid 421 of SEQ ID
N0:10;
(i) the position corresponding to the valine at amino acid 502 of SEQ ID
N0:10;
(j) the position corresponding to the alanine at amino acid 211 of SEQ ID
N0:10;
(k) the position corresponding to the glycine at amino acid 212 of SEQ ID
NO:10;
(I) the position corresponding to the isoleucine at amino acid 466 of SEQ ID
N0:10;
(m) the position corresponding to the proline at amino acid 369 of SEQ ID
N0:12;
(n) the position corresponding to the alanine at amino acid 226 of SEQ ID
N0:12;
(o) the position corresponding to the tyrosine at amino acid 432 of SEQ ID
N0:12;
(p) . the position corresponding to the valine at amino acid 517 of SEQ ID
N0:12;
(q) the position corresponding to the tyrosine at amino acid 428 of SEQ ID
N0:16;
(r) the position corresponding to the proline at amino acid 365 of SEQ ID
N0:16;
(s) the position corresponding to the tyrosine at amino acid 449 of SEQ ID
N0:18;
(t) the position corresponding to the alanine at amino acid 175 of SEQ ID
N0:6;
and (u) the position corresponding to the leucine at amino acid 337 of SEQ ID
N0:6;
and wherein the second amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the serine at amino acid 305 of SEQ ID N0:2;
(b) the position corresponding to the threonine at amino acid 249 of SEQ ID
N0:2;
(c) the position corresponding to the proline at amino acid 118 of SEQ ID
N0:2;
(d) the position corresponding to the asparagine at amino acid 425 of SEQ ID
N0:2; and (e) the position corresponding to the tyrosine at amino acid 498 of SEQ ID
N0:2.
Particularly preferred is a DNA molecule wherein the first amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the arginine at amino acid 88 of SEQ ID
N0:6;
(b) the position corresponding to the alanine at amino acid 175 of SEQ ID
N0:6;
and (c) the position corresponding to the leucine at amino acid 337 of SEQ ID
N0:6.
and .
wherein the second amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the serine at amino acid 305 of SEQ ID N0:2;
(b) the position corresponding to the threonine at amino acid 249 of SEQ ID
N0:2;
(c) the position corresponding to the proline at amino acid 118 of SEQ ID
N0:2;
(d) the position corresponding to the asparagine at amino acid 425 of SEQ ID
N0:2; and (d) the position corresponding to the tyrosine at amino acid 498 of SEQ ID
N0:2.Particularly preferred is a DNA molecule wherein the arginine occurring at the position corresponding to residue 88 of SEQ ID N0:6 is replaced with a cysteine or a leucine.
More preferred is a DNA molecule wherein the cysteine occurring at the position corresponding to residue 159 of SEQ ID N0:6 is replaced with an leucine.
Particularly preferred is a DNA molecule wherein the alanine occurring at the position corresponding to residue 175 of SEQ ID N0:6 is replaced with an amino acid selected from the group consisting of threonine and valine.
Particularly preferred is a DNA molecule wherein the leucine occurring at the position corresponding to residue 337 of SEQ ID N0:6 is replaced with a serine.
More preferred is a DNA molecule wherein the tyrosine occurring at the position corresponding to residue 428 of SEQ ID N0:16 is replaced with histidine or alanine.
The.present invention is still further directed to a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox having a double amino acid substitution, wherein both amino acid substitutions are required for there to be resistance to a protox inhibitor. Preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox, wherein the plant is selected from the group consisting of maize, wheat, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, sugar cane, and Arabidopsis. More preferred is a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox, wherein the plant is maize.
Preferred is a DNA molecule having a double amino acid substitution, wherein one amino acid substitution occurs at the position corresponding to the leucine at amino acid 347 of SEQ ID N0:6, and wherein the second amino acid substitution occurs at the position corresponding to the alanine at amino acid 453 of SEQ ID N0:6.
Particularly preferred is a DNA molecule having a double amino acid substitution, wherein a leucine occurring at the position corresponding to amino acid 347 of SEQ ID
N0:6 is replaced with a serine, and wherein an alanine occurring at the position corresponding to amino acid 453 of SEQ ID N0:6 is replaced with a threonine.
The present invention is further directed to a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the plant protox comprises an amino acid sequence selected from the group consisting of SEQ ID
NO: 37.
The present invention is further directed to expression cassettes and recombinant vectors comprising the expression cassettes comprising essentially a promoter, but especially a promoter that is active in a plant, operatively linked to a DNA
molecule encoding the protoporphyrinogen oxidase (protox) enzyme from a eukaryotic organism according to the invention. The expression cassette according to the invention may in addition further comprise a signal sequence operatively linked to the DNA
molecule, wherein the signal sequence is capable of targeting the protein encoded by the DNA
molecule into the chloroplast or the mitochondria.
The invention relates to a chimeric gene, which comprises an expression cassette comprising essentially a promoter, but especially a promoter that is active in a plant, operatively linked to a heterologous DNA molecule encoding a protoporphyrinogen oxidase (protox) enzyme from a eukaryotic organism according to the invention.
Preferred is a chimeric gene, wherein the DNA molecule encodes an protoporphyrinogen oxidase (protox) enzyme from sugar cane More preferred is a chimeric gene comprising a promoter active in a plant operatively linked to a heterologous DNA molecule encoding a protoporphyrinogen oxidase (protox) from sugar cane comprising the sequence set forth in SEQ ID N0:37.
Particularly preferred is a chimeric gene, wherein the DNA molecule encodes a Particularly preferred is a chimeric gene, wherein the DNA molecule encodes a protein from sugar cane having protox-1 activity, preferably wherein the protein comprises the amino acid sequence set forth in SEQ ID N0:37.
The invention also embodies a chimeric gene, which comprises an expression cassette comprising essentially a promoter, but especially a promoter that is active in a plant, operatively linked to the DNA molecule encoding an protoporphyrinogen oxidase (protox) enzyme from a eukaryotic organism according to the invention, which is resistant to herbicides at levels that inhibit the corresponding unmodified version of the enzyme.
Preferred is a chimeric gene, wherein the DNA molecule encodes an protoporphyrinogen oxidase (protox) enzyme from a plant selected from the group consisting of Arabidopsis, sugar cane, soybean, barley, cotton, tobacco, sugar beet, oilseed rape, maize, wheat, sorghum, rye, oats, turf and forage grasses, millet, forage and rice. More preferred is a chimeric gene, wherein the DNA molecule encodes an protoporphyrinogen oxidase (protox) enzyme from a plant selected from the group consisting of soybean, cotton, tobacco, sugar beet,. oilseed rape, maize, wheat, sorghum, rye, oats, turf grass, and rice.
Particularly preferred is a chimeric gene, wherein the DNA molecule encodes an protoporphyrinogen oxidase (protox) enzyme from a plant selected from the group consisting of Arabidopsis, soybean, cotton, sugar beet, oilseed rape, maize, wheat, sorghum, and rice.
Encompassed by the present invention is a chimeric gene comprising a promoter that is active in a plant operatively linked to the DNA molecule according to the invention encoding a modified protoporphyrinogen oxidase (protox) comprising a eukaryotic protox having at least one amino acid modification, wherein the amino acid modification has the property of conferring resistance to a protox inhibitor.
Also encompassed by the present invention is a chimeric gene comprising a promoter that is active in a plant operatively linked to the DNA molecule according to the invention encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox having a first amino acid substitution and a second amino acid substitution; the first amino acid substitution having the property of conferring resistance to a protox inhibitor; and the second amino acid substitution having the property of enhancing the resistance conferred by the first amino acid substitution. Preferred is the chimeric gene additionally comprising a signal sequence operatively linked to the DNA molecule, wherein the signal sequence is capable of targeting the protein encoded by the DNA molecule into the chloroplast or in the mitochondria.
The chimeric gene according to the invention may in addition further comprise a signal sequence operatively linked to the DNA molecule of the invention, wherein the signal sequence is capable of targeting the protein encoded by the DNA molecule into the chloroplast. The chimeric gene according to the invention may in addition further comprise a signal sequence operatively linked to the DNA molecule, wherein the signal sequence is capable of targeting the protein encoded by the DNA molecule into the mitochondria.
Also encompassed by the present invention is any of the DNA sequences mentioned herein before, which is stably integrated into a host genome.
The invention further relates to a recombinant DNA molecule comprising a plant protoporphyrinogen oxidase (protox) according to the invention or a functionally equivalent derivative thereof.
The invention further relates to a recombinant DNA vector comprising the recombinant DNA molecule of the invention.
_27_ A further object of the invention is a recombinant vector comprising the chimeric gene according to the invention, wherein the vector is capable of being stably transformed into a host cell.
A further object of the invention is a recombinant vector comprising the chimeric gene according to the invention, wherein the vector is capable of being stably transformed into a plant, plant seeds, plant tissue or plant cell. Preferred is a recombinant vector comprising the chimeric gene according to the invention, wherein the vector is capable of being stably transformed into a plant. The plant, plant seeds, plant tissue or plant cell stably transformed with the vector is capable of expressing the DNA molecule encoding a protoporphyrinogen oxidase (protox). Preferred is a recombinant vector, wherein the plant, plant seeds, plant tissue or plant cell stably transformed with the the vector is capable of expressing the DNA
molecule encoding a protoporphyrinogen oxidase (protox) from a plant that is resistant to herbicides at levels that inhibit the corresponding unmodified version of the enzyme.
Preferred is a recombinant vector comprising the chimeric gene of the invention comprising a promoter active in a plant operatively linked to a heterologous DNA molecule encoding a protoporphyrinogen oxidase (protox) from sugar cane comprising the sequence set forth in SEQ ID N0:37, wherein the vector is capable of being stably transformed into a host cell.
Also preferred is recombinant vector comprising the chimeric gene of the invention comprising a promoter that is active in a plant operatively linked to the DNA
molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox having a first amino acid substitution and a second amino acid substitution; the first amino acid substitution having the property of conferring resistance to a protox inhibitor; and the second amino acid substitution having the property of enhancing the resistance conferred by the first amino acid substitution, wherein the vector is capable of being stably transformed into a plant cell.
Also encompassed by the present invention is a host cell stably transformed with the vector according to the invention, wherein the host cell is capable of expressing the DNA
molecule. Preferred is a host cell selected from the group consisting of a plant cell, a bacterial cell, a yeast cell, and an insect cell.
The present invention is further directed to plants and the progeny thereof, plant tissue and plant seeds tolerant to herbicides that inhibit the naturally occurring protox activity in these plants, wherein the tolerance is conferred by a gene expressing a modified inhibitor-resistant protox enzyme as taught herein. Representative plants include any plants to which these herbicides may be applied for their normally intended purpose.
Preferred are agronomically important crops, i.e., angiosperms and gymnosperms such as Arabidopsis, sugar cane, soybean, barley, cotton, tobacco, sugar beet, oilseed rape, maize, wheat, sorghum, rye, oats, tomato, potato, turf and forage grasses, millet, forage, and rice and the like. More preferred are agronomically important crops, i.e., angiosperms and gymnosperms such as Arabidopsis, cotton, soybean, oilseed rape, sugar beet, maize, rice, wheat, barley, oats, rye, sorghum, millet, turf, forage, turf grasses. Particularly preferred are agronomically important crops, i.e., angiosperms and gymnosperms such as Arabidopsis, soybean, cotton, sugar beet, oilseed rape, maize, wheat, sorghum, and rice.
Preferred is a plant comprising the DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox having a first amino acid substitution and a second amino acid substitution; the first amino acid substitution having the property of conferring resistance to a protox inhibitor; and the second amino acid substitution having the property of enhancing the resistance conferred by the first amino acid substitution, wherein the DNA molecule is expressed in the plant and confers upon the plant tolerance to a herbicide in amounts that inhibit naturally occurring protox activity.
Preferred is a plant, wherein the DNA molecule replaces a corresponding naturally occurring protox coding sequence. Comprised by the present invention is a plant and the progeny thereof comprising the chimeric gene according to the invention, wherein the chimeric gene confers upon the plant tolerance to a herbicide in amounts that inhibit naturally occurring protox activity.
Encompassed by the present invention are transgenic plant tissue, including plants and the progeny thereof, seeds, and cultured tissue, stably transformed with at least one chimeric gene according to the invention. Preferred is transgenic plant tissue, including plants, seeds, and cultured tissue, stably transformed with at least one chimeric gene that comprises an expression cassette comprising essentially a promoter, but especially a promoter that is active in a plant, operatively linked to the DNA molecule encoding an protoporphyrinogen oxidase (protox) enzyme that is resistant to herbicides at levels that inhibit the corresponding unmodified version of the enzyme in the plant tissue.
The present invention is further directed to plants, plant tissue, plant seeds, and plant cells tolerant to herbicides that inhibit the naturally occurring protox activity in these plants, wherein the tolerance is conferred by increasing expression of wild-type herbicide-sensitive protox. This results in a level of a protox enzyme in the plant cell at least sufficient to overcome growth inhibition caused by the herbicide. The level of expressed enzyme generally is at least two times, preferably at least five times, and more preferably at least ten times the natively expressed amount. Increased expression may be due to multiple copies of a wild-type protox gene; multiple occurrences of the coding sequence within the gene (i.e. gene amplification) or a mutation in the non-coding, regulatory sequence of the endogenous gene in the plant cell. Plants having such altered gene activity can be obtained by direct selection in plants by methods known in the art (see, e.g.
U.S. Patent No.
5,162,602, and U.S. Patent No. 4,761,373, and references cited therein). These plants also may be obtained by genetic engineering techniques known in the art. Increased expression of a herbicide-sensitive protox gene can also be accomplished by stably transforming a plant cell with a recombinant or chimeric DNA molecule comprising a promoter capable of driving expression of an associated structural gene in a plant cell operatively linked to a homologous or heterologous structural gene encoding the protox enzyme.
The recombinant DNA molecules of the invention can be introduced into the plant cell in a number of art-recognized ways. Those skilled in the art will appreciate that the choice of method might depend on the type of plant, i.e. monocot or dicot, targeted for transformation. Suitable methods of transforming plant cells include microinjection (Crossway et al., BioTechniques 4320-334 (1986)), electroporation (Riggs et al, Proc. Natl.
Acad. Sci. USA 83:5602-5606 (1986), Agrobacterium mediated transformation (Hinchee et al., Biotechnology 6.915-921 (1988)), direct gene transfer (Paszkowski et aL, EMBO J.
32717-2722 (1984)), ballistic particle acceleration using devices available from Agracetus, Inc., Madison, Wisconsin and Dupont, Inc., Wilmington, Delaware (see, for example, Sanford et al., U.S. Patent 4,945,050; and McCabe et al., Biotechnology 6:923-926 (1988)), protoplast transformation/regeneration methods (see U.S. Patent No. 5,350,689 issued Sept. 27, 1994 to Ciba-Geigy Corp.), and pollen transformation (see U.S.
Patent No.
5,629,183). Also see, Weissinger etaG, Annual Rev. Genet. 22.421-477 (1988);
Sanford et al., Particulate Science and Technology 527-37 (1987)(onion); Christou et al., Plant PhysioL 87 671-674 (1988)(soybean); McCabe et al., BiolTechnology 6:923-926 (1988)(soybean); Datta et al., BiolTechnology 8:736-740 (1990)(rice); Klein et al., Proc.
Natl. Acad Sci. USA, 85:4305-4309 (1988)(maize); Klein et al., BiolTechnology (1988)(maize); Klein et al., Plant Physiol. 91:440-444 (1988)(maize); Fromm et al., BiolTechnology 833-839 (1990); Gordon-Kamm et al., Plant Ce112.603-618 (1990) (maize); and U.S. Patent Nos. 5,591,616 and 5,679,558 (rice).
Comprised within the scope of the present invention are transgenic plants, in particular transgenic fertile plants transformed by means of the aforedescribed processes and their asexual and/or sexual progeny, which still are resistant or at least tolerant to inhibition by a herbicide at levels that normally are inhibitory to the naturally occurring protox activity in the plant. Progeny plants also include plants with a different genetic background than the parent plant, which plants result from a backcrossing program and still comprise in their genome the herbicide resistance trait according to the invention. Very especially preferred are hybrid plants that are resistant or at least tolerant to inhibition by a herbicide at levels that normally are inhibitory to the naturally occurring protox activity in the plant.
The transgenic plant according to the invention may be a dicotyledonous or a monocotyledonous plant. Preferred are monocotyledonous plants of the Graminaceae family involving Lolium, Zea, Triticum, Triticale, Sorghum, Saccharum, Bromus, Oryzae, Avena, Hordeum, Secale and Setaria plants. More preferred are transgenic maize, wheat, barley, sorghum, rye, oats, sugar cane, turf and forage grasses, millet and rice. Especially preferred are maize, wheat, sorghum, rye, oats, turf grasses and rice.
Among the dicotyledonous plants Arabidopsis, soybean, cotton, sugar beet, oilseed rape, tobacco, tomato, potato, and sunflower are more preferred herein.
Especially preferred are soybean, cotton, tobacco, sugar beet, tomato, potato, and oilseed rape.
The expression 'progeny' is understood to embrace both, "asexually" and "sexually"
generated progeny of transgenic plants. This definition is also meant to include all mutants and variants obtainable by means of known processes, such as for example cell fusion or mutant selection and that still exhibit the characteristic properties of the initial transformed plant, together with all crossing and fusion products of the transformed plant material. This also includes progeny plants that result from a backcrossing program, as long as the progeny plants still contain the herbicide resistant trait according to the invention.
Another object of the invention concerns the proliferation material of transgenic plants.
The proliferation material of transgenic plants is defined relative to the invention as any plant material that may be propagated sexually or asexually in vivo or in vitro. Particularly preferred within the scope of the present invention are protoplasts, cells, calli, tissues, organs, seeds, embryos, pollen, egg cells, zygotes, together with any other propagating material obtained from transgenic plants.
Parts of plants, such as for example flowers, stems, fruits, leaves, roots originating in transgenic plants or their progeny previously transformed by means of the process of the invention and therefore consisting at least in part of transgenic cells, are also an object of the present invention.
A further object of the invention is a method of producing plants, protoplasts, cells, calli, tissues, organs, seeds, embryos, pollen, egg cells, zygotes, together with any other propagating material, parts of plants, such as for example flowers, stems, fruits, leaves, roots originating in transgenic plants or their progeny previously transformed by means of the process of the invention, which therefore produce an inhibitor resistant form of a plant protox enzyme by transforming the plant, plant parts with the DNA according to the invention. Preferred is a method of producing a host cell comprising an isolated DNA
molecule encoding a protein from a eukaryote having protoporphyrinogen oxidase (protox) activity comprising transforming the host cell with a recombinant vector molecule according to the invention. Further preferred is a method of producing a plant cell comprising an isolated DNA molecule encoding a protein from a eukaryote having protoporphyrinogen oxidase (protox) activity comprising transforming the plant cell with a recombinant vector molecule according to the invention. Preferred is a method of producing transgenic progeny of a transgenic parent plant comprising an isolated DNA molecule encoding a protein from a eukaryote having protoporphyrinogen oxidase (protox) activity comprising transforming the parent plant with a recombinant vector molecule according to the invention and transferring the herbicide tolerant trait to the progeny of the transgenic parent plant involving known plant breeding techniques.
Preferred is a method for the production of plants, plant tissues, plant seeds and plant parts, which produce an inhibitor-resistant form of the plant protox enzyme, wherein the plants, plant tissues, plant seeds and plant parts have been stably transformed with a structural gene encoding the resistant protox enzyme. Particularly preferred is a method for the production of plants, plant tissues, plant seeds and plant parts, wherein the plants, plant tissues, plant seeds and plant parts have been stably transformed with the DNA
according to the invention. Especially preferred is a method for the production of the plants, plant tissues, plant seeds and plant parts, which produce an inhibitor-resistant form of the plant protox enzyme, wherein the plants, plant tissues, plant seeds and plant parts have been prepared by direct selection techniques whereby herbicide resistant lines are isolated, characterized and developed.
The genetic properties engineered into the transgenic seeds and plants described above are passed on by sexual reproduction or vegetative growth and can thus be maintained and propagated in progeny plants. Generally the maintenance and propagation make use of known agricultural methods developed to fit specific purposes such as tilling, sowing or harvesting. Specialized processes such as hydroponics or greenhouse technologies can also be applied. As the growing crop is vulnerable to attack and damages caused by insects or infections as well as to competition by weed plants, measures are undertaken to control weeds, plant diseases, insects, nematodes, and other adverse conditions to improve yield. These include mechanical measures such a tillage of the soil or removal of weeds and infected plants, as well as the application of agrochemicals such as herbicides, fungicides, gametocides, nematicides, growth regulants, ripening agents and insecticides.
Use of the advantageous genetic properties of the transgenic plants and seeds according to the invention can further be made in plant breeding that aims at the development of plants with improved properties such as tolerance of pests, herbicide tolerance, or stress tolerance, improved nutritional value, increased yield, or improved structure causing less loss from lodging or shattering. The various breeding steps are characterized by well-defined human intervention such as selecting the lines to be crossed, directing pollination of the parental lines, or selecting appropriate progeny plants.
Depending on the desired properties different breeding measures are taken. The relevant techniques are well known in the art and include but are not limited to hybridization, inbreeding, backcross breeding, multiline breeding, variety blend, interspecific hybridization, aneuploid techniques, etc. Hybridization techniques also include the sterilization of plants to yield male or female sterile plants by mechanical, chemical or biochemical means. Cross pollination of a male sterile plant with pollen of a different line assures that the genome of the male sterile but female fertile plant will uniformly obtain properties of both parental lines.
Thus, the transgenic seeds and plants according to the invention can be used for the breeding of improved plant lines that for example increase the effectiveness of conventional methods such as herbicide or pesticide treatment or allow to dispense with the methods due to their modified genetic properties. Alternatively new crops with improved stress tolerance can be obtained that, due to their optimized genetic "equipment', yield harvested product of better quality than products that were not able to tolerate comparable adverse developmental conditions.
In seeds production germination quality and uniformity of seeds are essential product characteristics, whereas germination quality and uniformity of seeds harvested and sold by the farmer is not important. As it is difficult to keep a crop free from other crop and weed seeds, to control seedbome diseases, and to produce seed with good germination, fairly extensive and well-defined seed production practices have been developed by seed producers, who are experienced in the art of growing, conditioning and marketing of pure seed. Thus, it is common practice for the farmer to buy certified seed meeting specific quality standards instead of using seed harvested from his own crop.
Propagation material to be used as seeds is customarily treated with a protectant coating comprising herbicides, insecticides, fungicides, bactericides, nematicides, molluscicides or mixtures thereof.
Customarily used protectant coatings comprise compounds such as captan, carboxin, thiram (TMTD~), methalaxyl (Apron~), and pirimiphos-methyl (Actellic~). If desired these compounds are formulated together with further carriers, surfactants or application-promoting adjuvants customarily employed in the art of formulation to provide protection against damage caused by bacterial, fungal or animal pests. The protectant coatings may be applied by impregnating propagation material with a liquid formulation or by coating with a combined wet or dry formulation. Other methods of application are also possible such as treatment directed at the buds or the fruit.
It is thus a further object of the present invention to provide plant propagation material for cultivated plants, but especially plant seed that is treated with an seed protectant coating customarily used in seed treatment.
It is a further aspect of the present invention to provide new agricultural methods such as the methods exemplified above, which are characterized by the use of transgenic plants, transgenic plant material, or transgenic seed according to the present invention. Comprised by the present invention is an agricultural method, wherein a transgenic plant or the progeny thereof is used comprising a chimeric gene according to the invention in an amount sufficient to express herbicide resistant forms of herbicide target proteins in a plant to confer tolerance to the herbicide.
To breed progeny from plants transformed according to the method of the present invention, a method such as that which follows may be used: maize plants produced as described in the examples set forth below are grown in pots in a greenhouse or in soil, as is known in the art, and permitted to flower. Pollen is obtained from the mature tassel and used to pollinate the ears of the same plant, sibling plants, or any desirable maize plant.
Similarly, the ear developing on the transformed plant may be pollinated by pollen obtained from the same plant, sibling plants, or any desirable maize plant. Transformed progeny obtained by this method may be distinguished from non-transformed progeny by the presence of the introduced genes) and/or accompanying DNA (genotype), or the phenotype conferred. The transformed progeny may similarly be selfed or crossed to other plants, as is normally done with any plant carrying a desirable trait.
Similarly, tobacco or other transformed plants produced by this method may be selfed or crossed as is known in the art in order to produce progeny with desired characteristics. Similarly, other transgenic organisms produced by a combination of the methods known in the art and this invention may be bred as is known in the art in order to produce progeny with desired characteristics.
The modified inhibitor-resistant protox enzymes of the invention have at least one amino acid substitution, addition or deletion relative to their naturally occurring counterpart (i.e. inhibitor-sensitive forms that occur naturally in a plant without being manipulated, either directly via recombinant DNA methodology or indirectly via selective breeding, etc., by man).
Amino acid positions that may be modified to yield an inhibitor-resistant form of the protox enzyme, or enhance inhibitor resistance, are indicated in bold type in Table 1A in the context of plant protox-1 sequences from Arabidopsis, maize, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, wheat, and sugar cane. The skilled artisan will appreciate that equivalent changes may be made to any plant protox gene having a structure sufficiently similar to the protox enzyme sequences shown herein to allow alignment and identification of those amino acids that are modified according to the invention to generate inhibitor-resistant forms of the enzyme. Such additional plant protox genes may be obtained using standard techniques as described in International application no.
PCT/IB95/00452 filed June 8, 1995, published Dec. 21, 1995 as WO 95/34659 whose relevant parts are herein incorporated by reference.
DNA molecules encoding the herbicide resistant protox coding sequences taught herein may be genetically engineered for optimal expression in a crop plant.
This may include altering the coding sequence of the resistance allele for optimal expression in the crop species of interest. Methods for modifying coding sequences to achieve optimal expression in a particular crop species are well known (see, e.g. Perlak et al., Proc. Natl.
Acad. Sci. USA 88: 3324 (1991 ); Koziel et al., Bioltechnol. 11: 194 (1993)).
Genetically engineering a protox coding sequence for optimal expression may also include operatively linking the appropriate regulatory sequences (i.e.
promoter, signal sequence, transcriptional terminators). Examples of promoters capable of functioning in plants or plant cells (i.e., those capable of driving expression of the associated structural genes such as protox in plant cells) include the cauliflower mosaic virus (CaMV) 19S or 35S
promoters and CaMV double promoters; nopaline synthase promoters;
pathogenesis-related (PR) protein promoters; small subunit of ribulose bisphosphate carboxylase (ssuRUBISCO) promoters, heat shock protein promoter from Brassica with reference to EPA 0 559 603 (hsp80 promoter), Arabidopsis actin promoter and the SuperMas promoter with reference to WO 95/14098 and the like. Preferred promoters will be those that confer high level constitutive expression or, more preferably, those that confer specific high level expression in the tissues susceptible to damage by the herbicide.
Preferred promoters are the rice actin promoter (McElroy et al., Mol. Gen.
Genet. 231: 150 (1991 )), maize ubiquitin promoter (EP 0 342 926; Taylor et aL, Plant Cell Rep. 12: 491 (1993)), and the PR-1 promoter from tobacco, Arabidopsis, or maize (see U.S.
Patent No.
5,614,395 to Ryals et al., incorporated by reference herein in its entirety).
The promoters themselves may be modified to manipulate promoter strength to increase protox expression, in accordance with art-recognized procedures.
The inventors have also discovered that another preferred promoter for use with the inhibitor-resistant protox coding sequences is the promoter associated with the native protox gene (i.e. the protox promoter; see copending, co-owned U.S. Patent Application No.
08/808,323, entitled "Promoters from Protoporphyrinogen Oxidase Genes", incorporated by reference herein in its entirety.) The promoter sequence from an Arabidopsis protox-1 gene is set forth in SEQ ID N0:13, the promoter sequence from a maize protox-1 gene is set forth in SEQ ID N0:14, and the promoter sequence from a sugar beet protox-1 gene is set forth in SEQ ID N0:26.
Since the protox promoter itself is suitable for expression of inhibitor-resistant protox coding sequences, the modifications taught herein may be made directly on the native protox gene present in the plant cell genome~without the need to construct a chimeric gene with heterologous regulatory sequences. Such modifications can be made via directed mutagenesis techniques such as homologous recombination and selected for based on the resulting herbicide-resistance phenotype (see, e.g. Example 10, Pazkowski et al., EMBO J.
7: 4021-4026 (1988), and U.S. Patent No. 5,487,992, particularly columns 18-19 and Example 8). An added advantage of this approach is that besides containing the native protox promoter, the resulting modified gene will also include any other regulatory elements, such as signal or transit peptide coding sequences, which are part of the native gene.
In the event of transformation of the nuclear genome, signal or transit peptides may be fused to the protox coding sequence in chimeric DNA constructs of the invention to direct transport of the expressed protox enzyme to the desired site of action.
Examples of signal peptides include those natively linked to the plant pathogenesis-related proteins, e.g.
PR-1, PR-2, and the like. See, e.g., Payne et al., Plant Mol. Biol. 1 i:89-94 (1988).
Examples of transit peptides include the chloroplast transit peptides such as those described in Von Heijne et al., Plant Mol. Biol. Rep. 9:104-126 (1991 ); Mazur et al., Plant Physiol. 85: 1110 (1987); Vorst et al., Gene 65: 59 (1988), and mitochondrial transit peptides such as those described in Boutry et al., Nature 328340-342 (1987).
Chloroplast and mitochondria) transit peptides are contemplated to be particularly useful with the present invention as protox enzymatic activity typically occurs within the mitochondria and chloroplast. Most preferred for use are chloroplast transit peptides, as inhibition of the protox enzymatic activity in the chloroplasts is contemplated to be the primary basis for the action of protox-inhibiting herbicides (Witkowski and Halting, Plant Physiol.
87: 632 (1988);
Lehnen et al., Pestic. Biochem. Physiol. 37 239 (1990); Duke et al., Vheed Sci. 39: 465 (1991 )). Also included are sequences that result in localization of the encoded protein to various cellular compartments such as the vacuole. See, for example, Neuhaus et aL, Proc.
Nat). Acad. Sci. USA 88: 10362-10366 (1991) and Chrispeels, Ann. Rev. Plant Physiol.
Plant Mol. Biol. 42. 21-53 (1991 ). The relevant disclosures of these publications are incorporated herein by reference in their entirety.
Chimeric genes of the invention may contain multiple copies of a promoter or multiple copies of the protox structural genes. In addition, the constructs) may include coding sequences for markers and coding sequences for other peptides such as signal or transit peptides, each in proper reading frame with the other functional elements in the DNA
molecule. The preparation of such constructs are within the ordinary level of skill in the art.
lJseful markers include peptides providing herbicide, antibiotic or drug resistance, such as, for example, resistance to hygromycin, kanamycin, 6418, gentamycin, lincomycin, methotrexate, glyphosate, phosphinothricin, or the like. These markers can be used to select cells transformed with the chimeric DNA constructs of the invention from untransformed cells. Other useful markers are peptidic enzymes that can be easily detected by a visible reaction, for example a color reaction, for example luciferase, fi-glucuronidase, or f3-galactosidase.
The method of positive selection of genetically transformed cells into which a desired nucleotide sequence can be incorporated by providing the transformed cells with a selective advantage is herein incorporated by reference as WO 94/20627.
Where a herbicide resistant protox allele is obtained via directed mutation of the native gene in a crop plant or plant cell culture from which a crop plant can be regenerated, it may be moved into commercial varieties using traditional breeding techniques to develop a herbicide tolerant crop without the need for genetically engineering the modified coding sequence and transforming it into the plant. Alternatively, the herbicide resistant gene may be isolated, genetically engineered for optimal expression and then transformed into the desired variety.
Genes encoding altered protox resistant to a protox inhibitor can also be used as selectable markers in plant cell transformation methods. For example, plants, plant tissue or plant cells transformed with a transgene can also be transformed with a gene encoding an altered protox capable of being expressed by the plant. The thus-transformed cells are transferred to medium containing the protox inhibitor wherein only the transformed cells will survive. Protox inhibitors contemplated to be particularly useful as selective agents are the diphenylethers {e.g. acifluorfen, 5-[2-chloro-4-(trifluoromethyl)phenoxy]-2-nitrobezoic acid;
its methyl ester; or oxyfluorfen, 2-chloro-1-(3-ethoxy-4-nitrophenoxy)-4-(trifluorobenzene)}, oxidiazoles, (e.g. oxidiazon, 3-[2,4-dichloro-5-(1-methylethoxy)phenyl]-5-(1,1-dimethylethyl)-1,3,4-oxadiazol-2-(3M-one), cyclic imides (e.g. S-23142, 11(4-chloro-2-fluoro-propargyloxyphenyl)-3,4,5,6-tetrahydrophthalimide; chlorophthalim, 11(4-chlorophenyl)-3,4,5,6-tetrahydrophthalimide), phenyl pyrazoles (e.g. TNPP-ethyl, ethyl 2-[1-(2,3,4-trichlorophenyl)-4-nitropyrazolyl-5-oxy]propionate; M&B 39279), pyridine derivatives (e.g. LS
82-556), and phenopylate and its O-phenylpyrrolidino- and piperidinocarbamate analogs and bicyclic triazolones as disclosed in the International patent application WO 92/04827;
EP 532146).
The method is applicable to any plant cell capable of being transformed with an altered protox-encoding gene, and can be used with any transgene of interest.
Expression of the transgene and the protox gene can be driven by the same promoter functional on plant cells, or by separate promoters.
Modified inhibitor-resistant protox enzymes of the present invention are resistant to herbicides that inhibit the naturally occurring protox activity. The herbicides that inhibit protox include many different structural classes of molecules (Duke et al., Weed Sci. 39:
465 (1991 ); Nandihalli et aG, Pesticide Biochem. Physiol. 43: 193 (1992);
Matringe et al., FEBS Left. 245: 35 (1989); Yanase and Andoh, Pesticide Biochem. Physiol. 35:
70 (1989)), including the diphenylethers {e.g. acifluorifen, 5-[2-chloro-4-(trifluoromethyl)phenoxy]-2-nitrobezoic acid; its methyl ester; or oxyfluorfen, 2-chloro-1-(3-ethoxy-4-nitrophenoxy)-4-(trifluorobenzene)}, oxidiazoles (e.g. oxidiazon, 3-[2,4-dichloro-5-(1-methylethoxy)phenyl]-5-(1,1-dimethylethyl)-1,3,4-oxadiazol-2-(31-i)-one), cyclic imides (e.g. S-23142,11(4-chloro-2-fluoro-5-propargyloxyphenyl)-3,4,5,6-tetrahydrophthalimide; chlorophthalim, Iw(4-chlorophenyl)-3,4,5,6-tetrahydrophthalimide), phenyl pyrazoles (e.g. TNPP-ethyl, ethyl 2-[1-(2,3,4-trichlorophenyl)-4-nitropyrazolyl-5-oxy]propionate; M&B 39279), pyridine derivatives (e.g. LS 82-556), and phenopylate and its a-phenylpyrrolidino- and piperidinocarbamate analogs.
The diphenylethers of particular significance are those having the general formula CI
CF3 ~ ~ O ~ ~ N02 (Formula I) wherein R equals -COONa (Formula II), -CONHS02CH3 (Formula III) or -(Formula IV; see Maigrot et al., Brighton Crop Protection Conference-Weeds: 47-51 (1989)).
Additional diphenylethers of interest are those where R equals:
(Formula IVa; see Hayashi et al., Brighton Crop Protection Conference-Weeds:
(1989)).
An additional diphenylether of interest is one having the formula:
CI
(Formula IVb; bifenox, see Dest et al., Proc. Northeast Weed Sci. Conf. 27: 31 (1973)).
A further diphenylether of interest is one having the formula:
O
(Formula IVc; oxyfluorfen; see Yih and Swithenbank, J. Agric. Food Chem., 23:
592 (1975)) Yet another diphenylether of interest is one having the formula:
i Hs CF3 ~ ~ O N02 CI
(Formula IVd; lactofen, see page 623 of 'The Pesticide Manuah, 10t" ed., ed.
by C. Tomlin, British Crop Protection Council, Surrey (1994)) Also of significance are the class of herbicides known as imides, having the general formula R2 ~ / Q
(Formula V) wherein Q equals I ,N-o (Formula VI) or N' \
S
N
IN- (Formula VII) or c~
CF3 N~O
I N
o (Formula VIII) or C~~ N N-,N
HF2C ~ (Formula IX
) or CI
~C F3 ~N
(Formula IXa) or CI
~OC HF2 ~N
(Formula IXb) (see Hemper et al. (1995) in "Proceedings of the Eighth International Congress of Pesticide Chemistry", Ragdale et al., eds., Amer. Chem. Soc, Washington, D.C., pp.42-48 (1994));
and R, equals H, CI or F, R2 equals CI and R3 is an optimally substituted ether, thioether, ester, amino or alkyl group. Alternatively, R2 and R3 together may form a 5 or 6 membered heterocyclic ring. Examples of imide herbicides of particular interest are F
CI
O
(Formula Vlla; fluthiacet-methyl, see Miyazawa et aL, Brighton Crop Protection Conference-Weeds, pp. 23-28 (1993)) CI o ~N~CHF2 CI ~ ~ N N
J~C
CF~S02NH ~ (Formula X sulfentrazone, see Van Saun et al., Brighton Crop Protection Conference-(Needs, pp. 77-82 (1991 )).
CF3 N~O
N ~ COOCH(Ct-~)2 O
CI (Formula XI) C
(Formula XII) (see Miura et al., Brighton Crop Protection Conference-Nleeds: 35-40 (1993)) N' \
S F
N
INI ~ / CI
scHzCOOCI~ (Formula XIII) O F
\N- ~ / CI
0 ocl-~cooc5H" (Formula XIV) O F
\N ~ / CI
O O-CH C-CH
(Formula XV) O F
\N ~ ~ O
O ~N--~
Hoc-o~ o (Formula XVI) The herbicidal activity of the above compounds is described in the Proceedings of the 1991 Brighton Crop Protection Conference, Weeds (British Crop Protection Council) (Formulae X and XVI), Proceedings of the 1993 Brighton Crop Protection Conference, Weeds (British Crop Protection Council) (Formulae XII and XIII), U.S. Patent No. 4,746,352 (Formula XI) and Abstracts of the Weed Science Society of America vol. 33, pg.
(1993)(Formula XIV).
The most preferred imide herbicides are those classified as aryluracils and having the general formula cl-~
CF3 N~O
I N
O
CI
Coon (Formula XVII) wherein R signifies the group (C2.s-alkenyloxy)carbonyl-C,_4-alkyl, as disclosed in U.S.
Patent No. 5,183,492, herein incorporated by reference.
Also of significance are herbicides having the general formula:
O F
O N N~S~N
N
w (Formula XVIII; thiadiazimin) (see Weiler et al., Brighton Crop Protection Conference-Weeds, pp. 29-34 (1993));
CIC F O
O N
C H.~
(Formula XIX; carfentrazone) (see Van Saun et al., Brighton Crop Protection Conference-lNeeds: pp. 19-22 (1993));
N-substituted pyrazoles of the general formula:
Ri-N~ NiN Ra R
(Formula XX) wherein R, is C,-C4-alkyl, optionally substituted by one or more halogen atoms;
RZ is hydrogen, or a C,-C4-alkoxy, each of which is optionally substituted by one or more halogen atoms, or R, and R2 together from the group -(CH2)~ X-, where X is bound at R2;
R3 is hydrogen or halogen, R4 is hydrogen or C,-C4-alkyl, R5 is hydrogen, nitro, cyano or the group -COOR6 or -CONR~RB, and R6 is hydrogen, C,-C6-alkyl, C2-C6-alkenyl or CZ-C6-alkynyl;
(see international patent publications WO 94/08999, WO 93/10100, and U. S.
Patent No. 5,405,829 assigned to Schering);
N-phenylpyrazoles, such as:
~I
(Formula XXI; nipyraclofen) (see page 621 of 'The Pesticide Manual", 9th ed., ed. by C.R. Worthing, British Crop Protection Council, Surrey (1991 ));
and 3-substituted-2-aryl-4,5,6,7-tetrahydroindazoles (Lyga et al. Pesticide Sci. 42.29-36 (1994)).
N/ \ CI
~N ~ NHC-CH-CH3 O
CI CI
(Formula XXIa; BAY 11340) Also of significance are phenylpyrazoles of the type described in WO 96/01254 and WO 97/00246, both of which are hereby incorporated by reference. (Formula XXII).
Also of significance are pyridyl pyrazoles such as the following:
F CI
/~ ,~~F
CI , ~N~N\ F
(Formula XXllla) (Formula XXlllb) Also of significance are phenylpyrazoles having the general formula:
C- OPr-i Cl Me ' /
N
g3 C Sr (Formula XXIV: Fluazolate) (see Prosch, S. D. et al., Brighton Crop Protection Conference-Weeds: pp. 45-50 (1997), (Vol. 1 )) Additional compounds of significance are described in W098/33927 and US patent 5,856,495, both of which are incorporated herein by reference in their entirety.
Levels of herbicide that normally are inhibitory to the activity of protox include application rates known in the art, and that depend partly on external factors such as environment, time and method of application. For example, in the case of the imide herbicides represented by Formulae V through IX, and more particularly those represented by Formulae X through XVII, the application rates range from 0.0001 to 10 kg/ha, preferably from 0.005 to 2 kg/ha. This dosage rate or concentration of herbicide may be different, depending on the desired action and particular compound used, and can be determined by methods known in the art.
A further object of the invention is a method for controlling the growth of undesired vegetation that comprises applying to a population of the plant selected from a group consisting of Arabidopsis, sugar cane, soybean, barley, cotton, tobacco, sugar beet, oilseed rape, maize, wheat, sorghum, rye, oats, turf and forage grasses , millet, forage and rice and the like an effective amount of a protox-inhibiting herbicide. Preferred is a method for controlling the growth of undesired vegetation, which comprises applying to a population of the selected from the group consisting of selected from the group consisting of soybean, cotton, tobacco, sugar beet, oilseed rape, maize, wheat, sorghum, rye, oats, turf grasses and rice an effective amount of a protox-inhibiting herbicide. Particularly preferred is a method for controlling the growth of undesired vegetation, which comprises applying to a population of the selected from the group consisting of Arabidopsis, soybean, cotton, sugar beet, oilseed rape, maize, wheat, sorghum, and rice.
The present invention further encompasses a chimeric gene comprising a promoter capable of expression in a plant plastid operatively linked to a DNA molecule of the present invention. A preferred promoter capable of expression in a plant plastid is a promoter isolated from the 5' flanking region upstream of the coding region of a plastid gene, which may come from the same or a different species, and the native product of which is typically found in a majority of plastid types including those present in non-green tissues. Examples of such promoters are promoters of clpP genes, such as the tobacco clpP gene promoter (WO 97/06250, incorporated herein by reference) and the Arabidopsis clpP gene promoter (U.S. Application No. 09/038,878, incorporated herein by reference). Other promoters that are capable of expressing a DNA molecule in plant plastids are promoters recognized by viral RNA polymerases. Preferred promoters of this type are promoters recognized by a single sub-unit RNA polymerase, such as the T7 gene 10 promoter, which is recognized by the bacteriophage T7 DNA-dependent RNA polymerase. Yet another promoter that is capable of expressing a DNA molecule in plant plastids comes from the regulatory region of the plastid 16S ribosomal RNA operon (Harris et al., Microbiol. Rev. 58:700-754 (1994), Shinozaki et al., EMBO J. 5:2043-2049 (1986), both of which are incorporated herein by reference). The gene encoding the T7 polymerase is preferably transformed into the nuclear genome and the T7 polymerase is targeted to the plastids using a plastid transit peptide. Expression of the DNA molecules in the plastids can be constitutive or can be inducible. These different embodiment are extensively described in WO
98/11235, incorporated herein by reference. The chimeric gene preferably further comprises a 5' untranslated sequence (5' UTR) functional in plant plastids and a plastid gene 3' untranslated sequence (3' UTR) operatively linked to a DNA molecule of the present invention. Preferably, the 3' UTR is a plastid rpsl6 gene 3' untranslated sequence. In a further embodiment, the chimeric gene comprises a poly-G tract instead of a 3' untranslated sequence.
The present invention also encompasses a plastid transformation vector comprising the chimeric gene described above and flanking regions for integration into the plastid genome by homologous recombination. The plastid transformation vector may optionally comprise at least one chloroplast origin of replication. The present invention also encompasses a plant plastid transformed with such a plastid transformation vector, wherein the DNA molecule is expressible in the plant plastid. The invention also encompasses a plant or plant cell, including the progeny thereof, comprising this plant plastid. In a preferred embodiment, the plant is homoplasmic for transgenic plastids. The plants transformed in the present invention may be monocots or dicots. A preferred monocot is maize and a preferred dicot is tobacco. Other preferred dicots are tomato and potato.
Plastid transformation, in which genes are inserted by homologous recombination into some or all of the several thousand copies of the circular plastid genome present in each plant cell, takes advantage of the enormous copy number advantage over nuclear-expressed genes to permit expression levels that may exceed 10% of the total soluble plant protein. In addition, plastid transformation is desirable because in most plants plastid-encoded traits are not pollen transmissible; hence, potential risks of inadvertent transgene escape to wild relatives of transgenic plants is obviated. Plastid transformation technology is extensively described in U.S. Patent Nos. 5,451,513, 5,545,817, 5,545,818, and 5,576,198;
in PCT Application Nos. WO 95/16783 and WO 97/32977; and in McBride et al., Proc. Nat!.
Acad. Sci. USA 91: 7301-7305 (1994), all of which are incorporated herein by reference.
Plastid transformation via biolistics was achieved initially in the unicellular green alga Chlamydomonas reinhardfii (Boynton et al. (1988) Science 240: 1534-1537, incorporated herein by reference) and this approach, using selection for cis-acting antibiotic resistance loci (spectinomycin/streptomycin resistance) or complementation of non-photosynthetic mutant phenotypes, was soon extended to Nicotiana tabacum (Svab et al. (1990) Proc.
Natl. Acad. Sci. USA 87: 8526-8530, incorporated herein by reference).
The basic technique for tobacco chloroplast transformation involves the particle bombardment of leaf tissue or PEG-mediated uptake of plasmid DNA in protoplasts with regions of cloned plastid DNA flanking a selectable antibiotic resistance marker. The 1 to 1.5 kb flanking regions, termed "targeting sequences," facilitate homologous recombination with the plastid genome and thus allow the replacement or modification of specific regions of the 156 kb tobacco plastid genome. Initially, point mutations in the chloroplast 16S rDNA
and rpsl2 genes conferring resistance to spectinomycin and/or streptomycin were utilized as selectable markers for transformation (Svab, Z., Hajdukiewicz, P., and Maliga, P. (1990) Proc. Natl. Acad. Sci. USA 87, 8526-8530; Staub, J. M., and Maliga, P. (1992) Plant Cell4, 39-45, incorporated herein by reference). This resulted in stable homoplasmic transformants at a frequency of approximately one per 100 bombardments of target leaves.
The presence of cloning sites between these markers allowed creation of a plastid targeting vector for introduction of foreign genes (Staub, J.M., and Maliga, P., EMBO J.
12: 601-606 (1993), incorporated herein by reference). Substantial increases in transformation frequency were obtained by replacement of the recessive rRNA or r-protein antibiotic resistance genes with a dominant selectable marker, the bacterial aadA gene encoding the spectinomycin-detoxifying enzyme aminoglycoside-3'-adenyltransferase (Svab, Z., and Maliga, P. (1993) Proc. Natl. Acad. Sci. USA 90, 913-917, incorporated herein by reference). Previously, this marker had been used successfully for high-frequency transformation of the plastid genome of the green alga Chlamydomonas reinhardtii (Goldschmidt-Clermont, M. (1991 ) Nucl. Acids Res. 19, 4083-4089, incorporated herein by reference). Recently, plastid transformation of protoplasts from tobacco and the moss Physcomitrella patens has been attained using polyethylene glycol (PEG) mediated DNA
uptake (O'Neill et al. (1993) Plant J. 3: 729-738; Koop et al. (1996) Planta 199: 193-201, both of which are incorporated herein by reference).
In a preferred embodiment, the present invention encompasses a chimeric gene comprising a promoter capable of expression in a plant plastid operatively linked to a DNA
molecule isolated from a prokaryote or a eukaryote that encodes a native or modified protox enzyme, such as a DNA molecule that encodes a native or modified wheat, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, or sugar cane protox enzyme.
Such a DNA
molecule is comprised in a plastid transformation vector as described above and plants homoplasmic for transgenic plastid genomes are produced. Expression in plant plastids of a DNA molecule that encodes a modified protox enzyme preferably confers upon the plant tolerance to a herbicide in amounts that inhibit naturally occurring protox activity.
In a further preferred embodiment, the present invention encompasses a chimeric gene comprising (a) a DNA molecule isolated from a plant, which in its native state encodes a polypeptide that comprises a plastid transit peptide, and a mature enzyme that is natively targeted to a plastid of the plant by the plastid transit peptide, wherein the DNA molecule is modified such that it does not encode a functional plastid transit peptide;
and (b) a promoter capable of expressing the DNA molecule in a plastid, wherein the promoter is operatively linked to the DNA molecule. In one preferred embodiment, the transit peptide is mutated and thus does not allow the proper transport of the enzyme encoded by the DNA
molecule to the desired cell compartment, such as the plastid. In another preferred embodiment, a portion of the transit peptide coding sequence or the entire transit peptide coding sequence is removed from the DNA molecule, preventing the enzyme from being properly targeted to the desired cell compartment.
The chimeric genes described above are inserted in plastid transformation vectors, and the present invention is therefore also directed to plants having their plastid genome transformed with such vectors, whereby the DNA molecule is expressible in plant plastids.
Such plants are preferably homoplasmic for transgenic plastids.
In a preferred embodiment, a DNA molecule described immediately above encodes an enzyme that in its wild-type form is inhibited by a herbicide. In a further preferred embodiment, the DNA molecule encodes an enzyme that in its wild-type form is inhibited by a herbicide, but that comprises at least one amino acid change compared to the wild-type enzyme. Such an amino acid change makes the enzyme resistant to compounds that naturally inhibit the wild-type enzyme. In a further preferred embodiment, the DNA molecule encodes an enzyme having protoporphyrinogen oxidase (protox) activity. In a further preferred embodiment, the transit peptide is removed from the DNA molecule as further illustrated in Examples 37-42. Plants homoplasmic for transgenic plastids of the invention are resistant to high amounts of herbicides such as Formula XVII that inhibit the naturally occurring protox activity (as further illustrated in Example 44).
In another preferred embodiment, the transit peptide of a DNA molecule encoding a 5-enolpyruvyl-3-phosphoshikimate synthase (EPSP synthase) is mutated or removed.
The resulting DNA molecule is fused to a promoter capable of expression in plant plastids and homoplasmic plants harboring such constructs in their plastid genomes are obtained. These plants are resistant to herbicidal compounds that naturally inhibit EPSP
synthase, in particular glyphosate. In another preferred embodiment, the transit peptide of a DNA
molecule encoding a acetolactate synthase (ALS) is mutated or removed. The resulting DNA molecule is fused to a promoter capable of expression in plant plastids and homoplasmic plants harboring such constructs in their plastid genome are obtained. These plants are resistant to herbicidal compounds that naturally inhibit ALS, in particular sulfonylureas. In another preferred embodiment, the transit peptide of a DNA
molecule encoding a acetoxyhydroxyacid synthase (AHAS) is mutated or removed. The resulting DNA molecule is fused to a promoter capable of expression in plant plastids and homoplasmic plants harboring such constructs in their plastid genome are obtained. These plants are resistant to herbicidal compounds that naturally inhibit AHAS, in particular, imidazolinone and sulfonamide herbicides. In another preferred embodiment, the transit peptide of a DNA molecule encoding an acetylcoenzyme A carboxylase (ACCase) is mutated or removed. The resulting DNA molecule is fused to a promoter capable of expression in plant plastids and homoplasmic plants harboring such constructs in their plastid genome are obtained. These plants are resistant to herbicidal compounds that naturally inhibit ACCase, in particular cyclohexanedione and arylphenoxypropanoic acid herbicides. In another preferred embodiment, the transit peptide of a DNA
molecule encoding a glutamine synthase (GS) is mutated or removed. The resulting DNA
molecule is fused to a promoter capable of expression in plant plastids and homoplasmic plants harboring such constructs in their plastid genome are obtained. These plants are resistant to herbicidal compounds that naturally inhibit GS, in particular phosphinothricin and methionine sulfoximine.
The present invention is also further directed to a method of obtaining herbicide-resistant plants by transforming their plastid genome with a chimeric gene comprising (a) a DNA molecule isolated from a plant, which in its native state encodes a polypeptide that comprises a plastid transit peptide, and a mature enzyme that is natively targeted to a plastid of the plant by the plastid transit peptide, wherein the DNA molecule is modified such that it does not encode a functional plastid transit peptide; and (b) a promoter capable of expressing the DNA molecule in a plastid, wherein the promoter is operatively linked to the DNA molecule. Examples of enzymes that are used in the present invention are cited immediately above, but the applicability of such a method is not limited to the cited examples.
The present invention is still further directed to a novel method for selecting a transplastomic plant cell, comprising the steps of: introducing the above-described chimeric gene into the plastome of a plant cell; expressing the encoded enzyme in the plastids of the plant cell; and selecting a cell that is resistant to a herbicidal compound that naturally inhibits the activity of the enzyme, whereby the resistant cell comprises transformed plastids. In a preferred embodiment, the enzyme is naturally inhibited by a herbicidal compound and the transgenic plant is able to grow on an amount of the herbicidal compound that naturally inhibits the activity of the enzyme. In a further preferred embodiment, the enzyme has protoporphyrinogen oxidase (protox) activity and is modified so that it that confers resistance to protox inhibitors.
A further aspect of the present invention is a novel method for plastid transformation of recalcitrant plants. The methods pioneered for plastid transformation of tobacco and lower plant species rely on non-lethal selection for resistance to antibiotics that preferentially affect the plastid translational apparatus and hence allow photo-heterotrophic transformants to outgrow heterotrophic, non-transformed tissue.
Several factors have likely contributed to the difficulties encountered with plastid transformation of monocots and other dicots. For example, the maize chloroplast 16S
ribosomal RNA (rRNA) is naturally resistant to spectinomycin because of the presence of a G at position 1138 in the Zea mays 16S rDNA gene (Harris et aG, 1994). Thus, utilization of 16s rRNA point mutations that confer spectinomycin and/or streptomycin resistance which have been used successfully as selectable chloroplast markers in Chlamydomonas and tobacco (Boynton and Gillham (1993) In Wu, R. [Ed.] Methods in EnzymologyVol 217.
Academic Press, San Diego, pp. 510-536; Svab et al. (1990) Proc. Natl. Acad.
Sci. U.S.A.
87: 8526-8530) is not feasible for maize. Natural spectinomycin and streptomycin resistance in maize also obviates the use of the bacterial aadA gene encoding aminoglycoside 3"-adenyltransferase, which results in dominant spectinomycin and streptomycin resistance and allows a 100-fold increase in tobacco chloroplast transformation efficiency (Svab and Maliga (1993) Proc. Natl. Acad Sci. U.S.A.
90: 913-917). Use of kanamycin (the only other antibiotic proven to be useful for chloroplast transformation) is also problematic due to a large excess (ca. 50:1 ) of nuclear vs.
chloroplast-encoded resistance in tobacco following bombardment of the bacterial nptll gene encoding neomycin phosphotransferase (Carrer et al. (1993) MoL Gen.
Genet. 241:
49-56). This has been shown to result from both a high frequency of spontaneous nuclear resistance mutants as well as integration of nptll into the nuclear genome.
Since nptll is also a highly effective selectable marker for maize nuclear transformation it is reasonable to expect similar background levels to that observed in tobacco. Spontaneous resistance and a significant excess of selectable marker integration by random, illegitimate recombination into the nuclear genome, rather than homologous integration into the chloroplast genome, would make recovery of bona fide chloroplast transformants difficult if not impossible.
A more fundamental reason for the difficulties encountered with plastid transformation in plant species other than tobacco may have to do with the non-photosynthetic nature of many regenerable cultured plant tissues, especially in maize and Arabidopsis. Tobacco is an exception in that cultured vegetative tissues are regenerable and contain mature differentiated chloroplasts that are photosynthetically competent in the presence of sucrose. Consequently, the current system for selecting tobacco plastid transformants relies on the faster growth rate of transformed cells that can use both reduced and inorganic carbon sources. Moreover, transformed cells do not suffer the chloroplast membrane damage that results from inhibition of plastid protein synthesis in the light. This expression of selectable markers that act preferentially on photosynthetic cells, driven by promoters that have high activity in differentiated chloroplasts, is unlikely to work in non-green tissues containing proplastids (e.g. dark-grown maize Type I
callus, somatic embryos) or amyloplasts/leucoplasts (e.g. Arabidopsis root cultures). Plastid transformation in these plants requires a selectable marker that gives strong selection in all plastid types.
A preferred selectable marker for generalized plastid transformation: (1 ) is active only in the plastid to eliminate nuclear-transformed "escapes; (2) has a mode of action that does not depend on photosynthetic competence or the presence of fully differentiated chloroplasts; and (3) has a level of resistance that is co-dependent on an adjustable external parameter (e.g. light), rather than being determined solely by the bulk concentration of a selective agent, so that selection pressure can vary during selection to facilitate segregation of the many-thousand plastid genome copies.
In a preferred embodiment, such a selectable marker gene involves the use of a chimeric gene comprising an isolated DNA molecule encoding a plastid-targeted enzyme having in its natural state a plastid transit peptide, wherein the DNA
molecule is modified such that the transit peptide either is absent or does not function to target the enzyme to the plastid, wherein the DNA molecule is operatively linked to a promoter capable of expression in plant plastids. In a preferred embodiment, a DNA molecule of the present invention encodes an enzyme that is naturally inhibited by a herbicide. In another preferred embodiment, the DNA molecule encodes a protoporphyrinogen IX oxidase ("protox"). In a preferred embodiment, the protoporphyrinogen IX oxidase gene is from Arabidopsis thaliana and in a more preferred embodiment, the protoporphyrinogen IX oxidase gene is from Arabidopsis thaliana and comprises at least one amino acid substitution.
Preferably, an amino acid substitution results in tolerance of the enzyme against inhibition by an herbicide which naturally inhibits the activity of the enzyme. Low concentrations of herbicide are thought to kill wildtype plants due to light-sensitive intermediates which build up when the plastid-localized protox enzyme is inhibited. Production of these photosensitizing compounds does not require differentiated chloroplasts or active photosynthesis, which is a key factor for successful plastid transformation of plants whose regenerable cultured tissues are of non-photosynthetic nature.
Another key feature is to have expression of the selectable marker gene in non-green plastids. In a preferred embodiment, the invention encompasses the use of promoters that are capable of expression of operatively linked DNA molecules in plastids of both green and non-green tissue. In particular, one such promoter comes from the regulatory region of the plastid 16S ribosomal RNA operon. Another candidate is the promoter and 5' UTR
from the plastid clpP gene. The clpP gene product is expressed constitutively in plastids from all plant tissues, including those that do not contain chloroplasts (Shanklin (1995) Plant Cell7:
1713-22).
Other DNA molecules may be co-introduced in plant plastids using the method described above. In a preferred embodiment, a plastid transformation vector of the present invention contains a chimeric gene allowing for selection of transformants as described above and at least one other gene fused to a promoter capable of expression in plant plastids. The other such gene may, for example, confer resistance to insect pests, or to fungal or bacterial pathogens, or may encode one or more value-added traits.
BRIEF DESCRIPTION OF THE SEQUENCES IN THE SEQUENCE LISTING
SEQ ID N0:1: DNA coding sequence for an Arabidopsis thaliana protox-1 protein.
SEQ ID N0:2: Arabidopsis protox-1 amino acid sequence encoded by SEQ ID N0:1.
SEQ ID N0:3: DNA coding sequence for an Arabidopsis thaliana protox-2 protein.
SEQ ID N0:4: Arabidopsis protox-2 amino acid sequence encoded by SEQ ID N0:3.
SEQ ID N0:5: DNA coding sequence for a maize protox-1 protein.
SEQ ID N0:6: Maize protox-1 amino acid sequence encoded by SEQ ID N0:5.
SEQ ID N0:7: DNA coding sequence for a maize protox-2 protein.
SEQ ID N0:8: Maize protox-2 amino acid sequence encoded by SEQ ID N0:7.
SEQ ID N0:9: Partial DNA coding sequence for a wheat protox-1 protein.
SEQ ID N0:10: Partial wheat protox-1 amino acid sequence encoded by SEQ ID
N0:9.
SEQ ID N0:11: DNA coding sequence for a soybean protox-1 protein.
SEQ ID N0:12: Soybean protox-1 protein encoded by SEQ ID N0:11.
SEQ ID N0:13: Promoter sequence from Arabidopsis thaliana protox-1 gene.
SEQ ID N0:14: Promoter sequence from maize protox-1 gene.
SEQ ID N0:15: DNA coding sequence for a cotton protox-1 protein.
SEQ ID N0:16: Cotton protox-1 amino acid sequence encoded by SEQ ID N0:15.
SEQ ID N0:17: DNA coding sequence for a sugar beet protox-1 protein.
SEQ ID N0:18: Sugar beet protox-1 amino acid sequence encoded by SEQ ID N0:17.
SEQ ID N0:19: DNA coding sequence for an oilseed rape protox-1 protein.
SEQ ID N0:20: Oilseed rape protox-1 amino acid sequence encoded by SEQ ID
N0:19.
SEQ ID N0:21: Partial DNA coding sequence for a rice protox-1 protein.
SEQ ID N0:22: Partial rice protox-1 amino acid sequence encoded by SEQ ID
N0:21.
SEQ ID N0:23: Partial DNA coding sequence for a sorghum protox-1 protein.
SEQ ID N0:24: Partial sorghum protox-1 amino acid sequence encoded by SEQ ID
N0:23.
SEQ ID N0:25: Maize protox-1 intron sequence.
SEQ ID N0:26: Promoter sequence from sugar beet protox-1 gene.
SEQ ID N0:27: Pclp-P1 a - plastid clpP gene promoter top strand PCR primer.
SEQ ID N0:28: Pclp P1 b - plastid clpP gene promoter bottom strand PCR primer.
SEQ ID N0:29: Pclp_P2b - plastid clpP gene promoter bottom strand PCR primer.
SEQ ID N0:30: Trpsl6_P1a - plastid rpsl6 gene top strand PCR primer.
SEQ ID N0:31: Trpsl6_p1 b - plastid rpsl6 gene bottom strand PCR primer.
SEQ ID N0:32: minpsb_U - plastid psbA gene top strand primer.
SEQ ID N0:33: minpsb_L - plastid psbA gene bottom strand primer.
SEQ ID N0:34: APRTXP1 a - top strand PCR primer.
SEQ ID N0:35: APRTXP1 b - bottom strand PCR primer.
SEQ ID N0:36: Partial DNA coding sequence for a sugar cane protox-1 protein.
SEQ ID N0:37: Partial sugar cane protox-1 amino acid sequence encoded by SEQ
ID N0:36.
1. DEPOSITS
The following vector molecules have been deposited with Agricultural Research Service, Patent Culture Collection (NRRL), Northern Regional Research Center, 1815 North University Street, Peoria, Illinois 61604, U.S.A on the dates indicated below:
Wheat protox-1 a, in the pBluescript SK vector, was deposited March 19, 1996, as pWDC-13 (NRRL #B21545).
Soybean protox-1, in the pBluescript SK vector, was deposited December 15, 1995 as pWDC-12 (NRRL #B-21516).
Cotton protox-1, in the pBluescript SK vector, was deposited July 1, 1996 as pW DC-15 (NRRL #B-21594).
Sugar beet protox-1, in the pBluescript SK vector, was deposited July 29, 1996, as pWDC-16 (NRRL #B-21595N).
Oilseed rape protox-1, in the pBluescript SK vector, was deposited August 23, 1996, as pWDC-17 (NRRL #B-21615).
Rice protox-1, in the pBluescript SK vector, was deposited December 6, 1996, as pWDC-18 (NRRL #B-21648).
Sorghum protox-1, in the pBluescript SK vector, was deposited December 6, 1996, as pWDC-19 (NRRL #B-21649).
Resistant mutant pAraC-2Cys, in the pMut-1 plasmid, was deposited on November 14, 1994 under the designation pWDC-7 with the Agricultural Research Culture Collection and given the deposit designation NRRL #21339N.
AraPT1 Pro containing the Arabidopsis protox-1 promoter was deposited December 15, 1995, as pWDC-11 (NRRL #B-21515) A plasmid containing the maize protox-1 promoter fused to the remainder of the maize protox-1 coding sequence was deposited March 19, 1996 as pWDC-14 (NRRL #B-21546).
A plasmid containing the sugar beet protox-1 promoter was deposited December 6, 1996, as pWDC-20 (NRRL #B-21650).
EXAMPLES
The invention will be further described by reference to the following detailed examples. These examples are provided for purposes of illustration only, and are not intended to be limiting unless otherwise specified. Standard recombinant DNA
and molecular cloning techniques used here are well known in the art and are described by Ausubel (ed.), Current Protocols in Molecular Biology, John Wiley and Sons, Inc. (1994); T.
Maniatis, E. F. Fritsch and J. Sambrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor laboratory, Cold Spring Harbor, NY (1989); and by T.J. Silhavy, M.L. Berman, and L.W. Enquist, Experiments with Gene Fusions, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1984).
Section A. Isolation And Characterization Of Plant Protoporphyrinogen Oxidase (Protox) Genes Example 1: Isolation of a Wheat Protox-1 cDNA Based on Sequence Homology to a Maize Protox-1 Coding Sequence Total RNA prepared from Triticum aestivum (cv Kanzler) was submitted to Clontech for custom cDNA library construction in the Lambda Uni-Zap vector.
Approximately 50,000 pfu of the cDNA library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell). The plaque lifts were probed with the maize protox-1 cDNA (SEQ ID
N0:5; see Example 2 of International application no. PCT/IB95/00452, filed June 8, 1995, published Dec. 21, 1995 as WO 95/34659) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M
NaP04 pH 7.0, 1 mM EDTA at 50 C. Wash conditions were 2X SSC, 1 % SDS at 50 C.
(Church and Gilbert, Proc. Natl. Acad. Sci. USA 8i: 1991-1995 (1984), hereby incorporated by reference in its entirety.) Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.). The longest wheat protox-1 cDNA obtained from initial screening efforts, designated °wheat protox-1 °, was 1489-by in length. Wheat protox-1 lacks coding sequence for the transit peptide plus approximately 126 amino acids of the mature coding sequence based on comparison with the other known plant protox peptide sequences.
A second screen was performed to obtain a longer wheat protox cDNA. For this screen, a Triticum aestivum (cv Kanzler) cDNA library was prepared internally using the lambda Uni-Zap vector. Approximately 200,000 pfu of the cDNA library was screened as indicated above, except that the wheat protox-1 cDNA was used as a probe and hybridization and wash conditions were at 65 C instead of 50 C. The longest wheat cDNA
obtained from this screening effort, designated "wheat protox-1a", was 1811-by in length.
The nucleotide sequence of this cDNA and the amino acid sequence it encodes are set forth in SEQ ID NOs:9 and 10, respectively. Based on comparison with the other known plant protox peptide sequences and with corresponding genomic sequence, this cDNA is either full-length or missing only a few transit peptide codons (Table 1 A).
This wheat protein sequence is 91 % identical (95% similar) to the maize protox-1 protein sequence set forth in SEQ ID N0:6.
Wheat protox-1a, in the pBluescript SK vector, was deposited March 19, 1996, as pWDC-13 (NRRL #B21545).
Example 2: Isolation of a Soybean Protox-1 cDNA Based on Sequence Homology to an Arabidopsis Protox-1 Coding Sequence A Lambda Uni-Zap cDNA library prepared from soybean (v Williams 82, epicotyls) was purchased from Stratagene. Approximately 50,000 pfu of the library was plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto Colony/Plaque Screen membranes (NEN Dupont). The plaque lifts were probed with the Arabidopsis protox-1 cDNA (SEQ ID N0:1; see Example 1 of International application no. PCT/IB95/00452, filed June 8, 1995, published Dec. 21, 1995 as WO
95/34659)) labeled with 32P-dCTP by the random priming method (Life Technologies).
Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA
at 50 C. Wash conditions were 2X SSC, 1 % SDS at 50 C. (Church and Gilbert (1984)).
Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids.
The sequence of the cDNA inserts was determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
The longest soybean cDNA obtained, designated "soybean protox-1 ~, is full-length based on comparison with the other known plant protox peptide sequences (Table 1 A). Soybean protox-1 is 1847-by in length and encodes a protein of 58.8 kDa. The nucleotide sequence of this cDNA and the amino acid sequence it encodes are set forth in SEQ ID NOs:l1 and 12, respectively. The soybean protein is 78% identical (87% similar) to the Arabidopsis protox-1 protein.
Soybean protox-1, in the pBluescript SK vector, was deposited December 15, 1995 as pWDC-12 (NRRL #B-21516).
Example 3: Isolation of a Cotton Protox-1 cDNA Based on Sequence Homology to a Maize Protox-1 Coding Sequence A Lambda Uni-Zap cDNA library prepared from Gossypium hirsutum L. (72 hr. dark grown cotyledons) was obtained from Dr. Dick Trelease, Dept. of Botany, Arizona State University (Ni W. and Trelease R.N., Arch. Biochem. Biophys. 289: 237-243 (1991 )).
Approximately 50,000 pfu of the library was plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto Colony/Plaque Screen membranes (NEN Dupont). The plaque lifts were probed with the maize protox-1 cDNA
(SEQ ID N0:5) labeled with 32P-dCTP by the random priming method (Life Technologies).
Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH
7.0, 1 mM EDTA at 50 C. Wash conditions were 2X SSC, 1 % SDS at 50 C. (Church and Gilbert (1984)). Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequence of the cDNA inserts was determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
The longest cotton cDNA obtained, designated "cotton protox-1 ", appears to be full-length based on comparison with the other known plant protox peptide sequences (Table 1A).
Cotton protox-1 is 1826-by in length and encodes a protein of 58.2 kDa. The nucleotide sequence of this cDNA and the amino acid sequence it encodes are set forth in SEQ ID
NOs:l3 and 14, respectively. The cotton protein is 77% identical (86% similar) to the maize protox-1 protein.
Cotton protox-1, in the pBluescript SK vector, was deposited July 1, 1996 as pWDC-15 (NRRL #B-21594).
Example 4: Isolation of a Sugar Beet Protox-1 cDNA Based on Sequence Homology to an Arabidopsis Protox-1 Coding Sequence A Lambda-Zap cDNA library prepared from Beta vulgaris was obtained from Dr.
Philip Rea, Dept. of Botany, Plant Science Institute, Philadelphia, PA (Yongcheol Kim, Eugene J.
Kim, and Philip A. Rea, Plant Physiol. 106: 375-382 (1994)). Approximately 50,000 pfu of the cDNA library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell).
The plaque lifts were probed with the Arabidopsis protox-1 cDNA (SEQ ID N0:1 ) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50 C.
Wash conditions were 2X SSC, 1 % SDS at 50 C. (Church and Gilbert (1984)).
Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
The longest sugar beet protox-1 cDNA obtained, designated "sugar beet protox-1 ", is full-length based on comparison with the other known plant protox peptide sequences (Table 1A).
Sugar beet protox-1 is 1910-by in length and encodes a protein of 60 kDa. The nucleotide sequence of this cDNA and the amino acid sequence it encodes are set forth in SEQ ID
NOs:l5 and 16, respectively. The sugar beet protein is 73% identical (82%
similar) to the Arabidopsis protox-1 protein.
Sugar beet protox-1, in the pBluescript SK vector, was deposited July 29, 1996, as pWDC-16 (NRRL #B-21595N).
Example 5: Isolation of an Oilseed Rape Protox-1 cDNA Based on Sequence Homology to an Arabidopsis Protox-1 Coding Sequence A Lambda Uni-Zap II cDNA library prepared from Brassica napus (3-4 wk. mature green leaves) was obtained from Dr. Guenther Ochs, Institut Fuer Allgemeine Botanik, Johannes Gutenberg-Universitaet Mainz, Germany (Gunther Ochs, Gerald Schock, and Aloysius Wild, Plant Physiol. 103: 303-304 (1993)). Approximately 50,000 pfu of the cDNA
library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell). The plaque lifts were probed with the Arabidopsis protox-1 cDNA (SEQ ID N0:1 ) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50 C.
Wash conditions were 2X SSC, 1 % SDS at 50° C. (Church and Gilbert (1984)).
Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
The longest oilseed rape protox-1 cDNA obtained, designated "rape protox-1 ", is full-length based on comparison with the other known plant protox peptide sequences (Table 1 A).
Rape protox-1 is 1784-by in length and encodes a protein of 57.3kD. The nucleotide sequence of this cDNA and the amino acid sequence it encodes are set forth in SEQ ID NOs: 17 and 18, respectively. The oilseed rape protein is 87% identical (92% similar) to the Arabidopsis protox-1 protein.
Rape protox-1, in the pBluescript SK vector, was deposited August 23, 1996, as pWDC-17 (NRRL #B-21615).
Example 6: Isolation of a Rice Protox-1 cDNA Based on Sequence Homology to a Maize Protox-1 Coding Sequence A Lambda gtll cDNA library prepared from Oryza safiva (5 day etiolated shoots) was purchased from Clontech. Approximately 50,000 pfu of the cDNA library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell). The plaque lifts were probed with the maize protox-1 cDNA (SEQ ID N0:5) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50 C. Wash conditions were 2X SSC, 1 SDS at 50 C. (Church and Gilbert (1984)). Positively hybridizing plaques were purified, and lambda DNA was prepared using the Wizard Lambda-Prep kit (Promega). The cDNA
inserts were subcloned as EcoRl fragments into the pBluescript SK vector using standard techniques. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
The longest rice protox-1 cDNA obtained, designated "rice protox-1 ", was 1224-by in length.
Rice protox-1 lacks coding sequence for the transit peptide plus approximately 172 amino acids of the mature coding sequence based on comparison with the other known plant protox peptide sequences (Table 1 A). The nucleotide sequence of this partial cDNA and the amino acid sequence it encodes are set forth in SEQ ID NOs:l9 and 20, respectively.
Rice protox-1, in the pBluescript SK vector, was deposited December 6, 1996, as pWDC-18 (NRRL #B-21648).
Example 7: Isolation of a Sorghum Protox-1 cDNA Based on Sequence Homology to a Maize Protox-1 Coding Sequence A Lambda-Zap II cDNA library prepared from Sorghum bicolor (3-6 day green seedlings) was obtained from Dr. Klaus Pfizenmaier, Institute of Cell Biology and Immunology, University of Stuttgart, Germany (Harald Wajant, Karl-Wolfgang Mundry, and Klaus Pfizenmaier, Plant Mol. Biol. 26: 735-746 (1994)). Approximately 50,000 pfu of the cDNA library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell). The plaque lifts were probed with the maize protox-1 cDNA (SEQ ID N0:5) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7%
sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50 C. Wash conditions were 2X SSC, 1 % SDS at 50 C. (Church and Gilbert (1984)).
Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
The longest sorghum protox-1 cDNA obtained, designated "sorghum protox-1 °, was 1590-by in length.
Sorghum protox-1 lacks coding sequence for the transit peptide plus approximately 44 amino acids of the mature coding sequence based on comparison with the other known plant protox peptide sequences (Table 1 A). The nucleotide sequence of this partial cDNA
and the amino acid sequence it encodes are set forth in SEQ ID NOs:21 and 22, respectively.
Sorghum protox-1, in the pBluescript SK vector, was deposited December 6, 1996, as pWDC-19 (NRRL #B-21649).
Example 8: Isolation of a Sugar Cane Protox-1 cDNA Based on Sequence Homology to a Maize Protox-1 Coding Sequence A Lambda-Zap II cDNA library prepared from sugar cane was obtained from Henrik Albert of USDA/ARS at the Hawaii Agricultural Research Center. Approximately 50,000 pfu of the cDNA library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell).
The plaque lifts were probed with the maize protox-1 cDNA (SEQ ID N0:5) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50 C.
Wash conditions were 2X SSC, 1 % SDS at 50 C. (Church and Gilbert (1984)).
Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
The longest sugar cane protox-1 cDNA obtained, designated "sugar cane protox-1 ", was 633-by in length. Sugar cane protox-1 lacks coding sequence for the transit peptide plus approximately 382 amino acids of the mature coding sequence based on comparison with the other known plant protox peptide sequences (Table 1 A). The nucleotide sequence of this partial cDNA and the amino acid sequence it encodes are set forth in SEQ
ID NOs:36 and 37, respectively.
Example 9: Demonstration of Plant Protox Clone Sensitivity to Protox Inhibitory Herbicides in a Bacterial System Liquid cultures of protox-1/SASX38, protox-2/SASX38 and pBluescript/XL1-Blue were grown in L amp'°°. One hundred microliter aliquots of each culture were plated on L amp'°°
media containing various concentrations (1.OnM-lOmM) of a protox inhibitory aryluracil herbicide of formula XVII. Duplicate sets of plates were incubated for 18 hours at 37 C.
The protox+ E. coli strain XL1-Blue showed no sensitivity to the herbicide at any concentration, consistent with reported resistance of the native bacterial enzyme to similar herbicides. The protox-1/SASX38 was clearly sensitive, with the lawn of bacteria almost entirely eliminated by inhibitor concentrations as low as lOnM. The protox-2/SASX38 was also sensitive, but only at a higher concentration (10NM) of the herbicide.
The herbicide was effective even on plates maintained almost entirely in the dark. The toxicity of the herbicide was entirely eliminated by the addition of 20 Ng/ml hematin to the plates.
The different herbicide tolerance between the two plant protox strains is likely the result of differential expression from these two plasmids, rather than any inherent difference in enzyme sensitivity. Protox-1/SASX38 grows much more slowly than protox-2/SASX38 in any heme-deficient media. In addition, the Mzprotox-2/SASX38 strain, with a growth rate comparable to Arab protox-1/SASX38, is also very sensitive to herbicide at the lower (10-100nM) concentrations.
Section B: Identification and Characterization of Plant Protox Genes Resistant to Protox-Inhibitory Herbicides Example 10: Selecting for Plant Protox Genes Resistant to Protox-Inhibitory Herbicides in the E. coli Expression System An Arabidopsis thaliana (Landsberg) cDNA library in the plasmid vector pFL61 (Minet et al., Plant J. 2:417-422 (1992) was obtained and amplified. The E. coli hemG
mutant SASX38 (Sasarman et al., J. Gen. Microbiol. 113:297(1979)) was obtained and maintained on L media containing 20ug/ml hematin (United States Biochemicals). The plasmid library was transformed into SASX38 by electroporation using the Bio-Rad Gene Pulser and the manufacturer's conditions. The electroporated cells were plated on L agar containing 100ug/ml ampicillin at a density of approximately 500,000 transformants/1 Ocm plate. The cells were then incubated at 37 C for 40 hours in low light and selected for the ability to grow without the addition of exogenous heme. Heme prototrophs were recovered at a frequency of 400/10 from the pFL61 library. Sequence analysis of twenty-two complementing clones showed that nine are of the type designated "protox-1,"
the protox gene expected to express a chloroplastic protox enzyme.
The pFL61 library is a yeast expression library, with the Arabidopsis cDNAs inserted bidirectionally. These cDNAs can also be expressed in bacteria. The protox cDNAs apparently initiate at an in-frame ATG in the yeast PGK 3' sequence approximately 10 amino acids 5' to the Notl cloning site in the vector and are expressed either from the IacZ
promoter 300bp further upstream or from an undefined cryptic bacterial promoter. Because protox-1 cDNAs that included significant portions of a chloroplast transit sequence inhibited the growth of the E. coli SASX38 strain, the clone with the least amount of chloroplast transit sequence attached was chosen for mutagenesis/herbicide selection experiments.
This clone, pSLVl9, contains only 17 amino acids of the putative chloroplast transit peptide, with the DNA sequence beginning at bp-151 of the Arabidopsis protox-1 cDNA
(SEQ ID
N0:1 ).
The plasmid pSLVl9 was transformed into the random mutagenesis strain XL1-Red (Stratagene, La Jolla, CA). The transformation was plated on L media containing 50ug/ml ampicillin and incubated for 48 hours at 37 C. Lawns of transformed cells were scraped from the plates and plasmid DNA prepared using the Wizard Megaprep kit (Promega, Madison, W I). Plasmid DNA isolated from this mutator strain is predicted to contain approximately one random base change per 2000 nucleotides (see Greener et al., Strategies 7(2):32-34 (1994).
The mutated plasmid DNA was transformed into the hemG mutant SASX38 (Sasarman et aL, J. Gen. Microbiol. 113:297 (1979) and plated on L media containing various concentrations of protox-inhibiting herbicide (formula XVII). The plates were incubated for 2 days at 37 C. Plasmid DNA was isolated from all colonies that grew in the presence of herbicide concentrations that effectively killed the wild type strain. The isolated DNA was then transformed into SASX38 and plated again on herbicide to ensure that the resistance observed was plasmid-borne. The protox coding sequence from plasmids passing this screen was excised by Notl digestion, recloned into an unmutagenized vector, and tested again for the ability to confer herbicide tolerance. The DNA
sequence of protox cDNAs that conferred herbicide resistance was then determined and mutations identified by comparison with the wild type Arabidopsis protox-1 sequence (SEQ ID N0:1 ).
A single coding sequence mutant was recovered from the first mutagenesis experiment. This mutant leads to enhanced herbicide "resistance° only by increasing growth rate. It contains a C to A mutation at nucleotide 197 in SEQ ID N0:1 in the truncated chloroplast transit sequence of pSLV19, converting an ACG codon for threonine to an AAG codon for lysine at amino acid 56 of SEQ ID N0:2, and resulting in better complementation of the bacterial mutant. This plasmid also contains a silent coding sequence mutation at nucleotide 1059, with AGT (Ser) changing to AGC (Ser).
This plasmid was designated pMut-1.
The pMut-1 plasmid was then transformed into the mutator XL1-Red strain as described above and the mutated DNA was isolated and plated on an herbicide concentration that is lethal to the unmutagenized pMut-1 protox gene.
Herbicide tolerant colonies were isolated after two days at 37 C and analyzed as described above.
Multiple plasmids were shown to contain herbicide resistant protox coding sequences.
Sequence analysis indicated that the resistant genes fell into two classes. One resistance mutation identified was a C to T change at nucleotide 689 in the Arabidopsis protox-1 sequence set forth in SEQ ID NO:1. This change converts a GCT codon for alanine at amino acid 220 of SEQ ID N0:2 to a GTT codon for valine, and was designated pAraC-1 Val (see, Table 1 B;
sub-sequence 3).
A second class of herbicide resistant mutant contains an A to G change at nucleotide 1307 in the Arabidopsis protox-1 sequence. This change converts a TAC codon for tyrosine at amino acid 426 to a TGC codon for cysteine, and was designated pAraC-2Cys (see, Table 1 B; sub-sequence 7).
A third resistant mutant has a G to A change at nucleotide 691 in the Arabidopsis protox-1 sequence. This mutation converts a GGT codon for glycine at amino acid 221 to an AGT codon for serine at the codon position adjacent to the mutation in pAraC-1. This plasmid was designated pAraC-3Ser (see, Table 1 B; sub-sequence 4).
Resistant mutant pAraC-2Cys, in the pMut-1 plasmid, was deposited on November 14, 1994 under the designation pWDC-7 with the Agricultural Research Culture Collection and given the deposit designation NRRL #21339N.
Example 11: Additional Herbicide-Resistant Codon Substitutions at Positions Identified in the Random Screen The amino acids identified as herbicide resistance sites in the random screen are replaced by other amino acids and tested for function and for herbicide tolerance in the bacterial system. Oligonucleotide-directed mutagenesis of the Arabidopsis protox-1 sequence is performed using the Transformer Site-Directed Mutagenesis Kit (Clontech, Palo Alto, CA). After amino acid changes are confirmed by sequence analysis, the mutated plasmids are transformed into SASX38 and plated on L-amp'°°
media to test for function and on various concentrations of protox-inhibiting herbicide to test for tolerance.
This procedure is applied to the alanine codon at nucleotides 688-690 and to the tyrosine codon at nucleotides 1306-1308 of the Arabidopsis protox-1 sequence (SEQ ID
N0:1 ). The results demonstrate that the alanine codon at nucleotides 688-690 can be changed to a codon for valine (pAraC-1 Val), threonine (pAraC-1 Thr), leucine (pAraC-1 Leu), cysteine (pAraC-1 Cys), or isoleucine (pAraC-1 Ile) to yield an herbicide-resistant protox enzyme that retains function (see, Table 1 B; sub-sequence 3). The results further demonstrate that the tyrosine codon at nucleotides 1306-1308 can be changed to a codon for cysteine (pAraC-2Cys), isoleucine (pAraC-211e), leucine (pAraC-2Leu), threonine (pAraC-2Thr), methionine (pAraC-2Met), valine (pAraC-2Val), or alanine (pAraC-2Ala) to yield an herbicide-resistant protox enzyme that retains function (see, Table 1 B; sub-sequence 7).
Example 12: Isolation of Additional Mutations that Increase Enzyme Function and/or Herbicide Tolerance of Previously Identified Resistant Mutants Plasmids containing herbicide resistant protox genes are transformed into the mutator strain XL1-Red and mutated DNA is isolated as described above. The mutated plasmids are transformed into SASX38 and the transformants are screened on herbicide concentrations (formula XVII) sufficient to inhibit growth of the original "resistant" mutant.
Tolerant colonies are isolated and the higher tolerance phenotype is verified as being coding sequence dependent as described above. The sequence of these mutants is determined and mutations identified by comparison to the progenitor sequence.
This procedure was applied to the pAraC-1 Val mutant described above. The results demonstrate that the serine codon at amino acid 305 (SEQ ID N0:2) can be changed to a codon for leucine to yield an enzyme with higher tolerance to protox-inhibiting herbicides than the pAraC-1 Val mutant alone. This second site mutation is designated AraC305Leu (see, Table 1 B; sub-sequence 13). The same results are demonstrated for the threonine codon at amino acid 249, where a change to either isoleucine or to alanine leads to a more tolerant enzyme (see, Table 1 B; sub-sequence 12). These changes are designated AraC24911e and AraC249A1a, respectively.
The procedure was also applied to the pAraC-2Cys mutant described above. The results demonstrate that the proline codon at amino acid 118 (SEQ ID N0:2) can be changed to a codon for leucine to yield an enzyme with higher tolerance to protox-inhibiting herbicides than the pAraC-1 Cys mutant alone. This mutation is designated AraC1 l8Leu (see, Table 1 B; sub-sequence 11 ). The same results are demonstrated for the serine codon at amino acid 305, where a change to leucine leads to a more tolerant pAraC-2Cys enzyme (see, Table 1 B; sub-sequence 13). This change was also isolated with the pAraC-1 Val mutant as described above and is designated AraC305Leu. Additional mutations that enhance the herbicide resistance of the pAraC-2Cys mutant include an asparagine to serine change at amino acid 425, designated AraC425Ser (Table 1 B; sub-sequence 14), and a tyrosine to cysteine at amino acid 498, designated AraC498Cys (Table 1 B; sub-sequence 15).
These changes (Table 1B; sub-sequences 11-15) are referred to as "second site"
mutations, because they are not sufficient to confer herbicide tolerance alone, but rather enhance the function and/or the herbicide tolerance of an already mutant enzyme. This does not preclude the possibility that other amino acid substitutions at these sites could suffice to produce an herbicide tolerant enzyme since exhaustive testing of all possible replacements has not been performed.
Example 13: Combining Identified Resistance Mutations with Identified Second Site Mutations to Create Highly FunctionaUHighly Tolerant Protox Enzymes The AraC305Leu mutation described above was found to enhance the function/herbicide resistance of both the AraC-1 Val and the AraC-2Cys mutant plasmids. In an effort to test the general usefulness of this second site mutation, it was combined with the AraC-2Leu, AraC-2Val, and AraC-211e mutations and tested for herbicide tolerance. In each case, the AraC305Leu change significantly increased the growth rate of the resistant protox mutant on protox-inhibiting herbicide. Combinations of the AraC-211e resistant mutant with either the second site mutant AraC24911e or AraC118Leu also produced more highly tolerant mutant protox enzymes. The AraC24911e mutation demonstrates that a second site mutation identified as enhancing an AraC-1 (sub-sequence 3) mutant may also increase the resistance of an AraC-2 (sub-sequence 7) mutant. A three mutation plasmid containing AraC-211e, AraC305Leu, and AraC24911e (Table 1 B; sub-sequences 7, 13, and 12) has also been shown to produce a highly functional, highly herbicide tolerant protox-1 enzyme.
Example 14: Identification of Sites in the Maize Protox-1 Gene that Can Be Mutated to Give Herbicide Tolerance The pMut-1 Arabidopsis protox -1 plasmid described above is very effective when used in mutagenesis/screening experiments in that it gives a high frequency of genuine coding sequence mutants, as opposed to the frequent up-promoter mutants that are isolated when other plasmids are used. In an effort to create an efficient plasmid screening system for maize protox-1, the maize cDNA was engineered into the pMut-1 vector in approximately the same sequence context as the Arabidopsis cDNA. Using standard methods of overlapping PCR fusion, the 5' end of the pMut-1 Arabidopsis clone (including 17 amino acids of chloroplast transit peptide with one mis-sense mutation as described above) was fused to the maize protox-1 cDNA sequence starting at amino acid number 14 of the maize sequence (SEQ ID N0:6). The 3' end of the maize cDNA was unchanged.
Notl restriction sites were placed on both ends of this fusion, and the chimeric gene was cloned into the pFL61 plasmid backbone from pMut-1. Sequence analysis revealed a single nucleotide PCR-derived silent mutation that converts the ACG codon at nucleotides 745-747 (SEQ ID N0:5) to an ACT codon, both of which encode threonine. This chimeric Arab-maize protox-1 plasmid was designated pMut-3.
The pMut-3 plasmid was transformed into the mutator XL1-Red strain as described above and the mutated DNA was isolated and plated on a herbicide concentration (formula XVII) that was lethal to the unmutagenized pMut-3 maize protox gene. Herbicide tolerant colonies were isolated after two days at 37 C and analyzed as described above.
This analysis revealed multiple plasmids containing herbicide resistant protox coding sequences.
Sequence analysis showed 5 single base changes that individually result in an herbicide tolerant maize protox-1 enzyme. Three of these mutations correspond to amino acid changes previously shown to confer tolerance at the homologous position in the Arabidopsis protox-1, gene. Two of the three are pMzC-1 Val and pMzC-1 Thr, converting the alanine (GCT) at amino acid 164 (SEQ ID N0:6) to either valine (GAT) or to threonine (ACT). This position corresponds to the pAraC-1 mutations described above (see, Table 1 B; sub-sequence 3). The third analogous change, pMzC-3Ser, converts the glycine (GGT) at amino acid 165 to Serine (AGT), corresponding to the AraC-3Ser mutation described above (see, Table 1 B; sub-sequence 4). These results serve to validate the expectation that herbicide-tolerant mutations identified in one plant protox gene may also confer herbicide tolerance in an equivalent plant protox gene from another species.
Two of the mutations isolated from the maize protox-1 screen result in amino acid changes at residues not previously identified as herbicide resistance sites.
One change (Mz159Phe) converts cysteine (TGC) to phenylalanine (TTC) at amino acid 159 of the maize protox-1 sequence (SEQ ID N0:6) (see, Table 1 B; sub-sequence 2). The second (Mz419Thr) converts isoleucine (ATA) to threonine (ACA) at amino acid 419 (see, Table 1 B;
sub-sequence 9).
Additional amino acid substitutions were made and tested at three of the maize mutant sites. Tolerance was demonstrated when glycine 165 was changed to leucine (pMzC-3Leu) or when cysteine 159 was changed to either leucine (Mz159Leu) or to lysine (Mz159Lys) (see, Table 1 B; sub-sequences 4 and 2). Tolerant enzymes were also created by changing isoleucine 419 to histidine (Mz419His), glycine (Mz419G1y), or asparagine (Mz419Asn) (see, Table 1 B; sub-sequence 9).
Individual amino acid changes that produced highly herbicide tolerant Arabidopsis protox-1 enzymes were engineered into the maize protox-1 gene by site-directed mutagenesis as described above. Bacterial testing demonstrated that changing the alanine (GCT) at amino acid 164 (SEQ ID N0:6) to leucine (CTT) produced a highly tolerant maize enzyme (pMzC-1 Leu) (see, Table 1 B; sub-sequence 3). No mutation analogous to the AraC-2 site (Table 1 B; sub-sequence 7) in Arabidopsis was isolated in the maize random screen. However, changing this site, tyrosine 370 in the maize enzyme (SEQ ID
N0:6), to either isoleucine (pMzC-211e) or methionine (pMzC-2Met) did produce herbicide tolerant enzymes (see, Table 1 B; sub-sequence 7).
Additional mutant screens performed as described earlier in this example, except using formulas XXllla and XXlllb instead of XVII, identified three additional amino acid changes that confer tolerant protox enzymes. One, using formula XXlllb, demonstrated that changing the arginine (CGT) at amino acid 88 (SEQ ID N0:6) to cysteine (TGT) produced a highly tolerant maize enzyme (Mz88Cys) (see, Table 1 B; sub-sequence 1 ).
Another, using formula IVc, demonstrated that changing the arginine (CGT) at amino acid 88 (SEQ ID
N0:6) to leucine (CTT) produced a highly tolerant maize enzyme (Mz88Cys) (see, Table 1 B;
sub-sequence 1 ). Another, using formula XXllla, demonstrated that changing both the leucine (TTA) at amino acid 347 (SEQ ID N0:6) to serine (TCA) and the alanine (GCA) at amino acid 453 (SEQ ID N0:6) to threonine (ACA) produced a highly tolerant maize enzyme (Mz347Ser453Thr) (see, Table 1 B; sub-sequences 16 and 17). Unlike the second site mutations described above, which increase enzyme function and/or herbicide tolerance of previously identified resistant mutants, Mz347Ser453Thr is a "double mutant' that requires that both mutations be present for herbicide tolerance.
Additional mutant screens performed as described earlier in this example identified two additional amino acid changes that confer tolerant protox enzymes. One, using formula XXIV, demonstrated that changing the alanine (GCA) at amino acid 175 (SEQ ID
N0:6) to valine (GTA) or to threonine (ACA) produced a highly tolerant maize enzyme (Mz175Va1 and Mz175Thr, respectively) (see, Table 1 B; sub-sequence 18). Another, using formula IVc, demonstrated that changing the leucine (TTG) at amino acid 337 (SEQ ID N0:6) to serine (TCG) produced a highly tolerant maize enzyme (Mz337Ser) (see, Table 1 B; sub-sequence 19).
Example 15: Identification of Sites in the Wheat Protox-1 Gene that can be Mutated to Give Herbicide Tolerance To create an efficient plasmid screening system for wheat protox-1, the wheat cDNA
was engineered into the pMut-1 vector as described above for the maize cDNA.
This chimeric Arab-wheat protox-1 plasmid is designated pMut-4. The pMut-4 DNA was mutated and screened for herbicide tolerance as described above. This analysis revealed multiple plasmids containing herbicide resistant protox coding sequences.
Sequence analysis showed 7 single base changes that individually result in an herbicide tolerant wheat protox-1 enzyme. Four of these mutations correspond to amino acid changes previously shown to confer tolerance at the homologous position in the Arabidopsis and/or in the maize protox-1 gene. Two, pWhtC-lVal and pWhtC-lThr, convert the alanine (GCT) at amino acid 211 (SEQ ID N0:10) to valine (GAT) and to threonine (ACT), respectively.
This position corresponds to the pAraC-1 mutations described above (see, Table 1 B; sub-sequence 3). The third analogous change, pWhtC-3Ser, converts the glycine (GGT) at amino acid 212 to serine (AGT), corresponding to the AraC-3Ser mutation described above (see, Table 1 B; sub-sequence 4). The fourth, Wht466Thr, converts isoleucine (ATA) to threonine (ACA) at amino acid 466, corresponding to the Mz419Thr mutant from maize (see, Table 1 B; sub-sequence 9).
Three of the mutations isolated from the wheat protox-1 screen result in amino acid changes at residues not previously identified as herbicide resistance sites.
One change (VlIht356Leu) converts valine (GTT) to leucine (CTT) at amino acid 356 of the wheat protox-1 sequence (SEQ ID N0:10) (see, Table 1 B; sub-sequence 6). A second (V11ht421 Pro) converts serine (TCT) to proline (CCT) at amino acid 421 (see, Table 1 B; sub-sequence 8).
The third (Vl/ht502A1a) converts valine (GTT) to alanine (GCT) at amino acid 502 (see, Table 1 B; sub-sequence 10).
Example 16: Identification of Sites in the Soybean Protox-1 Gene that can be Mutated to Give Herbicide Tolerance To create an efficient plasmid screening system for soybean protox-1, the soybean cDNA was engineered into the pMut-1 vector as described above for the maize cDNA. This chimeric Arab-soybean protox-1 plasmid is designated pMut-5. The pMut-5 DNA
was mutated and screened for herbicide tolerance as described above. This analysis revealed multiple plasmids containing herbicide resistant protox coding sequences.
Sequence analysis showed 4 single base changes that individually result in an herbicide tolerant soybean protox-1 enzyme. Two of these mutations correspond to amino acid changes previously shown to confer tolerance at the homologous position in the Arabidopsis and/or in the wheat protox-1 gene. One, pSoyC-1 Thr, converts the alanine (GCA) at amino acid 226 (SEQ ID N0:12) to threonine (ACA). This position corresponds to the pAraC-1 Thr mutation described above (see, Table 1 B; sub-sequence 3). The second analogous change, Soy517A1a, converts the valine (GTT) at amino acid 517 to alanine (GCT), corresponding to the Wht502A1a mutation from wheat (see, Table 1 B; sub-sequence 10).
Two of the mutations isolated from the soybean protox-1 screen result in amino acid changes at a residue not previously identified as an herbicide resistance site. One change (Soy369Ser) converts proline (CCT) to serine (TCT) at amino acid 369 of the soybean protox-1 sequence (SEQ ID N0:12) (see, Table 1 B; sub-sequence 5). A second (Soy369His) converts this same proline369 to histidine (CAT) (see, Table 1 B;
sub-sequence 5).
Individual amino acid changes that produced highly herbicide tolerant Arabidopsis protox-1 enzymes were engineered into the soybean protox-1 gene by site directed mutagenesis as described above. Bacterial testing demonstrated that changing the alanine (GCA) at amino acid 226 (SEQ ID N0:12) to leucine (pSoyC-1 Leu) produced a tolerant soybean enzyme (see, Table 1 B; sub-sequence 3). Changing the tyrosine (TAC) at amino acid 432 (SEQ ID N0:12) to either leucine (pSoyC-2Leu) or isoleucine (pSoyC-211e) also produced herbicide tolerant enzymes (see, Table 1 B; sub-sequence 7).
Example 17: Identification of Sites in the Sugar Beet Protox-1 Gene that can be Mutated to Give Herbicide Tolerance To create an efficient plasmid screening system for sugar beet protox-1, the sugar beet cDNA was engineered into the pMut-1 vector as described above for the maize cDNA.
This chimeric Arab-sugar beet protox-1 plasmid is designated pMut-6. The pMut-was mutated and screened for herbicide tolerance as described above. This analysis revealed multiple plasmids containing herbicide resistant protox coding sequences.
Sequence analysis showed a single base change that results in an herbicide tolerant sugar beet protox-1 enzyme. This change (pSugC-2Cys) converts tyrosine (TAC) at amino acid 449 to cysteine (TGC) and is analogous to the AraC-2 mutations in Arabidopsis (see, Table 1 B; sub-sequence 7).
Individual amino acid changes that produced highly herbicide tolerant Arabidopsis protox-1 enzymes were engineered into the sugar beet protox-1 gene by site directed mutagenesis as described above. Bacterial testing demonstrated that changing the tyrosine (TAC) at amino acid 449 to leucine (pSugC-2Leu), isoleucine (pSugC-211e), valine (pSugC-2Val), or methionine (pSugC-2Met) produced herbicide tolerant sugar beet enzymes (see, Table 1 B; sub-sequence 7).
Example 18: Identification of Sites in the Cotton Protox-1 Gene that can be Mutated to Give Herbicide Tolerance In an effort to create an efficient plasmid screening system for cotton protox-1, the cotton cDNA was engineered into the pMut-1 vector as described above for the maize cDNA. This chimeric Arab-cotton protox-1 plasmid is designated pMut-7. The pMut-7 DNA
was mutated and screened for herbicide tolerance as described above. This analysis revealed multiple plasmids containing herbicide resistant protox coding sequences.
Sequence analysis showed 3 single base changes that individually result in an herbicide tolerant cotton protox-1 enzyme. Three mutants, pCotC-2Cys, pCotC-2His and pCotC-2Arg, change tyrosine (TAC) at amino acid 428 (SEQ ID N0:16) to cysteine (TGC), histidine (CAC) and to arginine (CGC), respectively (see, Table 1 B; sub-sequence 7).
Arginine is a novel substitution giving tolerance at this previously identified AraC-2 (sub-sequence 7) site.
The third mutation (Cot365Ser) converts proline (CCT) to serine (TCT) at amino acid 365.
This change corresponds to the soybean mutant Soy369Ser (see, Table 1 B; sub-sequence 5).
Example 19: Demonstration of Resistant Mutations' Cross-Tolerance to Various Protox-Inhibiting Compounds Resistant mutant plasmids, originally identified based on resistance against a single protox inhibitory herbicide, were tested against a spectrum of other protox inhibiting compounds. For this test, the SASX38 strain containing the wild-type plasmid is plated on a range of concentrations of each compound to determine the lethal concentration for each one. Resistant mutant plasmids in SASX38 are plated and scored for the ability to survive on a concentration of each compound at least 10 fold higher than the concentration that is lethal to the SASX38 strain containing the wild-type plasmid.
Results from bacterial cross-tolerance testing, illustrated in Tables 3A and 3B, show that each of the mutations identified confers tolerance to a variety of protox inhibiting compounds.
2. Section C: Expression of Herbicide-Resistant Protox Genes in Transgenic Plants Example 20: Engineering of Plants Tolerant to Protox-Inhibiting Herbicides by Homologous Recombination or Gene Conversion Because the described mutant coding sequences effectively confer herbicide tolerance when expressed under the control of the native protox promoter, targeted changes to the protox coding sequence in its native chromosomal location represent an alternative means for generating herbicide tolerant plants and plant cells. A
fragment of protox DNA containing the desired mutations, but lacking its own expression signals (either promoter or 3' untranslated region) can be introduced by any of several art-recognized methods (for instance, Agrobacterium transformation, direct gene transfer to protoplasts, microprojectile bombardment), and herbicide-tolerant transformants selected.
The introduced DNA fragment also contains a diagnostic restriction enzyme site or other sequence polymorphism that is introduced by site-directed mutagenesis in vitro without changing the encoded amino acid sequence (i.e. a silent mutation). As has been previously reported for various selectable marker and herbicide tolerance genes (see, e.g., Paszkowski et al., EMBO J. 7: 4021-4026 (1988); Lee et al., Plant Cell 2: 415-425 (1990);
Risseeuw et al., Plant J. 7: 109-119 (1995)). some transformants are found to result from homologous integration of the mutant DNA into the protox chromosomal locus, or from conversion of the native protox chromosomal sequence to the introduced mutant sequence.
These transformants are recognized by the combination of their herbicide-tolerant phenotype, and the presence of the diagnostic restriction enzyme site in their protox chromosomal locus.
3. Example 21: Construction of Plant Transformation Vectors Numerous transformation vectors are available for plant transformation, and the genes of this invention can be used in conjunction with any such vectors. The selection of vector for use will depend upon the preferred transformation technique and the target species for transformation. For certain target species, different antibiotic or herbicide selection markers may be preferred. Selection markers used routinely in transformation include the nptll gene, which confers resistance to kanamycin and related antibiotics (Messing & Vierra, Gene 19: 259-268 (1982); Bevan et al., Nature 304:184-187 (1983)), the bar gene, which confers resistance to the herbicide phosphinothricin (White etal., Nucl Acids Res 18: 1062 (1990), Spencer et al. Theor Appl Genet 79: 625-631 (1990)), the hph gene, which confers resistance to the antibiotic hygromycin (Blochinger &
Diggelmann, Mol Cell Biol 4: 2929-2931 ), and the dhfr gene, which confers resistance to methotrexate (Bourouis et al., EMBO J. 2(7): 1099-1104 (1983)).
I. Construction of Vectors Suitable for Agrobacterium Transformation Many vectors are available for transformation using Agrobacterium tumefaciens.
These typically carry at least one T-DNA border sequence and include vectors such as pBINl9 (Bevan, Nucl. Acids Res. (1984)) and pXYZ. Below the construction of two typical vectors is described.
Construction of pCIB200 and pCIB2001: The binary vectors pCIB200 and pCIB2001 are used for the construction of recombinant vectors for use with Agrobacterium and was constructed in the following manner. pTJS75kan was created by Narl digestion of pTJS75 (Schmidhauser & Helinski, J Bacteriol. 164: 446-455 (1985)) allowing excision of the tetracycline-resistance gene, followed by insertion of an Accl fragment from pUC4K carrying an NPTII (Messing & Vierra, Gene 19: 259-268 (1982); Bevan et aL, Nature 304:
(1983); McBride et al., Plant Molecular Biology i 4: 266-276 (1990)). Xhol linkers were ligated to the EcoRV fragment of pCIB7, which contains the left and right T-DNA borders, a plant selectable noslnptll chimeric gene and the pUC polylinker (Rothstein et al., Gene 53:
153-161 (1987)), and the Xhol-digested fragment was cloned into Sall digested pTJS75kan to create pCIB200 (see also EP 0 332 104, example 19). pCIB200 contains the following unique polylinker restriction sites: EcoRl, Sstl, Kpnl, Bglll, Xbal, and Sall.
pCIB2001 is a derivative of pCIB200, which is created by the insertion into the polylinker of additional restriction sites. Unique restriction sites in the polylinker of pCIB2001 are EcoRl, Sstl, Kpnl, Bglll, Xbal, Sall, Mlul, Bcll, Avrll, Apal, Hpal, and Stul. pCIB2001, in addition to containing these unique restriction sites also has plant and bacterial kanamycin selection, left and right T-DNA borders for Agrobacterium-mediated transformation, the RK2-derived tn'A
function for mobilization between E. coli and other hosts, and the OriT and OriV
functions also from RK2. The pCIB2001 polylinker is suitable for the cloning of plant expression cassettes containing their own regulatory signals.
Construction of pCIBlO and Hygromycin Selection Derivatives Thereof: The binary vector pCIBlO contains a gene encoding kanamycin resistance for selection in plants, T-DNA right and left border sequences and incorporates sequences from the wide host-range plasmid pRK252 allowing it to replicate in both E, coli and Agrobacterium. Its construction is described by Rothstein et al., Gene 53: 153-161 (1987). Various derivatives of pCIBlO
have been constructed that incorporate the gene for hygromycin B
phosphotransferase described by Gritz et al., Gene 25: 179-188 (1983)). These derivatives enable selection of transgenic plant cells on hygromycin only (pCIB743), or hygromycin and kanamycin (pCIB715, pCIB717).
Construction of Vectors Suitable for non-Agrobacterium Transformation.
Transformation without the use of Agrobacterium tumefaciens circumvents the requirement for T-DNA sequences in the chosen transformation vector and consequently vectors lacking these sequences can be utilized in addition to vectors such as the ones described above that contain T-DNA sequences. Transformation techniques that do not rely on Agrobacterium include transformation via particle bombardment, protoplast uptake (e.g. PEG and electroporation) and microinjection. The choice of vector depends largely on the preferred selection for the species being transformed. Below, the construction of some typical vectors is described.
Construction of pCIB3064: pCIB3064 is a pUC-derived vector suitable for direct gene transfer techniques in combination with selection by the herbicide basta (or phosphinothricin). The plasmid pCIB246 comprises the CaMV 35S promoter in operational fusion to the E. coli GUS gene and the CaMV 35S transcriptional terminator and is described in the PCT published application WO 93/07278. The 35S promoter of this vector contains two ATG sequences 5' of the start site. These sites were mutated using standard PCR techniques in such a way as to remove the ATG's and generate the restriction sites Sspl and Pvull. The new restriction sites were 96 and 37-by away from the unique Sall site and 101 and 42-by away from the actual start site. The resultant derivative of pCIB246 was designated pCIB3025. The GUS gene was then excised from pCIB3025 by digestion with Sall and Sacl, the termini rendered blunt and religated to generate plasmid pCIB3060. The plasmid pJIT82 was obtained from the John Innes Centre, Norwich and the a 400-by Smal fragment containing the bar gene from Streptomyces viridochromogenes was excised and inserted into the Hpal site of pCIB3060 (Thompson et al. EMBO J 6: 2519-2523 (1987)).
This generated pCIB3064, which comprises the bar gene under the control of the CaMV
35S promoter and terminator for herbicide selection, a gene for ampicillin resistance (for selection in E. coh) and a polylinker with the unique sites Sphl, Pstl, Hindlll, and BamHl.
This vector is suitable for the cloning of plant expression cassettes containing their own regulatory signals.
Construction of pSOGl9 and pSOG35: pSOG35 is a transformation vector that utilizes the E. coli gene dihydrofolate reductase (DHFR) as a selectable marker conferring resistance to methotrexate. PCR was used to amplify the 35S promoter (--800-bp), intron 6 from the maize Adh1 gene (-.550-bp) and 18-by of the GUS untranslated leader sequence from pSOGlO. A 250-by fragment encoding the E. coli dihydrofolate reductase type II gene was also amplified by PCR and these two PCR fragments were assembled with a Sacl-Pstl fragment from pB1221 (Clontech), which comprised the pUC19 vector backbone and the nopaline synthase terminator. Assembly of these fragments generated pSOGl9, which contains the 35S promoter in fusion with the intron 6 sequence, the GUS
leader, the DHFR
gene and the nopaline synthase terminator. Replacement of the GUS leader in pSOGl9 with the leader sequence from Maize Chlorotic Mottle Virus (MCMV) generated the vector pSOG35. pSOGl9 and pSOG35 carry the pUC gene for ampicillin resistance and have Hindlll, Sphl, Pstl and EcoRl sites available for the cloning of foreign sequences.
4. Example 22: Construction of Plant Expression Cassettes Gene sequences intended for expression in transgenic plants are firstly assembled in expression cassettes behind a suitable promoter and upstream of a suitable transcription terminator. These expression cassettes can then be easily transferred to the plant transformation vectors described above in Example 21.
I. Promoter Selection The selection of a promoter used in expression cassettes will determine the spatial and temporal expression pattern of the transgene in the transgenic plant.
Selected promoters will express transgenes in specific cell types (such as leaf epidermal cells, mesophyll cells, root cortex cells) or in specific tissues or organs (roots, leaves or flowers, for example) and this selection will reflect the desired location of expression of the transgene. Alternatively, the selected promoter may drive expression of the gene under a light-induced or other temporally regulated promoter. A further alternative is that the selected promoter be chemically regulated. This would provide the possibility of inducing expression of the transgene only when desired and caused by treatment with a chemical inducer.
II. Transcriptional Terminators A variety of transcriptional terminators are available for use in expression cassettes.
These are responsible for the termination of transcription beyond the transgene and its correct polyadenylation. Appropriate transcriptional terminators are those that are known to function in plants and include the CaMV 35S terminator, the tml terminator, the nopaline synthase terminator, the pea rbcS E9 terminator, as well as terminators naturally associated with the plant protox gene (i.e. "protox terminators"). These can be used in both monocotyledons and dicotyledons.
III. Sequences for the Enhancement or Regulation of Expression Numerous sequences have been found to enhance gene expression from within the transcriptional unit and these sequences can be used in conjunction with the genes of this invention to increase their expression in transgenic plants.
Various intron sequences have been shown to enhance expression, particularly in monocotyledonous cells. For example, the introns of the maize Adh 1 gene have been found to significantly enhance the expression of the wild-type gene under its cognate promoter when introduced into maize cells. Intron 1 was found to be particularly effective and enhanced expression in fusion constructs with the chloramphenicol acetyltransferase gene (Callis et al., Genes Develop. 1: 1183-1200 (1987)). In the same experimental system, the intron from the maize bronzes gene had a similar effect in enhancing expression (Callis et al., supra). Intron sequences have been routinely incorporated into plant transformation vectors, typically within the non-translated leader.
A number of non-translated leader sequences derived from viruses are also known to enhance expression, and these are particularly effective in dicotyledonous cells.
Specifically, leader sequences from Tobacco Mosaic Virus (TMV, the "W-sequence"), Maize Chlorotic Mottle Virus (MCMV), and Alfalfa Mosaic Virus (AMV) have been shown to be effective in enhancing expression (e.g. Gallie et al. Nucl. Acids Res. 15:
8693-8711 (1987);
Skuzeski et al. Plant Molec. Biol. 15: 65-79 (1990)) IV. Targeting of the Gene Product Within the Cell Various mechanisms for targeting gene products are known to exist in plants and the sequences controlling the functioning of these mechanisms have been characterized in some detail. For example, the targeting of gene products to the chloroplast is controlled by a signal sequence that is found at the amino terminal end of various proteins and that is cleaved during chloroplast import yielding the mature protein (e.g. Comas et al. J. BioL
Chem. 263: 15104-15109 (1988)). These signal sequences can be fused to heterologous gene products to effect the import of heterologous products into the chloroplast (van den Broeck et al. Nature 313: 358-363 (1985)). DNA encoding for appropriate signal sequences can be isolated from the 5' end of the cDNAs encoding the RUBISCO protein, the CAB
protein, the EPSP synthase enzyme, the GS2 protein and many other proteins that are known to be chloroplast localized.
Other gene products are localized to other organelles such as the mitochondrion and the peroxisome (e.g. Unger et al. Plant Molec. Biol. 13: 411-418 (1989)). The cDNAs encoding these products can also be manipulated to effect the targeting of heterologous gene products to these organelles. Examples of such sequences are the nuclear-encoded ATPases and specific aspartate amino transferase isoforms for mitochondria.
Targeting to _78_ cellular protein bodies has been described by Rogers et al., Proc. Nat). Acad.
Sci. USA 82.
6512-6516 (1985)).
In addition, sequences have been characterized that cause the targeting of gene products to other cell compartments. Amino terminal sequences are responsible for targeting to the ER, the apoplast, and extracellular secretion from aleurone cells (Koehler &
Ho, Plant Cell2: 769-783 (1990)). Additionally, amino terminal sequences in conjunction with carboxy terminal sequences are responsible for vacuolar targeting of gene products (Shinshi et al., Plant Molec. Biol. 14: 357-368 (1990)).
By the fusion of the appropriate targeting sequences described above to transgene sequences of interest it is possible to direct the transgene product to any organelle or cell compartment. For chloroplast targeting, for example, the chloroplast signal sequence from the RUBISCO gene, the CAB gene, the EPSP synthase gene, or the GS2 gene is fused in frame to the amino terminal ATG of the transgene. The signal sequence selected should include the known cleavage site and the fusion constructed should take into account any amino acids after the cleavage site that are required for cleavage. In some cases this requirement may be fulfilled by the addition of a small number of amino acids between the cleavage site and the transgene ATG or alternatively replacement of some amino acids within the transgene sequence. Fusions constructed for chloroplast import can be tested for efficacy of chloroplast uptake by in vitro translation of in vitro transcribed constructions followed by in vitro chloroplast uptake using techniques described by (Bartlett et al. In:
Edelmann et al. (Eds.) Methods in Chloroplast Molecular Biology, Elsevier. pp.
(1982); Wasmann et al. Mol. Gen. Genet. 205: 446-453 (1986)). These construction techniques are well known in the art and are equally applicable to mitochondria and peroxisomes. The choice of targeting that may be required for expression of the transgenes will depend on the cellular localization of the precursor required as the starting point for a given pathway. This will usually be cytosolic or chloroplastic, although it may is some cases be mitochondria) or peroxisomal. The products of transgene expression will not normally require targeting to the ER, the apoplast or the vacuole.
The above described mechanisms for cellular targeting can be utilized not only in conjunction with their cognate promoters, but also in conjunction with heterologous promoters so as to effect a specific cell targeting goal under the transcriptional regulation of a promoter that has an expression pattern different to that of the promoter from which the targeting signal derives.
5. Example 23: Transformation of Dicotyledons Transformation techniques for dicotyledons are well known in the art and include Agrobacterium-based techniques and techniques that do not require Agrobacterium. Non-Agrobacterium techniques involve the uptake of exogenous genetic material directly by protoplasts or cells. This can be accomplished by PEG or electroporation mediated uptake, particle bombardment-mediated delivery, or microinjection. Examples of these techniques are described by Paszkowski et al., EMBO J 3: 2717-2722 (1984), Potrykus et aL, Mol.
Gen. Genet. 199: 169-177 (1985), Reich et al., Biotechnology 4: 1001-1004 (1986), and Klein et al., Nature 327 70-73 (1987). In each case the transformed cells are regenerated to whole plants using standard techniques known in the art.
Agrobacterium-mediated transformation is a preferred technique for transformation of dicotyledons because of its high efficiency of transformation and its broad utility with many different species. The many crop species that are routinely transformable by Agrobacterium include tobacco, tomato, sunflower, cotton, oilseed rape, potato, soybean, alfalfa and poplar (EP 0 317 511 (cotton), EP 0 249 432 (tomato, to Calgene), WO 87/07299 (Brassica, to Calgene), US 4,795,855 (poplar)).
Transformation of the target plant species by recombinant Agrobacterium usually involves co-cultivation of the Agrobacterium with explants from the plant and follows protocols well known in the art. Transformed tissue is regenerated on selectable medium carrying the antibiotic or herbicide resistance marker present between the binary plasmid T-DNA borders.
6. Example 24: Transformation of Monocotyledons Transformation of most monocotyledon species has now also become routine.
Preferred techniques include direct gene transfer into protoplasts using PEG
or electroporation techniques, and particle bombardment into callus tissue.
Transformations can be undertaken with a single DNA species or multiple DNA species (i.e. co-transformation) and both these techniques are suitable for use with this invention. Co-transformation may have the advantage of avoiding complex vector construction and of generating transgenic plants with unlinked loci for the gene of interest and the selectable marker, enabling the removal of the selectable marker in subsequent generations, should this be regarded desirable. However, a disadvantage of the use of co-transformation is the less than 100% frequency with which separate DNA species are integrated into the genome (Schocher et al. Biotechnology 4: 1093-1096 (1986)).
Patent Applications EP 0 292 435 (to Ciba-Geigy), EP 0 392 225 (to Ciba-Geigy) and 8 (to Ciba-Geigy) describe techniques for the preparation of callus and protoplasts from an elite inbred line of maize, transformation of protoplasts using PEG or electroporation, and the regeneration of maize plants from transformed protoplasts.
Gordon-Kamm et al., Plant Cell 2: 603-618 (1990)) and Fromm et al., Biotechnology 8: 833-839 (1990)) have published techniques for transformation of A188-derived maize line using particle bombardment. Furthermore, application WO 93/07278 (to Ciba-Geigy) and Koziel et aL, Biotechnology 11: 194-200 (1993)) describe techniques for the transformation of Mite inbred lines of maize by particle bombardment. This technique utilizes immature maize embryos of 1.5-2.5 mm length excised from a maize ear 14-15 days after pollination and a PDS-1000He Biolistics device for bombardment.
Transformation of rice can also be undertaken by direct gene transfer techniques utilizing protoplasts or particle bombardment. Protoplast-mediated transformation has been described for Japonica-types and Indica-types (Zhang et al., Plant Cell Rep 7 (1988); Shimamoto et al. Nature 338: 274-277 (1989); Datta et al.
Biotechnology 8: 736-740 (1990)). Both types are also routinely transformable using particle bombardment (Christou et al. Biotechnology 9: 957-962 (1991 )).
Patent Application EP 0 332 581 (to Ciba-Geigy) describes techniques for the generation, transformation and regeneration of Pooideae protoplasts. These techniques allow the transformation of Dactylis and wheat. Furthermore, wheat transformation was been described by Vasil et al., Biotechnology i0: 667-674 (1992)) using particle bombardment into cells of type C long-term regenerable callus, and also by Vasil et al., Biotechnology 11: 1553-1558 (1993)) and Weeks et al., Plant Physiol. 102. 1077-(1993) using particle bombardment of immature embryos and immature embryo-derived callus. A preferred technique for wheat transformation, however, involves the transformation of wheat by particle bombardment of immature embryos and includes either a high sucrose or a high maltose step prior to gene delivery. Prior to bombardment, any number of embryos (0.75-1 mm in length) are plated onto MS medium with 3%
sucrose (Murashige & Skoog, Physiologia Plantarum 15: 473-497 (1962)) and 3 mg/I 2,4-D
for induction of somatic embryos, which is allowed to proceed in the dark. On the chosen day of bombardment, embryos are removed from the induction medium and placed onto the _81 _ osmoticum (i.e. induction medium with sucrose or maltose added at the desired concentration, typically 15%). The embryos are allowed to plasmolyze for 2-3 h and are then bombarded. Twenty embryos per target plate is typical, although not critical. An appropriate gene-carrying plasmid (such as pCIB3064 or pSG35) is precipitated onto micrometer size gold particles using standard procedures. Each plate of embryos is shot with the DuPont Biolistics~ helium device using a burst pressure of 1000 psi using a standard 80 mesh screen. After bombardment, the embryos are placed back into the dark to recover for about 24 h (still on osmoticum). After 24 hrs, the embryos are removed from the osmoticum and placed back onto induction medium where they stay for about a month before regeneration. Approximately one month later the embryo explants with developing embryogenic callus are transferred to regeneration medium (MS + 1 mg/liter NAA, 5 mg/liter GA), further containing the appropriate selection agent (10 mg/I basta in the case of pCIB3064 and 2 mg/I methotrexate in the case of pSOG35). After approximately one month, developed~shoots are transferred to larger sterile containers known as "GA7s° that contained half-strength MS, 2% sucrose, and the same concentration of selection agent.
Patent application WO 94/13822 describes methods for wheat transformation and is hereby incorporated by reference.
Example 25: Isolation of the Arabidopsis thaliana Protox-1 Promoter Sequence A Lambda Zap II genomic DNA library prepared from Arabidopsis thaliana (Columbia, whole plant) was purchased from Stratagene. Approximately 125,000 phage were plated at a density of 25,000 pfu per 15 cm Petri dish and duplicate lifts were made onto Colony/Plaque Screen membranes (NEN Dupont). The plaque lifts were probed with the Arabidopsis protox-1 cDNA (SEQ ID N0:1 labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization and wash conditions were at 65°C as described in Church and Gilbert, Proc. Natl. Acad. Sci. USA 81: 1991-1995 (1984).
Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. Sequence from the genomic DNA inserts was determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
One clone, AraPT1 Pro, was determined to contain 580-by of Arabidopsis sequence upstream from the initiating methionine (ATG) of the protox-1 protein coding sequence. This clone also contains coding sequence and introns that extend to-by 1241 of the protox-1 cDNA
sequence. The 580-by 5' noncoding fragment is the putative Arabidopsis protox-promoter, and the sequence is set forth in SEQ ID N0:13.
AraPTiPro was deposited December 15, 1995, as pWDC-11 (NRRL #B-21515) Example 26: Construction of Plant Transformation Vectors Expressing Altered Protox-1 Genes Behind the Native Arabidopsis Protox-1 Promoter A full-length cDNA of the appropriate altered Arabidopsis protox-1 cDNA was isolated as an EcoRl Xhol partial digest fragment and cloned into the plant expression vector pCGN1761 ENX (see Example 9 of International application no. PCT/IB95/00452 filed June 8, 1995, published Dec. 21, 1995 as WO 95/34659). This plasmid was digested with Ncol and BamHl to produce a fragment comprised of the complete protox-1 cDNA plus a transcription terminator from the 3' untranslated sequence of the tml gene of Agrobacterium tumefaciens. The AraPT1 Pro plasmid described above was digested with Ncol and BamHl to produce a fragment comprised of pBluescript and the 580-by putative Arabidopsis protox-1 promoter. Ligation of these two fragments produced a fusion of the altered protox cDNA to the native protox promoter. The expression cassette containing the protox-1 promoter/protox-1 cDNA/tml terminator fusion was excised by digestion with Kpnl and cloned into the binary vector pCIB200. The binary plasmid was transformed by electroporation into Agrobacterium and then into Arabidopsis using the vacuum infiltration method (Bechtold et al., C.R. Acad. Sci. Paris 316: 1194-1199 (1993).
Transformants expressing altered protox genes were selected on kanamycin or on various concentrations of protox inhibiting herbicide.
Example 27: Production of Herbicide Tolerant Plants by Expression of a Native Protox-1 Promoter/Altered Protox-1 Fusion Using the procedure described above, an Arabidopsis protox-1 cDNA containing a TAC to ATG (Tyrosine to Methionine) change at nucleotides 1306-1308 in the protox-1 sequence (SEQ ID N0:1 ) was fused to the native protox-1 promoter fragment and transformed into Arabidopsis thaliana. This altered protox-1 enzyme (AraC-2Met) has been shown to be >10-fold more tolerant to various protox-inhibiting herbicides than the naturally occurring enzyme when tested in the previously described bacterial expression system.
Seed from the vacuum infiltrated plants was collected and plated on a range (lO.OnM-1.OuM) of a protox inhibitory aryluracil herbicide of formula XVII. Multiple experiments with wild type Arabidopsis have shown that a lO.OnM concentration of this compound is sufficient to prevent normal seedling germination. Transgenic seeds expressing the AraC-2Met altered enzyme fused to the native protox-1 promoter produced normal Arabidopsis seedlings at herbicide concentrations up to 500nM, indicating at least 50-fold higher herbicide tolerance when compared to wild-type Arabidopsis. This promoter/altered protox enzyme fusion therefore functions as an effective selectable marker for plant transformation. Several of the plants that germinated on 100.OnM of protox-inhibiting herbicide were transplanted to soil, grown 2-3 weeks, and tested in a spray assay with various concentrations of the protox-inhibiting herbicide. When compared to empty vector control transformants, the AraPT1 Pro/AraC-2Met transgenics were >10-fold more tolerant to the herbicide spray.
EXAMPLE 28: Demonstration of resistant mutations' cross-tolerance to various protox inhibiting compounds in an Arabidopsis germination assay.
Using the procedure described above, an Arabidopsis protox-1 cDNA containing both a TAC to ATC (tyrosine to isoleucine) change at nucleotides 1306-1308 and a TCA to TTA
(serine to leucine) change at nucleotides 945-947 in the protox-1 sequence (SEQ ID N0:1 ) was fused to the native protox-1 promoter fragment and transformed into Arabidopsis thaliana. This altered protox-1 enzyme (AraC-211e + AraC305Leu) has been shown to be >10-fold more tolerant to a protox inhibitory aryluracil herbicide of formula XVII than the naturally occurring enzyme when tested in a bacterial system (see Examples 9-13).
Homozygous Arabidopsis lines containing this fusion were generated from transformants that showed high tolerance to a protox inhibiting herbicide in a seedling germination assay as described above. The seed from one line was tested for cross-tolerance to various protox-inhibitory compounds by repeating the germination assay on concentrations of the compounds that had been shown to inhibit germination of wild-type Arabidopsis.
The results from these experiments are shown in Table 4.
7. Example 29: Isolation of a Maize Protox-1 Promoter Sequence A Zea Mays (Missouri 17 inbred, etiolated seedlings) genomic DNA library in the Lambda FIX II vector was purchased from Stratagene. Approximately 250,000 pfu of the library was plated at a density of 50,000 phage per 15 cm plate and duplicate lifts were made onto Colony/Plaque screen membranes (NEN Dupont). The plaque lifts were probed with the maize protox-1 cDNA (SEQ ID N0:5) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization and wash conditions were at 65°C as described in Church and Gilbert, Proc. Natl. Acad. Sci. USA 81: 1991-1995 (1984).
Lambda phage DNA was isolated from three positively hybridizing phage using the Wizard Lambda Preps DNA Purification System (Promega). Analysis by restriction digest, hybridization patterns, and DNA sequence analysis identified a lambda clone containing approximately 3.5 kb of maize genomic DNA located 5' to the maize protox-1 coding sequence previously isolated as a cDNA clone. This fragment includes the maize protox-1 promoter. The sequence of this fragment is set forth in SEQ ID N0:14. From nucleotide 1 to 3532, this sequence is comprised of 5' noncoding sequence. From nucleotide 3533 to 3848, this sequence encodes the 5' end of the maize protox-1 protein.
A plasmid containing the sequence of SEQ ID N0:14 fused to the remainder of the maize protox-1 coding sequence was deposited March 19, 1996 as pWDC-14 (NRRL
#B-21546).
Example 30: Construction of Plant Transformation Vectors Expressing Altered Protox-1 Genes Behind the Native Maize Protox-1 Promoter The 3848-by maize genomic fragment (SEQ ID N0:14) was excised from the isolated lambda phage clone as a Sall Kpnl partial digest product and ligated to a Kpnl-Notl fragment derived from an altered maize protox-1 cDNA that contained an alanine to leucine change at amino acid 164 (SEQ ID N0:6). This created a fusion of the native maize protox-1 promoter to a full length cDNA that had been shown to confer herbicide tolerance in a bacterial system (Examples 9-14). This fusion was cloned into a pUCl8 derived vector containing the CaMV 35S terminator sequence to create a protox promoter/altered protox cDNA/terminator cassette. The plasmid containing this cassette was designated pWCo-1.
A second construct for maize transformation was created by engineering the first intron found in the coding sequence from the maize genomic clone back into the maize cDNA. The insertion was made using standard overlapping PCR fusion techniques.
The intron (SEQ ID N0:25) was 93-by long and was inserted between nucleotides 203 and 204 of SEQ ID N0:6, exactly as it appeared in natural context in the lambda clone described in Example 29. This intron-containing version of the expression cassette was designated pWCo-2.
8. Example 31: Demonstration of Maize Protox-1 Promoter Activity in Transgenic Maize Plants Maize plants transformed with maize protox promoter/altered protox fusions were identified using PCR analysis with primers specific for the transgene. Total RNA was prepared from the PCR positive plants and reverse-transcribed using Superscript M-MLV
(Life Technologies) under recommended conditions. Two microliters of the reverse transcription reaction was used in a PCR reaction designed to be specific for the altered protox sequence. While untransformed controls give no product in this reaction, approximately 85% of plants transformed with pWCo-1 gave a positive result, indicating the presence of mRNA derived from the transgene. This demonstrates some level of activity for the maize protox promoter. The RNA's from the transgenic maize plants were also subjected to standard northern blot analysis using the radiolabeled maize protox cDNA
fragment from SEQ ID N0:6 as a probe. Protox-1 mRNA levels significantly above those of untransformed controls were detected in some of the transgenic maize plants.
This elevated mRNA level is presumed to be due to expression of altered protox-1 mRNA from the cloned maize protox promoter.
In the event of transformation of the nuclear genome, signal or transit peptides may be fused to the protox coding sequence in chimeric DNA constructs of the invention to direct transport of the expressed protox enzyme to the desired site of action.
Examples of signal peptides include those natively linked to the plant pathogenesis-related proteins, e.g.
PR-1, PR-2, and the like. See, e.g., Payne et al., Plant Mol. Biol. 1 i:89-94 (1988).
Examples of transit peptides include the chloroplast transit peptides such as those described in Von Heijne et al., Plant Mol. Biol. Rep. 9:104-126 (1991 ); Mazur et al., Plant Physiol. 85: 1110 (1987); Vorst et al., Gene 65: 59 (1988), and mitochondrial transit peptides such as those described in Boutry et al., Nature 328340-342 (1987).
Chloroplast and mitochondria) transit peptides are contemplated to be particularly useful with the present invention as protox enzymatic activity typically occurs within the mitochondria and chloroplast. Most preferred for use are chloroplast transit peptides, as inhibition of the protox enzymatic activity in the chloroplasts is contemplated to be the primary basis for the action of protox-inhibiting herbicides (Witkowski and Halting, Plant Physiol.
87: 632 (1988);
Lehnen et al., Pestic. Biochem. Physiol. 37 239 (1990); Duke et al., Vheed Sci. 39: 465 (1991 )). Also included are sequences that result in localization of the encoded protein to various cellular compartments such as the vacuole. See, for example, Neuhaus et aL, Proc.
Nat). Acad. Sci. USA 88: 10362-10366 (1991) and Chrispeels, Ann. Rev. Plant Physiol.
Plant Mol. Biol. 42. 21-53 (1991 ). The relevant disclosures of these publications are incorporated herein by reference in their entirety.
Chimeric genes of the invention may contain multiple copies of a promoter or multiple copies of the protox structural genes. In addition, the constructs) may include coding sequences for markers and coding sequences for other peptides such as signal or transit peptides, each in proper reading frame with the other functional elements in the DNA
molecule. The preparation of such constructs are within the ordinary level of skill in the art.
lJseful markers include peptides providing herbicide, antibiotic or drug resistance, such as, for example, resistance to hygromycin, kanamycin, 6418, gentamycin, lincomycin, methotrexate, glyphosate, phosphinothricin, or the like. These markers can be used to select cells transformed with the chimeric DNA constructs of the invention from untransformed cells. Other useful markers are peptidic enzymes that can be easily detected by a visible reaction, for example a color reaction, for example luciferase, fi-glucuronidase, or f3-galactosidase.
The method of positive selection of genetically transformed cells into which a desired nucleotide sequence can be incorporated by providing the transformed cells with a selective advantage is herein incorporated by reference as WO 94/20627.
Where a herbicide resistant protox allele is obtained via directed mutation of the native gene in a crop plant or plant cell culture from which a crop plant can be regenerated, it may be moved into commercial varieties using traditional breeding techniques to develop a herbicide tolerant crop without the need for genetically engineering the modified coding sequence and transforming it into the plant. Alternatively, the herbicide resistant gene may be isolated, genetically engineered for optimal expression and then transformed into the desired variety.
Genes encoding altered protox resistant to a protox inhibitor can also be used as selectable markers in plant cell transformation methods. For example, plants, plant tissue or plant cells transformed with a transgene can also be transformed with a gene encoding an altered protox capable of being expressed by the plant. The thus-transformed cells are transferred to medium containing the protox inhibitor wherein only the transformed cells will survive. Protox inhibitors contemplated to be particularly useful as selective agents are the diphenylethers {e.g. acifluorfen, 5-[2-chloro-4-(trifluoromethyl)phenoxy]-2-nitrobezoic acid;
its methyl ester; or oxyfluorfen, 2-chloro-1-(3-ethoxy-4-nitrophenoxy)-4-(trifluorobenzene)}, oxidiazoles, (e.g. oxidiazon, 3-[2,4-dichloro-5-(1-methylethoxy)phenyl]-5-(1,1-dimethylethyl)-1,3,4-oxadiazol-2-(3M-one), cyclic imides (e.g. S-23142, 11(4-chloro-2-fluoro-propargyloxyphenyl)-3,4,5,6-tetrahydrophthalimide; chlorophthalim, 11(4-chlorophenyl)-3,4,5,6-tetrahydrophthalimide), phenyl pyrazoles (e.g. TNPP-ethyl, ethyl 2-[1-(2,3,4-trichlorophenyl)-4-nitropyrazolyl-5-oxy]propionate; M&B 39279), pyridine derivatives (e.g. LS
82-556), and phenopylate and its O-phenylpyrrolidino- and piperidinocarbamate analogs and bicyclic triazolones as disclosed in the International patent application WO 92/04827;
EP 532146).
The method is applicable to any plant cell capable of being transformed with an altered protox-encoding gene, and can be used with any transgene of interest.
Expression of the transgene and the protox gene can be driven by the same promoter functional on plant cells, or by separate promoters.
Modified inhibitor-resistant protox enzymes of the present invention are resistant to herbicides that inhibit the naturally occurring protox activity. The herbicides that inhibit protox include many different structural classes of molecules (Duke et al., Weed Sci. 39:
465 (1991 ); Nandihalli et aG, Pesticide Biochem. Physiol. 43: 193 (1992);
Matringe et al., FEBS Left. 245: 35 (1989); Yanase and Andoh, Pesticide Biochem. Physiol. 35:
70 (1989)), including the diphenylethers {e.g. acifluorifen, 5-[2-chloro-4-(trifluoromethyl)phenoxy]-2-nitrobezoic acid; its methyl ester; or oxyfluorfen, 2-chloro-1-(3-ethoxy-4-nitrophenoxy)-4-(trifluorobenzene)}, oxidiazoles (e.g. oxidiazon, 3-[2,4-dichloro-5-(1-methylethoxy)phenyl]-5-(1,1-dimethylethyl)-1,3,4-oxadiazol-2-(31-i)-one), cyclic imides (e.g. S-23142,11(4-chloro-2-fluoro-5-propargyloxyphenyl)-3,4,5,6-tetrahydrophthalimide; chlorophthalim, Iw(4-chlorophenyl)-3,4,5,6-tetrahydrophthalimide), phenyl pyrazoles (e.g. TNPP-ethyl, ethyl 2-[1-(2,3,4-trichlorophenyl)-4-nitropyrazolyl-5-oxy]propionate; M&B 39279), pyridine derivatives (e.g. LS 82-556), and phenopylate and its a-phenylpyrrolidino- and piperidinocarbamate analogs.
The diphenylethers of particular significance are those having the general formula CI
CF3 ~ ~ O ~ ~ N02 (Formula I) wherein R equals -COONa (Formula II), -CONHS02CH3 (Formula III) or -(Formula IV; see Maigrot et al., Brighton Crop Protection Conference-Weeds: 47-51 (1989)).
Additional diphenylethers of interest are those where R equals:
(Formula IVa; see Hayashi et al., Brighton Crop Protection Conference-Weeds:
(1989)).
An additional diphenylether of interest is one having the formula:
CI
(Formula IVb; bifenox, see Dest et al., Proc. Northeast Weed Sci. Conf. 27: 31 (1973)).
A further diphenylether of interest is one having the formula:
O
(Formula IVc; oxyfluorfen; see Yih and Swithenbank, J. Agric. Food Chem., 23:
592 (1975)) Yet another diphenylether of interest is one having the formula:
i Hs CF3 ~ ~ O N02 CI
(Formula IVd; lactofen, see page 623 of 'The Pesticide Manuah, 10t" ed., ed.
by C. Tomlin, British Crop Protection Council, Surrey (1994)) Also of significance are the class of herbicides known as imides, having the general formula R2 ~ / Q
(Formula V) wherein Q equals I ,N-o (Formula VI) or N' \
S
N
IN- (Formula VII) or c~
CF3 N~O
I N
o (Formula VIII) or C~~ N N-,N
HF2C ~ (Formula IX
) or CI
~C F3 ~N
(Formula IXa) or CI
~OC HF2 ~N
(Formula IXb) (see Hemper et al. (1995) in "Proceedings of the Eighth International Congress of Pesticide Chemistry", Ragdale et al., eds., Amer. Chem. Soc, Washington, D.C., pp.42-48 (1994));
and R, equals H, CI or F, R2 equals CI and R3 is an optimally substituted ether, thioether, ester, amino or alkyl group. Alternatively, R2 and R3 together may form a 5 or 6 membered heterocyclic ring. Examples of imide herbicides of particular interest are F
CI
O
(Formula Vlla; fluthiacet-methyl, see Miyazawa et aL, Brighton Crop Protection Conference-Weeds, pp. 23-28 (1993)) CI o ~N~CHF2 CI ~ ~ N N
J~C
CF~S02NH ~ (Formula X sulfentrazone, see Van Saun et al., Brighton Crop Protection Conference-(Needs, pp. 77-82 (1991 )).
CF3 N~O
N ~ COOCH(Ct-~)2 O
CI (Formula XI) C
(Formula XII) (see Miura et al., Brighton Crop Protection Conference-Nleeds: 35-40 (1993)) N' \
S F
N
INI ~ / CI
scHzCOOCI~ (Formula XIII) O F
\N- ~ / CI
0 ocl-~cooc5H" (Formula XIV) O F
\N ~ / CI
O O-CH C-CH
(Formula XV) O F
\N ~ ~ O
O ~N--~
Hoc-o~ o (Formula XVI) The herbicidal activity of the above compounds is described in the Proceedings of the 1991 Brighton Crop Protection Conference, Weeds (British Crop Protection Council) (Formulae X and XVI), Proceedings of the 1993 Brighton Crop Protection Conference, Weeds (British Crop Protection Council) (Formulae XII and XIII), U.S. Patent No. 4,746,352 (Formula XI) and Abstracts of the Weed Science Society of America vol. 33, pg.
(1993)(Formula XIV).
The most preferred imide herbicides are those classified as aryluracils and having the general formula cl-~
CF3 N~O
I N
O
CI
Coon (Formula XVII) wherein R signifies the group (C2.s-alkenyloxy)carbonyl-C,_4-alkyl, as disclosed in U.S.
Patent No. 5,183,492, herein incorporated by reference.
Also of significance are herbicides having the general formula:
O F
O N N~S~N
N
w (Formula XVIII; thiadiazimin) (see Weiler et al., Brighton Crop Protection Conference-Weeds, pp. 29-34 (1993));
CIC F O
O N
C H.~
(Formula XIX; carfentrazone) (see Van Saun et al., Brighton Crop Protection Conference-lNeeds: pp. 19-22 (1993));
N-substituted pyrazoles of the general formula:
Ri-N~ NiN Ra R
(Formula XX) wherein R, is C,-C4-alkyl, optionally substituted by one or more halogen atoms;
RZ is hydrogen, or a C,-C4-alkoxy, each of which is optionally substituted by one or more halogen atoms, or R, and R2 together from the group -(CH2)~ X-, where X is bound at R2;
R3 is hydrogen or halogen, R4 is hydrogen or C,-C4-alkyl, R5 is hydrogen, nitro, cyano or the group -COOR6 or -CONR~RB, and R6 is hydrogen, C,-C6-alkyl, C2-C6-alkenyl or CZ-C6-alkynyl;
(see international patent publications WO 94/08999, WO 93/10100, and U. S.
Patent No. 5,405,829 assigned to Schering);
N-phenylpyrazoles, such as:
~I
(Formula XXI; nipyraclofen) (see page 621 of 'The Pesticide Manual", 9th ed., ed. by C.R. Worthing, British Crop Protection Council, Surrey (1991 ));
and 3-substituted-2-aryl-4,5,6,7-tetrahydroindazoles (Lyga et al. Pesticide Sci. 42.29-36 (1994)).
N/ \ CI
~N ~ NHC-CH-CH3 O
CI CI
(Formula XXIa; BAY 11340) Also of significance are phenylpyrazoles of the type described in WO 96/01254 and WO 97/00246, both of which are hereby incorporated by reference. (Formula XXII).
Also of significance are pyridyl pyrazoles such as the following:
F CI
/~ ,~~F
CI , ~N~N\ F
(Formula XXllla) (Formula XXlllb) Also of significance are phenylpyrazoles having the general formula:
C- OPr-i Cl Me ' /
N
g3 C Sr (Formula XXIV: Fluazolate) (see Prosch, S. D. et al., Brighton Crop Protection Conference-Weeds: pp. 45-50 (1997), (Vol. 1 )) Additional compounds of significance are described in W098/33927 and US patent 5,856,495, both of which are incorporated herein by reference in their entirety.
Levels of herbicide that normally are inhibitory to the activity of protox include application rates known in the art, and that depend partly on external factors such as environment, time and method of application. For example, in the case of the imide herbicides represented by Formulae V through IX, and more particularly those represented by Formulae X through XVII, the application rates range from 0.0001 to 10 kg/ha, preferably from 0.005 to 2 kg/ha. This dosage rate or concentration of herbicide may be different, depending on the desired action and particular compound used, and can be determined by methods known in the art.
A further object of the invention is a method for controlling the growth of undesired vegetation that comprises applying to a population of the plant selected from a group consisting of Arabidopsis, sugar cane, soybean, barley, cotton, tobacco, sugar beet, oilseed rape, maize, wheat, sorghum, rye, oats, turf and forage grasses , millet, forage and rice and the like an effective amount of a protox-inhibiting herbicide. Preferred is a method for controlling the growth of undesired vegetation, which comprises applying to a population of the selected from the group consisting of selected from the group consisting of soybean, cotton, tobacco, sugar beet, oilseed rape, maize, wheat, sorghum, rye, oats, turf grasses and rice an effective amount of a protox-inhibiting herbicide. Particularly preferred is a method for controlling the growth of undesired vegetation, which comprises applying to a population of the selected from the group consisting of Arabidopsis, soybean, cotton, sugar beet, oilseed rape, maize, wheat, sorghum, and rice.
The present invention further encompasses a chimeric gene comprising a promoter capable of expression in a plant plastid operatively linked to a DNA molecule of the present invention. A preferred promoter capable of expression in a plant plastid is a promoter isolated from the 5' flanking region upstream of the coding region of a plastid gene, which may come from the same or a different species, and the native product of which is typically found in a majority of plastid types including those present in non-green tissues. Examples of such promoters are promoters of clpP genes, such as the tobacco clpP gene promoter (WO 97/06250, incorporated herein by reference) and the Arabidopsis clpP gene promoter (U.S. Application No. 09/038,878, incorporated herein by reference). Other promoters that are capable of expressing a DNA molecule in plant plastids are promoters recognized by viral RNA polymerases. Preferred promoters of this type are promoters recognized by a single sub-unit RNA polymerase, such as the T7 gene 10 promoter, which is recognized by the bacteriophage T7 DNA-dependent RNA polymerase. Yet another promoter that is capable of expressing a DNA molecule in plant plastids comes from the regulatory region of the plastid 16S ribosomal RNA operon (Harris et al., Microbiol. Rev. 58:700-754 (1994), Shinozaki et al., EMBO J. 5:2043-2049 (1986), both of which are incorporated herein by reference). The gene encoding the T7 polymerase is preferably transformed into the nuclear genome and the T7 polymerase is targeted to the plastids using a plastid transit peptide. Expression of the DNA molecules in the plastids can be constitutive or can be inducible. These different embodiment are extensively described in WO
98/11235, incorporated herein by reference. The chimeric gene preferably further comprises a 5' untranslated sequence (5' UTR) functional in plant plastids and a plastid gene 3' untranslated sequence (3' UTR) operatively linked to a DNA molecule of the present invention. Preferably, the 3' UTR is a plastid rpsl6 gene 3' untranslated sequence. In a further embodiment, the chimeric gene comprises a poly-G tract instead of a 3' untranslated sequence.
The present invention also encompasses a plastid transformation vector comprising the chimeric gene described above and flanking regions for integration into the plastid genome by homologous recombination. The plastid transformation vector may optionally comprise at least one chloroplast origin of replication. The present invention also encompasses a plant plastid transformed with such a plastid transformation vector, wherein the DNA molecule is expressible in the plant plastid. The invention also encompasses a plant or plant cell, including the progeny thereof, comprising this plant plastid. In a preferred embodiment, the plant is homoplasmic for transgenic plastids. The plants transformed in the present invention may be monocots or dicots. A preferred monocot is maize and a preferred dicot is tobacco. Other preferred dicots are tomato and potato.
Plastid transformation, in which genes are inserted by homologous recombination into some or all of the several thousand copies of the circular plastid genome present in each plant cell, takes advantage of the enormous copy number advantage over nuclear-expressed genes to permit expression levels that may exceed 10% of the total soluble plant protein. In addition, plastid transformation is desirable because in most plants plastid-encoded traits are not pollen transmissible; hence, potential risks of inadvertent transgene escape to wild relatives of transgenic plants is obviated. Plastid transformation technology is extensively described in U.S. Patent Nos. 5,451,513, 5,545,817, 5,545,818, and 5,576,198;
in PCT Application Nos. WO 95/16783 and WO 97/32977; and in McBride et al., Proc. Nat!.
Acad. Sci. USA 91: 7301-7305 (1994), all of which are incorporated herein by reference.
Plastid transformation via biolistics was achieved initially in the unicellular green alga Chlamydomonas reinhardfii (Boynton et al. (1988) Science 240: 1534-1537, incorporated herein by reference) and this approach, using selection for cis-acting antibiotic resistance loci (spectinomycin/streptomycin resistance) or complementation of non-photosynthetic mutant phenotypes, was soon extended to Nicotiana tabacum (Svab et al. (1990) Proc.
Natl. Acad. Sci. USA 87: 8526-8530, incorporated herein by reference).
The basic technique for tobacco chloroplast transformation involves the particle bombardment of leaf tissue or PEG-mediated uptake of plasmid DNA in protoplasts with regions of cloned plastid DNA flanking a selectable antibiotic resistance marker. The 1 to 1.5 kb flanking regions, termed "targeting sequences," facilitate homologous recombination with the plastid genome and thus allow the replacement or modification of specific regions of the 156 kb tobacco plastid genome. Initially, point mutations in the chloroplast 16S rDNA
and rpsl2 genes conferring resistance to spectinomycin and/or streptomycin were utilized as selectable markers for transformation (Svab, Z., Hajdukiewicz, P., and Maliga, P. (1990) Proc. Natl. Acad. Sci. USA 87, 8526-8530; Staub, J. M., and Maliga, P. (1992) Plant Cell4, 39-45, incorporated herein by reference). This resulted in stable homoplasmic transformants at a frequency of approximately one per 100 bombardments of target leaves.
The presence of cloning sites between these markers allowed creation of a plastid targeting vector for introduction of foreign genes (Staub, J.M., and Maliga, P., EMBO J.
12: 601-606 (1993), incorporated herein by reference). Substantial increases in transformation frequency were obtained by replacement of the recessive rRNA or r-protein antibiotic resistance genes with a dominant selectable marker, the bacterial aadA gene encoding the spectinomycin-detoxifying enzyme aminoglycoside-3'-adenyltransferase (Svab, Z., and Maliga, P. (1993) Proc. Natl. Acad. Sci. USA 90, 913-917, incorporated herein by reference). Previously, this marker had been used successfully for high-frequency transformation of the plastid genome of the green alga Chlamydomonas reinhardtii (Goldschmidt-Clermont, M. (1991 ) Nucl. Acids Res. 19, 4083-4089, incorporated herein by reference). Recently, plastid transformation of protoplasts from tobacco and the moss Physcomitrella patens has been attained using polyethylene glycol (PEG) mediated DNA
uptake (O'Neill et al. (1993) Plant J. 3: 729-738; Koop et al. (1996) Planta 199: 193-201, both of which are incorporated herein by reference).
In a preferred embodiment, the present invention encompasses a chimeric gene comprising a promoter capable of expression in a plant plastid operatively linked to a DNA
molecule isolated from a prokaryote or a eukaryote that encodes a native or modified protox enzyme, such as a DNA molecule that encodes a native or modified wheat, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, or sugar cane protox enzyme.
Such a DNA
molecule is comprised in a plastid transformation vector as described above and plants homoplasmic for transgenic plastid genomes are produced. Expression in plant plastids of a DNA molecule that encodes a modified protox enzyme preferably confers upon the plant tolerance to a herbicide in amounts that inhibit naturally occurring protox activity.
In a further preferred embodiment, the present invention encompasses a chimeric gene comprising (a) a DNA molecule isolated from a plant, which in its native state encodes a polypeptide that comprises a plastid transit peptide, and a mature enzyme that is natively targeted to a plastid of the plant by the plastid transit peptide, wherein the DNA molecule is modified such that it does not encode a functional plastid transit peptide;
and (b) a promoter capable of expressing the DNA molecule in a plastid, wherein the promoter is operatively linked to the DNA molecule. In one preferred embodiment, the transit peptide is mutated and thus does not allow the proper transport of the enzyme encoded by the DNA
molecule to the desired cell compartment, such as the plastid. In another preferred embodiment, a portion of the transit peptide coding sequence or the entire transit peptide coding sequence is removed from the DNA molecule, preventing the enzyme from being properly targeted to the desired cell compartment.
The chimeric genes described above are inserted in plastid transformation vectors, and the present invention is therefore also directed to plants having their plastid genome transformed with such vectors, whereby the DNA molecule is expressible in plant plastids.
Such plants are preferably homoplasmic for transgenic plastids.
In a preferred embodiment, a DNA molecule described immediately above encodes an enzyme that in its wild-type form is inhibited by a herbicide. In a further preferred embodiment, the DNA molecule encodes an enzyme that in its wild-type form is inhibited by a herbicide, but that comprises at least one amino acid change compared to the wild-type enzyme. Such an amino acid change makes the enzyme resistant to compounds that naturally inhibit the wild-type enzyme. In a further preferred embodiment, the DNA molecule encodes an enzyme having protoporphyrinogen oxidase (protox) activity. In a further preferred embodiment, the transit peptide is removed from the DNA molecule as further illustrated in Examples 37-42. Plants homoplasmic for transgenic plastids of the invention are resistant to high amounts of herbicides such as Formula XVII that inhibit the naturally occurring protox activity (as further illustrated in Example 44).
In another preferred embodiment, the transit peptide of a DNA molecule encoding a 5-enolpyruvyl-3-phosphoshikimate synthase (EPSP synthase) is mutated or removed.
The resulting DNA molecule is fused to a promoter capable of expression in plant plastids and homoplasmic plants harboring such constructs in their plastid genomes are obtained. These plants are resistant to herbicidal compounds that naturally inhibit EPSP
synthase, in particular glyphosate. In another preferred embodiment, the transit peptide of a DNA
molecule encoding a acetolactate synthase (ALS) is mutated or removed. The resulting DNA molecule is fused to a promoter capable of expression in plant plastids and homoplasmic plants harboring such constructs in their plastid genome are obtained. These plants are resistant to herbicidal compounds that naturally inhibit ALS, in particular sulfonylureas. In another preferred embodiment, the transit peptide of a DNA
molecule encoding a acetoxyhydroxyacid synthase (AHAS) is mutated or removed. The resulting DNA molecule is fused to a promoter capable of expression in plant plastids and homoplasmic plants harboring such constructs in their plastid genome are obtained. These plants are resistant to herbicidal compounds that naturally inhibit AHAS, in particular, imidazolinone and sulfonamide herbicides. In another preferred embodiment, the transit peptide of a DNA molecule encoding an acetylcoenzyme A carboxylase (ACCase) is mutated or removed. The resulting DNA molecule is fused to a promoter capable of expression in plant plastids and homoplasmic plants harboring such constructs in their plastid genome are obtained. These plants are resistant to herbicidal compounds that naturally inhibit ACCase, in particular cyclohexanedione and arylphenoxypropanoic acid herbicides. In another preferred embodiment, the transit peptide of a DNA
molecule encoding a glutamine synthase (GS) is mutated or removed. The resulting DNA
molecule is fused to a promoter capable of expression in plant plastids and homoplasmic plants harboring such constructs in their plastid genome are obtained. These plants are resistant to herbicidal compounds that naturally inhibit GS, in particular phosphinothricin and methionine sulfoximine.
The present invention is also further directed to a method of obtaining herbicide-resistant plants by transforming their plastid genome with a chimeric gene comprising (a) a DNA molecule isolated from a plant, which in its native state encodes a polypeptide that comprises a plastid transit peptide, and a mature enzyme that is natively targeted to a plastid of the plant by the plastid transit peptide, wherein the DNA molecule is modified such that it does not encode a functional plastid transit peptide; and (b) a promoter capable of expressing the DNA molecule in a plastid, wherein the promoter is operatively linked to the DNA molecule. Examples of enzymes that are used in the present invention are cited immediately above, but the applicability of such a method is not limited to the cited examples.
The present invention is still further directed to a novel method for selecting a transplastomic plant cell, comprising the steps of: introducing the above-described chimeric gene into the plastome of a plant cell; expressing the encoded enzyme in the plastids of the plant cell; and selecting a cell that is resistant to a herbicidal compound that naturally inhibits the activity of the enzyme, whereby the resistant cell comprises transformed plastids. In a preferred embodiment, the enzyme is naturally inhibited by a herbicidal compound and the transgenic plant is able to grow on an amount of the herbicidal compound that naturally inhibits the activity of the enzyme. In a further preferred embodiment, the enzyme has protoporphyrinogen oxidase (protox) activity and is modified so that it that confers resistance to protox inhibitors.
A further aspect of the present invention is a novel method for plastid transformation of recalcitrant plants. The methods pioneered for plastid transformation of tobacco and lower plant species rely on non-lethal selection for resistance to antibiotics that preferentially affect the plastid translational apparatus and hence allow photo-heterotrophic transformants to outgrow heterotrophic, non-transformed tissue.
Several factors have likely contributed to the difficulties encountered with plastid transformation of monocots and other dicots. For example, the maize chloroplast 16S
ribosomal RNA (rRNA) is naturally resistant to spectinomycin because of the presence of a G at position 1138 in the Zea mays 16S rDNA gene (Harris et aG, 1994). Thus, utilization of 16s rRNA point mutations that confer spectinomycin and/or streptomycin resistance which have been used successfully as selectable chloroplast markers in Chlamydomonas and tobacco (Boynton and Gillham (1993) In Wu, R. [Ed.] Methods in EnzymologyVol 217.
Academic Press, San Diego, pp. 510-536; Svab et al. (1990) Proc. Natl. Acad.
Sci. U.S.A.
87: 8526-8530) is not feasible for maize. Natural spectinomycin and streptomycin resistance in maize also obviates the use of the bacterial aadA gene encoding aminoglycoside 3"-adenyltransferase, which results in dominant spectinomycin and streptomycin resistance and allows a 100-fold increase in tobacco chloroplast transformation efficiency (Svab and Maliga (1993) Proc. Natl. Acad Sci. U.S.A.
90: 913-917). Use of kanamycin (the only other antibiotic proven to be useful for chloroplast transformation) is also problematic due to a large excess (ca. 50:1 ) of nuclear vs.
chloroplast-encoded resistance in tobacco following bombardment of the bacterial nptll gene encoding neomycin phosphotransferase (Carrer et al. (1993) MoL Gen.
Genet. 241:
49-56). This has been shown to result from both a high frequency of spontaneous nuclear resistance mutants as well as integration of nptll into the nuclear genome.
Since nptll is also a highly effective selectable marker for maize nuclear transformation it is reasonable to expect similar background levels to that observed in tobacco. Spontaneous resistance and a significant excess of selectable marker integration by random, illegitimate recombination into the nuclear genome, rather than homologous integration into the chloroplast genome, would make recovery of bona fide chloroplast transformants difficult if not impossible.
A more fundamental reason for the difficulties encountered with plastid transformation in plant species other than tobacco may have to do with the non-photosynthetic nature of many regenerable cultured plant tissues, especially in maize and Arabidopsis. Tobacco is an exception in that cultured vegetative tissues are regenerable and contain mature differentiated chloroplasts that are photosynthetically competent in the presence of sucrose. Consequently, the current system for selecting tobacco plastid transformants relies on the faster growth rate of transformed cells that can use both reduced and inorganic carbon sources. Moreover, transformed cells do not suffer the chloroplast membrane damage that results from inhibition of plastid protein synthesis in the light. This expression of selectable markers that act preferentially on photosynthetic cells, driven by promoters that have high activity in differentiated chloroplasts, is unlikely to work in non-green tissues containing proplastids (e.g. dark-grown maize Type I
callus, somatic embryos) or amyloplasts/leucoplasts (e.g. Arabidopsis root cultures). Plastid transformation in these plants requires a selectable marker that gives strong selection in all plastid types.
A preferred selectable marker for generalized plastid transformation: (1 ) is active only in the plastid to eliminate nuclear-transformed "escapes; (2) has a mode of action that does not depend on photosynthetic competence or the presence of fully differentiated chloroplasts; and (3) has a level of resistance that is co-dependent on an adjustable external parameter (e.g. light), rather than being determined solely by the bulk concentration of a selective agent, so that selection pressure can vary during selection to facilitate segregation of the many-thousand plastid genome copies.
In a preferred embodiment, such a selectable marker gene involves the use of a chimeric gene comprising an isolated DNA molecule encoding a plastid-targeted enzyme having in its natural state a plastid transit peptide, wherein the DNA
molecule is modified such that the transit peptide either is absent or does not function to target the enzyme to the plastid, wherein the DNA molecule is operatively linked to a promoter capable of expression in plant plastids. In a preferred embodiment, a DNA molecule of the present invention encodes an enzyme that is naturally inhibited by a herbicide. In another preferred embodiment, the DNA molecule encodes a protoporphyrinogen IX oxidase ("protox"). In a preferred embodiment, the protoporphyrinogen IX oxidase gene is from Arabidopsis thaliana and in a more preferred embodiment, the protoporphyrinogen IX oxidase gene is from Arabidopsis thaliana and comprises at least one amino acid substitution.
Preferably, an amino acid substitution results in tolerance of the enzyme against inhibition by an herbicide which naturally inhibits the activity of the enzyme. Low concentrations of herbicide are thought to kill wildtype plants due to light-sensitive intermediates which build up when the plastid-localized protox enzyme is inhibited. Production of these photosensitizing compounds does not require differentiated chloroplasts or active photosynthesis, which is a key factor for successful plastid transformation of plants whose regenerable cultured tissues are of non-photosynthetic nature.
Another key feature is to have expression of the selectable marker gene in non-green plastids. In a preferred embodiment, the invention encompasses the use of promoters that are capable of expression of operatively linked DNA molecules in plastids of both green and non-green tissue. In particular, one such promoter comes from the regulatory region of the plastid 16S ribosomal RNA operon. Another candidate is the promoter and 5' UTR
from the plastid clpP gene. The clpP gene product is expressed constitutively in plastids from all plant tissues, including those that do not contain chloroplasts (Shanklin (1995) Plant Cell7:
1713-22).
Other DNA molecules may be co-introduced in plant plastids using the method described above. In a preferred embodiment, a plastid transformation vector of the present invention contains a chimeric gene allowing for selection of transformants as described above and at least one other gene fused to a promoter capable of expression in plant plastids. The other such gene may, for example, confer resistance to insect pests, or to fungal or bacterial pathogens, or may encode one or more value-added traits.
BRIEF DESCRIPTION OF THE SEQUENCES IN THE SEQUENCE LISTING
SEQ ID N0:1: DNA coding sequence for an Arabidopsis thaliana protox-1 protein.
SEQ ID N0:2: Arabidopsis protox-1 amino acid sequence encoded by SEQ ID N0:1.
SEQ ID N0:3: DNA coding sequence for an Arabidopsis thaliana protox-2 protein.
SEQ ID N0:4: Arabidopsis protox-2 amino acid sequence encoded by SEQ ID N0:3.
SEQ ID N0:5: DNA coding sequence for a maize protox-1 protein.
SEQ ID N0:6: Maize protox-1 amino acid sequence encoded by SEQ ID N0:5.
SEQ ID N0:7: DNA coding sequence for a maize protox-2 protein.
SEQ ID N0:8: Maize protox-2 amino acid sequence encoded by SEQ ID N0:7.
SEQ ID N0:9: Partial DNA coding sequence for a wheat protox-1 protein.
SEQ ID N0:10: Partial wheat protox-1 amino acid sequence encoded by SEQ ID
N0:9.
SEQ ID N0:11: DNA coding sequence for a soybean protox-1 protein.
SEQ ID N0:12: Soybean protox-1 protein encoded by SEQ ID N0:11.
SEQ ID N0:13: Promoter sequence from Arabidopsis thaliana protox-1 gene.
SEQ ID N0:14: Promoter sequence from maize protox-1 gene.
SEQ ID N0:15: DNA coding sequence for a cotton protox-1 protein.
SEQ ID N0:16: Cotton protox-1 amino acid sequence encoded by SEQ ID N0:15.
SEQ ID N0:17: DNA coding sequence for a sugar beet protox-1 protein.
SEQ ID N0:18: Sugar beet protox-1 amino acid sequence encoded by SEQ ID N0:17.
SEQ ID N0:19: DNA coding sequence for an oilseed rape protox-1 protein.
SEQ ID N0:20: Oilseed rape protox-1 amino acid sequence encoded by SEQ ID
N0:19.
SEQ ID N0:21: Partial DNA coding sequence for a rice protox-1 protein.
SEQ ID N0:22: Partial rice protox-1 amino acid sequence encoded by SEQ ID
N0:21.
SEQ ID N0:23: Partial DNA coding sequence for a sorghum protox-1 protein.
SEQ ID N0:24: Partial sorghum protox-1 amino acid sequence encoded by SEQ ID
N0:23.
SEQ ID N0:25: Maize protox-1 intron sequence.
SEQ ID N0:26: Promoter sequence from sugar beet protox-1 gene.
SEQ ID N0:27: Pclp-P1 a - plastid clpP gene promoter top strand PCR primer.
SEQ ID N0:28: Pclp P1 b - plastid clpP gene promoter bottom strand PCR primer.
SEQ ID N0:29: Pclp_P2b - plastid clpP gene promoter bottom strand PCR primer.
SEQ ID N0:30: Trpsl6_P1a - plastid rpsl6 gene top strand PCR primer.
SEQ ID N0:31: Trpsl6_p1 b - plastid rpsl6 gene bottom strand PCR primer.
SEQ ID N0:32: minpsb_U - plastid psbA gene top strand primer.
SEQ ID N0:33: minpsb_L - plastid psbA gene bottom strand primer.
SEQ ID N0:34: APRTXP1 a - top strand PCR primer.
SEQ ID N0:35: APRTXP1 b - bottom strand PCR primer.
SEQ ID N0:36: Partial DNA coding sequence for a sugar cane protox-1 protein.
SEQ ID N0:37: Partial sugar cane protox-1 amino acid sequence encoded by SEQ
ID N0:36.
1. DEPOSITS
The following vector molecules have been deposited with Agricultural Research Service, Patent Culture Collection (NRRL), Northern Regional Research Center, 1815 North University Street, Peoria, Illinois 61604, U.S.A on the dates indicated below:
Wheat protox-1 a, in the pBluescript SK vector, was deposited March 19, 1996, as pWDC-13 (NRRL #B21545).
Soybean protox-1, in the pBluescript SK vector, was deposited December 15, 1995 as pWDC-12 (NRRL #B-21516).
Cotton protox-1, in the pBluescript SK vector, was deposited July 1, 1996 as pW DC-15 (NRRL #B-21594).
Sugar beet protox-1, in the pBluescript SK vector, was deposited July 29, 1996, as pWDC-16 (NRRL #B-21595N).
Oilseed rape protox-1, in the pBluescript SK vector, was deposited August 23, 1996, as pWDC-17 (NRRL #B-21615).
Rice protox-1, in the pBluescript SK vector, was deposited December 6, 1996, as pWDC-18 (NRRL #B-21648).
Sorghum protox-1, in the pBluescript SK vector, was deposited December 6, 1996, as pWDC-19 (NRRL #B-21649).
Resistant mutant pAraC-2Cys, in the pMut-1 plasmid, was deposited on November 14, 1994 under the designation pWDC-7 with the Agricultural Research Culture Collection and given the deposit designation NRRL #21339N.
AraPT1 Pro containing the Arabidopsis protox-1 promoter was deposited December 15, 1995, as pWDC-11 (NRRL #B-21515) A plasmid containing the maize protox-1 promoter fused to the remainder of the maize protox-1 coding sequence was deposited March 19, 1996 as pWDC-14 (NRRL #B-21546).
A plasmid containing the sugar beet protox-1 promoter was deposited December 6, 1996, as pWDC-20 (NRRL #B-21650).
EXAMPLES
The invention will be further described by reference to the following detailed examples. These examples are provided for purposes of illustration only, and are not intended to be limiting unless otherwise specified. Standard recombinant DNA
and molecular cloning techniques used here are well known in the art and are described by Ausubel (ed.), Current Protocols in Molecular Biology, John Wiley and Sons, Inc. (1994); T.
Maniatis, E. F. Fritsch and J. Sambrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor laboratory, Cold Spring Harbor, NY (1989); and by T.J. Silhavy, M.L. Berman, and L.W. Enquist, Experiments with Gene Fusions, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1984).
Section A. Isolation And Characterization Of Plant Protoporphyrinogen Oxidase (Protox) Genes Example 1: Isolation of a Wheat Protox-1 cDNA Based on Sequence Homology to a Maize Protox-1 Coding Sequence Total RNA prepared from Triticum aestivum (cv Kanzler) was submitted to Clontech for custom cDNA library construction in the Lambda Uni-Zap vector.
Approximately 50,000 pfu of the cDNA library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell). The plaque lifts were probed with the maize protox-1 cDNA (SEQ ID
N0:5; see Example 2 of International application no. PCT/IB95/00452, filed June 8, 1995, published Dec. 21, 1995 as WO 95/34659) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M
NaP04 pH 7.0, 1 mM EDTA at 50 C. Wash conditions were 2X SSC, 1 % SDS at 50 C.
(Church and Gilbert, Proc. Natl. Acad. Sci. USA 8i: 1991-1995 (1984), hereby incorporated by reference in its entirety.) Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.). The longest wheat protox-1 cDNA obtained from initial screening efforts, designated °wheat protox-1 °, was 1489-by in length. Wheat protox-1 lacks coding sequence for the transit peptide plus approximately 126 amino acids of the mature coding sequence based on comparison with the other known plant protox peptide sequences.
A second screen was performed to obtain a longer wheat protox cDNA. For this screen, a Triticum aestivum (cv Kanzler) cDNA library was prepared internally using the lambda Uni-Zap vector. Approximately 200,000 pfu of the cDNA library was screened as indicated above, except that the wheat protox-1 cDNA was used as a probe and hybridization and wash conditions were at 65 C instead of 50 C. The longest wheat cDNA
obtained from this screening effort, designated "wheat protox-1a", was 1811-by in length.
The nucleotide sequence of this cDNA and the amino acid sequence it encodes are set forth in SEQ ID NOs:9 and 10, respectively. Based on comparison with the other known plant protox peptide sequences and with corresponding genomic sequence, this cDNA is either full-length or missing only a few transit peptide codons (Table 1 A).
This wheat protein sequence is 91 % identical (95% similar) to the maize protox-1 protein sequence set forth in SEQ ID N0:6.
Wheat protox-1a, in the pBluescript SK vector, was deposited March 19, 1996, as pWDC-13 (NRRL #B21545).
Example 2: Isolation of a Soybean Protox-1 cDNA Based on Sequence Homology to an Arabidopsis Protox-1 Coding Sequence A Lambda Uni-Zap cDNA library prepared from soybean (v Williams 82, epicotyls) was purchased from Stratagene. Approximately 50,000 pfu of the library was plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto Colony/Plaque Screen membranes (NEN Dupont). The plaque lifts were probed with the Arabidopsis protox-1 cDNA (SEQ ID N0:1; see Example 1 of International application no. PCT/IB95/00452, filed June 8, 1995, published Dec. 21, 1995 as WO
95/34659)) labeled with 32P-dCTP by the random priming method (Life Technologies).
Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA
at 50 C. Wash conditions were 2X SSC, 1 % SDS at 50 C. (Church and Gilbert (1984)).
Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids.
The sequence of the cDNA inserts was determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
The longest soybean cDNA obtained, designated "soybean protox-1 ~, is full-length based on comparison with the other known plant protox peptide sequences (Table 1 A). Soybean protox-1 is 1847-by in length and encodes a protein of 58.8 kDa. The nucleotide sequence of this cDNA and the amino acid sequence it encodes are set forth in SEQ ID NOs:l1 and 12, respectively. The soybean protein is 78% identical (87% similar) to the Arabidopsis protox-1 protein.
Soybean protox-1, in the pBluescript SK vector, was deposited December 15, 1995 as pWDC-12 (NRRL #B-21516).
Example 3: Isolation of a Cotton Protox-1 cDNA Based on Sequence Homology to a Maize Protox-1 Coding Sequence A Lambda Uni-Zap cDNA library prepared from Gossypium hirsutum L. (72 hr. dark grown cotyledons) was obtained from Dr. Dick Trelease, Dept. of Botany, Arizona State University (Ni W. and Trelease R.N., Arch. Biochem. Biophys. 289: 237-243 (1991 )).
Approximately 50,000 pfu of the library was plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto Colony/Plaque Screen membranes (NEN Dupont). The plaque lifts were probed with the maize protox-1 cDNA
(SEQ ID N0:5) labeled with 32P-dCTP by the random priming method (Life Technologies).
Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH
7.0, 1 mM EDTA at 50 C. Wash conditions were 2X SSC, 1 % SDS at 50 C. (Church and Gilbert (1984)). Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequence of the cDNA inserts was determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
The longest cotton cDNA obtained, designated "cotton protox-1 ", appears to be full-length based on comparison with the other known plant protox peptide sequences (Table 1A).
Cotton protox-1 is 1826-by in length and encodes a protein of 58.2 kDa. The nucleotide sequence of this cDNA and the amino acid sequence it encodes are set forth in SEQ ID
NOs:l3 and 14, respectively. The cotton protein is 77% identical (86% similar) to the maize protox-1 protein.
Cotton protox-1, in the pBluescript SK vector, was deposited July 1, 1996 as pWDC-15 (NRRL #B-21594).
Example 4: Isolation of a Sugar Beet Protox-1 cDNA Based on Sequence Homology to an Arabidopsis Protox-1 Coding Sequence A Lambda-Zap cDNA library prepared from Beta vulgaris was obtained from Dr.
Philip Rea, Dept. of Botany, Plant Science Institute, Philadelphia, PA (Yongcheol Kim, Eugene J.
Kim, and Philip A. Rea, Plant Physiol. 106: 375-382 (1994)). Approximately 50,000 pfu of the cDNA library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell).
The plaque lifts were probed with the Arabidopsis protox-1 cDNA (SEQ ID N0:1 ) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50 C.
Wash conditions were 2X SSC, 1 % SDS at 50 C. (Church and Gilbert (1984)).
Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
The longest sugar beet protox-1 cDNA obtained, designated "sugar beet protox-1 ", is full-length based on comparison with the other known plant protox peptide sequences (Table 1A).
Sugar beet protox-1 is 1910-by in length and encodes a protein of 60 kDa. The nucleotide sequence of this cDNA and the amino acid sequence it encodes are set forth in SEQ ID
NOs:l5 and 16, respectively. The sugar beet protein is 73% identical (82%
similar) to the Arabidopsis protox-1 protein.
Sugar beet protox-1, in the pBluescript SK vector, was deposited July 29, 1996, as pWDC-16 (NRRL #B-21595N).
Example 5: Isolation of an Oilseed Rape Protox-1 cDNA Based on Sequence Homology to an Arabidopsis Protox-1 Coding Sequence A Lambda Uni-Zap II cDNA library prepared from Brassica napus (3-4 wk. mature green leaves) was obtained from Dr. Guenther Ochs, Institut Fuer Allgemeine Botanik, Johannes Gutenberg-Universitaet Mainz, Germany (Gunther Ochs, Gerald Schock, and Aloysius Wild, Plant Physiol. 103: 303-304 (1993)). Approximately 50,000 pfu of the cDNA
library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell). The plaque lifts were probed with the Arabidopsis protox-1 cDNA (SEQ ID N0:1 ) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50 C.
Wash conditions were 2X SSC, 1 % SDS at 50° C. (Church and Gilbert (1984)).
Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
The longest oilseed rape protox-1 cDNA obtained, designated "rape protox-1 ", is full-length based on comparison with the other known plant protox peptide sequences (Table 1 A).
Rape protox-1 is 1784-by in length and encodes a protein of 57.3kD. The nucleotide sequence of this cDNA and the amino acid sequence it encodes are set forth in SEQ ID NOs: 17 and 18, respectively. The oilseed rape protein is 87% identical (92% similar) to the Arabidopsis protox-1 protein.
Rape protox-1, in the pBluescript SK vector, was deposited August 23, 1996, as pWDC-17 (NRRL #B-21615).
Example 6: Isolation of a Rice Protox-1 cDNA Based on Sequence Homology to a Maize Protox-1 Coding Sequence A Lambda gtll cDNA library prepared from Oryza safiva (5 day etiolated shoots) was purchased from Clontech. Approximately 50,000 pfu of the cDNA library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell). The plaque lifts were probed with the maize protox-1 cDNA (SEQ ID N0:5) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50 C. Wash conditions were 2X SSC, 1 SDS at 50 C. (Church and Gilbert (1984)). Positively hybridizing plaques were purified, and lambda DNA was prepared using the Wizard Lambda-Prep kit (Promega). The cDNA
inserts were subcloned as EcoRl fragments into the pBluescript SK vector using standard techniques. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
The longest rice protox-1 cDNA obtained, designated "rice protox-1 ", was 1224-by in length.
Rice protox-1 lacks coding sequence for the transit peptide plus approximately 172 amino acids of the mature coding sequence based on comparison with the other known plant protox peptide sequences (Table 1 A). The nucleotide sequence of this partial cDNA and the amino acid sequence it encodes are set forth in SEQ ID NOs:l9 and 20, respectively.
Rice protox-1, in the pBluescript SK vector, was deposited December 6, 1996, as pWDC-18 (NRRL #B-21648).
Example 7: Isolation of a Sorghum Protox-1 cDNA Based on Sequence Homology to a Maize Protox-1 Coding Sequence A Lambda-Zap II cDNA library prepared from Sorghum bicolor (3-6 day green seedlings) was obtained from Dr. Klaus Pfizenmaier, Institute of Cell Biology and Immunology, University of Stuttgart, Germany (Harald Wajant, Karl-Wolfgang Mundry, and Klaus Pfizenmaier, Plant Mol. Biol. 26: 735-746 (1994)). Approximately 50,000 pfu of the cDNA library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell). The plaque lifts were probed with the maize protox-1 cDNA (SEQ ID N0:5) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7%
sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50 C. Wash conditions were 2X SSC, 1 % SDS at 50 C. (Church and Gilbert (1984)).
Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
The longest sorghum protox-1 cDNA obtained, designated "sorghum protox-1 °, was 1590-by in length.
Sorghum protox-1 lacks coding sequence for the transit peptide plus approximately 44 amino acids of the mature coding sequence based on comparison with the other known plant protox peptide sequences (Table 1 A). The nucleotide sequence of this partial cDNA
and the amino acid sequence it encodes are set forth in SEQ ID NOs:21 and 22, respectively.
Sorghum protox-1, in the pBluescript SK vector, was deposited December 6, 1996, as pWDC-19 (NRRL #B-21649).
Example 8: Isolation of a Sugar Cane Protox-1 cDNA Based on Sequence Homology to a Maize Protox-1 Coding Sequence A Lambda-Zap II cDNA library prepared from sugar cane was obtained from Henrik Albert of USDA/ARS at the Hawaii Agricultural Research Center. Approximately 50,000 pfu of the cDNA library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell).
The plaque lifts were probed with the maize protox-1 cDNA (SEQ ID N0:5) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaP04 pH 7.0, 1 mM EDTA at 50 C.
Wash conditions were 2X SSC, 1 % SDS at 50 C. (Church and Gilbert (1984)).
Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
The longest sugar cane protox-1 cDNA obtained, designated "sugar cane protox-1 ", was 633-by in length. Sugar cane protox-1 lacks coding sequence for the transit peptide plus approximately 382 amino acids of the mature coding sequence based on comparison with the other known plant protox peptide sequences (Table 1 A). The nucleotide sequence of this partial cDNA and the amino acid sequence it encodes are set forth in SEQ
ID NOs:36 and 37, respectively.
Example 9: Demonstration of Plant Protox Clone Sensitivity to Protox Inhibitory Herbicides in a Bacterial System Liquid cultures of protox-1/SASX38, protox-2/SASX38 and pBluescript/XL1-Blue were grown in L amp'°°. One hundred microliter aliquots of each culture were plated on L amp'°°
media containing various concentrations (1.OnM-lOmM) of a protox inhibitory aryluracil herbicide of formula XVII. Duplicate sets of plates were incubated for 18 hours at 37 C.
The protox+ E. coli strain XL1-Blue showed no sensitivity to the herbicide at any concentration, consistent with reported resistance of the native bacterial enzyme to similar herbicides. The protox-1/SASX38 was clearly sensitive, with the lawn of bacteria almost entirely eliminated by inhibitor concentrations as low as lOnM. The protox-2/SASX38 was also sensitive, but only at a higher concentration (10NM) of the herbicide.
The herbicide was effective even on plates maintained almost entirely in the dark. The toxicity of the herbicide was entirely eliminated by the addition of 20 Ng/ml hematin to the plates.
The different herbicide tolerance between the two plant protox strains is likely the result of differential expression from these two plasmids, rather than any inherent difference in enzyme sensitivity. Protox-1/SASX38 grows much more slowly than protox-2/SASX38 in any heme-deficient media. In addition, the Mzprotox-2/SASX38 strain, with a growth rate comparable to Arab protox-1/SASX38, is also very sensitive to herbicide at the lower (10-100nM) concentrations.
Section B: Identification and Characterization of Plant Protox Genes Resistant to Protox-Inhibitory Herbicides Example 10: Selecting for Plant Protox Genes Resistant to Protox-Inhibitory Herbicides in the E. coli Expression System An Arabidopsis thaliana (Landsberg) cDNA library in the plasmid vector pFL61 (Minet et al., Plant J. 2:417-422 (1992) was obtained and amplified. The E. coli hemG
mutant SASX38 (Sasarman et al., J. Gen. Microbiol. 113:297(1979)) was obtained and maintained on L media containing 20ug/ml hematin (United States Biochemicals). The plasmid library was transformed into SASX38 by electroporation using the Bio-Rad Gene Pulser and the manufacturer's conditions. The electroporated cells were plated on L agar containing 100ug/ml ampicillin at a density of approximately 500,000 transformants/1 Ocm plate. The cells were then incubated at 37 C for 40 hours in low light and selected for the ability to grow without the addition of exogenous heme. Heme prototrophs were recovered at a frequency of 400/10 from the pFL61 library. Sequence analysis of twenty-two complementing clones showed that nine are of the type designated "protox-1,"
the protox gene expected to express a chloroplastic protox enzyme.
The pFL61 library is a yeast expression library, with the Arabidopsis cDNAs inserted bidirectionally. These cDNAs can also be expressed in bacteria. The protox cDNAs apparently initiate at an in-frame ATG in the yeast PGK 3' sequence approximately 10 amino acids 5' to the Notl cloning site in the vector and are expressed either from the IacZ
promoter 300bp further upstream or from an undefined cryptic bacterial promoter. Because protox-1 cDNAs that included significant portions of a chloroplast transit sequence inhibited the growth of the E. coli SASX38 strain, the clone with the least amount of chloroplast transit sequence attached was chosen for mutagenesis/herbicide selection experiments.
This clone, pSLVl9, contains only 17 amino acids of the putative chloroplast transit peptide, with the DNA sequence beginning at bp-151 of the Arabidopsis protox-1 cDNA
(SEQ ID
N0:1 ).
The plasmid pSLVl9 was transformed into the random mutagenesis strain XL1-Red (Stratagene, La Jolla, CA). The transformation was plated on L media containing 50ug/ml ampicillin and incubated for 48 hours at 37 C. Lawns of transformed cells were scraped from the plates and plasmid DNA prepared using the Wizard Megaprep kit (Promega, Madison, W I). Plasmid DNA isolated from this mutator strain is predicted to contain approximately one random base change per 2000 nucleotides (see Greener et al., Strategies 7(2):32-34 (1994).
The mutated plasmid DNA was transformed into the hemG mutant SASX38 (Sasarman et aL, J. Gen. Microbiol. 113:297 (1979) and plated on L media containing various concentrations of protox-inhibiting herbicide (formula XVII). The plates were incubated for 2 days at 37 C. Plasmid DNA was isolated from all colonies that grew in the presence of herbicide concentrations that effectively killed the wild type strain. The isolated DNA was then transformed into SASX38 and plated again on herbicide to ensure that the resistance observed was plasmid-borne. The protox coding sequence from plasmids passing this screen was excised by Notl digestion, recloned into an unmutagenized vector, and tested again for the ability to confer herbicide tolerance. The DNA
sequence of protox cDNAs that conferred herbicide resistance was then determined and mutations identified by comparison with the wild type Arabidopsis protox-1 sequence (SEQ ID N0:1 ).
A single coding sequence mutant was recovered from the first mutagenesis experiment. This mutant leads to enhanced herbicide "resistance° only by increasing growth rate. It contains a C to A mutation at nucleotide 197 in SEQ ID N0:1 in the truncated chloroplast transit sequence of pSLV19, converting an ACG codon for threonine to an AAG codon for lysine at amino acid 56 of SEQ ID N0:2, and resulting in better complementation of the bacterial mutant. This plasmid also contains a silent coding sequence mutation at nucleotide 1059, with AGT (Ser) changing to AGC (Ser).
This plasmid was designated pMut-1.
The pMut-1 plasmid was then transformed into the mutator XL1-Red strain as described above and the mutated DNA was isolated and plated on an herbicide concentration that is lethal to the unmutagenized pMut-1 protox gene.
Herbicide tolerant colonies were isolated after two days at 37 C and analyzed as described above.
Multiple plasmids were shown to contain herbicide resistant protox coding sequences.
Sequence analysis indicated that the resistant genes fell into two classes. One resistance mutation identified was a C to T change at nucleotide 689 in the Arabidopsis protox-1 sequence set forth in SEQ ID NO:1. This change converts a GCT codon for alanine at amino acid 220 of SEQ ID N0:2 to a GTT codon for valine, and was designated pAraC-1 Val (see, Table 1 B;
sub-sequence 3).
A second class of herbicide resistant mutant contains an A to G change at nucleotide 1307 in the Arabidopsis protox-1 sequence. This change converts a TAC codon for tyrosine at amino acid 426 to a TGC codon for cysteine, and was designated pAraC-2Cys (see, Table 1 B; sub-sequence 7).
A third resistant mutant has a G to A change at nucleotide 691 in the Arabidopsis protox-1 sequence. This mutation converts a GGT codon for glycine at amino acid 221 to an AGT codon for serine at the codon position adjacent to the mutation in pAraC-1. This plasmid was designated pAraC-3Ser (see, Table 1 B; sub-sequence 4).
Resistant mutant pAraC-2Cys, in the pMut-1 plasmid, was deposited on November 14, 1994 under the designation pWDC-7 with the Agricultural Research Culture Collection and given the deposit designation NRRL #21339N.
Example 11: Additional Herbicide-Resistant Codon Substitutions at Positions Identified in the Random Screen The amino acids identified as herbicide resistance sites in the random screen are replaced by other amino acids and tested for function and for herbicide tolerance in the bacterial system. Oligonucleotide-directed mutagenesis of the Arabidopsis protox-1 sequence is performed using the Transformer Site-Directed Mutagenesis Kit (Clontech, Palo Alto, CA). After amino acid changes are confirmed by sequence analysis, the mutated plasmids are transformed into SASX38 and plated on L-amp'°°
media to test for function and on various concentrations of protox-inhibiting herbicide to test for tolerance.
This procedure is applied to the alanine codon at nucleotides 688-690 and to the tyrosine codon at nucleotides 1306-1308 of the Arabidopsis protox-1 sequence (SEQ ID
N0:1 ). The results demonstrate that the alanine codon at nucleotides 688-690 can be changed to a codon for valine (pAraC-1 Val), threonine (pAraC-1 Thr), leucine (pAraC-1 Leu), cysteine (pAraC-1 Cys), or isoleucine (pAraC-1 Ile) to yield an herbicide-resistant protox enzyme that retains function (see, Table 1 B; sub-sequence 3). The results further demonstrate that the tyrosine codon at nucleotides 1306-1308 can be changed to a codon for cysteine (pAraC-2Cys), isoleucine (pAraC-211e), leucine (pAraC-2Leu), threonine (pAraC-2Thr), methionine (pAraC-2Met), valine (pAraC-2Val), or alanine (pAraC-2Ala) to yield an herbicide-resistant protox enzyme that retains function (see, Table 1 B; sub-sequence 7).
Example 12: Isolation of Additional Mutations that Increase Enzyme Function and/or Herbicide Tolerance of Previously Identified Resistant Mutants Plasmids containing herbicide resistant protox genes are transformed into the mutator strain XL1-Red and mutated DNA is isolated as described above. The mutated plasmids are transformed into SASX38 and the transformants are screened on herbicide concentrations (formula XVII) sufficient to inhibit growth of the original "resistant" mutant.
Tolerant colonies are isolated and the higher tolerance phenotype is verified as being coding sequence dependent as described above. The sequence of these mutants is determined and mutations identified by comparison to the progenitor sequence.
This procedure was applied to the pAraC-1 Val mutant described above. The results demonstrate that the serine codon at amino acid 305 (SEQ ID N0:2) can be changed to a codon for leucine to yield an enzyme with higher tolerance to protox-inhibiting herbicides than the pAraC-1 Val mutant alone. This second site mutation is designated AraC305Leu (see, Table 1 B; sub-sequence 13). The same results are demonstrated for the threonine codon at amino acid 249, where a change to either isoleucine or to alanine leads to a more tolerant enzyme (see, Table 1 B; sub-sequence 12). These changes are designated AraC24911e and AraC249A1a, respectively.
The procedure was also applied to the pAraC-2Cys mutant described above. The results demonstrate that the proline codon at amino acid 118 (SEQ ID N0:2) can be changed to a codon for leucine to yield an enzyme with higher tolerance to protox-inhibiting herbicides than the pAraC-1 Cys mutant alone. This mutation is designated AraC1 l8Leu (see, Table 1 B; sub-sequence 11 ). The same results are demonstrated for the serine codon at amino acid 305, where a change to leucine leads to a more tolerant pAraC-2Cys enzyme (see, Table 1 B; sub-sequence 13). This change was also isolated with the pAraC-1 Val mutant as described above and is designated AraC305Leu. Additional mutations that enhance the herbicide resistance of the pAraC-2Cys mutant include an asparagine to serine change at amino acid 425, designated AraC425Ser (Table 1 B; sub-sequence 14), and a tyrosine to cysteine at amino acid 498, designated AraC498Cys (Table 1 B; sub-sequence 15).
These changes (Table 1B; sub-sequences 11-15) are referred to as "second site"
mutations, because they are not sufficient to confer herbicide tolerance alone, but rather enhance the function and/or the herbicide tolerance of an already mutant enzyme. This does not preclude the possibility that other amino acid substitutions at these sites could suffice to produce an herbicide tolerant enzyme since exhaustive testing of all possible replacements has not been performed.
Example 13: Combining Identified Resistance Mutations with Identified Second Site Mutations to Create Highly FunctionaUHighly Tolerant Protox Enzymes The AraC305Leu mutation described above was found to enhance the function/herbicide resistance of both the AraC-1 Val and the AraC-2Cys mutant plasmids. In an effort to test the general usefulness of this second site mutation, it was combined with the AraC-2Leu, AraC-2Val, and AraC-211e mutations and tested for herbicide tolerance. In each case, the AraC305Leu change significantly increased the growth rate of the resistant protox mutant on protox-inhibiting herbicide. Combinations of the AraC-211e resistant mutant with either the second site mutant AraC24911e or AraC118Leu also produced more highly tolerant mutant protox enzymes. The AraC24911e mutation demonstrates that a second site mutation identified as enhancing an AraC-1 (sub-sequence 3) mutant may also increase the resistance of an AraC-2 (sub-sequence 7) mutant. A three mutation plasmid containing AraC-211e, AraC305Leu, and AraC24911e (Table 1 B; sub-sequences 7, 13, and 12) has also been shown to produce a highly functional, highly herbicide tolerant protox-1 enzyme.
Example 14: Identification of Sites in the Maize Protox-1 Gene that Can Be Mutated to Give Herbicide Tolerance The pMut-1 Arabidopsis protox -1 plasmid described above is very effective when used in mutagenesis/screening experiments in that it gives a high frequency of genuine coding sequence mutants, as opposed to the frequent up-promoter mutants that are isolated when other plasmids are used. In an effort to create an efficient plasmid screening system for maize protox-1, the maize cDNA was engineered into the pMut-1 vector in approximately the same sequence context as the Arabidopsis cDNA. Using standard methods of overlapping PCR fusion, the 5' end of the pMut-1 Arabidopsis clone (including 17 amino acids of chloroplast transit peptide with one mis-sense mutation as described above) was fused to the maize protox-1 cDNA sequence starting at amino acid number 14 of the maize sequence (SEQ ID N0:6). The 3' end of the maize cDNA was unchanged.
Notl restriction sites were placed on both ends of this fusion, and the chimeric gene was cloned into the pFL61 plasmid backbone from pMut-1. Sequence analysis revealed a single nucleotide PCR-derived silent mutation that converts the ACG codon at nucleotides 745-747 (SEQ ID N0:5) to an ACT codon, both of which encode threonine. This chimeric Arab-maize protox-1 plasmid was designated pMut-3.
The pMut-3 plasmid was transformed into the mutator XL1-Red strain as described above and the mutated DNA was isolated and plated on a herbicide concentration (formula XVII) that was lethal to the unmutagenized pMut-3 maize protox gene. Herbicide tolerant colonies were isolated after two days at 37 C and analyzed as described above.
This analysis revealed multiple plasmids containing herbicide resistant protox coding sequences.
Sequence analysis showed 5 single base changes that individually result in an herbicide tolerant maize protox-1 enzyme. Three of these mutations correspond to amino acid changes previously shown to confer tolerance at the homologous position in the Arabidopsis protox-1, gene. Two of the three are pMzC-1 Val and pMzC-1 Thr, converting the alanine (GCT) at amino acid 164 (SEQ ID N0:6) to either valine (GAT) or to threonine (ACT). This position corresponds to the pAraC-1 mutations described above (see, Table 1 B; sub-sequence 3). The third analogous change, pMzC-3Ser, converts the glycine (GGT) at amino acid 165 to Serine (AGT), corresponding to the AraC-3Ser mutation described above (see, Table 1 B; sub-sequence 4). These results serve to validate the expectation that herbicide-tolerant mutations identified in one plant protox gene may also confer herbicide tolerance in an equivalent plant protox gene from another species.
Two of the mutations isolated from the maize protox-1 screen result in amino acid changes at residues not previously identified as herbicide resistance sites.
One change (Mz159Phe) converts cysteine (TGC) to phenylalanine (TTC) at amino acid 159 of the maize protox-1 sequence (SEQ ID N0:6) (see, Table 1 B; sub-sequence 2). The second (Mz419Thr) converts isoleucine (ATA) to threonine (ACA) at amino acid 419 (see, Table 1 B;
sub-sequence 9).
Additional amino acid substitutions were made and tested at three of the maize mutant sites. Tolerance was demonstrated when glycine 165 was changed to leucine (pMzC-3Leu) or when cysteine 159 was changed to either leucine (Mz159Leu) or to lysine (Mz159Lys) (see, Table 1 B; sub-sequences 4 and 2). Tolerant enzymes were also created by changing isoleucine 419 to histidine (Mz419His), glycine (Mz419G1y), or asparagine (Mz419Asn) (see, Table 1 B; sub-sequence 9).
Individual amino acid changes that produced highly herbicide tolerant Arabidopsis protox-1 enzymes were engineered into the maize protox-1 gene by site-directed mutagenesis as described above. Bacterial testing demonstrated that changing the alanine (GCT) at amino acid 164 (SEQ ID N0:6) to leucine (CTT) produced a highly tolerant maize enzyme (pMzC-1 Leu) (see, Table 1 B; sub-sequence 3). No mutation analogous to the AraC-2 site (Table 1 B; sub-sequence 7) in Arabidopsis was isolated in the maize random screen. However, changing this site, tyrosine 370 in the maize enzyme (SEQ ID
N0:6), to either isoleucine (pMzC-211e) or methionine (pMzC-2Met) did produce herbicide tolerant enzymes (see, Table 1 B; sub-sequence 7).
Additional mutant screens performed as described earlier in this example, except using formulas XXllla and XXlllb instead of XVII, identified three additional amino acid changes that confer tolerant protox enzymes. One, using formula XXlllb, demonstrated that changing the arginine (CGT) at amino acid 88 (SEQ ID N0:6) to cysteine (TGT) produced a highly tolerant maize enzyme (Mz88Cys) (see, Table 1 B; sub-sequence 1 ).
Another, using formula IVc, demonstrated that changing the arginine (CGT) at amino acid 88 (SEQ ID
N0:6) to leucine (CTT) produced a highly tolerant maize enzyme (Mz88Cys) (see, Table 1 B;
sub-sequence 1 ). Another, using formula XXllla, demonstrated that changing both the leucine (TTA) at amino acid 347 (SEQ ID N0:6) to serine (TCA) and the alanine (GCA) at amino acid 453 (SEQ ID N0:6) to threonine (ACA) produced a highly tolerant maize enzyme (Mz347Ser453Thr) (see, Table 1 B; sub-sequences 16 and 17). Unlike the second site mutations described above, which increase enzyme function and/or herbicide tolerance of previously identified resistant mutants, Mz347Ser453Thr is a "double mutant' that requires that both mutations be present for herbicide tolerance.
Additional mutant screens performed as described earlier in this example identified two additional amino acid changes that confer tolerant protox enzymes. One, using formula XXIV, demonstrated that changing the alanine (GCA) at amino acid 175 (SEQ ID
N0:6) to valine (GTA) or to threonine (ACA) produced a highly tolerant maize enzyme (Mz175Va1 and Mz175Thr, respectively) (see, Table 1 B; sub-sequence 18). Another, using formula IVc, demonstrated that changing the leucine (TTG) at amino acid 337 (SEQ ID N0:6) to serine (TCG) produced a highly tolerant maize enzyme (Mz337Ser) (see, Table 1 B; sub-sequence 19).
Example 15: Identification of Sites in the Wheat Protox-1 Gene that can be Mutated to Give Herbicide Tolerance To create an efficient plasmid screening system for wheat protox-1, the wheat cDNA
was engineered into the pMut-1 vector as described above for the maize cDNA.
This chimeric Arab-wheat protox-1 plasmid is designated pMut-4. The pMut-4 DNA was mutated and screened for herbicide tolerance as described above. This analysis revealed multiple plasmids containing herbicide resistant protox coding sequences.
Sequence analysis showed 7 single base changes that individually result in an herbicide tolerant wheat protox-1 enzyme. Four of these mutations correspond to amino acid changes previously shown to confer tolerance at the homologous position in the Arabidopsis and/or in the maize protox-1 gene. Two, pWhtC-lVal and pWhtC-lThr, convert the alanine (GCT) at amino acid 211 (SEQ ID N0:10) to valine (GAT) and to threonine (ACT), respectively.
This position corresponds to the pAraC-1 mutations described above (see, Table 1 B; sub-sequence 3). The third analogous change, pWhtC-3Ser, converts the glycine (GGT) at amino acid 212 to serine (AGT), corresponding to the AraC-3Ser mutation described above (see, Table 1 B; sub-sequence 4). The fourth, Wht466Thr, converts isoleucine (ATA) to threonine (ACA) at amino acid 466, corresponding to the Mz419Thr mutant from maize (see, Table 1 B; sub-sequence 9).
Three of the mutations isolated from the wheat protox-1 screen result in amino acid changes at residues not previously identified as herbicide resistance sites.
One change (VlIht356Leu) converts valine (GTT) to leucine (CTT) at amino acid 356 of the wheat protox-1 sequence (SEQ ID N0:10) (see, Table 1 B; sub-sequence 6). A second (V11ht421 Pro) converts serine (TCT) to proline (CCT) at amino acid 421 (see, Table 1 B; sub-sequence 8).
The third (Vl/ht502A1a) converts valine (GTT) to alanine (GCT) at amino acid 502 (see, Table 1 B; sub-sequence 10).
Example 16: Identification of Sites in the Soybean Protox-1 Gene that can be Mutated to Give Herbicide Tolerance To create an efficient plasmid screening system for soybean protox-1, the soybean cDNA was engineered into the pMut-1 vector as described above for the maize cDNA. This chimeric Arab-soybean protox-1 plasmid is designated pMut-5. The pMut-5 DNA
was mutated and screened for herbicide tolerance as described above. This analysis revealed multiple plasmids containing herbicide resistant protox coding sequences.
Sequence analysis showed 4 single base changes that individually result in an herbicide tolerant soybean protox-1 enzyme. Two of these mutations correspond to amino acid changes previously shown to confer tolerance at the homologous position in the Arabidopsis and/or in the wheat protox-1 gene. One, pSoyC-1 Thr, converts the alanine (GCA) at amino acid 226 (SEQ ID N0:12) to threonine (ACA). This position corresponds to the pAraC-1 Thr mutation described above (see, Table 1 B; sub-sequence 3). The second analogous change, Soy517A1a, converts the valine (GTT) at amino acid 517 to alanine (GCT), corresponding to the Wht502A1a mutation from wheat (see, Table 1 B; sub-sequence 10).
Two of the mutations isolated from the soybean protox-1 screen result in amino acid changes at a residue not previously identified as an herbicide resistance site. One change (Soy369Ser) converts proline (CCT) to serine (TCT) at amino acid 369 of the soybean protox-1 sequence (SEQ ID N0:12) (see, Table 1 B; sub-sequence 5). A second (Soy369His) converts this same proline369 to histidine (CAT) (see, Table 1 B;
sub-sequence 5).
Individual amino acid changes that produced highly herbicide tolerant Arabidopsis protox-1 enzymes were engineered into the soybean protox-1 gene by site directed mutagenesis as described above. Bacterial testing demonstrated that changing the alanine (GCA) at amino acid 226 (SEQ ID N0:12) to leucine (pSoyC-1 Leu) produced a tolerant soybean enzyme (see, Table 1 B; sub-sequence 3). Changing the tyrosine (TAC) at amino acid 432 (SEQ ID N0:12) to either leucine (pSoyC-2Leu) or isoleucine (pSoyC-211e) also produced herbicide tolerant enzymes (see, Table 1 B; sub-sequence 7).
Example 17: Identification of Sites in the Sugar Beet Protox-1 Gene that can be Mutated to Give Herbicide Tolerance To create an efficient plasmid screening system for sugar beet protox-1, the sugar beet cDNA was engineered into the pMut-1 vector as described above for the maize cDNA.
This chimeric Arab-sugar beet protox-1 plasmid is designated pMut-6. The pMut-was mutated and screened for herbicide tolerance as described above. This analysis revealed multiple plasmids containing herbicide resistant protox coding sequences.
Sequence analysis showed a single base change that results in an herbicide tolerant sugar beet protox-1 enzyme. This change (pSugC-2Cys) converts tyrosine (TAC) at amino acid 449 to cysteine (TGC) and is analogous to the AraC-2 mutations in Arabidopsis (see, Table 1 B; sub-sequence 7).
Individual amino acid changes that produced highly herbicide tolerant Arabidopsis protox-1 enzymes were engineered into the sugar beet protox-1 gene by site directed mutagenesis as described above. Bacterial testing demonstrated that changing the tyrosine (TAC) at amino acid 449 to leucine (pSugC-2Leu), isoleucine (pSugC-211e), valine (pSugC-2Val), or methionine (pSugC-2Met) produced herbicide tolerant sugar beet enzymes (see, Table 1 B; sub-sequence 7).
Example 18: Identification of Sites in the Cotton Protox-1 Gene that can be Mutated to Give Herbicide Tolerance In an effort to create an efficient plasmid screening system for cotton protox-1, the cotton cDNA was engineered into the pMut-1 vector as described above for the maize cDNA. This chimeric Arab-cotton protox-1 plasmid is designated pMut-7. The pMut-7 DNA
was mutated and screened for herbicide tolerance as described above. This analysis revealed multiple plasmids containing herbicide resistant protox coding sequences.
Sequence analysis showed 3 single base changes that individually result in an herbicide tolerant cotton protox-1 enzyme. Three mutants, pCotC-2Cys, pCotC-2His and pCotC-2Arg, change tyrosine (TAC) at amino acid 428 (SEQ ID N0:16) to cysteine (TGC), histidine (CAC) and to arginine (CGC), respectively (see, Table 1 B; sub-sequence 7).
Arginine is a novel substitution giving tolerance at this previously identified AraC-2 (sub-sequence 7) site.
The third mutation (Cot365Ser) converts proline (CCT) to serine (TCT) at amino acid 365.
This change corresponds to the soybean mutant Soy369Ser (see, Table 1 B; sub-sequence 5).
Example 19: Demonstration of Resistant Mutations' Cross-Tolerance to Various Protox-Inhibiting Compounds Resistant mutant plasmids, originally identified based on resistance against a single protox inhibitory herbicide, were tested against a spectrum of other protox inhibiting compounds. For this test, the SASX38 strain containing the wild-type plasmid is plated on a range of concentrations of each compound to determine the lethal concentration for each one. Resistant mutant plasmids in SASX38 are plated and scored for the ability to survive on a concentration of each compound at least 10 fold higher than the concentration that is lethal to the SASX38 strain containing the wild-type plasmid.
Results from bacterial cross-tolerance testing, illustrated in Tables 3A and 3B, show that each of the mutations identified confers tolerance to a variety of protox inhibiting compounds.
2. Section C: Expression of Herbicide-Resistant Protox Genes in Transgenic Plants Example 20: Engineering of Plants Tolerant to Protox-Inhibiting Herbicides by Homologous Recombination or Gene Conversion Because the described mutant coding sequences effectively confer herbicide tolerance when expressed under the control of the native protox promoter, targeted changes to the protox coding sequence in its native chromosomal location represent an alternative means for generating herbicide tolerant plants and plant cells. A
fragment of protox DNA containing the desired mutations, but lacking its own expression signals (either promoter or 3' untranslated region) can be introduced by any of several art-recognized methods (for instance, Agrobacterium transformation, direct gene transfer to protoplasts, microprojectile bombardment), and herbicide-tolerant transformants selected.
The introduced DNA fragment also contains a diagnostic restriction enzyme site or other sequence polymorphism that is introduced by site-directed mutagenesis in vitro without changing the encoded amino acid sequence (i.e. a silent mutation). As has been previously reported for various selectable marker and herbicide tolerance genes (see, e.g., Paszkowski et al., EMBO J. 7: 4021-4026 (1988); Lee et al., Plant Cell 2: 415-425 (1990);
Risseeuw et al., Plant J. 7: 109-119 (1995)). some transformants are found to result from homologous integration of the mutant DNA into the protox chromosomal locus, or from conversion of the native protox chromosomal sequence to the introduced mutant sequence.
These transformants are recognized by the combination of their herbicide-tolerant phenotype, and the presence of the diagnostic restriction enzyme site in their protox chromosomal locus.
3. Example 21: Construction of Plant Transformation Vectors Numerous transformation vectors are available for plant transformation, and the genes of this invention can be used in conjunction with any such vectors. The selection of vector for use will depend upon the preferred transformation technique and the target species for transformation. For certain target species, different antibiotic or herbicide selection markers may be preferred. Selection markers used routinely in transformation include the nptll gene, which confers resistance to kanamycin and related antibiotics (Messing & Vierra, Gene 19: 259-268 (1982); Bevan et al., Nature 304:184-187 (1983)), the bar gene, which confers resistance to the herbicide phosphinothricin (White etal., Nucl Acids Res 18: 1062 (1990), Spencer et al. Theor Appl Genet 79: 625-631 (1990)), the hph gene, which confers resistance to the antibiotic hygromycin (Blochinger &
Diggelmann, Mol Cell Biol 4: 2929-2931 ), and the dhfr gene, which confers resistance to methotrexate (Bourouis et al., EMBO J. 2(7): 1099-1104 (1983)).
I. Construction of Vectors Suitable for Agrobacterium Transformation Many vectors are available for transformation using Agrobacterium tumefaciens.
These typically carry at least one T-DNA border sequence and include vectors such as pBINl9 (Bevan, Nucl. Acids Res. (1984)) and pXYZ. Below the construction of two typical vectors is described.
Construction of pCIB200 and pCIB2001: The binary vectors pCIB200 and pCIB2001 are used for the construction of recombinant vectors for use with Agrobacterium and was constructed in the following manner. pTJS75kan was created by Narl digestion of pTJS75 (Schmidhauser & Helinski, J Bacteriol. 164: 446-455 (1985)) allowing excision of the tetracycline-resistance gene, followed by insertion of an Accl fragment from pUC4K carrying an NPTII (Messing & Vierra, Gene 19: 259-268 (1982); Bevan et aL, Nature 304:
(1983); McBride et al., Plant Molecular Biology i 4: 266-276 (1990)). Xhol linkers were ligated to the EcoRV fragment of pCIB7, which contains the left and right T-DNA borders, a plant selectable noslnptll chimeric gene and the pUC polylinker (Rothstein et al., Gene 53:
153-161 (1987)), and the Xhol-digested fragment was cloned into Sall digested pTJS75kan to create pCIB200 (see also EP 0 332 104, example 19). pCIB200 contains the following unique polylinker restriction sites: EcoRl, Sstl, Kpnl, Bglll, Xbal, and Sall.
pCIB2001 is a derivative of pCIB200, which is created by the insertion into the polylinker of additional restriction sites. Unique restriction sites in the polylinker of pCIB2001 are EcoRl, Sstl, Kpnl, Bglll, Xbal, Sall, Mlul, Bcll, Avrll, Apal, Hpal, and Stul. pCIB2001, in addition to containing these unique restriction sites also has plant and bacterial kanamycin selection, left and right T-DNA borders for Agrobacterium-mediated transformation, the RK2-derived tn'A
function for mobilization between E. coli and other hosts, and the OriT and OriV
functions also from RK2. The pCIB2001 polylinker is suitable for the cloning of plant expression cassettes containing their own regulatory signals.
Construction of pCIBlO and Hygromycin Selection Derivatives Thereof: The binary vector pCIBlO contains a gene encoding kanamycin resistance for selection in plants, T-DNA right and left border sequences and incorporates sequences from the wide host-range plasmid pRK252 allowing it to replicate in both E, coli and Agrobacterium. Its construction is described by Rothstein et al., Gene 53: 153-161 (1987). Various derivatives of pCIBlO
have been constructed that incorporate the gene for hygromycin B
phosphotransferase described by Gritz et al., Gene 25: 179-188 (1983)). These derivatives enable selection of transgenic plant cells on hygromycin only (pCIB743), or hygromycin and kanamycin (pCIB715, pCIB717).
Construction of Vectors Suitable for non-Agrobacterium Transformation.
Transformation without the use of Agrobacterium tumefaciens circumvents the requirement for T-DNA sequences in the chosen transformation vector and consequently vectors lacking these sequences can be utilized in addition to vectors such as the ones described above that contain T-DNA sequences. Transformation techniques that do not rely on Agrobacterium include transformation via particle bombardment, protoplast uptake (e.g. PEG and electroporation) and microinjection. The choice of vector depends largely on the preferred selection for the species being transformed. Below, the construction of some typical vectors is described.
Construction of pCIB3064: pCIB3064 is a pUC-derived vector suitable for direct gene transfer techniques in combination with selection by the herbicide basta (or phosphinothricin). The plasmid pCIB246 comprises the CaMV 35S promoter in operational fusion to the E. coli GUS gene and the CaMV 35S transcriptional terminator and is described in the PCT published application WO 93/07278. The 35S promoter of this vector contains two ATG sequences 5' of the start site. These sites were mutated using standard PCR techniques in such a way as to remove the ATG's and generate the restriction sites Sspl and Pvull. The new restriction sites were 96 and 37-by away from the unique Sall site and 101 and 42-by away from the actual start site. The resultant derivative of pCIB246 was designated pCIB3025. The GUS gene was then excised from pCIB3025 by digestion with Sall and Sacl, the termini rendered blunt and religated to generate plasmid pCIB3060. The plasmid pJIT82 was obtained from the John Innes Centre, Norwich and the a 400-by Smal fragment containing the bar gene from Streptomyces viridochromogenes was excised and inserted into the Hpal site of pCIB3060 (Thompson et al. EMBO J 6: 2519-2523 (1987)).
This generated pCIB3064, which comprises the bar gene under the control of the CaMV
35S promoter and terminator for herbicide selection, a gene for ampicillin resistance (for selection in E. coh) and a polylinker with the unique sites Sphl, Pstl, Hindlll, and BamHl.
This vector is suitable for the cloning of plant expression cassettes containing their own regulatory signals.
Construction of pSOGl9 and pSOG35: pSOG35 is a transformation vector that utilizes the E. coli gene dihydrofolate reductase (DHFR) as a selectable marker conferring resistance to methotrexate. PCR was used to amplify the 35S promoter (--800-bp), intron 6 from the maize Adh1 gene (-.550-bp) and 18-by of the GUS untranslated leader sequence from pSOGlO. A 250-by fragment encoding the E. coli dihydrofolate reductase type II gene was also amplified by PCR and these two PCR fragments were assembled with a Sacl-Pstl fragment from pB1221 (Clontech), which comprised the pUC19 vector backbone and the nopaline synthase terminator. Assembly of these fragments generated pSOGl9, which contains the 35S promoter in fusion with the intron 6 sequence, the GUS
leader, the DHFR
gene and the nopaline synthase terminator. Replacement of the GUS leader in pSOGl9 with the leader sequence from Maize Chlorotic Mottle Virus (MCMV) generated the vector pSOG35. pSOGl9 and pSOG35 carry the pUC gene for ampicillin resistance and have Hindlll, Sphl, Pstl and EcoRl sites available for the cloning of foreign sequences.
4. Example 22: Construction of Plant Expression Cassettes Gene sequences intended for expression in transgenic plants are firstly assembled in expression cassettes behind a suitable promoter and upstream of a suitable transcription terminator. These expression cassettes can then be easily transferred to the plant transformation vectors described above in Example 21.
I. Promoter Selection The selection of a promoter used in expression cassettes will determine the spatial and temporal expression pattern of the transgene in the transgenic plant.
Selected promoters will express transgenes in specific cell types (such as leaf epidermal cells, mesophyll cells, root cortex cells) or in specific tissues or organs (roots, leaves or flowers, for example) and this selection will reflect the desired location of expression of the transgene. Alternatively, the selected promoter may drive expression of the gene under a light-induced or other temporally regulated promoter. A further alternative is that the selected promoter be chemically regulated. This would provide the possibility of inducing expression of the transgene only when desired and caused by treatment with a chemical inducer.
II. Transcriptional Terminators A variety of transcriptional terminators are available for use in expression cassettes.
These are responsible for the termination of transcription beyond the transgene and its correct polyadenylation. Appropriate transcriptional terminators are those that are known to function in plants and include the CaMV 35S terminator, the tml terminator, the nopaline synthase terminator, the pea rbcS E9 terminator, as well as terminators naturally associated with the plant protox gene (i.e. "protox terminators"). These can be used in both monocotyledons and dicotyledons.
III. Sequences for the Enhancement or Regulation of Expression Numerous sequences have been found to enhance gene expression from within the transcriptional unit and these sequences can be used in conjunction with the genes of this invention to increase their expression in transgenic plants.
Various intron sequences have been shown to enhance expression, particularly in monocotyledonous cells. For example, the introns of the maize Adh 1 gene have been found to significantly enhance the expression of the wild-type gene under its cognate promoter when introduced into maize cells. Intron 1 was found to be particularly effective and enhanced expression in fusion constructs with the chloramphenicol acetyltransferase gene (Callis et al., Genes Develop. 1: 1183-1200 (1987)). In the same experimental system, the intron from the maize bronzes gene had a similar effect in enhancing expression (Callis et al., supra). Intron sequences have been routinely incorporated into plant transformation vectors, typically within the non-translated leader.
A number of non-translated leader sequences derived from viruses are also known to enhance expression, and these are particularly effective in dicotyledonous cells.
Specifically, leader sequences from Tobacco Mosaic Virus (TMV, the "W-sequence"), Maize Chlorotic Mottle Virus (MCMV), and Alfalfa Mosaic Virus (AMV) have been shown to be effective in enhancing expression (e.g. Gallie et al. Nucl. Acids Res. 15:
8693-8711 (1987);
Skuzeski et al. Plant Molec. Biol. 15: 65-79 (1990)) IV. Targeting of the Gene Product Within the Cell Various mechanisms for targeting gene products are known to exist in plants and the sequences controlling the functioning of these mechanisms have been characterized in some detail. For example, the targeting of gene products to the chloroplast is controlled by a signal sequence that is found at the amino terminal end of various proteins and that is cleaved during chloroplast import yielding the mature protein (e.g. Comas et al. J. BioL
Chem. 263: 15104-15109 (1988)). These signal sequences can be fused to heterologous gene products to effect the import of heterologous products into the chloroplast (van den Broeck et al. Nature 313: 358-363 (1985)). DNA encoding for appropriate signal sequences can be isolated from the 5' end of the cDNAs encoding the RUBISCO protein, the CAB
protein, the EPSP synthase enzyme, the GS2 protein and many other proteins that are known to be chloroplast localized.
Other gene products are localized to other organelles such as the mitochondrion and the peroxisome (e.g. Unger et al. Plant Molec. Biol. 13: 411-418 (1989)). The cDNAs encoding these products can also be manipulated to effect the targeting of heterologous gene products to these organelles. Examples of such sequences are the nuclear-encoded ATPases and specific aspartate amino transferase isoforms for mitochondria.
Targeting to _78_ cellular protein bodies has been described by Rogers et al., Proc. Nat). Acad.
Sci. USA 82.
6512-6516 (1985)).
In addition, sequences have been characterized that cause the targeting of gene products to other cell compartments. Amino terminal sequences are responsible for targeting to the ER, the apoplast, and extracellular secretion from aleurone cells (Koehler &
Ho, Plant Cell2: 769-783 (1990)). Additionally, amino terminal sequences in conjunction with carboxy terminal sequences are responsible for vacuolar targeting of gene products (Shinshi et al., Plant Molec. Biol. 14: 357-368 (1990)).
By the fusion of the appropriate targeting sequences described above to transgene sequences of interest it is possible to direct the transgene product to any organelle or cell compartment. For chloroplast targeting, for example, the chloroplast signal sequence from the RUBISCO gene, the CAB gene, the EPSP synthase gene, or the GS2 gene is fused in frame to the amino terminal ATG of the transgene. The signal sequence selected should include the known cleavage site and the fusion constructed should take into account any amino acids after the cleavage site that are required for cleavage. In some cases this requirement may be fulfilled by the addition of a small number of amino acids between the cleavage site and the transgene ATG or alternatively replacement of some amino acids within the transgene sequence. Fusions constructed for chloroplast import can be tested for efficacy of chloroplast uptake by in vitro translation of in vitro transcribed constructions followed by in vitro chloroplast uptake using techniques described by (Bartlett et al. In:
Edelmann et al. (Eds.) Methods in Chloroplast Molecular Biology, Elsevier. pp.
(1982); Wasmann et al. Mol. Gen. Genet. 205: 446-453 (1986)). These construction techniques are well known in the art and are equally applicable to mitochondria and peroxisomes. The choice of targeting that may be required for expression of the transgenes will depend on the cellular localization of the precursor required as the starting point for a given pathway. This will usually be cytosolic or chloroplastic, although it may is some cases be mitochondria) or peroxisomal. The products of transgene expression will not normally require targeting to the ER, the apoplast or the vacuole.
The above described mechanisms for cellular targeting can be utilized not only in conjunction with their cognate promoters, but also in conjunction with heterologous promoters so as to effect a specific cell targeting goal under the transcriptional regulation of a promoter that has an expression pattern different to that of the promoter from which the targeting signal derives.
5. Example 23: Transformation of Dicotyledons Transformation techniques for dicotyledons are well known in the art and include Agrobacterium-based techniques and techniques that do not require Agrobacterium. Non-Agrobacterium techniques involve the uptake of exogenous genetic material directly by protoplasts or cells. This can be accomplished by PEG or electroporation mediated uptake, particle bombardment-mediated delivery, or microinjection. Examples of these techniques are described by Paszkowski et al., EMBO J 3: 2717-2722 (1984), Potrykus et aL, Mol.
Gen. Genet. 199: 169-177 (1985), Reich et al., Biotechnology 4: 1001-1004 (1986), and Klein et al., Nature 327 70-73 (1987). In each case the transformed cells are regenerated to whole plants using standard techniques known in the art.
Agrobacterium-mediated transformation is a preferred technique for transformation of dicotyledons because of its high efficiency of transformation and its broad utility with many different species. The many crop species that are routinely transformable by Agrobacterium include tobacco, tomato, sunflower, cotton, oilseed rape, potato, soybean, alfalfa and poplar (EP 0 317 511 (cotton), EP 0 249 432 (tomato, to Calgene), WO 87/07299 (Brassica, to Calgene), US 4,795,855 (poplar)).
Transformation of the target plant species by recombinant Agrobacterium usually involves co-cultivation of the Agrobacterium with explants from the plant and follows protocols well known in the art. Transformed tissue is regenerated on selectable medium carrying the antibiotic or herbicide resistance marker present between the binary plasmid T-DNA borders.
6. Example 24: Transformation of Monocotyledons Transformation of most monocotyledon species has now also become routine.
Preferred techniques include direct gene transfer into protoplasts using PEG
or electroporation techniques, and particle bombardment into callus tissue.
Transformations can be undertaken with a single DNA species or multiple DNA species (i.e. co-transformation) and both these techniques are suitable for use with this invention. Co-transformation may have the advantage of avoiding complex vector construction and of generating transgenic plants with unlinked loci for the gene of interest and the selectable marker, enabling the removal of the selectable marker in subsequent generations, should this be regarded desirable. However, a disadvantage of the use of co-transformation is the less than 100% frequency with which separate DNA species are integrated into the genome (Schocher et al. Biotechnology 4: 1093-1096 (1986)).
Patent Applications EP 0 292 435 (to Ciba-Geigy), EP 0 392 225 (to Ciba-Geigy) and 8 (to Ciba-Geigy) describe techniques for the preparation of callus and protoplasts from an elite inbred line of maize, transformation of protoplasts using PEG or electroporation, and the regeneration of maize plants from transformed protoplasts.
Gordon-Kamm et al., Plant Cell 2: 603-618 (1990)) and Fromm et al., Biotechnology 8: 833-839 (1990)) have published techniques for transformation of A188-derived maize line using particle bombardment. Furthermore, application WO 93/07278 (to Ciba-Geigy) and Koziel et aL, Biotechnology 11: 194-200 (1993)) describe techniques for the transformation of Mite inbred lines of maize by particle bombardment. This technique utilizes immature maize embryos of 1.5-2.5 mm length excised from a maize ear 14-15 days after pollination and a PDS-1000He Biolistics device for bombardment.
Transformation of rice can also be undertaken by direct gene transfer techniques utilizing protoplasts or particle bombardment. Protoplast-mediated transformation has been described for Japonica-types and Indica-types (Zhang et al., Plant Cell Rep 7 (1988); Shimamoto et al. Nature 338: 274-277 (1989); Datta et al.
Biotechnology 8: 736-740 (1990)). Both types are also routinely transformable using particle bombardment (Christou et al. Biotechnology 9: 957-962 (1991 )).
Patent Application EP 0 332 581 (to Ciba-Geigy) describes techniques for the generation, transformation and regeneration of Pooideae protoplasts. These techniques allow the transformation of Dactylis and wheat. Furthermore, wheat transformation was been described by Vasil et al., Biotechnology i0: 667-674 (1992)) using particle bombardment into cells of type C long-term regenerable callus, and also by Vasil et al., Biotechnology 11: 1553-1558 (1993)) and Weeks et al., Plant Physiol. 102. 1077-(1993) using particle bombardment of immature embryos and immature embryo-derived callus. A preferred technique for wheat transformation, however, involves the transformation of wheat by particle bombardment of immature embryos and includes either a high sucrose or a high maltose step prior to gene delivery. Prior to bombardment, any number of embryos (0.75-1 mm in length) are plated onto MS medium with 3%
sucrose (Murashige & Skoog, Physiologia Plantarum 15: 473-497 (1962)) and 3 mg/I 2,4-D
for induction of somatic embryos, which is allowed to proceed in the dark. On the chosen day of bombardment, embryos are removed from the induction medium and placed onto the _81 _ osmoticum (i.e. induction medium with sucrose or maltose added at the desired concentration, typically 15%). The embryos are allowed to plasmolyze for 2-3 h and are then bombarded. Twenty embryos per target plate is typical, although not critical. An appropriate gene-carrying plasmid (such as pCIB3064 or pSG35) is precipitated onto micrometer size gold particles using standard procedures. Each plate of embryos is shot with the DuPont Biolistics~ helium device using a burst pressure of 1000 psi using a standard 80 mesh screen. After bombardment, the embryos are placed back into the dark to recover for about 24 h (still on osmoticum). After 24 hrs, the embryos are removed from the osmoticum and placed back onto induction medium where they stay for about a month before regeneration. Approximately one month later the embryo explants with developing embryogenic callus are transferred to regeneration medium (MS + 1 mg/liter NAA, 5 mg/liter GA), further containing the appropriate selection agent (10 mg/I basta in the case of pCIB3064 and 2 mg/I methotrexate in the case of pSOG35). After approximately one month, developed~shoots are transferred to larger sterile containers known as "GA7s° that contained half-strength MS, 2% sucrose, and the same concentration of selection agent.
Patent application WO 94/13822 describes methods for wheat transformation and is hereby incorporated by reference.
Example 25: Isolation of the Arabidopsis thaliana Protox-1 Promoter Sequence A Lambda Zap II genomic DNA library prepared from Arabidopsis thaliana (Columbia, whole plant) was purchased from Stratagene. Approximately 125,000 phage were plated at a density of 25,000 pfu per 15 cm Petri dish and duplicate lifts were made onto Colony/Plaque Screen membranes (NEN Dupont). The plaque lifts were probed with the Arabidopsis protox-1 cDNA (SEQ ID N0:1 labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization and wash conditions were at 65°C as described in Church and Gilbert, Proc. Natl. Acad. Sci. USA 81: 1991-1995 (1984).
Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. Sequence from the genomic DNA inserts was determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
One clone, AraPT1 Pro, was determined to contain 580-by of Arabidopsis sequence upstream from the initiating methionine (ATG) of the protox-1 protein coding sequence. This clone also contains coding sequence and introns that extend to-by 1241 of the protox-1 cDNA
sequence. The 580-by 5' noncoding fragment is the putative Arabidopsis protox-promoter, and the sequence is set forth in SEQ ID N0:13.
AraPTiPro was deposited December 15, 1995, as pWDC-11 (NRRL #B-21515) Example 26: Construction of Plant Transformation Vectors Expressing Altered Protox-1 Genes Behind the Native Arabidopsis Protox-1 Promoter A full-length cDNA of the appropriate altered Arabidopsis protox-1 cDNA was isolated as an EcoRl Xhol partial digest fragment and cloned into the plant expression vector pCGN1761 ENX (see Example 9 of International application no. PCT/IB95/00452 filed June 8, 1995, published Dec. 21, 1995 as WO 95/34659). This plasmid was digested with Ncol and BamHl to produce a fragment comprised of the complete protox-1 cDNA plus a transcription terminator from the 3' untranslated sequence of the tml gene of Agrobacterium tumefaciens. The AraPT1 Pro plasmid described above was digested with Ncol and BamHl to produce a fragment comprised of pBluescript and the 580-by putative Arabidopsis protox-1 promoter. Ligation of these two fragments produced a fusion of the altered protox cDNA to the native protox promoter. The expression cassette containing the protox-1 promoter/protox-1 cDNA/tml terminator fusion was excised by digestion with Kpnl and cloned into the binary vector pCIB200. The binary plasmid was transformed by electroporation into Agrobacterium and then into Arabidopsis using the vacuum infiltration method (Bechtold et al., C.R. Acad. Sci. Paris 316: 1194-1199 (1993).
Transformants expressing altered protox genes were selected on kanamycin or on various concentrations of protox inhibiting herbicide.
Example 27: Production of Herbicide Tolerant Plants by Expression of a Native Protox-1 Promoter/Altered Protox-1 Fusion Using the procedure described above, an Arabidopsis protox-1 cDNA containing a TAC to ATG (Tyrosine to Methionine) change at nucleotides 1306-1308 in the protox-1 sequence (SEQ ID N0:1 ) was fused to the native protox-1 promoter fragment and transformed into Arabidopsis thaliana. This altered protox-1 enzyme (AraC-2Met) has been shown to be >10-fold more tolerant to various protox-inhibiting herbicides than the naturally occurring enzyme when tested in the previously described bacterial expression system.
Seed from the vacuum infiltrated plants was collected and plated on a range (lO.OnM-1.OuM) of a protox inhibitory aryluracil herbicide of formula XVII. Multiple experiments with wild type Arabidopsis have shown that a lO.OnM concentration of this compound is sufficient to prevent normal seedling germination. Transgenic seeds expressing the AraC-2Met altered enzyme fused to the native protox-1 promoter produced normal Arabidopsis seedlings at herbicide concentrations up to 500nM, indicating at least 50-fold higher herbicide tolerance when compared to wild-type Arabidopsis. This promoter/altered protox enzyme fusion therefore functions as an effective selectable marker for plant transformation. Several of the plants that germinated on 100.OnM of protox-inhibiting herbicide were transplanted to soil, grown 2-3 weeks, and tested in a spray assay with various concentrations of the protox-inhibiting herbicide. When compared to empty vector control transformants, the AraPT1 Pro/AraC-2Met transgenics were >10-fold more tolerant to the herbicide spray.
EXAMPLE 28: Demonstration of resistant mutations' cross-tolerance to various protox inhibiting compounds in an Arabidopsis germination assay.
Using the procedure described above, an Arabidopsis protox-1 cDNA containing both a TAC to ATC (tyrosine to isoleucine) change at nucleotides 1306-1308 and a TCA to TTA
(serine to leucine) change at nucleotides 945-947 in the protox-1 sequence (SEQ ID N0:1 ) was fused to the native protox-1 promoter fragment and transformed into Arabidopsis thaliana. This altered protox-1 enzyme (AraC-211e + AraC305Leu) has been shown to be >10-fold more tolerant to a protox inhibitory aryluracil herbicide of formula XVII than the naturally occurring enzyme when tested in a bacterial system (see Examples 9-13).
Homozygous Arabidopsis lines containing this fusion were generated from transformants that showed high tolerance to a protox inhibiting herbicide in a seedling germination assay as described above. The seed from one line was tested for cross-tolerance to various protox-inhibitory compounds by repeating the germination assay on concentrations of the compounds that had been shown to inhibit germination of wild-type Arabidopsis.
The results from these experiments are shown in Table 4.
7. Example 29: Isolation of a Maize Protox-1 Promoter Sequence A Zea Mays (Missouri 17 inbred, etiolated seedlings) genomic DNA library in the Lambda FIX II vector was purchased from Stratagene. Approximately 250,000 pfu of the library was plated at a density of 50,000 phage per 15 cm plate and duplicate lifts were made onto Colony/Plaque screen membranes (NEN Dupont). The plaque lifts were probed with the maize protox-1 cDNA (SEQ ID N0:5) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization and wash conditions were at 65°C as described in Church and Gilbert, Proc. Natl. Acad. Sci. USA 81: 1991-1995 (1984).
Lambda phage DNA was isolated from three positively hybridizing phage using the Wizard Lambda Preps DNA Purification System (Promega). Analysis by restriction digest, hybridization patterns, and DNA sequence analysis identified a lambda clone containing approximately 3.5 kb of maize genomic DNA located 5' to the maize protox-1 coding sequence previously isolated as a cDNA clone. This fragment includes the maize protox-1 promoter. The sequence of this fragment is set forth in SEQ ID N0:14. From nucleotide 1 to 3532, this sequence is comprised of 5' noncoding sequence. From nucleotide 3533 to 3848, this sequence encodes the 5' end of the maize protox-1 protein.
A plasmid containing the sequence of SEQ ID N0:14 fused to the remainder of the maize protox-1 coding sequence was deposited March 19, 1996 as pWDC-14 (NRRL
#B-21546).
Example 30: Construction of Plant Transformation Vectors Expressing Altered Protox-1 Genes Behind the Native Maize Protox-1 Promoter The 3848-by maize genomic fragment (SEQ ID N0:14) was excised from the isolated lambda phage clone as a Sall Kpnl partial digest product and ligated to a Kpnl-Notl fragment derived from an altered maize protox-1 cDNA that contained an alanine to leucine change at amino acid 164 (SEQ ID N0:6). This created a fusion of the native maize protox-1 promoter to a full length cDNA that had been shown to confer herbicide tolerance in a bacterial system (Examples 9-14). This fusion was cloned into a pUCl8 derived vector containing the CaMV 35S terminator sequence to create a protox promoter/altered protox cDNA/terminator cassette. The plasmid containing this cassette was designated pWCo-1.
A second construct for maize transformation was created by engineering the first intron found in the coding sequence from the maize genomic clone back into the maize cDNA. The insertion was made using standard overlapping PCR fusion techniques.
The intron (SEQ ID N0:25) was 93-by long and was inserted between nucleotides 203 and 204 of SEQ ID N0:6, exactly as it appeared in natural context in the lambda clone described in Example 29. This intron-containing version of the expression cassette was designated pWCo-2.
8. Example 31: Demonstration of Maize Protox-1 Promoter Activity in Transgenic Maize Plants Maize plants transformed with maize protox promoter/altered protox fusions were identified using PCR analysis with primers specific for the transgene. Total RNA was prepared from the PCR positive plants and reverse-transcribed using Superscript M-MLV
(Life Technologies) under recommended conditions. Two microliters of the reverse transcription reaction was used in a PCR reaction designed to be specific for the altered protox sequence. While untransformed controls give no product in this reaction, approximately 85% of plants transformed with pWCo-1 gave a positive result, indicating the presence of mRNA derived from the transgene. This demonstrates some level of activity for the maize protox promoter. The RNA's from the transgenic maize plants were also subjected to standard northern blot analysis using the radiolabeled maize protox cDNA
fragment from SEQ ID N0:6 as a probe. Protox-1 mRNA levels significantly above those of untransformed controls were detected in some of the transgenic maize plants.
This elevated mRNA level is presumed to be due to expression of altered protox-1 mRNA from the cloned maize protox promoter.
9. Example 32: Isolation of a Sugar Beet Protox-1 Promoter Sequence A genomic sugar beet library was prepared by Stratagene in the Lambda Fix II
vector.
Approximately 300,000 pfu of the library was plated and probed with the sugar beet protox-1 cDNA sequence (SEQ ID N0:17) as described for maize in Example 29. Analysis by restriction digest, hybridization patterns and DNA sequence analysis identified a lambda clone containing approximately 7 kb of sugar beet genomic DNA located 5' to the sugar beet coding sequence previously isolated as a cDNA clone. A Pstl Sall fragment of 2606-bp was subcloned from the lambda clone into a pBluescript vector. This fragment contains 2068-by of 5' noncoding sequence and includes the sugar beet protox-1 promoter sequence. It also includes the first 453-by of the protox-1 coding- sequence and the 85-by first intron contained in the coding sequence. The sequence of this fragment is set forth in SEQ ID N0:26.
A plasmid containing the sequence of SEQ ID N0:26 was deposited December 6, 1996 as pWDC-20 (NRRL #B-21650).
Example 33: Construction of Plant Transformation Vectors Expressing Altered Sugar Beet Protox-1 Genes Behind the Native Sugar Beet Protox-1 Promoter The sugar beet genomic fragment (SEQ ID N0:26) was excised from the genomic subclone described in Example 32 as a Sacl BsrGl fragment that includes 2068-by of 5' noncoding sequence and the first 300-by of the sugar beet protox-1 coding sequence. This fragment was ligated to a BsrGl Notl fragment derived from an altered sugar beet protox-1 cDNA that contained a tyrosine to methionine change at amino acid 449 (SEQ ID
N0:18).
This created a fusion of the native sugar beet protox-1 promoter to a full length cDNA that had been shown to confer herbicide tolerance in a bacterial system (Examples 9-14). This fusion was cloned into a pUCl8 derived vector containing the CaMV 35S
terminator sequence to create a protox promoter/altered protox cDNA/terminator cassette.
The plasmid containing this cassette was designated pWCo-3.
Example 34: Production of Herbicide Tolerant Plants by Expression of a Native Sugar Beet Protox-1 Promoter/Altered Sugar Beet Protox-1 Fusion The expression cassette from pWCo-3 is transformed into sugar beet using any of the transformation methods applicable to dicot plants, including Agrobacterium, protoplast, and biolistic transformation techniques. Transgenic sugar beets expressing the altered protox-1 enzyme are identified by RNA-PCR and tested for tolerance to protox-inhibiting herbicides at concentrations that are lethal to untransformed sugar beets.
Section D: Expression of Protox Genes in Plant Plastids Example 35: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter and Native clpP 5' Untranslated Sequence Fused to a GUS Reporter Gene and Plastid rpsl6 Gene 3' Untranslated Sequence in a Plastid Transformation Vector _87_ I. Amplification of the Tobacco Plastid clpP Gene Promoter and Complete 5' Untranslated RNA (5' UTR).
Total DNA from N. tabacum c.v. "Xanthi NC" was used as the template for PCR
with a left-to-right "top strand" primer comprising an introduced EcoRl restriction site at position -197 relative to the ATG start codon of the constitutively expressed plastid clpP gene (primer Pclp_Pla: 5'-GCGGAATTCATACTTATTTATCATTAGAAAG-3' (SEQ ID N0:27); EcoRl restriction site underlined) and a right-to-left "bottom strand" primer homologous to the region from -21 to -1 relative to the ATG start codon of the clpP promoter that incorporates an introduced Ncol restriction site at the start of translation (primer Pclp_P2b: 5'-GCGCCATGGTAAATGAAAGAAAGAACTAAA-3' (SEQ ID N0:28); Ncol restriction site underlined). This PCR reaction was undertaken with Pfu thermostable DNA
polymerase (Stratagene, La Jolla CA) in a Perkin Elmer Thermal Cycler 480 according to the manufacturer's recommendations (Perkin Elmer/Roche, Branchburg, NJ) as follows: 7 min 95°C, followed by 4 cycles of 1 min 95°C / 2 min 43°C / 1 min 72°C, then 25 cycles of 1 min 95°C / 2 min 55°C / 1 min 72°C. The 213-by amplification product comprising the promoter and 5' untranslated region of the clpP gene containing an EcoRl site at its left end and an Ncol site at its right end and corresponding to nucleotides 74700 to 74505 of the N.
tabacum plastid DNA sequence (Shinozaki et al., EMBO J. 5: 2043-2049 (1986)) was gel purified using standard procedures and digested with EcoRl and Ncol (all restriction enzymes were purchased from New England Biolabs, Beverly, MA).
Amplification of the Tobacco Plastid rpsl6 Gene 3' Untranslated RNA Sequence (3'UTR).
Total DNA from N. tabacum c.v. "Xanthi NC" was used as the template for PCR as described above with a left-to-right °top strand° primer comprising an introduced Xbal restriction site immediately following the TAA stop codon of the plastid rpsl6 gene encoding ribosomal protein S16 (primer rpsi 6P_1 a (5'-GCGTCTAGATCAACCGAAATTCAATTAAGG-3' (SEQ ID N0:30); Xbal restriction site underlined) and a right-to-left "bottom strand" primer homologous to the region from +134 to +151 relative to the TAA stop codon of rpsl6 that incorporates an introduced Hindlll restriction site at the 3' end of the rpsl6 3' UTR (primer rpsl 6P_1 b (5'-_88_ CGCAAGCTTCAATGGAAGCAATGATAA-3' (SEQ ID N0:31 ); Hindlll restriction site underlined). The 169-by amplification product comprising the 3' untranslated region of the rpsl6 gene containing an Xbal site at its left end and a Hindlll site at its right end and containing the region corresponding to nucleotides 4943 to 5093 of the N.
tabacum plastid DNA sequence (Shinozaki et al., 1986) was gel purified and digested with Xbal and Hindlll.
III. Ligation of a GUS Reporter Gene Fragment to the clpP Gene Promoter and 5' and 3' UTR's An 1864-by ~i-glucuronidase (GUS) reporter gene fragment derived from plasmid pRAJ275 (Clontech) containing an Ncol restriction site at the ATG start codon and an Xbal site following the native 3' UTR was produced by digestion with Ncol and Xbal.
This fragment was ligated in a four-way reaction to the 201-by EcoRllNcol clpP
promoter fragment, the 157-by XballHindlll rps163'UTR fragment, and a 3148-by EcoRllHindlll fragment from cloning vector pGEM3Zf(-) (Promega, Madison WI) to construct plasmid pPH138. Plastid transformation vector pPH140 was constructed by digesting plasmid pPRV111 a (Zoubenko et al. 1994) with EcoRl and Hindlll and ligating the resulting 7287-by fragment to a 2222-by EcoRllHindlll fragment of pPH138.
Example 36: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter Plus Tobacco Plastid psbA Gene Minimal 5' Untranslated Sequence Fused to a GUS Reporter Gene and Plastid rpsl6 Gene 3' Untranslated Sequence in a Plastid Transformation Vector Amplification of the tobacco plastid clpP gene promoter and truncated 5' untranslated RNA (5' UTR): Total DNA from N. tabacum c.v. "Xanthi NC" was used as the template for PCR as described above with the left-to-right "top strand" primer Pclp P1 a (SEQ ID N0:27) and a right-to-left "bottom strand" primer homologous to the region from -34 to -11 relative to the ATG start codon of the clpP promoter that incorporates an introduced Xbal restriction site in the clpP 5' UTR at position -11 (primer Pclp P1 b: 5'-GCGTCTAGAAAGAACTAAATACTATATTTCAC-3' (SEQ ID N0:29); Xbal restriction site underlined). The 202-by amplification product comprising the promoter and truncated 5' UTR of the clpP gene containing an EcoRl site at its left end and an Xbal site at its right _89_ end was gel purified and digested with Xbal. The Xbal site was subsequently filled in with Klenow DNA polymerase (New England Biolabs) and the fragment digested with EcoRl.
This was ligated in a five-way reaction to a double stranded DNA fragment corresponding to the final 38 nucleotides and ATG start codon of the tobacco plastid psbA gene 5' UTR (with an Ncol restriction site overhang introduced into the ATG start codon) that was created by annealing the synthetic oligonucleotides minpsb_U (top strand: 5'-GGGAGTCCCTGATGATTAAATAAACCAAGATTTTAC-3' (SEQ ID N0:32)) and minpsb_L
(bottom strand: 5'-CATGGTAAAATCTTGGTTTATTTAATCATCAGGGACTCCC-3' (SEQ ID
N0:33); Ncol restriction site 5' overhang underlined), the NcollXbal GUS
reporter gene fragment described above, the XballHindlll rps163'UTR fragment described above, and the EcoRllHindlll pGEM3Zf(-) fragment described above to construct plasmid pPH139.
Plastid transformation vector pPH144 was constructed by digesting plasmid pPRV111a (Zoubenko, et al., Nucleic Acids Res 22: 3819-3824 (1994)) with EcoRl and Hindlll and ligating the resulting 7287-by fragment to a 2251-by EcoRllHindlll fragment of pPH139.
Example 37: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter and Complete 5' Untranslated Sequence Fused to the Arabidopsis thaliana Protox-1 Coding Sequence and Plastid rpsl6 Gene 3' Untranslated Sequence in a Vector for Tobacco Plastid Transformation Miniprep DNA from plasmid AraC-2Met carrying an Arabidopsis thaliana Notl insert that includes cDNA sequences from the Protoporphyrinogen IX Oxidase ("protox") gene encoding a portion of the amino terminal plastid transit peptide, the full-length cDNA and a portion of the 3' untranslated region was used as the template for PCR as described above using a left-to-right "top strand" primer (with homology to nucleotides +172 to +194 relative to the ATG start codon of the full length precursor protein) comprising an introduced Ncol restriction site and new ATG start codon at the deduced start of the mature protox protein coding sequence (primer APRTXP1 a: 5'-GGGACCATGGATTGTGTGATTGTCGGCGGAGG-3' (SEQ ID N0:34); Ncol restriction site underlined) and a right-to-left "bottom strand" primer homologous to nucleotides +917 to +940 relative to the native ATG start codon of the protox precursor protein (primer APRTXP1 b: 5'- CTCCGCTCTCCAGCTTAGTGATAC-3' (SEQ ID N0:35)). The 778-by product was digested with Ncol and Sful and the resulting 682-by fragment ligated to an 844-by SfullNotl DNA fragment of AraC-2Met comprising the 3' portion of the protox coding sequence and a 2978-by NcollNotl fragment of the cloning vector pGEMSZf(+) (Promega, Madison WI) to construct plasmid pPH141. Plastid transformation vector pPH143 containing the clpP promoter driving the Formula XVII-resistant AraC-2Met protox gene with the rpsl63' UTR was constructed by digesting pPH141 with Ncol and Sspl and isolating the 1491-by fragment containing the complete protox coding sequence, digesting the rpsl 6P_1 a and rpsl 6P_1 b PCR product described above with Hindlll, and ligating these to a 7436-by NcollHindlll fragment of pPH140.
Example 38: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter Plus Tobacco Plastid psbA Gene Minimal 5' Untranslated Sequence Fused to the Arabidopsis thaliana Protox-1 Coding Sequence and Plastid rpsl6 Gene 3' Untranslated Sequence in a Vector for Tobacco Plastid Transformation Plastid transformation vector pPH145 containing the clpP promoter/psbA 5' UTR
fusion driving the Formula XVII-resistant AraC-2Met protox gene with the rpsl6 3' UTR was constructed by digesting pPH141 with Ncol and Sspl and isolating the 1491-by fragment containing the complete protox coding sequence, digesting the rpsl 6P_1 a and rpsl 6P_1 b PCR product described above with Hindlll, and ligating these to a 7465-by NcollHindlll fragment of pPH144.
Example 39: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter and 5' Untranslated Sequence Fused to the EPSP Synthase Coding Sequence and Plastid rpsl6 Gene 3' Untranslated Sequence in a Vector for Tobacco Plastid Transformation A cDNA library is screened for the 5-enolpyruvyl-3-phosphoshikimate synthase (EPSP synthase) gene (U.S. Patent Nos. 5,310,667, 5,312,910, and 5,633,435, all incorporated herein by reference). A plasmid clone containing the full length EPSP
synthase gene cDNA is isolated by standard techniques of molecular cloning.
PCR primers are designed for amplification of the mature-size EPSP synthase coding sequence from this plasmid using a top strand primer having a 5' extension containing an Ncol restriction site inserted at amino acid -1 from the deduced mature protein start, thus creating an ATG start codon at this position, and a bottom strand primer having a 5' extension containing an Xbal restriction site downstream of the stop codon of the EPSP mature coding sequence in the amplified PCR product. The PCR amplification is performed using the designated primers and plasmid DNA template according to standard protocols. Amplified products are cloned and sequenced and a Ncol Xbal DNA fragment containing the complete mature EPSP
synthase coding sequence is isolated by restriction digest with Ncol and Xbal, electrophoresis on a 0.8% TAE agarose gel, and phenol extraction of the excised band.
A plastid transformation vector containing the clpP promoter directing transcription of the mature-sized EPSP synthase gene with the rpsi6 3' UTR is constructed by digesting pPH140 with Ncol and Xbal and purifying the fragment containing the vector backbone, 5' and 3' plastid integration targeting sequences, aadA selectable marker cassette, and clpP
promoter / rpsl6 3' UTR expression sequences. This product is ligated in a two-way reaction with the Ncol Xbal DNA fragment containing the mature-sized EPSP
synthase coding sequence isolated as described above.
Example 40: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter and 5' Untranslated Sequence Fused to the ALS Coding Sequence and Plastid rpsl6 Gene 3' Untranslated Sequence in a Vector for Tobacco Plastid Transformation A cDNA library is screened for the acetolactate synthase (ALS) gene (U.S.
Patent No. 5,013,659). A plasmid clone containing the full length ALS gene cDNA is isolated by standard techniques of molecular cloning. PCR primers are designed for amplification of the _92_ mature-size ALS coding sequence from this plasmid using a top strand primer having a 5' extension containing an Ncol restriction site inserted at amino acid -1 from the deduced mature protein start, thus creating an ATG start codon at this position, and a bottom strand primer having a 5' extension containing an Xbal restriction site downstream of the stop codon of the ALS mature coding sequence in the amplified PCR product. The PCR
amplification is performed using the designated primers and plasmid DNA
template according to standard protocols. Amplified products are cloned and sequenced and a Ncol Xbal DNA fragment containing the complete mature ALS coding sequence is isolated by restriction digest with Ncol and Xbal, electrophoresis on a 0.8% TAE agarose gel, and phenol extraction of the excised band.
A plastid transformation vector containing the clpP promoter driving the mature-sized ALS gene with the rpsi63' UTR is constructed by digesting pPH140 with Ncol and Xbal and purifying the fragment containing the vector backbone, 5' and 3' plastid integration targeting sequences, aadA selectable marker cassette, and clpP promoter /
rpsl6 3' UTR
expression sequences. This product is ligated in a two-way reaction with the Ncol Xbal DNA fragment containing the mature-sized ALS coding sequence isolated as described above.
Example 41: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter and 5' Untranslated Sequence Fused to the AHAS Coding Sequence and Plastid rpsl6 Gene 3' Untranslated Sequence in a Vector for Tobacco Plastid Transformation A cDNA library is screened for the acetohydroxyacid synthase (AHAS) gene (U.S.
Patent No. 4,761,373). A plasmid clone containing the full length AHAS gene cDNA is isolated by standard techniques of molecular cloning. PCR primers are designed for amplification of the mature-size AHAS coding sequence from this plasmid using a top strand primer having a 5' extension containing an Ncol restriction site inserted at amino acid -1 from the deduced mature protein start, thus creating an ATG start codon at this position, and a bottom strand primer having a 5' extension containing an Xbal restriction site downstream of the stop codon of the AHAS mature coding sequence in the amplified PCR
product. The PCR amplification is performed using the designated primers and plasmid DNA template according to standard protocols. Amplified products are cloned and sequenced and a Ncol Xbal DNA fragment containing the complete mature AHAS
coding sequence is isolated by restriction digest with Ncol and Xbal, electrophoresis on a 0.8%
TAE agarose gel, and phenol extraction of the excised band.
A plastid transformation vector containing the clpP promoter driving the mature-sized AHAS gene with the rps163' UTR is constructed by digesting pPH140 with Ncol and Xbal and purifying the fragment containing the vector backbone, 5' and 3' plastid integration targeting sequences, aadA selectable marker cassette, and clpP promoter /
rpsl6 3' UTR
expression sequences. This product is ligated in a two-way reaction with the Ncol-Xbal DNA fragment containing the mature-sized AHAS coding sequence isolated as described above.
Example 42: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter and 5' Untranslated Sequence Fused to the ACCase Coding Sequence and Plastid rpsl6 Gene 3' Untranslated Sequence in a Vector for Tobacco Plastid Transformation A cDNA library is screened for the acetylcoenzyme A carboxylase (ACCase) gene (U.S. Patent No. 5,162,602). A plasmid clone containing the full length ACCase gene cDNA is isolated by standard techniques of molecular cloning. PCR primers are designed for amplification of the mature-size ACCase coding sequence from this plasmid using a top strand primer having a 5' extension containing an Ncol restriction site inserted at amino acid -1 from the deduced mature protein start, thus creating an ATG start codon at this position, and a bottom strand primer having a 5' extension containing an Xbal restriction site downstream of the stop codon of the ACCase mature coding sequence in the amplified PCR product. The PCR amplification is performed using the designated primers and plasmid DNA template according to standard protocols. Amplified products are cloned and sequenced and a Ncol Xbal DNA fragment containing the complete mature ACCase coding sequence is isolated by restriction digest with Ncol and Xbal, electrophoresis on a 0.8% TAE agarose gel, and phenol extraction of the excised band.
A plastid transformation vector containing the clpP promoter driving the mature-sized ACCase gene with the rpsi6 3' UTR is constructed by digesting pPH140 with Ncol and Xbal and purifying the fragment containing the vector backbone, 5' and 3' plastid integration targeting sequences, aadA selectable marker cassette, and clpP promoter /
rpsi6 3' UTR
expression sequences. This product is ligated in a two-way reaction with the Ncol Xbal DNA fragment containing the mature-sized ACCase coding sequence isolated as described above.
vector.
Approximately 300,000 pfu of the library was plated and probed with the sugar beet protox-1 cDNA sequence (SEQ ID N0:17) as described for maize in Example 29. Analysis by restriction digest, hybridization patterns and DNA sequence analysis identified a lambda clone containing approximately 7 kb of sugar beet genomic DNA located 5' to the sugar beet coding sequence previously isolated as a cDNA clone. A Pstl Sall fragment of 2606-bp was subcloned from the lambda clone into a pBluescript vector. This fragment contains 2068-by of 5' noncoding sequence and includes the sugar beet protox-1 promoter sequence. It also includes the first 453-by of the protox-1 coding- sequence and the 85-by first intron contained in the coding sequence. The sequence of this fragment is set forth in SEQ ID N0:26.
A plasmid containing the sequence of SEQ ID N0:26 was deposited December 6, 1996 as pWDC-20 (NRRL #B-21650).
Example 33: Construction of Plant Transformation Vectors Expressing Altered Sugar Beet Protox-1 Genes Behind the Native Sugar Beet Protox-1 Promoter The sugar beet genomic fragment (SEQ ID N0:26) was excised from the genomic subclone described in Example 32 as a Sacl BsrGl fragment that includes 2068-by of 5' noncoding sequence and the first 300-by of the sugar beet protox-1 coding sequence. This fragment was ligated to a BsrGl Notl fragment derived from an altered sugar beet protox-1 cDNA that contained a tyrosine to methionine change at amino acid 449 (SEQ ID
N0:18).
This created a fusion of the native sugar beet protox-1 promoter to a full length cDNA that had been shown to confer herbicide tolerance in a bacterial system (Examples 9-14). This fusion was cloned into a pUCl8 derived vector containing the CaMV 35S
terminator sequence to create a protox promoter/altered protox cDNA/terminator cassette.
The plasmid containing this cassette was designated pWCo-3.
Example 34: Production of Herbicide Tolerant Plants by Expression of a Native Sugar Beet Protox-1 Promoter/Altered Sugar Beet Protox-1 Fusion The expression cassette from pWCo-3 is transformed into sugar beet using any of the transformation methods applicable to dicot plants, including Agrobacterium, protoplast, and biolistic transformation techniques. Transgenic sugar beets expressing the altered protox-1 enzyme are identified by RNA-PCR and tested for tolerance to protox-inhibiting herbicides at concentrations that are lethal to untransformed sugar beets.
Section D: Expression of Protox Genes in Plant Plastids Example 35: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter and Native clpP 5' Untranslated Sequence Fused to a GUS Reporter Gene and Plastid rpsl6 Gene 3' Untranslated Sequence in a Plastid Transformation Vector _87_ I. Amplification of the Tobacco Plastid clpP Gene Promoter and Complete 5' Untranslated RNA (5' UTR).
Total DNA from N. tabacum c.v. "Xanthi NC" was used as the template for PCR
with a left-to-right "top strand" primer comprising an introduced EcoRl restriction site at position -197 relative to the ATG start codon of the constitutively expressed plastid clpP gene (primer Pclp_Pla: 5'-GCGGAATTCATACTTATTTATCATTAGAAAG-3' (SEQ ID N0:27); EcoRl restriction site underlined) and a right-to-left "bottom strand" primer homologous to the region from -21 to -1 relative to the ATG start codon of the clpP promoter that incorporates an introduced Ncol restriction site at the start of translation (primer Pclp_P2b: 5'-GCGCCATGGTAAATGAAAGAAAGAACTAAA-3' (SEQ ID N0:28); Ncol restriction site underlined). This PCR reaction was undertaken with Pfu thermostable DNA
polymerase (Stratagene, La Jolla CA) in a Perkin Elmer Thermal Cycler 480 according to the manufacturer's recommendations (Perkin Elmer/Roche, Branchburg, NJ) as follows: 7 min 95°C, followed by 4 cycles of 1 min 95°C / 2 min 43°C / 1 min 72°C, then 25 cycles of 1 min 95°C / 2 min 55°C / 1 min 72°C. The 213-by amplification product comprising the promoter and 5' untranslated region of the clpP gene containing an EcoRl site at its left end and an Ncol site at its right end and corresponding to nucleotides 74700 to 74505 of the N.
tabacum plastid DNA sequence (Shinozaki et al., EMBO J. 5: 2043-2049 (1986)) was gel purified using standard procedures and digested with EcoRl and Ncol (all restriction enzymes were purchased from New England Biolabs, Beverly, MA).
Amplification of the Tobacco Plastid rpsl6 Gene 3' Untranslated RNA Sequence (3'UTR).
Total DNA from N. tabacum c.v. "Xanthi NC" was used as the template for PCR as described above with a left-to-right °top strand° primer comprising an introduced Xbal restriction site immediately following the TAA stop codon of the plastid rpsl6 gene encoding ribosomal protein S16 (primer rpsi 6P_1 a (5'-GCGTCTAGATCAACCGAAATTCAATTAAGG-3' (SEQ ID N0:30); Xbal restriction site underlined) and a right-to-left "bottom strand" primer homologous to the region from +134 to +151 relative to the TAA stop codon of rpsl6 that incorporates an introduced Hindlll restriction site at the 3' end of the rpsl6 3' UTR (primer rpsl 6P_1 b (5'-_88_ CGCAAGCTTCAATGGAAGCAATGATAA-3' (SEQ ID N0:31 ); Hindlll restriction site underlined). The 169-by amplification product comprising the 3' untranslated region of the rpsl6 gene containing an Xbal site at its left end and a Hindlll site at its right end and containing the region corresponding to nucleotides 4943 to 5093 of the N.
tabacum plastid DNA sequence (Shinozaki et al., 1986) was gel purified and digested with Xbal and Hindlll.
III. Ligation of a GUS Reporter Gene Fragment to the clpP Gene Promoter and 5' and 3' UTR's An 1864-by ~i-glucuronidase (GUS) reporter gene fragment derived from plasmid pRAJ275 (Clontech) containing an Ncol restriction site at the ATG start codon and an Xbal site following the native 3' UTR was produced by digestion with Ncol and Xbal.
This fragment was ligated in a four-way reaction to the 201-by EcoRllNcol clpP
promoter fragment, the 157-by XballHindlll rps163'UTR fragment, and a 3148-by EcoRllHindlll fragment from cloning vector pGEM3Zf(-) (Promega, Madison WI) to construct plasmid pPH138. Plastid transformation vector pPH140 was constructed by digesting plasmid pPRV111 a (Zoubenko et al. 1994) with EcoRl and Hindlll and ligating the resulting 7287-by fragment to a 2222-by EcoRllHindlll fragment of pPH138.
Example 36: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter Plus Tobacco Plastid psbA Gene Minimal 5' Untranslated Sequence Fused to a GUS Reporter Gene and Plastid rpsl6 Gene 3' Untranslated Sequence in a Plastid Transformation Vector Amplification of the tobacco plastid clpP gene promoter and truncated 5' untranslated RNA (5' UTR): Total DNA from N. tabacum c.v. "Xanthi NC" was used as the template for PCR as described above with the left-to-right "top strand" primer Pclp P1 a (SEQ ID N0:27) and a right-to-left "bottom strand" primer homologous to the region from -34 to -11 relative to the ATG start codon of the clpP promoter that incorporates an introduced Xbal restriction site in the clpP 5' UTR at position -11 (primer Pclp P1 b: 5'-GCGTCTAGAAAGAACTAAATACTATATTTCAC-3' (SEQ ID N0:29); Xbal restriction site underlined). The 202-by amplification product comprising the promoter and truncated 5' UTR of the clpP gene containing an EcoRl site at its left end and an Xbal site at its right _89_ end was gel purified and digested with Xbal. The Xbal site was subsequently filled in with Klenow DNA polymerase (New England Biolabs) and the fragment digested with EcoRl.
This was ligated in a five-way reaction to a double stranded DNA fragment corresponding to the final 38 nucleotides and ATG start codon of the tobacco plastid psbA gene 5' UTR (with an Ncol restriction site overhang introduced into the ATG start codon) that was created by annealing the synthetic oligonucleotides minpsb_U (top strand: 5'-GGGAGTCCCTGATGATTAAATAAACCAAGATTTTAC-3' (SEQ ID N0:32)) and minpsb_L
(bottom strand: 5'-CATGGTAAAATCTTGGTTTATTTAATCATCAGGGACTCCC-3' (SEQ ID
N0:33); Ncol restriction site 5' overhang underlined), the NcollXbal GUS
reporter gene fragment described above, the XballHindlll rps163'UTR fragment described above, and the EcoRllHindlll pGEM3Zf(-) fragment described above to construct plasmid pPH139.
Plastid transformation vector pPH144 was constructed by digesting plasmid pPRV111a (Zoubenko, et al., Nucleic Acids Res 22: 3819-3824 (1994)) with EcoRl and Hindlll and ligating the resulting 7287-by fragment to a 2251-by EcoRllHindlll fragment of pPH139.
Example 37: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter and Complete 5' Untranslated Sequence Fused to the Arabidopsis thaliana Protox-1 Coding Sequence and Plastid rpsl6 Gene 3' Untranslated Sequence in a Vector for Tobacco Plastid Transformation Miniprep DNA from plasmid AraC-2Met carrying an Arabidopsis thaliana Notl insert that includes cDNA sequences from the Protoporphyrinogen IX Oxidase ("protox") gene encoding a portion of the amino terminal plastid transit peptide, the full-length cDNA and a portion of the 3' untranslated region was used as the template for PCR as described above using a left-to-right "top strand" primer (with homology to nucleotides +172 to +194 relative to the ATG start codon of the full length precursor protein) comprising an introduced Ncol restriction site and new ATG start codon at the deduced start of the mature protox protein coding sequence (primer APRTXP1 a: 5'-GGGACCATGGATTGTGTGATTGTCGGCGGAGG-3' (SEQ ID N0:34); Ncol restriction site underlined) and a right-to-left "bottom strand" primer homologous to nucleotides +917 to +940 relative to the native ATG start codon of the protox precursor protein (primer APRTXP1 b: 5'- CTCCGCTCTCCAGCTTAGTGATAC-3' (SEQ ID N0:35)). The 778-by product was digested with Ncol and Sful and the resulting 682-by fragment ligated to an 844-by SfullNotl DNA fragment of AraC-2Met comprising the 3' portion of the protox coding sequence and a 2978-by NcollNotl fragment of the cloning vector pGEMSZf(+) (Promega, Madison WI) to construct plasmid pPH141. Plastid transformation vector pPH143 containing the clpP promoter driving the Formula XVII-resistant AraC-2Met protox gene with the rpsl63' UTR was constructed by digesting pPH141 with Ncol and Sspl and isolating the 1491-by fragment containing the complete protox coding sequence, digesting the rpsl 6P_1 a and rpsl 6P_1 b PCR product described above with Hindlll, and ligating these to a 7436-by NcollHindlll fragment of pPH140.
Example 38: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter Plus Tobacco Plastid psbA Gene Minimal 5' Untranslated Sequence Fused to the Arabidopsis thaliana Protox-1 Coding Sequence and Plastid rpsl6 Gene 3' Untranslated Sequence in a Vector for Tobacco Plastid Transformation Plastid transformation vector pPH145 containing the clpP promoter/psbA 5' UTR
fusion driving the Formula XVII-resistant AraC-2Met protox gene with the rpsl6 3' UTR was constructed by digesting pPH141 with Ncol and Sspl and isolating the 1491-by fragment containing the complete protox coding sequence, digesting the rpsl 6P_1 a and rpsl 6P_1 b PCR product described above with Hindlll, and ligating these to a 7465-by NcollHindlll fragment of pPH144.
Example 39: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter and 5' Untranslated Sequence Fused to the EPSP Synthase Coding Sequence and Plastid rpsl6 Gene 3' Untranslated Sequence in a Vector for Tobacco Plastid Transformation A cDNA library is screened for the 5-enolpyruvyl-3-phosphoshikimate synthase (EPSP synthase) gene (U.S. Patent Nos. 5,310,667, 5,312,910, and 5,633,435, all incorporated herein by reference). A plasmid clone containing the full length EPSP
synthase gene cDNA is isolated by standard techniques of molecular cloning.
PCR primers are designed for amplification of the mature-size EPSP synthase coding sequence from this plasmid using a top strand primer having a 5' extension containing an Ncol restriction site inserted at amino acid -1 from the deduced mature protein start, thus creating an ATG start codon at this position, and a bottom strand primer having a 5' extension containing an Xbal restriction site downstream of the stop codon of the EPSP mature coding sequence in the amplified PCR product. The PCR amplification is performed using the designated primers and plasmid DNA template according to standard protocols. Amplified products are cloned and sequenced and a Ncol Xbal DNA fragment containing the complete mature EPSP
synthase coding sequence is isolated by restriction digest with Ncol and Xbal, electrophoresis on a 0.8% TAE agarose gel, and phenol extraction of the excised band.
A plastid transformation vector containing the clpP promoter directing transcription of the mature-sized EPSP synthase gene with the rpsi6 3' UTR is constructed by digesting pPH140 with Ncol and Xbal and purifying the fragment containing the vector backbone, 5' and 3' plastid integration targeting sequences, aadA selectable marker cassette, and clpP
promoter / rpsl6 3' UTR expression sequences. This product is ligated in a two-way reaction with the Ncol Xbal DNA fragment containing the mature-sized EPSP
synthase coding sequence isolated as described above.
Example 40: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter and 5' Untranslated Sequence Fused to the ALS Coding Sequence and Plastid rpsl6 Gene 3' Untranslated Sequence in a Vector for Tobacco Plastid Transformation A cDNA library is screened for the acetolactate synthase (ALS) gene (U.S.
Patent No. 5,013,659). A plasmid clone containing the full length ALS gene cDNA is isolated by standard techniques of molecular cloning. PCR primers are designed for amplification of the _92_ mature-size ALS coding sequence from this plasmid using a top strand primer having a 5' extension containing an Ncol restriction site inserted at amino acid -1 from the deduced mature protein start, thus creating an ATG start codon at this position, and a bottom strand primer having a 5' extension containing an Xbal restriction site downstream of the stop codon of the ALS mature coding sequence in the amplified PCR product. The PCR
amplification is performed using the designated primers and plasmid DNA
template according to standard protocols. Amplified products are cloned and sequenced and a Ncol Xbal DNA fragment containing the complete mature ALS coding sequence is isolated by restriction digest with Ncol and Xbal, electrophoresis on a 0.8% TAE agarose gel, and phenol extraction of the excised band.
A plastid transformation vector containing the clpP promoter driving the mature-sized ALS gene with the rpsi63' UTR is constructed by digesting pPH140 with Ncol and Xbal and purifying the fragment containing the vector backbone, 5' and 3' plastid integration targeting sequences, aadA selectable marker cassette, and clpP promoter /
rpsl6 3' UTR
expression sequences. This product is ligated in a two-way reaction with the Ncol Xbal DNA fragment containing the mature-sized ALS coding sequence isolated as described above.
Example 41: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter and 5' Untranslated Sequence Fused to the AHAS Coding Sequence and Plastid rpsl6 Gene 3' Untranslated Sequence in a Vector for Tobacco Plastid Transformation A cDNA library is screened for the acetohydroxyacid synthase (AHAS) gene (U.S.
Patent No. 4,761,373). A plasmid clone containing the full length AHAS gene cDNA is isolated by standard techniques of molecular cloning. PCR primers are designed for amplification of the mature-size AHAS coding sequence from this plasmid using a top strand primer having a 5' extension containing an Ncol restriction site inserted at amino acid -1 from the deduced mature protein start, thus creating an ATG start codon at this position, and a bottom strand primer having a 5' extension containing an Xbal restriction site downstream of the stop codon of the AHAS mature coding sequence in the amplified PCR
product. The PCR amplification is performed using the designated primers and plasmid DNA template according to standard protocols. Amplified products are cloned and sequenced and a Ncol Xbal DNA fragment containing the complete mature AHAS
coding sequence is isolated by restriction digest with Ncol and Xbal, electrophoresis on a 0.8%
TAE agarose gel, and phenol extraction of the excised band.
A plastid transformation vector containing the clpP promoter driving the mature-sized AHAS gene with the rps163' UTR is constructed by digesting pPH140 with Ncol and Xbal and purifying the fragment containing the vector backbone, 5' and 3' plastid integration targeting sequences, aadA selectable marker cassette, and clpP promoter /
rpsl6 3' UTR
expression sequences. This product is ligated in a two-way reaction with the Ncol-Xbal DNA fragment containing the mature-sized AHAS coding sequence isolated as described above.
Example 42: Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP
Gene Promoter and 5' Untranslated Sequence Fused to the ACCase Coding Sequence and Plastid rpsl6 Gene 3' Untranslated Sequence in a Vector for Tobacco Plastid Transformation A cDNA library is screened for the acetylcoenzyme A carboxylase (ACCase) gene (U.S. Patent No. 5,162,602). A plasmid clone containing the full length ACCase gene cDNA is isolated by standard techniques of molecular cloning. PCR primers are designed for amplification of the mature-size ACCase coding sequence from this plasmid using a top strand primer having a 5' extension containing an Ncol restriction site inserted at amino acid -1 from the deduced mature protein start, thus creating an ATG start codon at this position, and a bottom strand primer having a 5' extension containing an Xbal restriction site downstream of the stop codon of the ACCase mature coding sequence in the amplified PCR product. The PCR amplification is performed using the designated primers and plasmid DNA template according to standard protocols. Amplified products are cloned and sequenced and a Ncol Xbal DNA fragment containing the complete mature ACCase coding sequence is isolated by restriction digest with Ncol and Xbal, electrophoresis on a 0.8% TAE agarose gel, and phenol extraction of the excised band.
A plastid transformation vector containing the clpP promoter driving the mature-sized ACCase gene with the rpsi6 3' UTR is constructed by digesting pPH140 with Ncol and Xbal and purifying the fragment containing the vector backbone, 5' and 3' plastid integration targeting sequences, aadA selectable marker cassette, and clpP promoter /
rpsi6 3' UTR
expression sequences. This product is ligated in a two-way reaction with the Ncol Xbal DNA fragment containing the mature-sized ACCase coding sequence isolated as described above.
10. Example 43: Biolistic Transformation of the Tobacco Plastid Genome Seeds of Nicotiana tabacum c.v. 'Xanthi nc' were germinated seven per plate in a 1"
circular array on T agar medium and bombarded 12-14 days after sowing with 1 L~m tungsten particles (M10, Biorad, Hercules, CA) coated with DNA from plasmids pPH143 and pPH145 essentially as described in Svab, Z. and Maliga, P. (1993) PNAS 90, 913-917.
Bombarded seedlings were incubated on T medium for two days after which leaves were excised and placed abaxial side up in bright light (350-500 Nmol photons/m2/s) on plates of RMOP medium (Svab, Z., Hajdukiewicz, P. and Maliga, P. (1990) PNAS 87, 8526-8530) containing 500 Ng/ml spectinomycin dihydrochloride (Sigma, St. Louis, MO).
Resistant shoots appearing underneath the bleached leaves three to eight weeks after bombardment were subcloned onto the same selective medium, allowed to form callus, and secondary shoots isolated and subcloned. Complete segregation of transformed plastid genome copies (homoplasmicity) in independent subclones was assessed by standard techniques of Southern blotting (Sambrook et al., (1989) Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor). BamHllEcoRl digested total cellular DNA
(Mettler, I. J. (1987) Plant Mol Biol Reporter5, 346-349) was separated on 1%
Tris-borate (TBE) agarose gels, transferred to nylon membranes (Amersham) and probed with labeled random primed DNA sequences corresponding to a 0.7 kb BamHllHindlll DNA
fragment from pC8 containing a portion of the rps7/12 plastid targeting sequence.
Homoplasmic shoots are rooted aseptically on spectinomycin-containing MS/IBA
medium (McBride, K. E. et al. (1994) PNAS 91, 7301-7305) and transferred to the greenhouse.
Example 44: Assessment of Herbicide Tolerance in Nt-pPH143 and Nt-pPH145 Plastid Transformant Lines Primary homoplasmic transformant lines transformed with pPH143 (line Nt-pPH143) or with pPH145 (line Nt-pPH145), which were obtained as described in Example 43, were grown to maturity in the greenhouse. Flowers were either: (a) self-pollinated, (b) pollinated with wildtype tobacco (c.v. Xanthi nc), or (c) used as pollen donors to fertilize emasculated flowers of wildtype Xanthi plants. Plastid segregation of the linked spectinomycin resistance marker was verified by uniparental female inheritance of the spectinomycin-resistance phenotype in each transformant line using a minimum of 50 seeds per selection pool derived from either selfed or backcross capsules. Additional self or wildtype backcross (Xanthi pollen parent) seeds were germinated in soil. 36 plants of each line (143 1 B-1, 143 1 B-4, 143 4A-2, 143 4A-5, 145 7A-5, 145 7A-6, 145 8A-3) plus 36 wildtype Xanthi plants as isogenic controls were grown in separate 6" clay pots in a controlled environment cubicle.
In order to assess tolerance to the protox inhibitor Formula XVII, plants of Xanthi and the seven transformant lines were distributed into eight identical 16-pot flats (2 plants of each type per flat). The flats were sprayed with Formula XVII until runoff at concentrations of either 0, 0.5, 2.5, 5, 10, 25, 50, or 100 mg Formula XVII per liter. Solutions were made up in water using 4 g/liter or 40 g/liter stock solutions of Formula XVII
dissolved in dimethylsulfoxide (DMSO) and used immediately after preparation. Twenty microliters of the wetting agent Silwett was added to each 200 ml volume of herbicide solution for a final concentration of 0.01 %. Flats were sprayed in the late afternoon and allowed to dry overnight before transfer to the growth cubicle. Tolerance was assesed by comparing leaf damage and wilting to the untransformed Xanthi controls at 0, 18 hrs, 48 hrs, and 6 days post-application. Severe damage was apparent on the Xanthi plants at all concentrations above 0.5 mg/I, and complete wilting/burn down occurred above 2.5 mg/I. Only slight damage occurred on the Nt_pPH143 plants even at the highest concentration (100 mg/liter), and the plants soon outgrew the bleached spots (the appearance of Xanthi at 0.5 mg/liter was approximately equivalent to Nt_pPH143 1 B-1 at 100 mg/liter, giving a tolerance of ca. 200-fold).
Example 45: Plastid Transformation of Maize Type I embryogenic callus cultures (Green et al. (1983) in A. Fazelahmad, K.
Downey, J. Schultz, R.W. Voellmy, eds. Advances in Gene Technology: Molecular Genetics of Plants and Animals. Miami Winter Symposium Series, Vol. 20.
Academic Press, N.Y.) of the proprietary genotypes CG00526 and CG00714 are initiated from immature embryos, 1.5 - 2.5 mm in length, from greenhouse grown material. Embryos are aseptically excised from surface-sterilized ears approximately 14 days after pollination.
Embryos of CG00526 are placed on D callus initiation media with 2% sucrose and 5mg/L
chloramben (Duncan et al. (1985) Planta 165: 322-332) while those of CG00714 are placed onto KM
callus initiation media with 3% sucrose and 0.75mg/L 2,4-d (Kao and Michayluk (1975) Planta 126, 105-110). Embryos and embryogenic cultures are subsequently cultured in the dark. Embryogenic responses are removed from the explants after --14 days.
responses are placed onto D callus maintenance media with 2% sucrose and 0.5mg/L 2,4-d while those of CG00714 are placed onto KM callus maintenance media with 2%
sucrose and 5mg/L Dicamba. After 3 to 8 weeks of weekly selective subculture to fresh maintenance media, high quality compact embryogenic cultures are established.
Actively growing embryogenic callus pieces are selected as target tissue for gene delivery. The callus pieces are plated onto target plates containing maintenance medium with 12%
sucrose approximately 4 hours prior to gene delivery. The callus pieces are arranged in circles, with radii of 8 and 1 Omm from the center of the target plate.
Plasmid DNA is precipitated onto gold microcarriers as described in the DuPont Biolistics manual. Two to three ~g of each plasmid is used in each 6 shot microcarrier preparation.
Genes are delivered to the target tissue cells using the PDS-1000He Biolistics device.
The settings on the Biolistics device are as follows: 8 mm between the rupture disc and the macrocarrier, mm between the macrocarrier and the stopping screen and 7 cm between the stopping screen and the target. Each target plate is shot twice using 650psi rupture discs. A 200 X
200 stainless steel mesh (McMaster-Carr, New Brunswick, NJ) is placed between the stopping screen and the target tissue.
Five days later, the bombed callus pieces are transferred to maintenance medium with 2% sucrose and 0.5mg/L 2,4-d, but without amino acids, and containing 750 or 1000 nM Formula XVII. The callus pieces are placed for 1 hour on the light shelf 4-5 hours after transfer or on the next day, and stored in the dark at 27°C for 5-6 weeks. Following the 5-6 week primary selection stage, yellow to white tissue is transferred to fresh plates containing the same medium supplemented with 500 or 750 nM Formula XVII. 4-5 hours after transfer or on the next day, the tissues are placed for 1 hour on the light shelf and stored in the dark at 27°C for 3-4 weeks. Following the 3-4 week secondary selection stage, the tissues are transferred to plates containing the same medium supplemented with 500 nM
Formula XVII.
Healthy growing tissue is placed for 1 hour on the light shelf and stored in the dark at 27°C.
It is subcultured every two weeks until the colonies are large enough for regeneration.
At that point, colonies are transferred to a modified MS medium (Murashige and Skoog (1962) Physiol. Plant 15: 473-497) containing 3% sucrose (MS3S) with no selection agent and placed in the light. For CG00526, 0.25mg/L ancymidol and 0.5mg/L kinetin are added to this medium to induce embryo germination, while for CG00714, 2mg/L benzyl adenine is added. Regenerating colonies are transferred to MS3S media without ancymidol and kinetin, or benzyl adenine, for CG00526 or CG00714, respectively, after 2 weeks.
Regenerating shoots with or without roots are transferred to boxes containing medium and small plants with roots are eventually recovered and transferred to soil in the greenhouse.
Table 1 A
Alignment of the full-length and partial protox-1 amino acid sequences from Arabidopsis ("Arabpt-1 "; SEQ ID N0:2), maize ("Mzpt-1 "; SEQ ID N0:6), wheat ("Wtpt-1 ";
SEQ ID
N0:10), soybean ("Soybeanpt-1"; SEQ ID N0:12), cotton ("Cottonpt-1"; SEQ ID
N0:16), sugar beet ("Sugpt-1"; SEQ ID N0:18), oilseed rape ("Rapept-1"; SEQ ID N0:20), rice ("Ricept-1"; SEQ ID N0:22), sorghum ("Sorghumpt-1"; SEQ ID N0:24), and sugar cane ("Scpt-1 "; SEQ ID N0:37). Alignment was performed using the Pileup program (GCG
package, University of Wisconsin, Madison, WI). Positions that may be modified according to the teachings herein to confer or enhance inhibitor resistance are shown in bold type.
Rapept-1 .......... ........., MDLSLLRP.. QPFLSPFSNP FPRSRPYKPL
Arabpt-1 .......... .....,..,. MELSLLRPTT QSLLPSFSKP NLRLNVYKPL
Sorghumpt-1 .......... .......... .......... .......... ..........
Mzpt-1 .......... .......... .......... .......... ..........
Wtpt-1 .......... .......... .........M ATATVAAASP LRGRVTGRPH
Ricept-1 .......... .......... .......... .......... ..........
Cottonpt-1 .......... ......MTAL IDLSLLRSSP SVSPFSIPHH QHPPRFRKPF
Soybeanptl ........MV SVFNEILFPP NQTLLRPSLH SPTSFFTSPT RKFPRSRPNP
Sugpt-1 MKSMALSNCI PQTQCMPLRS SGHYRGNCIM LSIPCSLIGR RGYYSHKKRR
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 NLRCSVSGGS WGSSTIEGG GGGKTVTADC VIVGGGISGL CIAQALVTKH
Arabpt-1 RLRCSVAGGP TVGSSKIEGG GGT.TITTDC VIVGGGISGL CIAQALATKH
Sorghumpt-1 .......... :......... .......... .......... ..........
_98_ Mzpt-1 .......... ... ...... .......ADC VWGGGISGL CTAQALATRH
Wtpt-1 RVRPRCATAS SATETPAAPG VRL...SAEC VIVGAGISGL CTAQALATRY
Ricept-1 .......... .......... .......... .......... ..........
Cottonpt-1 KLRCSLAEGP TISSSKIDGG ESS...IADC VIVGGGISGL CIAQALATKH
Soybeanptl ILRCSIAEES TASPPKTR.. DSA...PVDC VWGGGVSGL CIAQALATKH
Sugpt-1 MSMSCSTSSG SKSAVKEAGS GSGAGGLLDC VIVGGGISGL CIAQALCTKH
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 PDA..AKNVM VTEAKDRVGG NIIT..REEQ GFLWEEGPNS FQPSDPMLTM
Arabpt-1 PDA..APNLI VTEAKDRVGG NIIT..REEN GFLWEEGPNS FQPSDPMLTM
Sorghumpt-1 .......... .......... ..STVERPEE GYLWEEGPNS FQPSDPVLSM
Mzpt-1 ..G..VGDVL VTEARARPGG NITTVERPEE GYLWEEGPNS FQPSDPVLTM
Wtpt-1 ..G..VSDLL VTEARDRPGG NITTVERPDE GYLWEEGPNS FQPSDPVLTM
Ricept-1 .......... .......... .......... .......... ..........
Cottonpt-1 RDV..ASNVI VTEARDRVGG NITTVER..D GYLWEEGPNS FQPSDPILTM
Soybeanptl ..A..NANW VTEARDRVGG NITTMER..D GYLWEEGPNS FQPSDPMLTM
Sugpt-1 SSSSLSPNFI VTEAKDRVGG NIVTVE..AD GYIWEEGPNS FQPSDAVLTM
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 VVDSGLKDDL VLGDPTAPRF VLWNGKLRPV PSKLTDLPFF DLMSIGGKIR
Arabpt-1 VVDSGLKDDL VLGDPTAPRF VLWNGKLRPV PSKLTDLPFF DLMSIGGKIR
Sorghumpt-1 AVDSGLKDDL VFGDPNAPRF VLWEGKLRPV PSKPADLPFF DLMSIPGKLR
Mzpt-1 AVDSGLKDDL VFGDPNAPRF VLWEGKLRPV PSKPADLPFF DLMSIPGKLR
Wtpt-1 AVDSGLKDDL VFGDPNAPRF VLWEGKLRPV PSKPGDLPFF SLMSIPGKLR
Ricept-1 .......... .......... ... ...... .......... ..........
Cottonpt-1 AVDSGLKDDL VLGDPNAPRF VLWEGKLRPV PSKPTDLPFF DLMSIAGKLR
Soybeanptl VVDSGLKDEL VLGDPDAPRF VLWNRKLRPV PGKLTDLPFF DLMSIGGKIR
Sugpt-1 AVDSGLKDEL VLGDPNAPRF VLWNDKLRPV PSSLTDLPFF DLMTIPGKIR
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 AGFGAIGIRP SPPGREESVE EFVRRNLGDE VFERLIEPFC SGVYAGDPAK
Arabpt-1 AGFGALGIRP SPPGREESVE EFVRRNLGDE VFERLIEPFC SGVYAGDPSK
Sorghumpt-1 AGLGALGIRP PAPGREESVE EFVRRNLGAE VFERLIEPFC SGVYAGDPSK
Mzpt-1 AGLGALGIRP PPPGREESVE EFVRRNLGAE VFERLIEPFC SGVYAGDPSK
Wtpt-1 AGLGALGIRP PPPGREESVE EFVRRNLGAE VFERLIEPFC SGVYAGDPSK
Ricept-1 .......... .......... .......... .......... ..........
Cottonpt-1 AGFGAIGIRP PPPGYEESVE EFVRRNLGAE VFERFIEPFC SGVYAGDPSK
Soybeanptl AGFGALGIRP PPPGHEESVE EFVRRNLGDE VFERLIEPFC SGVYAGDPSK
Sugpt-1 AALGALGFRP SPPPHEESVE HFVRRNLGDE VFERLIEPFC SGVYAGDPAK
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 LSMKAAFGKV WKLEENGGSI IGGAFKAIQA KNKAPKTTRD PRLPKPKGQT
Arabpt-1 LSMKAAFGKV WKLEQNGGSI IGGTFKAIQE RKNAPKAERD PRLPKPQGQT
Sorghumpt-1 LSMKAAFGKV WRLEEAGGSI IGGTIKTIQE RGKNPKPPRD PRLPKPKGQT
Mzpt-1 LSMKAAFGKV WRLEETGGSI IGGTIKTIQE RSKNPKPPRD ARLPKPKGQT
Wtpt-1 LSMKAAFGKV WRLEEIGGSI IGGTIKAIQD KGKNPKPPRD PRLPAPKGQT
Ricept-1 RALKAAFGKV WRLEDTGGSI IGGTIKTIQE RGKNPKPPRD PRLPTPKGQT
Cottonpt-1 LSMKAAFGRV WKLEEIGGSI IGGTFKTIQE RNKTPKPPRD PRLPKPKGQT
Soybeanptl LSMKAAFGKV WKLEKNGGSI IGGTFKAIQE RNGASKPPRD PRLPKPKGQT
Sugpt-1 LSMKAAFGKV WKLEQKGGSI IGGTLKAIQE RGSNPKPPRD QRLPKPKGQT
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 VGSFRKGLTM LPEAISARLG DKVKVSWKLS SITKLASGEY SLTYETPEGI
Arabpt-1 VGSFRKGLRM LPEAISARLG SKVKLSWKLS GITKLESGGY NLTYETPDGL
Sorghumpt-1 VASFRKGLAM LPNAITSSLG SKVKLSWKLT SMTKSDGKGY VLEYETPEGV
Mzpt-1 VASFRKGLAM LPNAITSSLG SKVKLSWKLT SITKSDDKGY VLEYETPEGV
Wtpt-1 VASFRKGLAM LPNAIASRLG SKVKLSWKLT SITKADNQGY VLGYETPEGL
Ricept-1 VASFRKGLTM LPDAITSRLG SKVKLSWKLT SITKSDNKGY ALVYETPEGV
Cottonpt-1 VGSFRKGLTM LPEAIANSLG SNVKLSWKLS SITKLGNGGY NLTFETPEGM
Soybeanptl VGSFRKGLTM LPDAISARLG NKVKLSWKLS SISKLDSGEY SLTYETPEGV
Sugpt-1 VGSFRKGLVM LPTAISARLG SRVKLSWTLS SIVKSLNGEY SLTYDTPDGL
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 VTVQSKSVVM TVPSHVASSL LRPLSDSAAE ALSKLYYPPV AAVSISYAKE
Arabpt-1 VSVQSKSVVM TVPSHVASGL LRPLSESAAN ALSKLYYPPY AAVSISYPKE
Sorghumpt-1 VLVQAKSVIM TIPSYVASDI LRPLSGDAAD VLSRFYYPPV AAVTVSYPKE
Mzpt-1 VSVQAKSVIM TIPSYVASNI LRPLSSDAAD ALSRFYYPPV AAVTVSYPKE
Wtpt-1 VSVQAKSVIM TIPSYVASDI LRPLSIDAAD ALSKFYYPPV AAVTVSYPKE
Ricept-1 VSVQAKTVVM TIPSYVASDI LRPLSSDAAD ALSIFYYPPV AAVTVSYPKE
Cottonpt-1 VSLQSRSVVM TIPSHVASNL LHPLSAAAAD ALSQFYYPPV ASVTVSYPKE
Soybeanptl VSLQCKTVVL TIPSYVASTL LRPLSAAAAD ALSKFYYPPV AAVSISYPKE
Sugpt-1 VSVRTKSVVM TVPSYVASRL LRPLSDSAAD SLSKFYYPPV AAVSLSYPKE
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 AIRSECLIDG ELKGFGQLHP RTQKVETLGT IYSSSLFPNR APPGRVLLLN
Arabpt-1 AIRTECLIDG ELKGFGQLHP RTQGVETLGT IYSSSLFPNR APPGRILLLN
Sorghumpt-1 AIRKECLIDG ELQGFGQLHP RSQGVETLGT IYSSSLFPNR APAGRVLLLN
Mzpt-1 AIRKECLIDG ELQGFGQLHP RSQGVETLGT IYSSSLFPNR APDGRVLLLN
Wtpt-1 AIRKECLIDG ELQGFGQLHP RSQGVETLGT IYSSSLFPNR APAGRVLLLN
Ricept-1 AIRKECLIDG ELQGFGQLHP RSQGVETLGT IYSSSLFPNR APAGRVLLLN
Cottonpt-1 AIRKECLIDG ELKGFGQLHP RSQGIETLGT IYSSSLFPNR APSGRVLLLN
Soybeanptl AIRSECLIDG ELKGFGQLHP RSQGVETLGT IYSSSLFPNR APPGRVLLLN
Sugpt-1 AIRSECLING ELQGFGQLHP RSQGVETLGT IYSSSLFPGR APPGRILILS
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 YIGGATNTGI LSKSEGELVE AVDRDLRKML IKPSSTDPLV LGVKLWPQAI
Arabpt-1 YIGGSTNTGI LSKSEGELVE AVDRDLRKML IKPNSTDPLK LGVRVWPQAI
Sorghumpt-1 YIGGATNTGI VSKTESELVE AVDRDLRKML INPTAVDPLV LGVRVWPQAI
Mzpt-1 YIGGATNTGI VSKTESELVE AVDRDLRKML INSTAVDPLV LGVRVWPQAI
Wtpt-1 YIGGSTNTGI VSKTESDLVG AVDRDLRKML INPRAADPLA LGVRVWPQAI
Ricept-1 YIGGSTNTGI VSKTESELVE AVDRDLRKML INPRAVDPLV LGVRVWPQAI
Cottonpt-1 YIGGATNTGI LSKTEGELVE AVDRDLRKML INPNAKDPLV LGVRVWPKAI
Soybeanptl YIGGATNTGI LSKTDSELVE TVDRDLRKIL INPNAQDPFV VGVRLWPQAI
Sugpt-1 YIGGAKNPGI LNKSKDELAK TVDKDLRRML INPDAKLPRV LGVRVWPQAI
Scpt-1 .......... .SKTESELVE AVDRDLRKML INPTAVDPLV LGVRVWPQAI
Rapept-1 PQFLIGHIDL VDAAKASLSS SGHEGLFLGG NYVAGVALGR CVEGAYETAT
Arabpt-1 PQFLVGHFDI LDTAKSSLTS SGYEGLFLGG NYVAGVALGR CVEGAYETAI
Sorghumpt-1 PQFLVGHLDL LEAAKSALDQ GGYNGLFLGG NYVAGVALGR CIEGAYESAA
Mzpt-1 PQFLVGHLDL LEAAKAALDR GGYDGLFLGG NYVAGVALGR CVEGAYESAS
Wtpt-1 PQFLIGHLDR LAAAKSALGQ GGYDGLFLGG KYVAGVALGR CIEGAYESAS
Ricept-1 PQFLIGHLDH LEAAKSALGK GGYDGLFLGG NYVAGVALGR CVEGAYESAS
Cottonpt-1 PQFLVGHLDL LDSAKMALRD SGFHGLFLGG NYVSGVALGR CVEGAYEVAA
Soybeanptl PQFLVGHLDL LDVAKASIRN TGFEGLFLGG NYVSGVALGR CVEGAYEVAA
Sugpt-1 PQFSIGHFDL LDAAKAALTD TGVKGLFLGG NYVSGVALGR CIEGAYESAA
Scpt-1 PQFLVGHLDL LEAAKSALDR GGYDGLFLGG NYVAGVALGR CVEGAYESAS
Rapept-1 QVNDFMSRYA YK*
Arabpt-1 EVNNFMSRYA YK*
Sorghumpt-1 QIYDFLTKYA YK*
Mzpt-1 QISDFLTKYA YK*
Wtpt-1 QVSDFLTKYA YK*
Ricept-1 QISDYLTKYA YK*
Cottonpt-1 EVKEFLSQYA YK*
Soybeanptl EVNDFLTNRV YK*
Sugpt-1 EVVDFLSQYS DK*
Scpt-1 QIYDFLTKYA YK*
Correspon Sub- Sub-sequence4, AA ~" AA ding Exemplary mutants AA
sequence AA sequence wild-typesubstitutiposition of ons ~" in Table 1 AP~~ F R C, L 169 Mz88Cys Mz88Leu 2 FMS C F, L, 240 Mz159Phe K
Mz159Leu Mz159Lys 3 Y~G A V, T, 245 pAraC-l Val L, C, I pAraC-lThr pAraC-1 Leu pAraC-1 Cys pAraC-1 Ile pMzC-1 Val pMzC-1 Thr pMzC-1 Leu pW htC-1 Val pW htC-1 Thr pSoyC-1 Thr pSoyC-lLeu 4 AtI~D G S, L 246 pAraC-3Ser pMzC-3Ser pMzC-3Leu pW htC-3Ser Y05P P S, H 388 Soy369Ser Soy369His Cot365Ser 6 PEA V L 390 Wht356Leu D,IG Y C, I, 451 pAraC-2Cys L, T, M, V, pAraC-211e A, H, R pAraC-2Leu pAraC-2Thr pAraC-2Met pAraC-2Val pAraC-2Ala pMzC-211e pMzC-2Met pSoyC-2Leu pSoyC-211e pSugC-2Cys pSugC-2Leu pSugC-211e pSugC-2Val pSugC-2Met pCotC-2Cys pCotC-2His pCotC-2Arg 8 YIGG~ A, P 455 Wht421 S Pro 9 AO9P I T, 500 Mz419Thr H, G, N Mz419His Mz419Gly Mz419Asn W ht466Thr GO~oA V A 536 Wht502A1a Soy517Ala 18 KA~,BF A T,V 256 Mz175Thr Mz175Va1 19 QO~9H S 418 Mz337Ser L
Second-site mutations 11 QD"S P L 143 AraC1 l8Leu 12 IGG0,2 T I, 274 AraC2 A
4911e AraC2 49A1a 13 SWXLA~3 S, T L 330 AraC3 05Leu 14 L014Y N S 450 AraC4 25Ser G~,5XGL Y, H, C 523 AraC4 F, V
98Cys Double mutation 16 T0, 6G L S 428 Mz34 17 YVO"G A, (S) T 534 7Ser-453Th r Table 2 Comparison of the Arabidopsis (SEQ ID N0:4) and maize (SEQ ID N0:8) protox-2 amino acid sequences. Identical residues are denoted by the vertical bars between the two sequences. Alignment was performed using the GAP program described in Deveraux et al., Nucleic Acids Res~ 12.387-395 (1984). Percent similarity: 75.889 / percent identity: 57.905.
1 .....~~.....-...............MASGAVAD.HQIEAVSGKRVAV 21 ~~
122 SSVLSTQSKFQILLEPFLWKK....KSSKVSDASAEESVSEFFQRHFGQE 167 268 VLSLS..YNSGSRQENWSLSCVSHNETQRQ...NPHYDAVIMTAPLCNVK 312 ~~~~~ ~~~I~~~ ~~..~~~
363 E.QKHGFKTLGTLFSSMMFPDRSPSDVHLYTTFIGGSRNQELAKASTDEL 411 ~~
462 LPGFFYAGNHRGGLSVGKSIASGCKAADLVISYLESCSNDKKPNDSL* 509 ~~~~~
501 LPGFFYAGNSKDGLAVGSVIASGSKAADLAISYLESHTKHNNSH*... 545 Table 3A
Cross tolerance of plant protox mutants to various protox inhibitors.
Formula AraC-1 AraC-2Cys AraC-1 AraC-3Thr MzC-1 Val Val Thr XVII + + + + +
Vlla + + + - +
IV ++ - ++ ++ -XV + + + + +
XI - + + ++ +
XVI - - - - +
XI I + - ++ ++ ++
XIV + - + + +
*X
+ =1 OX or more tolerant than WT
++ = 100X or more tolerant than WT
= no cross tolerance * = this compound was tested but provided no information Table 3B
Cross tolerance of plant protox mutants to various protox inhibitors.
AraC- AraC- AraC- AraC- AraC- AraC- AraC- AraC-1 Leu 211e 1 Leu 1 Leu 211e 2Leu 2Met + + + + + +
AraC- AraC- AraC AraC AraC AraC
rmula 2Met 2Leu 305Leu 425Se 425Se 425Se r r r XVII + + + + + + + +
Vlla ++ ++ ++ ++ ++ ++ ++ ++
IV ++ - + ++ + - + +
XV ++ +++ +++ +++ +++ ++ +++ ++
XI ++ ++ ++ ++ ++ ++ ++ ++
XVI +++ +++ +++ +++ +++ + ++ ++
XII
XIV ++~+~ ++ I ++ ++ - ++ ++
Table 4 Cross tolerance to various protox inhibitors in a seed germination assay.
Formula Common name Tolerance II acifluorofen III omasafen IV luoroglycofen IVb bifenox IVc oxyfluorofen IVd lactofen Ila luthiacet-methyl +
sulfentrazone XI lupropazil +
IV lumiclorac XVI lumioxazin +++
XVII +
XXIa BAY 11340 XXI I +
~ < 1 OX more tolerant than wt + >_ 10X more tolerant than wt ++ > 100X more tolerant than wt +++ >_ 1000X more tolerant than wt Various modifications of the invention described herein will become apparent to those skilled in the art. Such modifications are intended to fall within the scope of the appended claims.
SEQUF~TCE LISTING
<110> Novartis <120> Herbicide-Tolerant Protopozphyrinogen Oxidase <130> PB/5-30911A
<140>
<141>
<150> US 09/373691 <151> 1999-08-13 <160> 44 <170> Patentln Ver. 2.2 <210> 1 <211> 1719 <212> L~lPr <213> Arabidopsis thaliana <220>
<221> CDS
<222> (31)..(1644) <223> Arabidopsis protox-1 <400> 1 tgacaaaatt ccgaattctc tgcgatttcc atg gag tta tct ctt ctc cgt ccg 54 Met Glu Leu Ser Leu Leu Arg Pro acg act caa tcg ctt ctt ccg tcg ttt tcg aag ccc aat ctc cga tta 102 Thr Thr Gln Ser Leu Leu Pro Ser Phe Ser Lys Pro Asn Leu Arg Lieu aat gtt tat aag cct ctt aga ctc cgt tgt tca gtg gcc ggt gga cca 150 Asn Val Tyr Lys Pro Leu Arg Leu Arg Cars Ser Val Ala Gly Gly Pro ~cc ~tc gga tct tca aaa atc gaa ggc gga gga ggc acc acc atc acg 198 'rhr Val Gly Ser Ser Lys Ile Glu Gly Gly Gly Gly Thr Thr Ile Thr acg gat tgt gtg att gtc ggc gga ggt att agt ggt ctt tgc atc get 246 Thr Asp Cps Val Ile Val Gly Gly Gly Ile Ser Gly Leu.C~rs Ile Ala cag gcg ctt get act aag cat cct gat get get ccg aat tta att gtg 294 Gln Ala Leu Ala Thr Lys His Pro Asp Ala Ala Pro Asn Leu Ile Val acc gag get aag gat cgt gtt gga ggc aac att atc act cgt gaa gag 342 Thr Glu Ala Lys Asp Arg Val Gly Gly Asn Ile Ile Thr Arg Glu Glu aat ggt ttt ctc tgg gaa gaa ggt ccc aat agt ttt caa ccg tct gat 390 Asn Gly Phe Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp cct atg ctc act atg gtg gta gat agt ggt ttg aag gat gat ttg gtg 438 Pro Met Leu Thr Met Val Val Asp Ser Gly Leu Lys Asp Asp Leu Val ttg gga gat cct act gcg cca agg ttt gtg ttg tgg aat ggg aaa ttg 486 Leu Gly Asp Pro Thr Ala Pro Arg Phe Val Leu Trp Asn Gly Lys Leu agg ccg gtt cca tcg aag cta aca gac tta ccg ttc ttt gat ttg atg 534 Arg Pro Val Pro Ser Lys Leu Thr Asp Leu Pro Phe Phe Asp Leu Met agt att ggt ggg aag att aga get ggt ttt ggt gca ctt ggc att cga 582 Ser Ile Gly Gly Lys Ile Arg Ala Gly Phe Gly Ala Leu Gly Ile Arg ccg tca cct cca ggt cgt gaa gaa tct gtg gag gag ttt gta cgg cgt 630 Pro Ser Pro Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg aac ctc ggt gat gag gtt ttt gag cgc ctg att gaa ccg ttt tgt tca 678 Asn Leu Gly Asp Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cps Ser ggt gtt tat get ggt gat cct tca aaa ctg agc atg aaa gca gcg ttt 726 Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe ggg aag gtt tgg aaa cta gag caa aat ggt gga agc ata ata ggt ggt 774 Gly Lys Val Trp Lys L~eu Glu Gln Asn Gly Gly Ser Ile Ile Gly Gly act ttt aag gca att cag gag agg aaa aac get ccc aag gca gaa cga 822 Thr Phe Lys Ala Ile Gln Glu Arg Lys Asn Ala Pro Lys Ala Glu Arg gac ccg cgc ctg cca aaa cca cag ggc caa aca gtt ggt tct ttc agg 870 Asp Pro Arg Leu Pro Lys Pro Gln Gly Gln 'rhr Val Gly Ser Phe Arg aag gga ctt cga atg ttg cca gaa gca ata tct gca aga tta ggt agc 918 Lys Gly Leu Arg Met Leu Pro Glu Ala Ile Ser Ala Arg Leu Gly Ser aaa gtt aag ttg tct tgg aag ctc tca ggt atc act aag ctg gag agc 966 Lys Val Lys Leu Ser Trp Lys Leu Ser Gly Ile Thr Lys Leu Glu Ser gga gga tac aac tta aca tat gag act cca gat ggt tta gtt tcc gtg 1014 Gly Gly Tyr Asn Leu Thr err Glu Thr Pro Asp Gly Leu Val Ser Val cag agc aaa agt gtt gta atg acg gtg cca tct cat gtt gca agt ggt 1062 Gln Ser Lys Ser Val Val Met Thr Val Pro Ser His Val Ala Ser Gly ctc ttg cgc cct ctt tct gaa tct get gca aat gca ctc tca aaa cta 1110 Leu Leu Arg Pro Leu Ser Glu Ser Ala Ala Asn Ala Leu Ser Lys Leu tat tac cca cca gtt gca gca gta tct atc tcg tac ccg aaa gaa gca 1158 Tyr Tyr Pro Pro Val Ala Ala Val Ser Ile Ser Tyr Pro Lys Glu Ala atc cga aca gaa tgt ttg ata gat ggt gaa cta aag ggt ttt ggg caa 1206 Ile Arg Thr Glu Cys Leu Ile Asp Gly Glu Leu Lys Gly Phe Gly Gln ttg cat cca cgc acg caa gga gtt gaa aca tta gga act atc tac agc 1254 Leu His Pro Arg Thr Gln Gly Val Glu Thr Lsu Gly Thr Ile Tyr Ser tcc tca ctc ttt cca aat cgc gca ccg ccc gga aga att ttg ctg ttg 1302 Ser Ser Leu Phe Pro Asn Arg Ala Pro Pro Gly Arg Ile Leu Leu Leu aac tac att ggc ggg tct aca aac acc gga att ctg tcc aag tct gaa 1350 Asn Tyr Ile Gly Gly Ser Thr Asn Thr Gly Ile Leu Ser Lys Ser Glu ggt gag tta gtg gaa gca gtt gac aga gat ttg agg aaa atg cta att 1398 Gly Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile aag cct aat tcg acc gat cca ctt aaa tta gga gtt agg gta tgg cct 1446 Lys Pro Asn Ser Thr Asp Pro Leu Lys Leu Gly Val Arg Val Trp Pro caa gcc att cct cag ttt cta gtt ggt cac ttt gat atc ctt gac acg 1494 Gln Ala Ile Pro Gln Phe Leu Val Gly His Phe Asp Ile Leu Asp Z'hr get aaa tca tct cta acg tct tcg ggc tac gaa ggg cta ttt ttg ggt 1542 Ala Lys Ser Ser Leu Thr Ser Ser Gly Tyr Glu Gly Leu Phe Leu Gly ggc aat tac gtc get ggt gta gcc tta ggc cgg tgt gta gaa ggc gca 1590 Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cars Val Glu Gly Ala tat gaa acc gcg att gag gtc aac aac ttc atg tca cgg tac get tac 1638 Tyr Glu Thr Ala Ile Glu Val Asn Asn Phe Met Ser Arg Tyr Ala Tyr aag taa atgtaaaaca ttaaatctcc cagcttgcgt gagttttatt aaatattttg 1694 Lys agatatccaa aaaaaaaaaa aaaaa 1719 <210> 2 <211> 537 <212> PRT
<213> Arabidopsis thaliana <400> 2 Met Glu Leu Ser Leu Leu Arg Pro Thr Thr Gln Ser Leu Leu Pro Ser Phe Ser Lys Pro Asn Leu Arg Leu Asn Val Tyr Lys Pro Leu Arg Leu Arg CSrs Ser Val Ala Gly Gly Pro Thr Val Gly Ser Ser Lys Ile Glu Gly Gly Gly Gly Thr Thr Ile Thr Thr Asp Cps Val Ile Val Gly Gly Gly Ile Ser Gly Leu Cps Ile Ala Gln Ala Leu Ala Thr Lys His Pro Asp Ala Ala Pro Asn Leu Ile Val Thr Glu Ala Lys Asp Arg Val Gly Gly Asn Ile Ile Thr Arg Glu Glu Asn Gly Phe Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Met Leu Thr Met Val Val Asp Ser Gly Leu Lys Asp Asp Leu Val Leu Gly Asp Pro Thr Ala Pro Arg Phe Val Leu Trp Asn Gly Lys L~eu Arg Pro Val Pro Ser Lys Leu Thr Asp Leu Pro Phe Phe Asp Leu Met Ser Ile Gly Gly Lys Ile Arg Ala Gly Phe Gly Ala Leu Gly Ile Arg Pro Ser Pro Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly Asp Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cps Ser Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Lys Leu Glu Gln Asn Gly Gly Ser Ile Ile Gly Gly Thr Phe Lys Ala Ile Gln Glu Arg Lys Asn Ala Pro Lys Ala Glu Arg Asp Pro Arg Leu Pro Lys Pro Gln Gly Gln 'rhr Val Gly Ser Phe Arg Lys Gly Leu Arg Met Leu Pro Glu Ala Ile Ser Ala Arg Leu Gly Ser Lys Val Lys Leu Ser Trp Lys Leu Ser Gly Ile Thr Lys Leu Glu Ser Gly Gly Tyr Asn Leu Thr Tyr Glu Thr Pro Asp Gly Leu Val Ser Val Gln Ser Lys Ser Val Val Met Thr Val Pro Ser His Val Ala Ser Gly Leu Leu Arg Pro Leu Ser Glu Ser Ala Ala Asn Ala Leu Ser Lys Leu Tyr Tyr Pro Pro Val Ala Ala Val Ser Ile Ser Tyr Pro Lys Glu Ala Ile Arg Thr Glu Cars Leu Ile Asp Gly Glu Leu Lys Gly Phe Gly Gln Leu His Pro Arg 'rhr Gln Gly Val Glu Thr Leu Gly Ttir Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Pro Gly Arg Ile Leu Leu Leu Asn Tyr Ile Gly Gly Ser Thr Asn Thr Gly Ile Leu Ser Lys Ser Glu Gly Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Lys Pro Asn Ser Thr Asp Pro Leu Lys Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Leu Val Gly His Phe Asp Ile Leu Asp Thr Ala Lys Ser Ser Leu Thr Ser Ser Gly Tyr Glu Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cys Val Glu Gly Ala Tyr Glu Thr Ala Ile Glu Val Asn Asn Phe Met Ser Arg Tyr Ala Tyr Lys <210> 3 <211> 1738 <212> I~
<213> Arabidopsis thaliana <220>
<221> C'DS
<222> (70)..(1596) <223> Arabidapsis protox-2 <400> 3 ttttttactt atttccgtca ctgctttcga ctggtcagag attttgactc tgaattgttg 60 cagatagca atg gcg tct gga gca gta gca gat cat caa att gaa gcg gtt 111 Met Ala Ser Gly Ala Val Ala Asp His Gln Ile Glu Ala Val tca gga aaa aga gtc gca gtc gta ggt gca ggt gta agt gga ctt gcg 159 Ser Gly Lys Arg Val Ala Val Val Gly Ala Gly Val Ser Gly Leu Ala _g_ gcg get tac aag ttg aaa tcg agg ggt ttg aat gtg act gtg ttt gaa 207 Ala Ala Tyr Lys Leu Lys Ser Arg Gly Leu Asn Val Thr Val Phe Glu get gat gga aga gta ggt ggg aag ttg aga agt gtt atg caa aat ggt 255 Ala Asp Gly Arg Val Gly Gly Lys Leu Arg Ser Val Met Gln Asn Gly ttg att tgg gat gaa gga gca aac acc atg act gag get gag cca gaa 303 Leu Ile Trp Asp Glu Gly Ala Asn Thr Met Thr Glu Ala Glu Pro Glu gtt ggg agt tta ctt gat gat ctt ggg ctt cgt gag aaa caa caa ttt 351 Val Gly Ser Leu Leu Asp Asp Leu Gly Leu Arg Glu Lys Gln Gln Phe cca att tca cag aaa aag cgg tat att gtg cgg aat ggt gta cct gtg 399 Pro Ile Ser Gln Lys Lys Arg Tyr Ile Val Arg Asn Gly Val Pro Val atg cta cct acc aat ccc ata gag ctg gtc aca agt agt gtg ctc tct 447 Met L~eu Pro Thr Asn Pro Ile Glu Leu Val 'I'hr Ser Ser Val L~eu Ser acc caa tct aag ttt caa atc ttg ttg gaa cca ttt tta tgg aag aaa 495 Thr Gln Ser Lys Phe Gln Ile Leu Leu Glu Pro Phe Leu Trp Lys Lys aag tcc tca aaa gtc tca gat gca tct get gaa gaa agt gta agc gag 543 Lys Ser Ser Lys Val Ser Asp Ala Ser Ala Glu Glu Ser Val Ser Glu ttc ttt caa cgc cat ttt gga caa gag gtt gtt gac tat ctc atc gac 591 Phe Phe Gln Arg His Phe Gly Gln Glu Val Val Asp err Leu Ile Asp _g_ cct ttt gtt ggt gga aca agt get gcg gac cct gat tcc ctt tca atg 639 Pro Phe Val Gly Gly 2'hr Ser Ala Ala Asp Pro Asp Ser Leu Ser Met aag cat tct ttc cca gat ctc tgg aat gta gag aaa agt ttt ggc tct 687 Lys His Ser Phe Pro Asp Leu Trp Asn Val Glu Lys Ser Phe Gly Ser att ata gtc ggt gca atc aga aca aag ttt get get aaa ggt ggt aaa 735 Ile Ile Val Gly Ala Ile Arg Thr Lys Phe Ala Ala Lys Gly Gly Lys agt aga gac aca aag agt tct cct ggc aca aaa aag ggt tcg cgt ggg 783 Ser Arg Asp Thr Lys Ser Ser Pro Gly Thr Lys Lys Gly Ser Arg Gly tca ttc tct ttt aag ggg gga atg cag att ctt cct gat acg ttg tgc 831 Ser Phe Ser Phe Lys Gly Gly Met Gln Ile Leu Pro Asp Thr Leu Cps aaa agt ctc tca cat gat gag atc aat tta gac tcc aag gta ctc tct 879 Lys Ser Leu Ser His Asp Glu Ile Asn Leu Asp Ser Lys Val Leu Ser ttg tct tac aat tct gga tca aga cag gag aac tgg tca tta tct tgt 927 L~eu Ser 'I~r Asn Ser Gly Ser Arg Gln Glu Asn Trp Ser L~eu Ser Gars gtt tcg cat aat gaa acg cag aga caa aac ccc cat tat gat get gta 975 Val Ser His Asn Glu Thr Gln Arg Gln Asn Pro His Tyr Asp Ala Val att atg acg get cct ctg tgc aat gtg aag gag atg aag gtt atg aaa 1023 Ile Met Thr Ala Pro Leu Cys Asn Val Lys Glu Met Lys Val Met Lys gga gga caa ccc ttt cag cta aac ttt ctc ccc gag att aat tac atg 1071 Gly Gly Gln Pro Phe Gln Leu Asn Phe Leu Pro Glu Ile Asn Tyr Met ccc ctc tcg gtt tta atc acc aca ttc aca aag gag aaa gta aag aga 1119 Pro Leu Ser Val Leu Ile Thr Thr Phe Thr Lys Glu Lys Val Lys Arg cct ctt gaa ggc ttt ggg gta ctc att cca tct aag gag caa aag cat 1167 Pro Leu Glu Gly Phe Gly Val Leu Ile Pro Ser Lys Glu Gln Lys His ggt ttc aaa act cta ggt aca ctt ttt tca tca atg atg ttt cca gat 1215 Gly Phe Lys Thr Leu Gly Thr Leu Phe Ser Ser Met Met Phe Pro Asp cgt tcc cct agt gac gtt cat cta tat aca act ttt att ggt ggg agt 1263 Arg Ser Pro Ser Asp Val His Leu err Thr Thr Phe Ile Gly Gly Ser agg aac cag gaa cta gcc aaa get tcc act gac gaa tta aaa caa gtt 1311 Arg Asn Gln Glu Leu Ala Lys Ala Ser 'rhr Asp Glu Leu Lys Gln Val gtg act tct gac ctt cag cga ctg ttg ggg gtt gaa ggt gaa ccc gtg 1359 Val 'I'hr Ser Asp Leu Gln Arg Leu Leu Gly Val Glu Gly Glu Pro Val tct gtc aac cat tac tat tgg agg aaa gca ttc ccg ttg tat gac agc 1407 Ser Val Asn His Tyr Tyr Trp Arg Lys Ala Phe Pro heu Tyr Asp Ser agc tat gac tca gtc atg gaa gca att gac aag atg gag aat gat cta 1455 Ser 'I~r Asp Ser Val Met Glu Ala Ile Asp Lys Met Glu Asn Asp Leu cct ggg ttc ttc tat gca ggt aat cat cga ggg ggg ctc tct gtt ggg 1503 Pro Gly Phe Phe Tyr Ala Gly Asn His Arg Gly Gly Leu Ser Val Gly aaa tca ata gca tca ggt tgc aaa gca get gac ctt gtg atc tca tac 1551 Lys Ser Ile Ala Ser Gly Cys Lys Ala Ala Asp Leu Val Ile Ser Tyr ctg gag tct tgc tca aat gac aag aaa cca aat gac agc tta taa 1596 Leu Glu Ser Cars Ser Asn Asp Lys Lys Pro Asn Asp Ser Leu cattgtcaag gttcgtccct ttttatcact tactttgtaa acttgtaaaa tgcaacaagc 1656 cgccgtgcga ttagccaaca actcagcaaa acccagattc tcataaggct cactaattcc 1716 agaataaact atttatgtaa as 1738 <210> 4 <211> 508 <212> PRT
<213> Arabidopsis thaliana <400> 4 Met Ala Ser Gly Ala Val Ala Asp His Gln Ile Glu Ala Val Ser Gly Lys Arg Val Ala Val Val Gly Ala Gly Val Ser Gly Leu Ala Ala Ala Tyr Lys Leu Lys Ser Arg Gly Leu Asn Val Thr Val Phe Glu Ala Asp Gly Arg Val Gly Gly Lys Leu Arg Ser Val Met Gln Asn Gly Leu Ile Trp Asp Glu Gly Ala Asn Thr Met Thr Glu Ala Glu Pro Glu Val Gly Ser Leu Leu Asp Asp Leu Gly Leu Arg Glu Lys Gln Gln Phe Pro Ile Ser Gln Lys Lys Arg Tyr Ile Val Arg Asn Gly Val Pro Val Met Leu Pro Thr Asn Pro Ile Glu Leu Val Thr Ser Ser Val Leu Ser Thr Gln Ser Lys Phe Gln Ile Leu Leu Glu Pro Phe Leu Tip Lys Lys Lys Ser Ser Lys Val Ser Asp Ala Ser Ala Glu Glu Ser Val Ser Glu Phe Phe Gln Arg His Phe Gly Gln Glu Val Val Asp Tyr Leu Ile Asp Pro Phe Val Gly Gly Thr Ser Ala Ala Asp Pro Asp Ser Leu Ser Met Lys His Ser Phe Pro Asp Leu Tip Asn Val Glu Lys Ser Phe Gly Ser Ile Ile Val Gly Ala Ile Arg Thr Lys Phe Ala Ala Lys Gly Gly Lys Ser Arg Asp Thr Lys Ser Ser Pro Gly Thr Lys Lys Gly Ser Arg Gly Ser Phe Ser Phe Lys Gly Gly Met Gln Ile Leu Pro Asp Thr Leu Cps Lys Ser Leu Ser His Asp Glu Ile Asn Leu Asp Ser Lys Val Leu Ser Leu Ser Tyr Asn Ser Gly Ser Arg Gln Glu Asn Trp Ser Leu Ser Cars Val Ser His Asn Glu Thr Gln Arg Gln Asn Pro.His Tyr Asp Ala Val Ile Met Thr Ala Pro Leu Cys Asn Val Lys Glu Met Lys Val Met Lys Gly Gly Gln Pro Phe Gln Leu Asn Phe Leu Pro Glu Ile Asn Tyr Met Pro Leu Ser Val Leu Ile Thr Thr Phe Thr Lys Glu Lys Val Lys Arg Pro Leu Glu Gly Phe Gly Val Leu Ile Pro Ser Lys Glu Gln Lys His Gly Phe Lys Thr Leu Gly Thr Leu Phe Ser Ser Met Met Phe Pro Asp Arg Ser Pro Ser Asp Val His Leu Tyr Thr Thr Phe Ile Gly Gly Ser Arg Asn Gln Glu Leu Ala Lys Ala Ser Thr Asp Glu Leu Lys Gln Val Val Thr Ser Asp Leu Gln Arg Leu Leu Gly Val Glu Gly Glu Pro Val Sex Val Asn His Tyr Tyr Tip Arg Lys Ala Phe Pro Leu Tyr Asp Ser Ser Tyr Asp Ser Val Met Glu Ala Ile Asp Lys Met Glu Asn Asp Leu Pro Gly Phe Phe Tyr Ala Gly Asn His Arg Gly Gly Leu Ser Val Gly Lys Ser Ile Ala Ser Gly Cps Lys Ala Ala Asp Leu Val Ile Ser Tyr Leu Glu Ser Cps Ser Asn Asp Lys Lys Pro Asn Asp Ser Leu <210> 5 <211> 1691 <212> L'8sA
<213> Zea mat's <220>
<221> CDS
<222> (1)..(1443) <223> Maize protox-1 c-L'.~1 (not full-length) <400> 5 gcg gac tgc gtc gtg gtg ggc gga ggc atc agt ggc ctc tgc acc gcg 48 Ala Asp Cps Val Val Val Gly Gly Gly Ile Ser Gly Leu Cps Thr Ala cag gcg ctg gcc acg cgg cac ggc gtc ggg gac gtg ctt gtc acg gag 96 Gln Ala Leu Ala Thr Arg His Gly Val Gly Asp Val Leu Val Thr Glu gcc cgc gcc cgc ccc ggc ggc aac att acc acc gtc gag cgc ccc gag 144 Ala Arg Ala Arg Pro Gly Gly Asn Ile Thr Thr Val Glu Arg Pro Glu gaa ggg tac ctc tgg gag gag ggt ccc aac agc ttc cag ccc tcc gac 192 Glu Gly Tyr Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp ccc gtt ctc acc atg gcc gtg gac agc gga ctg aag gat gac ttg gtt 240 Pro Val Leu 'Ihr Met Ala Val Asp Ser Gly Leu Lys Asp Asp Leu Val ttt ggg gac cca aac gcg ccg cgt ttc gtg ctg tgg gag ggg aag ctg 288 Phe Gly Asp Pro Asn Ala Pro Arg Phe Val Leu 'I~p Glu Gly Lys Leu agg ccc gtg cca tcc aag ccc gcc gac ctc ccg ttc ttc gat ctc atg 336 Arg Pro Val Pro Ser Lys Pro Ala Asp Leu Pro Phe Phe Asp Leu Met agc atc cca ggg aag ctc agg gcc ggt cta ggc gcg ctt ggc atc cgc 384 Ser Ile Pro Gly Lys Leu Arg Ala Gly Leu Gly Ala Leu Gly Ile Arg ccg cct cct cca ggc cgc gaa gag tca gtg gag gag ttc gtg cgc cgc 432 Pro Pro Pro Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg aac ctc ggt get gag gtc ttt gag cgc ctc att gag cct ttc tgc tca 480 Asn Leu Gly Ala Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cys Ser ggt gtc tat get ggt gat cct tct aag ctc agc atg aag get gca ttt 528 Gly Val Z~r Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe ggg aag gtt tgg cgg ttg gaa gaa act gga ggt agt att att ggt gga 576 Gly Lys Val Trp Arg Leu Glu Glu Thr Gly Gly Ser Ile Ile Gly Gly acc atc aag aca att cag gag agg agc aag aat cca aaa cca ccg agg 624 Thr Ile Lys Thr Ile Gln Glu Arg Ser Lys Asn Pro Lys Pro Pro Arg gat gcc cgc ctt ccg aag cca aaa ggg cag aca gtt gca tct ttc agg 672 Asp Ala Arg Leu Pro Lys Pro Lys Gly Gln Thr Val Ala Ser Phe Arg aag ggt ctt gcc atg ctt cca aat gcc att aca tcc agc ttg ggt agt 720 Lys Gly Leu Ala Met Leu Pro Asn Ala Ile Thr Ser Ser Leu Gly Ser aaa gtc aaa cta tca tgg aaa ctc acg agc att aca aaa tca gat gac 768 Lys Val Lys Leu Ser Trp Lys Leu Thr Ser Ile Thr Lys Ser Asp Asp aag gga tat gtt ttg gag tat gaa acg cca gaa ggg gtt gtt tcg gtg 816 Lys Gly Tyr Val Leu Glu Tyr Glu Thr Pro Glu Gly Val Val Ser Val cag get aaa agt gtt atc atg act att cca tca tat gtt get agc aac 864 Gln Ala Lys Ser Val Ile Met Thr Ile Pro Ser Tyr Val Ala Ser Asn att ttg cgt cca ctt tca agc gat get gca gat get cta tca aga ttc 912 Ile Leu Arg Pro Leu Ser Ser Asp Ala Ala Asp Ala Leu Ser Arg Phe tat tat cca ccg gtt get get gta act gtt tcg tat cca aag gaa gca 960 Tyr Tyr Pro Pro Val Ala Ala Val Thr Val Ser Tyr Pro Lys Glu Ala att aga aaa gaa tgc tta att gat ggg gaa ctc cag ggc ttt ggc cag 1008 Ile Arg Lys Glu Cps Leu Ile Asp Gly Glu Leu Gln Gly Phe Gly Gln ttg cat cca cgt agt caa gga gtt gag aca tta gga aca ata tac agt 1056 Leu His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser tcc tca ctc ttt cca aat cgt get cct gac ggt agg gtg tta ctt cta 1104 Ser Ser Leu Phe Pro Asn Arg Ala Pro Asp Gly Arg Val Leu Leu Leu aac tac ata gga ggt get aca aac aca gga att gtt tcc aag act gaa 1152 Asn Tyr Ile Gly Gly Ala Thr Asn Thr Gly Ile Val Ser Lys Thr Glu agt gag ctg gtc gaa gca gtt gac cgt gac ctc cga aaa atg ctt ata 1200 Ser Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile aat tct aca gca gtg gac cct tta gtc ctt ggt gtt cga gtt tgg cca 1248 Asn'Ser 'rhr Ala Val Asp Pro Leu Val Leu Gly Val Arg Val Z'rp Pro caa gcc ata cct cag ttc ctg gta gga cat ctt gat ctt ctg gaa gcc 1296 Gln Ala Ile Pro Gln Phe Leu Val Gly His Leu Asp L~eu Leu Glu Ala gca aaa get gcc ctg gac cga ggt ggc tac gat ggg ctg ttc cta gga 1344 Ala Lys Ala Ala Lsu Asp Arg Gly Gly Tyr Asp Gly Leu Phe Leu Gly ggg aac tat gtt gca gga gtt gcc ctg ggc aga tgc gtt gag ggc gcg 1392 Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cps Val Glu Gly Ala tat gaa agt gcc tcg caa ata tct gac ttc ttg acc aag tat gcc tac 1440 Tyr Glu Ser Ala Ser Gln Ile Ser Asp Phe Leu Thr Lys Tyr Ala Tyr 465 470 475' 480 aag tgatgaaaga agtggagcgc tacttgttaa tcgtttatgt tgcatagatg 1493 Lys aggtgcctcc ggggaaaaaa aagcttgaat agtatttttt attcttattt tgtaaattgc 1553 atttctgttc ttttttctat cagtaattag ttatatttta gttctgtagg agattgttct 1613 _18_ gttcactgcc cttcaaaaga aattttattt ttcattcttt tatgagagct gtgctactta 1673 aaaaaaaaaa aaaaaaaa 1691 <210> 6 <211> 481 <212> PRT
<213> Zea mays <400> 6 Ala Asp Cars Val Val Val Gly Gly Gly Ile Ser Gly Leu Gds Thr Ala Gln Ala Leu Ala Thr Arg His Gly Val Gly Asp Val Leu Val Thr Glu Ala Arg Ala Arg Pro Gly Gly Asn Ile Thr Thr Val Glu Arg Pro Glu Glu Gly Tyr Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Val Leu Thr Met Ala Val Asp Ser Gly Leu Lys Asp Asp Leu Val Phe Gly Asp Pro Asn Ala Pro Arg Phe Val Leu Trp Glu Gly Lys Leu Arg Pro Val Pro Ser Lys Pro Ala Asp Leu Pro Phe Phe Asp Leu Met Ser Ile Pro Gly Lys Leu Arg Ala Gly Leu Gly Ala Leu Gly Ile Arg Pro Pro Pro Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly Ala Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cars Ser Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Arg Leu Glu Glu Thr Gly Gly Ser Ile Ile Gly Gly Thr Ile Lys Thr Ile Gln Glu Arg Ser Lys Asn Pro Lys Pro Pro Arg 195 200 205 .
Asp Ala Arg Leu Pro Lys Pro Lys Gly Gln Thr Val Ala Ser Phe Arg Lys Gly Leu Ala Met Leu Pro Asn Ala Ile 'rhr Ser Ser Leu Gly Ser Lys Val Lys Leu Ser Trp Lys Leu Thr Ser Ile Thr Lys Ser Asp Asp Lys Gly Tyr Val Leu Glu Tyr Glu Thr Pro Glu Gly Val Val Ser Val Gln Ala Lys Ser Val Ile Met Thr Ile Pro Ser Tyr Val Ala Ser Asn Ile Leu Arg Pro Leu Ser Ser Asp Ala Ala Asp Ala Leu Ser Arg Phe Tyr ~r Pro Pro Val Ala Ala Val Thr Val Ser Tyr Pro Lys Glu Ala Ile Arg Lys Glu Cps Leu Ile Asp Gly Glu Leu Gln Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Sex Ser Ser Leu Phe Pro Asn Arg Ala Pro Asp Gly Arg Val Leu Leu Leu Asn Tyr Ile Gly Gly Ala Thr Asn Thr Gly Ile Val Ser Lys Thr Glu Ser Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Asn Ser Thr Ala Val Asp Pro Leu Val Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Leu Val Gly His Leu Asp Leu Leu Glu Ala Ala Lys Ala Ala Leu Asp Arg Gly Gly 'I'yr Asp Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cys Val Glu Gly Ala Tyr Glu Ser Ala Ser Gln Ile Ser Asp Phe Leu Thr Lys Tyr Ala Tyr Lys <210> 7 <211> 2061 <212> I~1A
<213> Zea mays <220>
<221> CDS
<222> (64)..(1698) <223> Maize protox-2 <400> 7 ctctcctacc tccacctcca cgacaacaag caaatcccca tccagttcca aaccctaact 60 caa atg ctc.gct ttg act gcc tca gcc tca tcc get tcg tcc cat cct 108 Met Leu Ala Leu Thr Ala Ser Ala Ser Ser Ala Ser Ser His Pro tat cgc cac gcc tcc gcg cac act cgt cgc ccc cgc cta cgt gcg gtc 156 Tyr Arg His Ala Ser Ala His Thr Arg Arg Pro Arg Leu Arg Ala Val ctc gcg atg gcg ggc tcc gac gac ccc cgt gca gcg ccc gcc aga tcg 204 Leu Ala Met Ala Gly Ser Asp Asp Pro Arg Ala Ala Pro Ala Arg Ser gtc gcc gtc gtc ggc gcc ggg gtc agc ggg ctc gcg gcg gcg tac agg 252 Val Ala Val Val Gly Ala Gly Val Ser Gly Leu Ala Ala Ala Tyr Arg ctc aga cag agc ggc gtg aac gta acg gtg ttc gaa gcg gcc gac agg 300 Leu Arg Gln Ser Gly Val Asn Val Thr Val Phe Glu Ala Ala Asp Arg gcg gga gga aag ata cgg acc aat tcc gag ggc ggg ttt gtc tgg gat 348 Ala Gly Gly Lys Ile Arg Thr Asn Ser Glu Gly Gly Phe Val Trp Asp gaa gga get aac acc atg aca gaa ggt gaa tgg gag gcc agt aga ctg 396 Glu Gly Ala Asn Thr Met Thr Glu Gly Glu Trp Glu Ala Ser Arg Leu att gat gat ctt ggt cta caa gac aaa cag cag tat cct aac tcc caa 444 Ile Asp Asp Leu Gly Leu Gln Asp Lys Gln Gln 'I~rr Pro Asn Ser Gln cac aag cgt tac att gtc aaa gat gga gca cca gca ctg att cct tcg 492 His Lys Arg Tyr Ile Val Lys Asp Gly Ala Pro Ala Leu Ile Pro Ser gat ccc att tcg cta atg aaa agc agt gtt ctt tcg aca aaa tca aag 540 Asp Pro Ile Ser Leu Met Lys Ser Ser Val Leu Ser Thr Lys Ser Lys att gcg tta ttt ttt gaa cca ttt ctc tac aag aaa get aac aca aga 588 Ile Ala Leu Phe Phe Glu Pro Phe Leu Tyr Lys Lys Ala Asn Thr Arg aac tct gga aaa gtg tct gag gag cac ttg agt gag agt gtt ggg agc 636 Asn Ser Gly Lys Val Ser Glu Glu His Leu Ser Glu Ser Val Gly Ser ttc tgt gaa cgc cac ttt gga aga gaa gtt gtt gac tat ttt gtt gat 684 Phe Cys Glu Arg His Phe Gly Arg Glu Val Val Asp Tyr Phe Val Asp cca ttt gta get gga aca agt gca gga gat cca gag tca cta tct att 732 Pro Phe Val Ala Gly Thr Ser Ala Gly Asp Pro Glu Ser Leu Ser Ile cgt cat gca ttc cca gca ttg tgg aat ttg gaa aga aag tat ggt tca 780 Arg His Ala Phe Pro Ala Leu Trp Asn Txu Glu Arg Lys Tyr Gly Ser gtt att gtt ggt gcc atc ttg tct aag cta gca get aaa ggt gat cca 828 Val Ile Val Gly Ala Ile Leu Ser Lys Leu Ala Ala Lys Gly Asp Pro gta aag aca aga cat gat tca tca ggg aaa aga agg aat aga cga gtg 876 Val Lys Thr Arg His Asp Ser Ser Gly Lys Arg Arg Asn Arg Arg Val tcg ttt tca ttt cat ggt gga atg cag tca cta ata aat gca ctt cac 924 Ser Phe Ser Phe His Gly Gly Met Gln Ser Leu Ile Asn Ala Leu His aat gaa gtt gga gat gat aat gtg aag ctt ggt aca gaa gtg ttg tca 972 Asn Glu Val Gly Asp Asp Asn Val Lys Leu Gly Thr Glu Val Leu Ser ttg gca tgt aca ttt gat gga gtt cct gca cta ggc agg tgg tca att 1020 Leu Ala Cys Thr Phe Asp Gly Val Pro Ala Leu Gly Arg Trp Ser Ile tct gtt gat tcg aag gat agc ggt gac aag gac ctt get agt aac caa 1068 Ser Val Asp Ser Lys Asp Ser Gly Asp Lys Asp Leu Ala Ser Asn Gln acc ttt gat get gtt ata atg aca get cca ttg tca aat gtc cgg agg 1116 Thr Phe Asp Ala Val Ile Met Thr Ala Pro Leu Ser Asn Val Arg Arg atg aag ttc acc aaa ggt gga get ccg gtt gtt ctt gac ttt ctt cct 1164 Met Lys Phe Thr Lys Gly Gly Ala Pro Val Val Leu Asp Phe Leu Pro aag atg gat tat cta cca cta tct ctc atg gtg act get ttt aag aag 1212 Lys Met Asp Tyr Leu Pro Leu Ser Leu Met Val Thr Ala Phe Lys Lys gat gat gtc aag aaa cct ctg gaa gga ttt ggg gtc tta ata cct tac 1260 Asp Asp Val Lys Lys Pro Leu Glu Gly Phe Gly Val Leu Ile Pro err aag gaa cag caa aaa cat ggt ctg aaa acc ctt ggg act ctc ttt tcc 1308 Lys Glu Gln Gln Lys His Gly Leu Lys Thr Leu Gly Thr Leu Phe Ser tca atg atg ttc cca gat cga get cct gat gac caa tat tta tat aca 1356 Ser Met Met Phe Pro Asp Arg Ala Pro Asp Asp Gln Tyr Leu Tyr Thr aca ttt gtt ggg ggt agc cac aat aga gat ctt get gga get cca acg 1404 Thr Phe Val Gly Gly Ser His Asn Arg Asp Leu Ala Gly Ala Pro Thr tct att ctg aaa caa ctt gtg acc tct gac ctt aaa aaa ctc ttg ggc 1452 Ser Ile Leu Lys Gln Leu Val Thr Ser Asp Leu Lys Lys Leu Leu Gly gta gag ggg caa cca act ttt gtc aag cat gta tac tgg gga aat get 1500 Val Glu Gly Gln Pro Thr Phe Val Lys His Val Tyr 'I~p Gly Asn Ala ttt cct ttg tat ggc cat gat tat agt tct gta ttg gaa get ata gaa 1548 Phe Pro Leu Tyr Gly His Asp Tyr Ser Ser Val Leu Glu Ala Ile Glu aag atg gag aaa aac ctt cca ggg ttc ttc tac gca gga aat agc aag 1596 Lys Met Glu Lys Asn Leu Pro Gly Phe Phe Tyr Ala Gly Asn Ser Lys gat ggg ctt get gtt gga agt gtt ata get tca gga agc aag get get 1644 Asp Gly Leu Ala Val Gly Ser Val Ile Ala Ser Gly Ser Lys Ala Ala gac ctt gca atc tca tat ctt gaa tct cac acc aag cat aat aat tca 1692 Asp Leu Ala Ile Ser Tyr Leu Glu Ser His Thr Lys His Asn Asn Ser cat tga aagtgtctga cctatcctct agcagttgtc gacaaatttc tccagttcat 1748 His gtacagtaga aaccgatgcg ttgcagtttc agaacatctt cacttcttca gatattaacc 1808 cttcgttgaa catccaccag aaaggtagtc acatgtgtaa gtgggaaaat gaggttaaaa 1868 actattatgg cggccgaaat gttccttttt gttttcctca caagtggcct acgacacttg 1928 atgttggaaa tacatttaaa tttgttgaat tgtttgagaa cacatgcgtg acgtgtaata 1988 tttgcctatt gtgattttag cagtagtctt ggccagatta tgctttacgc ctttaaaaaa 2048 aaaaaaaaaa aaa 2061 <210> 8 <211> 544 <212> PRT
<213> Zea mays <400> 8 Met Leu Ala Leu Thr Ala Ser Ala Ser Ser Ala Ser Ser His Pro Tyr Arg His Ala Ser Ala His Thr Arg Arg Pro Arg Leu Arg Ala Val Leu Ala Met Ala Gly Ser Asp Asp Pro Arg Ala Ala Pro Ala Arg Ser Val Ala Val Val Gly Ala Gly Val Ser Gly Leu Ala Ala Ala Tyr Arg Leu Arg Gln Ser Gly Val Asn Val Thr Val Phe Glu Ala Ala Asp Arg Ala Gly Gly Lys Ile Arg Thr Asn Ser Glu Gly Gly Phe Val Trp Asp Glu Gly Ala Asn Thr Met Thr Glu Gly Glu Trp Glu Ala Ser Arg Leu Ile Asp Asp Leu Gly Leu Gln Asp Lys Gln Gln Tyr Pro Asn Ser Gln His Lys Arg Tyr Ile Val Lys Asp Gly Ala Pro Ala Leu Ile Pro Ser Asp Pro Ile Ser Leu Met Lys Ser Ser Val Leu Ser Thr Lys Ser Lys Ile Ala Leu Phe Phe Glu Pro Phe Leu Tyr Lys Lys Ala Asn Thr Arg Asn Ser Gly Lys Val Ser Glu Glu His Leu Ser Glu Ser Val Gly Ser Phe Cps Glu Arg His Phe Gly Arg Glu Val Val Asp Tyr Phe Val Asp Pro Phe Val Ala Gly Thr Ser Ala Gly Asp Pro Glu Ser Leu Ser Ile Arg His Ala Phe Pro Ala Leu '1'rp Asn Leu Glu Arg Lys Tyr Gly Ser Val Ile Val Gly Ala Ile Leu Ser Lys Leu Ala Ala Lys Gly Asp Pro Val Lys Thr Arg His Asp Ser Ser Gly Lys Arg Arg Asn Arg Arg Val Ser Phe Ser Phe His Gly Gly Met Gln Ser Leu Ile Asn Ala Leu His Asn Glu Val Gly Asp Asp Asn Val Lys Leu Gly Thr Glu Val Leu Ser Leu Ala Cys Thr Phe Asp Gly Val Pro Ala Leu Gly Arg Trp Ser Ile Ser Val Asp Ser Lys Asp Ser Gly Asp Lys Asp Leu Ala Ser Asn Gln Thr Phe Asp Ala Val Ile Met Thr Ala Pro Leu Ser Asn Val Arg Arg Met Lys Phe Thr Lys Gly Gly Ala Pro Val Val Leu Asp Phe Leu Pro Lys Met Asp Tyr Leu Pro Leu Ser Leu Met Val Thr Ala Phe Lys Lys Asp Asp Val Lys Lys Pro Leu Glu Gly Phe Gly Val Leu Ile Pro Tyr Lys Glu Gln Gln Lys His Gly Leu Lys Thr Leu Gly Thr Leu Phe Ser Ser Met Met Phe Pro Asp Arg Ala Pro Asp Asp Gln Tyr Leu Tyr Thr Thr Phe Val Gly Gly Ser His Asn Arg Asp Leu Ala Gly Ala Pro Thr.Ser Ile Leu Lys Gln Leu Val Thr Ser Asp Leu Lys Lys Leu Leu Gly Val Glu Gly Gln Pro.Thr Phe Val Lys His Val Tyr Trp Gly Asn Ala Phe Pro Leu Tyr Gly His Asp Tyr Ser Ser Val Leu Glu Ala Ile Glu Lys _2g_ Met Glu Lys Asn Leu Pro Gly Phe Phe Tyr Ala Gly Asn Ser Lys Asp Gly Leu Ala Val Gly Ser Val Ile Ala Ser Gly Ser Lys Ala Ala Asp Leu Ala Ile Ser Tyr Leu Glu Ser His Thr Lys His Asn Asn Ser His <210> 9 <211> 1811 <212> IOTA
<213> Tritictun aestivtm~
<220>
<221> CDS
<222> (3)..(1589) <223> wheat protox-1 <400> 9 gc gca aca atg gcc acc gcc acc gtc gcg gcc gcg tcg ccg ctc cgc 47 Ala Thr Met Ala Thr Ala Thr Val Ala Ala Ala Ser Pro Leu Arg ggc agg'gtc acc ggg cgc cca cac cgc gtc cgc ccg cgt tgc get acc 95 Gly Arg Val 'hhr Gly Arg Pro His Arg.Val Arg Pro Arg Cys Ala Thr gcg agc agc gcg acc gag act ccg gcg gcg ccc ggc gtg cgg ctg tcc 143 Ala Ser Ser Ala Thr Glu Thr Pro Ala Ala Pro Gly Val Arg Leu Ser gcg gaa tgc gtc att gtg ggc gcc ggc atc agc ggc ctc tgc acc gcg 191 Ala Glu Gars Val Ile Val Gly Ala Gly Ile Ser Gly Leu Gars Thr Ala cag gcg ctg gcc acc cga tac ggc gtc agc gac ctg ctc gtc acg gag 239 Gln Ala Leu Ala Thr Arg Tyr Gly Val Ser Asp Leu Leu Val Thr Glu gcc cgc gac cgc ccg ggc ggc aac atc acc acc gtc gag cgt ccc gac 287 Ala Arg Asp Arg Pro Gly Gly Asn Ile Thr Thr Val Glu Arg Pro Asp gag ggg tac ctg tgg gag gag gga ccc aac agc ttc cag ccc tcc gac 335 Glu Gly Tyr Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp ccg gtc ctc acc atg gcc gtg gac agc ggg ctc aag gat gac ttg gtg 383 Pro Val Leu Thr Met Ala Val Asp Ser Gly Leu Lys Asp Asp L~u Val ttc ggg gac ccc aac gcg ccc cgg ttc gtg ctg tgg gag ggg aag ctg 431 Phe Gly Asp Pro Asn Ala Pro Arg Phe Val Leu Trp Glu Gly Lys Leu agg ccg gtg ccg tcg aag cca ggc gac ctg cct ttc ttc agc ctc atg 479 Arg Pro Val Pro Ser Lys Pro Gly Asp Leu Pro Phe Phe Ser Leu Met agt atc cct ggg aag ctc agg gcc ggc ctt ggc gcg ctc ggc att cgc 527 Ser Ile Pro Gly Lys Leu Arg Ala Gly Leu Gly Ala Leu Gly Ile Arg cca cct cct cca ggg cgc gag gag tcg gtg gag gag ttt gtg cgc cgc 575 Pro Pro Pro Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg aac ctc ggt gcc gag gtc ttt gag cgc ctc atc gag cct ttc tgc tca 623 Asn Leu Gly Ala Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cys Ser ggt gta tat get ggt gat cct tcg aag ctt agt atg aag get gca ttt 671 Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe ggg aag gtc tgg agg ttg gag gag att gga ggt agt att att ggt gga 719 Gly Lys Val Trp Arg Leu Glu Glu Ile Gly Gly Ser Ile Ile Gly Gly acc atc aag gcg att cag gat aaa ggg aag aac ccc aaa ccg cca agg 767 Thr Ile Lys Ala Ile Gln Asp Lys Gly Lys Asn Pro Lys Pro Pro Arg gat ccc cga ctt ccg gca cca aag gga cag acg gtg gca tct ttc agg 815 Asp Pro Arg Leu Pro Ala Pro Lys Gly Gln 'rhr Val Ala Ser Phe Arg aag ggt cta gcc atg ctc ccg aat gcc atc gca tct agg ctg ggt agt 863 Lys Gly Leu Ala Met Lzu Pro Asn Ala Ile Ala Ser Arg Leu Gly Ser aaa gtc aag ctg tca tgg aag ctt acg agc att aca aag gcg gac aac 911 Lys Val Lys Leu Ser Trp Lys Leu Thr Ser Ile Thr Lys Ala Asp Asn caa gga tat gta tta ggt tat gaa aca cca gaa gga ctt gtt tca gtg 959 Gln Gly Tyr Val Leu Gly Tyr Glu Thr Pro Glu Gly Leu Val Ser Val cag get aaa agt gtt atc atg acc atc ccg tca tat gtt get agt gat 1007 Gln Ala Lys Ser Val Ile Met Thr Ile Pro Ser Tyr Val Ala Ser Asp atc ttg cgc cca ctt tca att gat gca gca gat gca ctc tca aaa ttc 1055 Ile Leu Arg Pro Leu Ser Ile Asp Ala Ala Asp Ala Leu Ser Lys Phe tat tat ccg cca gtt get get gta act gtt tca tat cca aaa gaa get 1103 Tyr Tyr Pro Pro Val Ala Ala Val Thr Val Ser Tyr Pro Lys Glu Ala att aga aaa gaa tgc tta att gat ggg gag ctc cag ggt ttc ggc cag 1151 Ile Arg Lys Glu Cars Leu Ile Asp Gly Glu Leu Gln Gly Phe Gly Gln ttg cat cca cgt agc caa gga gtc gag act tta ggg aca ata tat agc 1199 Leu His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser tct tct ctc ttt cct aat cgt get cct get gga aga gtg tta ctt ctg 1247 Ser Ser Leu Phe Pro Asn Arg Ala Pro Ala Gly Arg Val Leu Leu Leu aac tat atc ggg ggt tct aca aat aca ggg atc gtc tcc aag act gag 1295 Asn Tyr Ile Gly Gly Ser Thr Asn Thr Gly Ile Val Ser Lys Thr Glu agt gac tta gta gga gcc gtt gac cgt gac ctc aga aaa atg ttg ata 1343 Ser Asp Leu Val Gly Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile aac cct aga gca gca gac cct tta gca tta ggg gtt cga gtg tgg cca 1391 Asn Pro Arg Ala Ala Asp Pro Leu Ala Leu Gly Val Arg Val Trp Pro caa gca ata cca cag ttt ttg att ggg cac ctt gat cgc ctt get get 1439 Gln Ala Ile Pro Gln Phe Lzu Ile Gly His Leu Asp Arg Leu Ala Ala gca aaa tct gca ctg ggc caa ggc ggc tac gac ggg ttg ttc cta gga 1487 Ala Lys Ser Ala Leu Gly Gln Gly Gly Tyr Asp Gly Leu Phe Leu Gly gga aac tac gtc gca gga gtt gcc ttg ggc cga tgc atc gag ggt gcg 1535 Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cars Ile Glu Gly Ala tac gag agt gcc tca caa gta tct gac ttc ttg acc aag tat gcc tac 1583 Tyr Glu Ser Ala Ser Gln Val Ser Asp Phe Lsu Thr Lys Tyr Ala Tyr aag tga tggaagtagt gcatctcttc attttgttgc atatacgagg tgaggctagg 1639 Lys atcggtaaaa catcatgaga ttctgtagtg tttctttaat tgaaaaaaca aattttagtg 1699 atgcaatatg tgctctttcc tgtagttcga gcatgtacat cggtatggga taaagtagaa 1759 taagctattc tgcaaaagca gtgatttttt ttgaaaaaaa aaaaaaaaaa as 1811 <210> 10 <211> 528 <212> PRT
<213> Tritictun aestiv~mi <400> 10 Ala Thr Met Ala Thr Ala Thr Val Ala Ala Ala Ser Pro Leu Arg Gly Arg Val 'I'hr Gly Arg Pro His Arg Val Arg Pro Arg Cps Ala Thr Ala Ser Ser Ala Thr Glu Thr Pro Ala Ala Pro Gly Val Arg Leu Ser Ala Glu Cars Val Ile Val Gly Ala Gly Ile Ser Gly Leu Cys Thr Ala Gln Ala Leu Ala Thr Arg Tyr Gly Val Ser Asp Leu Leu Val Z'hr Glu Ala Arg Asp Arg Pro Gly Gly Asn Ile Thr Thr Val Glu Arg Pro Asp Glu Gly Tyr Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Val Leu Thr Met Ala Val Asp Ser Gly Leu Lys Asp Asp Leu Val Phe Gly Asp Pro Asn Ala Pro Arg Phe Val Leu Trp Glu Gly Lys Leu Arg Pro Val Pro Ser Lys Pro Gly Asp Leu Pro Phe Phe Ser Leu Met Ser Ile Pro Gly Lys Leu Arg Ala Gly I~eu Gly Ala Leu Gly Ile Arg Pro Pro Pro Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly Ala Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cars Ser Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Arg Leu Glu Glu Ile Gly Gly Ser Ile Ile Gly Gly Thr Ile Lys Ala Ile Gln Asp Lys Gly Lys Asn Pro Lys Pro Pro Arg Asp Pro Arg Leu Pro Ala Pro Lys Gly Gln 'hhr Val Ala Ser Phe Arg Lys Gly Leu Ala Met Leu Pro Asn Ala Ile Ala Ser Arg Leu Gly Ser Lys Val Lys Leu Ser Trp Lys Leu Thr Ser Ile Thr Lys Ala Asp Asn Gln Gly Tyr Val Leu Gly Tyr Glu Thr Pro Glu Gly Leu Val Ser Val Gln Ala Lys Ser Val Ile Met Thr Ile Pro Ser Tyr Val Ala Ser Asp Ile Leu Arg Pro Leu Ser Ile Asp Ala Ala Asp Ala Leu Ser Lys Phe Tyr Tyr Pro Pro Val Ala Ala Val Thr Val Ser Tyr Pro Lys Glu Ala Ile Arg Lys Glu CSrs Leu Ile Asp Gly Glu Leu Gln Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Ala Gly Arg Val Leu Leu Leu Asn Tyr Ile Gly Gly Ser Thr Asn Thr Gly Ile Val Ser Lys Thr Glu Ser Asp Leu Val Gly Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Asn Pro Arg Ala Ala Asp Pro Leu Ala Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe L~eu Ile Gly His Leu.Asp Arg Leu Ala Ala Ala Lys Ser Ala L~eu Gly Gln Gly Gly Tyr Asp Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cars Ile Glu Gly Ala Tyr Glu Ser Ala Ser Gln Val Ser Asp Phe Leu Thr Lys Tyr Ala Tyr Lys <210> 11 <211> 1847 <212> IAA
<213> Glycine mzx <220>
<221> CDS
<222> (55)..(1683) <223> soybean protox-1 <400> 11 ctttagcaca gtgttgaaga taacgaacga atagtgccat tactgtaacc aacc atg 57 Met gtt tcc gtc ttc aac gag atc cta ttc ccg ccg aac caa acc ctt ctt 105 Val Ser Val Phe Asn Glu Ile Leu Phe Pro Pro Asn Gln Thr Leu Leu cgc ccc tcc ctc cat tcc cca acc tct ttc ttc acc tct ccc act cga 153 Arg Pro Ser Leu His Ser Pro Thr Sex Phe Phe Thr Ser Pro Thr Arg 20 25 30.
aaa ttc cct cgc tct cgc cct aac cct att cta cgc tgc tcc att gcg 201 Lys Phe Pro Arg Ser Arg Pro Asn Pro Ile Leu Arg Cps Ser Ile Ala gag gaa tcc acc gcg tct ccg ccc aaa acc aga gac tcc gcc ccc gtg 249 Glu Glu Ser Thr Ala Ser Pro Pro Lys Thr Arg Asp Ser Ala Pro Val gac tgc gtc gtc gtc ggc gga ggc gtc agc ggc ctc tgc atc gcc cag 297 Asp Cps Val Val Val Gly Gly Gly Val Ser Gly Leu Cps Ile Ala Gln gcc ctc gcc acc aaa cac gcc aat gcc aac gtc gtc gtc acg gag gcc 345 Ala Leu Ala Thr Lys His Ala Asn Ala Asn Val Val Val Thr Glu Ala cga gac cgc gtc ggc ggc aac atc acc acg atg gag agg gac gga tac 393 Arg Asp Arg Val Gly Gly Asn Ile Thr Thr Met Glu Arg Asp Gly Tyr ctc tgg gaa gaa ggc ccc aac agc ttc cag cct tct gat cca atg ctc 441 Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Met Leu acc atg gtg gtg gac agt ggt tta aag gat gag ctt gtt ttg ggg gat 489 Thr Met Val Val Asp Ser Gly Leu Lys Asp Glu Leu Val Leu Gly Asp cct gat gca cct cgg ttt gtg ttg tgg aac agg aag ttg agg ccg gtg 537 Pro Asp Ala Pro Arg Phe Val Leu Trp Asn Arg Lys Leu Arg Pro Val ccc ggg aag ctg act gat ttg cct ttc ttt gac ttg atg agc att ggt 585 Pro Gly Lys Leu Thr Asp L~eu Pro Phe Phe Asp Leu Met Ser Ile Gly ggc aaa atc agg get ggc ttt ggt gcg ctt gga att cgg cct cct cct 633 Gly Lys Ile Arg Ala Gly Phe Gly Ala L~eu Gly Ile Arg Pro Pro Pro cca ggt cat gag gaa tcg gtt gaa gag ttt gtt cgt cgg aac ctt ggt 681 Pro Gly His Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly gat gag gtt ttt gaa cgg ttg ata gag cct ttt tgt tca ggg gtc tat. 729 Asp Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cps Ser Gly Val Tyr gca ggc gat cct tca aaa tta agt atg aaa gca gca ttc ggg aaa gtt 777 Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val tgg aag ctg gaa aaa aat ggt ggt agc att att ggt gga act ttc aaa 825 Trp Lys Leu Glu Lys Asn Gly Gly Ser Ile Ile Gly Gly Thr Phe Lys gca ata caa gag aga aat gga get tca aaa cca cct cga gat ccg cgt 873 Ala Ile Gln Glu Arg Asn Gly Ala Ser Lys Pro Pro Arg Asp Pro Arg ctg cca aaa cca aaa ggt cag act gtt gga tct ttc cgg aag gga ctt 921 Leu Pro Lys Pro Lys Gly Gln Thr Val Gly Ser Phe Arg Lys Gly Leu acc atg ttg cct gat gca att tct gcc aga cta ggc aac aaa gta aag 969 Thr Met Leu Pro Asp Ala Ile Ser Ala Arg Leu Gly Asn Lys Val Lys tta tct tgg aag ctt tca agt att agt aaa ctg gat agt gga gag tac 1017 Leu Ser Trp Lys Ireu Ser Ser Ile Ser Lys Leu Asp Ser Gly Glu Tyr agt ttg aca tat gaa aca cca gaa gga gtg gtt tct ttg cag tgc aaa 1065 Ser Leu Thr Tyr Glu Thr Pro Glu Gly Val Val Ser Leu Gln Cars Lys act gtt gtc ctg acc att cct tcc tat gtt get agt aca ttg ctg cgt 1113 Thr Val Val Leu Thr Ile Pro Ser err Val Ala Ser Thr Leu Leu Arg cct ctg tct get get get gca gat gca ctt tca aag ttt tat tac cct 1161 Pro Leu Ser Ala Ala Ala Ala Asp Ala Leu Ser Lys Phe Tyr 'I~r Pro cca gtt get gca gtt tcc ata tcc tat cca aaa gaa get att aga tca 1209 Pro Val Ala Ala Val Ser Ile Ser 'I~r Pro Lys Glu Ala Ile Arg Ser gaa tgc ttg ata gat ggt gag ttg aag ggg ttt ggt caa ttg cat cca 1257 Glu Cys Leu Ile Asp Gly Glu Leu Lys Gly Phe Gly Gln Leu His Pro cgt agc caa gga gtg gaa aca tta gga act ata tac agc tca tca cta 1305 Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu ttc ccc aac cga gca cca cct gga agg gtt cta ctc ttg aat tac att 1353 Phe Pro Asn Arg Ala Pro Pro Gly Arg Val Leu Leu Leu Asn Tyr Ile gga gga gca act aat act gga att tta tcg aag acg gac agt gaa ctt 1401 Gly Gly Ala Thr Asn Thr Gly Ile Leu Ser Lys Thr Asp Ser Glu Leu gtg gaa aca gtt gat cga gat ttg agg aaa atc ctt ata aac cca aat 1449 Val Glu Thr Val Asp Arg Asp Leu Arg Lys Ile Leu Ile Asn Pro Asn gcc cag gat cca ttt gta gtg ggg gtg aga ctg tgg cct caa get att 1497 Ala Gln Asp Pro Phe Val Val Gly Val Arg Leu Trp Pro Gln Ala Ile cca cag.ttc tta gtt ggc cat ctt gat ctt cta gat gtt get aaa get 1545 Pro Gln Phe Leu Val Gly His Leu Asp Leu Leu Asp Val Ala Lys Ala tct atc aga aat act ggg ttt gaa ggg ctc ttc ctt ggg ggt aat tat 1593 Ser Ile Arg Asn Thr Gly Phe Glu Gly Leu Phe Leu Gly Gly Asn Tyr gtg tct ggt gtt gcc ttg gga cga tgc gtt gag gga gcc tat gag gta 1641 Val Ser Gly Val Ala Leu Gly Arg Cars Val Glu Gly Ala Tyr Glu Val gca get gaa gta aac gat ttt ctc aca aat aga gtg tac aaa 1683 Ala Ala Glu Val Asn Asp Phe Leu Thr Asn Arg Val Tyr Lys tagtagcagt ttttgttttt gtggtggaat gggtgatggg actctcgtgt tccattgaat 1743 tataataatg tgaaagtttc tcaaattcgt tcgataggtt tttggcggct tctattgctg 1803 ataatgtaaa atcctcttta agtttgaaaa aaaaaaaaaa aaaa 1847 <210> 12 <211> 543 <212> PRT
<213> Glycine mix <400> 12 Met Val Ser Val Phe Asn Glu Ile Leu Phe Pro Pro Asn Gln Thr Leu Leu Arg Pro Ser Leu His Ser Pro Thr Ser Phe Phe Thr Ser Pro Thr Arg Lys Phe Pro Arg Ser Arg Pro Asn Pro Ile Leu Arg Cars Ser Ile Ala Glu Glu Ser Thr Ala Ser Pro Pro Lys Thr Arg Asp Ser Ala Pro Val Asp C~5 Val Val Val Gly Gly Gly Val Ser Gly Leu Cars Ile Ala Gln Ala Leu Ala Thr Lys His Ala Asn Ala Asn Val Val Val Thr Glu Ala Arg Asp Arg Val Gly Gly Asn Ile Thr Thr Met Glu Arg Asp Gly Tyr Lsu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Met Leu Thr Met Val Val Asp Ser Gly Leu Lys Asp Glu Leu Val Leu Gly Asp Pro Asp Ala Pro Arg Phe Val Leu Trp Asn Arg Lys Leu Arg Pro Val Pro Gly Lys Leu Thr Asp Leu Pro Phe Phe Asp Leu Met Ser Ile Gly Gly Lys Ile Arg Ala Gly Phe Gly Ala Leu Gly Ile Arg Pro Pro Pro Pro Gly His Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly Asp Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cars Ser Gly Val err Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Lys Leu Glu Lys Asn Gly Gly Ser Ile Ile Gly Gly Thr Phe Lys Ala Ile Gln Glu Arg Asn Gly Ala Ser Lys Pro Pro Arg Asp Pro Arg Leu Pro Lys Pro Lys Gly Gln Thr Val Gly Ser Phe Arg Lys Gly Leu Thr Met Leu Pro Asp Ala Ile Ser Ala Arg Leu Gly Asn Lys Val Lys Leu Ser Trp Lys Leu Ser Ser Ile Ser Lys Leu Asp Ser Gly Glu Tyr Ser Leu Thr Tyr Glu Thr Pro Glu Gly Val Val Ser Leu Gln Cys Lys Thr Val Val Leu Thr Ile Pro Ser Tyr Val Ala Ser Z'hr Leu Leu Arg Pro Leu Ser Ala Ala Ala Ala Asp Ala Leu Ser Lys Phe Tyr 'I~rr Pro Pro Val Ala Ala Val Ser Ile Ser Tyr Pro Lys Glu Ala Ile Arg Ser Glu Cps Leu Ile Asp Gly Glu Leu Lys Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly 2"hr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Pro Gly Arg Val Leu Leu Leu Asn Tyr Ile Gly Gly Ala ~hr Asn Thr Gly Ile Leu Ser Lys Thr Asp Ser Glu Leu Val Glu Thr Val Asp Arg Asp Leu Arg Lys Ile Leu Ile Asn Pro Asn Ala Gln Asp Pro Phe Val Val Gly Val Arg Leu Trp Pro Gln Ala Ile Pro Gln Phe Leu Val Gly His Leu Asp Leu Leu Asp Val Ala Lys Ala Ser Ile Arg Asn Thr Gly Phe Glu Gly Leu Phe Leu Gly Gly Asn Tyr Val Ser Gly Val Ala Leu Gly Arg Cys Val Glu Gly Ala Tyr Glu Val Ala Ala Glu Val Asn Asp Phe Leu Thr Asn Arg Val Tyr Lys <210> 13 <211> 583 <212> L'~1A
<213> Arabidopsis thaliana <220>
<221> misc feature <222> (1)..(583) <223> Arabidopsis protox-1 promoter <400> 13 gaattccgat cgaattatat aattatcata aatttgaata agcatgttgc cttttattaa 60 agaggtttaa taaagtttgg taataatgga ctttgacttc aaactcgatt ctcatgtaat 120 taattaatat ttacatcaaa atttggtcac taatattacc aaattaatat actaaaatgt 180 taattcgcaa ataaaacact aattccaaat aaagggtcat tatgataaac acgtattgaa 240 cttgataaag caaagcaaaa ataatgggtt tcaaggtttg ggttatatat gacaaaaaaa 300 aaaaaaggtt tggttatata tctattgggc ctataaccat gttatacaaa tttgggccta 360 actaaaataa taaaataaac gtaatggtcc tttttatatt tgggtcaaac ccaactctaa 420 acccaaacca aagaaaaagt atacggtacg gtacacagac ttatggtgtg tgtgattgca 480 ggtgaatatt tctcgtcgtc ttctcctttc ttctgaagaa gattacccaa tctgaaaaaa 540 accaagaagc tgacaaaatt ccgaattctc tgcgatttcc atg 583 <210> 14 <211> 3848 <212> L~TP.
<213> Zea mays <220>
<221> misc feature <222> (1)..(3848) <223> maize protox-1 promoter <400> 14 tcgatctttc taggctgatc cccaaatctt cctccgaagc ccctggcgcc tctgcccctt 60 ggagctggtg gcctgaaaga gctttgctgt tgccccgaag attgtgaggt atattgtgac 120 ctctgagact gacttccttt gtcgtcactt tgagtggagt tatggattga cctgacgtgc 180 ctcagatgga ttcttcctcc gaagcccctg gtcatttcgg agaatctgta atcttattcc 240 cttctttggc gaaaatctgt cagcttggat gtactcatcc atcttctgaa gcagcttctc 300 cagagtttgt ggaggcttcc tggcgaaata ttgggctgta ggtcctggac gaagaccctt 360 gatcatggcc tcaatgacaa tctcattggg caccgtaggc gcttgtgccc tcaatcgcaa 420 gaaccttcgt acatatgcct gaaggtattc ttcgtgatct tgtgtgcatt ggaacagagc 480 ctgagctgtg accgacttcg tttgaaagcc ttggaagcta gtaaccaaca tgtgcttaag 540 cttctgccac gacgtgatag tccctggccg aagagaagaa taccatgttt gggctacatt 600 ccggactgcc atgacgaagg acttcgccat gactacagtg ttgaccccat acgaagatat 660 agttgcttcg tagctcatca gaaactgctt tggatctgag tgcccatcat acatggggag 720 ctgaggtggc ttgtatgatg ggggccatgg ggtagcctgc agttctgctg ccaagggaga 780 agcatcatca aaagtaaagg catcatgatt aaaatcatca taccatccat cctcgttgaa 840 taagccttct tgacgaagct ccctgtgttg gggccttcga tcttgttcat cttgaacaag 900 atgacgcact tcttcagtgg cttcgtcgat ctttctttgg agatcagcca gtcgcaccat 960 cttctccttc tttctttgta cttgttgatg gatgatctcc atgtccctga tctcttggtc 1020 caactcctcc tcttggagtg tcagactggt ggctttcctc ttctggcttc gagcctctcg 1080 aagagaaaga gtttcttgat ttgggtccag cggctgcagt gcagtggtcc ctggtgctga 1140 agctttcttc ggtggcatga caaaggtcag tgcttgccga aggtggtcga aaagggttca 1200 ctagaggtgg gagccaatgt tggggacttc tcaagtgcta tgagttaaga acaaggcaac 1260 acaaaatgtt aaatattaat agctttcatc tttcgaagca ttatttccct ttgggtataa 1320 tgatcttcag acgaaagagt ccttcatcat tgcgatatat gttaatagaa ggaggagcat 1380 atgaaatgta agagacaaca tgaacaatcg tgtagcattg ttaattcatc atcattttat 1440 tattatggaa aaatagaaac aatattgaat tacaaatgta cctttggctt gacagaagat 1500 aaaagtacaa gcttgacgca cgagcaagta caagtcagtg tgaacagtac gggggtactg 1560 ttcatctatt tataggcaca ggacacagcc tgtgagaaat tacagtcatg ccctttacat 1620 ttactattga cttatagaaa aatctatgag gactggatag ccttttcccc tttaagtcgg 1680 tgcctttttc cgcgattaag ccgaatctcc cttgcgcata gcttcggagc atcggcaacc 1740 ttcgtcacga tcatgccctt ctcattgtgt atgcttttaa tcctgaattc gaaggtacct 1800 gtccataaac catacttgga agacattgtt aaattatgtt tttgaggacc ttcggaggac 1860 gaaggccccc aacagtcgtg tttttgagga ccttcggaag atgaaggccc ccaacaagac 1920 ctatccataa aaccaaccta tccacaaaac cgaccccatt cacccttcat ttgcctcacc 1980 aacaacccta attaggttgt tggtttaaat tttttagggt caatttggtc atcaccatcc 2040 actgtcactc cacaaactca atatcaataa acagactcaa tcacccaaac tgaccatacc 2100 cataaaaccg ccccaccctt ctagcgcctc gccagaaacc agaaaccctg attcagagtt 2160 caaacttaaa acgaccataa ctttcacctt ggaactcgaa tcaggtccat ttttttccaa 2220 atcacacaaa attaaatttc gcatccgata atcaagccat ctcttcacta tggttttaag 2280 tgttgctcac actagtgtat ttatggacta atcacctgtg tatctcatac aataacatat 2340 cagtacatct aagttgttac tcaattacca aaaccgaatt atagccttcg aaaaaggtta 2400 tcgactagtc actcaattac caaaactaaa ctttagactt tcatgtatga catccaacat 2460 gacactgtac tggactaaac cacctttcaa gctacacaag gagcaaaaat aactaatttt 2520 cgtagttgta ggagctaaag tatatgtcca caacaatagt taagggaagc ccccaaggac 2580 ttaaaagtcc ttttacctct tgaaactttt gtcgtggtct actttttcac tttaaacttc 2640 aaaatttgac attttatcac cccttaactc ttaaaaccat ttaaattaca ttcttactag 2700 attatagatg attttgttgt gaaaagtttt taagacatgt ttacacattg attaaaatca 2760 tttgttcaat ttcctagagt taaatctaat cttattaaaa ctattagaga tactttcacg 2820 agctctaaat atttttattt tttcattatg gaattttgtt agaattctta tagacctttt 2880 tttgtggttt aaaagccttg ccatgttttt aacaagtttt ttttctattt tttgaaattt 2940 tcttggaaac cacttctaac ccggtagaag atttattttg ctacacttat atctacaaca 3000 aaatcaactt atgaaattgt cttggaaact acctctaacc cggtagaatg aatttgaatg 3060 aaaattaaac caacttacgg aatcgcccaa catatgtcga ttaaagtgga tatggataca 3120 tatgaagaag ccctagagat aatctaaatg gtttcagaat tgagggttat tttttgaagt 3180 ttgatgggaa gataagacca taacggtagt tcacagagat aaaagggtta tttttttcag 3240 aaatatttgt gctgcaattg atcctgtgcc tcaaattcag cctgcaacca aggccaggtt 3300 ctagagcgaa caaggcccac gtcacccgtg gcccgtcagg cgaagcaggt cttgtgcaga 3360 ctttgagagg gattggatat caacggaacc aatcacgcac ggcaatgcga ttcccagccc 3420 acctgtaacg ttccagtggg ccatccttaa ctccaagccc aacggcccta ccccatctcg 3480 tcgtgtcatc cactccgccg cacaggcgct cagctccgca acgccgccgg aaatggtcgc 3540 cgccacagcc accgccatgg ccaccgctgc atcgccgcta ctcaacggga cccgaatacc 3600 tgcgcggctc cgccatcgag gactcagcgt gcgctgcgct gctgtggcgg gcggcgcggc 3660 cgaggcaccg gcatccaccg gcgcgcggct gtccgcggac tgcgttgtgg tgggcggagg 3720 catcagtggc ctctgcaccg cgcaggcgct ggccacgcgg cacggcgtcg gggacgtgct 3780 tgtcacggag gcccgcgccc gccccggcgg caacattacc accgtcgagc gccccgagga 3840 agggtacc 3848 <210> 15 <211> 1826 <212> LTA
<213> Gossypiiun hirsutiun <220>
<221> CDS
<222> (31)..(1647) <223> cotton protox-1 coding sequence <400> 15 cctctcgctc gcctggcccc accaccaatc atg acg get cta atc gac ctt tct 54 Met Thr Ala Leu Ile Asp Leu Ser ctt ctc cgt tcc tcg ccc tcc gtt tcc cct ttc tcc ata ccc cac cac 102 Leu Leu Arg Ser Ser Pro Ser Val Ser Pro Phe Ser Ile Pro His His cag cat ccg ccc cgc ttt cgt aaa cct ttc aag ctc cga tgc tcc ctc 150 Gln His Pro Pro Arg Phe Arg Lys Pro Phe Lys Lsu Arg Cps Ser Leu gcc gag ggt ccc acg att tcc tca tct aaa atc gac ggg gga gaa tca 198 Ala Glu Gly Pro Thr Ile Ser Ser Ser Lys Ile Asp Gly Gly Glu Ser tcc atc gcg gat tgc gtc atc gtt gga ggt ggt atc agt gga ctt tgc 246 Ser Ile Ala Asp Cars Val Ile Val Gly Gly Gly Ile Ser Gly 1xu Gds att get caa get ctc gcc acc aag cac cgt gac gtc get tcc aat gtg 294 Ile Ala Gln Ala Leu Ala Thr Lys His Arg Asp Val Ala Ser Asn Val att gtg acg gag gcc aga gac cgt gtt ggt ggc aac atc act acc gtt 342 Ile Val Thr Glu Ala Arg Asp Arg Val Gly Gly Asn Ile 'rhr Thr Val gag aga gat gga tat ctg tgg gaa gaa ggc ccc aac agt ttt cag ccc 390 Glu Arg Asp Gly Tyr Isu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro tcc gat cct att cta acc atg gcc gtg gat agt gga ttg aag gac gat 438 Ser Asp Pro Ile Leu 'I2~r Met Ala Val Asp Ser Gly Leu Lys Asp Asp ttg gtt tta ggt gac cct aat gca ccg cga ttt gta cta tgg gag gga 486 Leu Val Leu Gly Asp Pro Asn Ala Pro Arg Phe Val Leu Trp Glu Gly aaa cta agg cct gtg ccc tcc aag cca acc gac ttg ccg ttt ttt gat 534 Lys Lsu Arg Pro Val Pro Ser Lys Pro Thr Asp Leu Pro Phe Phe Asp ttg atg agc att get gga aaa ctt agg get ggg ttc ggg get att ggc 582 Leu Met Ser Ile Ala Gly Lys Leu Arg Ala Gly Phe Gly Ala Ile Gly att cgg cct ccc cct ccg ggt tat gaa gaa tcg gtg gag gag ttt gtg 630 Ile Arg Pro Pro Pro Pro Gly Tyr Glu Glu Ser Val Glu Glu Phe Val cgc cgt aat ctt ggt get gag gtt ttt gaa cgc ttt att gaa cca ttt 678 Arg Arg Asn Leu Gly Ala Glu Val Phe Glu Arg Phe Ile Glu Pro Phe tgt tca ggt gtt tat gca ggg gat cct tca aaa tta agc atg aaa gca 726 Gds Ser Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala gca ttt gga aga gta tgg aag cta gaa gag att ggt ggc agc atc att 774 Ala Phe Gly Arg Val Trp Lys Leu Glu Glu Ile Gly Gly Ser Ile Ile ggt ggc act ttc aag aca atc cag gag aga aat aag aca cct aag cca 822 Gly Gly Thr Phe Lys Thr Ile Gln Glu Arg Asn Lys Thr Pro Lys Pro ccc aga gac ccg cgt ctg cca aaa ccg aag ggc caa aca gtt gga tct 870 Pro Arg Asp Pro Arg Leu Pro Lys Pro Lys Gly Gln Thr Val Gly Ser ttt agg aag gga ctt acc atg ctg cct gag gca att get aac agt ttg 918 Phe Arg Lys Gly Leu Thr Met Leu Pro Glu Ala Ile Ala Asn Ser Leu ggt agc aat gta aaa tta tct tgg aag ctt tcc agt att acc aaa ttg 966 Gly Ser Asn Val Lys Leu Ser Trp Lys Leu Ser Ser Ile Thr Lys Leu ggc aat gga ggg tat aac ttg aca ttt gaa aca cct gaa gga atg gta 1014 Gly Asn Gly Gly Tyr Asn Leu Thr Phe Glu Thr Pro Glu Gly Met Val tct ctt cag agt aga agt gtt gta atg acc att cca tcc cat gtt gcc 1062 Ser Leu Gln Ser Arg Ser Val Val Met Thr Ile Pro Ser His Val Ala agt aac ttg ttg cat cct ctc tcg get get get gca gat gca tta tcc 1110 Ser Asn Leu Leu His Pro Leu Ser Ala Ala Ala Ala Asp Ala Leu Ser caa ttt tat tat cct cca gtt gca tca gtc aca gtc tcc tat cca aaa 1158 Gln Phe Tyr Tyr Pro Pro Val Ala Ser Val Thr Val Ser Tyr Pro Lys gaa gcc att cga aaa gaa tgt ttg att gat ggt gaa ctt aag ggg ttt 1206 Glu Ala Ile Arg Lys Glu Cps Leu Ile Asp Gly Glu Leu Lys Gly Phe ggc cag ttg cac cca cgc agc caa gga att gaa act tta ggg acg ata 1254 Gly Gln Leu His Pro Arg Ser Gln Gly Ile Glu Thr Leu Gly Thr Ile tac agt tca tca ctt ttc ccc aat cga get cca tct ggc agg gtg ttg 1302 Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Ser Gly Arg Val Leu ctc ttg aac tac ata gga gga get acc aac act gga att ttg tcc aag 1350 Leu Leu Asn Tyr Ile Gly Gly Ala Thr Asn Thr Gly Ile Leu Ser Lys act gaa ggg gaa ctt gta gaa gca gtt gat cgt gat ttg aga aaa atg 1398 Thr Glu Gly Glu L~eu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met ctt ata aat cct aat gca aag gat cct ctt gtt ttg ggt gta aga gta 1446 Leu Ile Asn Pro Asn Ala Lys Asp Pro Leu Val Lsu Gly Val Arg Val tgg cca aaa gcc att cca cag ttc ttg gtt ggt cat ttg gat ctc ctt 1494 Trp Pro Lys Ala Ile Pro Gln Phe Leu Val Gly His Leu Asp Leu L~eu gat agt gca aaa atg get ctc agg gat tct ggg ttt cat gga ctg ttt 1542 Asp Ser Ala Lys Met Ala Leu Arg Asp Ser Gly Phe His Gly Leu Phe ctt ggg ggc aac tat gta tct ggt gtg gca tta gga cgg tgt gtg gaa 1590 Leu Gly Gly Asn Tyr Val Ser Gly Val Ala Leu Gly Arg Cars Val Glu ggt get tac gag gtt gca get gaa gtg aag gaa ttc ctg tca caa tat 1638 Gly Ala Tyr Glu Val Ala Ala Glu Val Lys Glu Phe Leu Ser Gln Tyr gca tac aaa taatattgaa attcttgtca ggctgcaaat gtagaagtca 1687 Ala Tyr Lys gttattggat agtatctctt tagctaaaaa attgggtagg gttttttttg ttagttcctt 1747 gaccactttt tggggttttc attagaactt catatttgta tatcatgttg caatatcaaa 1807 aaaaaaaaaa aaaaaaaaa 1826 <210> 16 <211> 539 <212> PRT
<213> Gossypium hirsutum <400> 16 Met Thr Ala Leu Ile Asp Leu Ser Leu Leu Arg Ser Ser Pro Ser Val Ser Pro Phe Ser Ile Pro His His Gln His Pro Pro Arg Phe Arg Lys Pro Phe Lys Leu Arg Cys Ser Leu Ala Glu Gly Pro Thr Ile Ser Ser Ser Lys Ile Asp Gly Gly Glu Ser Ser Ile Ala Asp Gars Val Ile Val Gly Gly Gly Ile Ser Gly Leu Cars Ile Ala Gln Ala Leu Ala Thr Lys His Arg Asp Val Ala Ser Asn Val Ile Val Thr Glu Ala Arg Asp Arg Val Gly Gly Asn Ile Thr Thr Val Glu Arg Asp Gly Tyr Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Ile Leu Thr Met Ala Val Asp Ser Gly Leu Lys Asp Asp Leu Val Leu Gly Asp Pro Asn Ala Pro Arg Phe Val Leu 'I'rp Glu Gly Lys Leu Arg Pro Val Pro Ser Lys Pro Thr Asp Leu Pro Phe Phe Asp Leu Met Ser Ile Ala Gly Lys Leu Arg Ala Gly Phe Gly Ala Ile Gly Ile Arg Pro Pro Pro Pro Gly Tyr Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly Ala Glu Val Phe Glu Arg Phe Ile Glu Pro Phe Cars Ser Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe Gly Arg Val Trp Lys Leu Glu Glu Ile Gly Gly Ser Ile Ile Gly Gly Thr Phe Lys Thr Ile Gln Glu Arg Asn Lys Thr Pro Lys Pro Pro Arg Asp Pro Arg Leu Pro Lys Pro Lys Gly Gln Thr Val Gly Ser Phe Arg Lys Gly Leu 'rhr Met Leu Pro Glu Ala Ile Ala Asn Ser Leu Gly Ser Asn Val Lys L~etz Ser '1'rp Lys Leu Ser Ser Ile Thr Lys Leu Gly Asn Gly Gly Tyr Asn Leu Thr Phe Glu Thr Pro Glu Gly Met Val Ser Leu Gln Ser Arg Ser Val Val Met Thr Ile Pro Ser His Val Ala Ser Asn Leu Leu His Pro Leu Ser Ala Ala Ala Ala Asp Ala Leu Ser Gln Phe Tyr Tyr Pro Pro Val Ala Ser Val Thr Val Ser Tyr Pro Lys Glu Ala Ile Arg Lys Glu Cars Leu Ile Asp Gly Glu Leu Lys Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Ile Glu Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Ser Gly Arg Val Leu Leu Leu Asn 'I~rr Ile Gly Gly Ala Thr Asn Thr Gly Ile Leu Ser Lys ~'hr Glu Gly Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Asn Pro Asn Ala Lys Asp Pro Leu Val Leu Gly Val Arg Val Trp Pro Lys Ala Ile Pro Gln Phe Leu Val Gly His Leu Asp Leu Leu Asp Ser Ala Lys Met Ala Leu Arg Asp Ser Gly Phe His Gly Leu Phe Leu Gly Gly Asn Tyr Val Ser Gly Val Ala Leu Gly Arg Cps Val Glu Gly Ala Tyr Glu Val Ala Ala Glu Val Lys Glu Phe L'eu Ser Gln Tyr Ala Tyr Lys <210> 17 <211> 1910 <212> I~iA
<213> Beta vulgaris <220>
<221> CDS
<222> (1)..(1680) <223> sugar beet protox-1 coding sequence <400> 17 atg aaa tca atg gcg tta tca aac tgc att cca cag aca cag tgc atg 48 Met Lys Ser Met Ala Leu Ser Asn Cps Ile Pro Gln Thr Gln Cars Met cca ttg cgc agc agc ggg cat tac agg ggt aat tgt atc atg ttg tca 96 Pro Leu Arg Ser Ser Gly His Tyr Arg Gly Asn Cps Ile Met Leu Ser att cca tgt agt tta att gga aga cga ggt tat tat tca cat aag aag 144 Ile Pro Cars Ser Leu Ile Gly Arg Arg Gly Tyr Tyr Ser His Lys Lys agg agg atg agc atg agt tgc agc aca agc tca ggc tca aag tca gcg 192 Arg Arg Met Ser Met Ser Cars Ser Thr Ser Ser Gly Ser Lys Ser Ala gtt aaa gaa gca gga tca gga tca ggt gca gga gga ttg cta gac tgc 240 Val Lys Glu Ala Gly Ser Gly Ser Gly Ala Gly Gly Leu Leu Asp Cps gta atc gtt gga ggt gga att agc ggg ctt tgc.atc gcg cag get ctt 288 Val Ile Val Gly Gly Gly Ile Ser Gly Leu Cys Ile Ala Gln Ala Leu tgt aca aaa cac tcc tct tcc tct tta tcc cca aat ttt ata gtt aca 336 Cys Thr Lys His Ser Ser Ser Ser Leu Ser Pro Asn Phe Ile Val Thr gag gcc aaa gac aga gtt ggc ggc aac atc gtc act gtg gag gcc gat 384 Glu Ala Lys Asp Arg Val Gly Gly Asn Ile Val Thr Val Glu Ala Asp ggc tat atc tgg gag gag gga ccc aat agc ttc cag cct tcc gac gcg 432 Gly Tyr Ile Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Ala gtg ctc acc atg gcg gtc gac agt ggc ttg aaa gat gag ttg gtg ctc 480 Val Leu Thr Met Ala Val Asp Ser Gly Leu Lys Asp Glu Leu Val Leu gga gat ccc aat get cct cgc ttt gtg cta tgg aat gac aaa tta agg 528 Gly Asp Pro Asn Ala Pro Arg Phe Val Leu Trp Asn Asp Lys Leu Arg ccc gta cct tcc agt ctc acc gac ctc cct ttc ttc gac ctc atg acc 576 Pro Val Pro Ser Ser Lreu Thr Asp Leu Pro Phe Phe Asp L~eu Met Thr att ccg ggc aag att agg get get ctt ggt get ctc gga ttt cgc cct 624 Ile Pro Gly Lys Ile Arg Ala Ala Leu Gly Ala Leu Gly Phe Arg Pro tct cct cca cct cat gag gaa tct gtt gaa cac ttt gtg cgt cgt aat 672 Ser Pro Pro Pro His Glu Glu Ser Val Glu His Phe Val Arg Arg Asn ctc gga gat gag gtc ttt gaa cgc ttg att gaa ccc ttt tgt tca ggt 720 Leu Gly Asp Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cars Ser Gly gtg tat gcc ggt gat cct gcc aag ctg agt atg aaa get get ttt ggg 768 Val Tyr Ala Gly Asp Pro Ala Lys Leu Ser Met Lys Ala Ala Phe Gly aag gtc tgg aag ttg gag caa aag ggt ggc agc ata att ggt ggc act 816 Lys Val Trp Lys Leu Glu Gln Lys Gly Gly Ser Ile Ile Gly Gly Thr ctc aaa get ata cag gaa aga ggg agt aat cct aag ccg ccc cgt gac 864 Leu Lys Ala Ile Gln Glu Arg Gly Ser Asn Pro Lys Pro Pro Arg Asp cag cgc ctc cct aaa cca aag ggt cag act gtt gga tcc ttt aga aag 912 Gln Arg L~eu Pro Lys Pro Lys Gly Gln Thr Val Gly Ser Phe Arg Lys gga ctc gtt atg ttg cct acc gcc att tct get cga ctt ggc agt aga 960 Gly Leu Val Met Leu Pro Thr Ala Ile Ser Ala Arg Leu Gly Ser Arg gtg aaa cta tct tgg acc ctt tct agt atc gta aag tca ctc aat gga 1008 Val Lys Leu Ser Trp Thr Leu Ser Ser Ile Val Lys Ser Leu Asn Gly gaa tat agt ctg act tat gat acc cca gat ggc ttg gtt tct gta aga 1056 Glu Tyr Ser Leu 'rhr Tyr Asp Thr Pro Asp Gly Leu Val Ser Val Arg acc aaa agt gtt gtg atg act gtt cca tca tat gtt gca agt agg ctt 1104 'I'hr Lys Ser Val Val Met Thr Val Pro Ser Tyr Val Ala Ser Arg Leu ctt cgt cca ctt tca gac tct get gca gat tct ctt tca aaa ttt tac 1152 Leu Arg Pro Leu Ser Asp Ser Ala Ala Asp Ser Leu Ser Lys Phe Tyr tat cca cca gtt gca gca gtg tca ctt tcc tat cct aaa gaa gcg atc 1200 Tyr Pro Pro Val Ala Ala Val Ser Isu Ser Tyr Pro Lys Glu Ala Ile aga tca gaa tgc ttg att aat ggt gaa ctt caa ggt ttc ggg caa cta 1248 Arg Ser Glu Cys Leu Ile Asn Gly Glu Leu Gln Gly Phe Gly Gln Leu cat ccc cgc agt cag ggt gtg gaa acc ttg gga aca att tat agt tcg 1296 His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser Ser tct ctt ttc cct ggt cga gca cca cct ggt agg atc ttg atc ttg agc 1344 Ser Leu Phe Pro Gly Arg Ala Pro Pro Gly Arg Ile Leu Ile Leu Ser tac atc gga ggt get aaa aat cct ggc ata tta aac aag tcg aaa gat 1392 Tyr Ile Gly Gly Ala Lys Asn Pro Gly Ile L~eu Asn Lys Ser Lys Asp gaa ctt gcc aag aca gtt gac aag gac ctg aga aga atg ctt ata aat 1440 Glu Leu Ala Lys Thr Val Asp Lys Asp Leu Arg Arg Met Leu Ile Asn cct gat gca aaa ctt cct cgt gta ctg ggt gtg aga gta tgg cct caa 1488 Pro Asp Ala Lys Leu Pro Arg Val Leu Gly Val Arg Val Trp Pro Gln gca ata ccc cag ttt tct att ggg cac ttt gat ctg ctc gat get gca 1536 Ala Ile Pro Gln Phe Ser Ile Gly His Phe Asp Leu Leu Asp Ala Ala aaa get get ctg aca gat aca ggg gtc aaa gga ctg ttt ctt ggt ggc 1584 Lys Ala Ala Leu Thr Asp Thr Gly Val Lys Gly Leu Phe Leu Gly Gly aac tat gtt tca ggt gtt gcc ttg ggg cgg tgt ata gag ggt get tat 1632 Asn Tyr Val Ser Gly Val Ala Leu Gly Arg Cars Ile Glu Gly Ala Tyr gag tct gca get gag gta gta gat ttc ctc tca cag tac tca gac aaa 1680 Glu Ser Ala Ala Glu Val Val Asp Phe Leu Ser Gln Tyr Ser Asp Lys tagagcttca gcatcctgtg taattcaaca caggcctttt tgtatctgtt gtgcgcgcat 1740 gtagtctggt cgtggtgcta ggattgatta gttgctctgc tgtgtgatcc acaagaattt 1800 tgatggaatt tttccagatg tgggcattat atgttgctgt cttataaatc cttaatttgt 1860 acgtttagtg aattacaccg catttgatga ctaaaaaaaa aaaaaaaaaa 1910 <210> 18 <211> 560 <212> PRT
<213> Beta vulgaris <400> 18 Met Lys Ser Met Ala Leu Ser Asn Cps Ile Pro Gln Thr Gln Cps Met Pro Leu Arg Ser Ser Gly His Tyr Arg Gly Asn Gds Ile Met Leu Ser Ile Pro Cars Ser Leu Ile Gly Arg Arg Gly Tyr Tyr Ser His Lys Lys Arg Arg Met Ser Met Ser Cps Ser Thr Ser Ser Gly Ser Lys Ser Ala Val Lys Glu Ala Gly,Ser Gly Ser Gly Ala Gly Gly Leu Leu Asp Cars Val Ile Val Gly Gly Gly Ile Ser Gly Leu Cps Ile Ala Gln Ala Leu Cps Thr Lys His Ser Ser Ser Ser Leu Ser Pro Asn Phe Ile Val 'I'hr Glu Ala Lys Asp Arg Val Gly Gly Asn Ile Val Thr Val Glu Ala Asp Gly Tyr Ile Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Ala Val Leu Thr Met Ala Val Asp Ser Gly Leu Lys Asp Glu Leu Val Leu Gly Asp Pro Asn Ala Pro Arg Phe Val Leu Trp Asn Asp Lys Lieu Arg Pro Val Pro Ser Ser Leu Thr Asp Leu Pro Phe Phe Asp Lieu Met 'rhr Ile Pro Gly Lys Ile Arg Ala Ala Leu Gly Ala Leu Gly Phe Arg Pro Ser Pro Pro Pro His Glu Glu Ser Val Glu His Phe Val Arg Arg Asn Leu Gly Asp Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cps Ser Gly Val err Ala Gly Asp Pro Ala Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Lys Leu Glu Gln Lys Gly Gly Ser Ile Ile Gly Gly Thr Leu Lys Ala Ile Gln Glu Arg Gly Ser Asn Pro Lys Pro Pro Arg Asp Gln Arg Leu Pro Lys Pro Lys Gly Gln Thr Val Gly Ser Phe Arg Lys Gly Leu Val Met Leu Pro Thr Ala Ile Ser Ala Arg Leu Gly Ser Arg Val Lys Leu Ser Trp Thr Leu Ser Ser Ile Val Lys Ser Leu Asn Gly Glu Tyr Ser Leu Thr 'I~r Asp Thr Pro Asp Gly Leu Val Ser Val Arg Thr Lys Ser Val Val Met 'I'hr Val Pro Ser Tyr Val Ala Ser Arg Leu Leu Arg Pro Leu Ser Asp Ser Ala Ala Asp Ser Leu Ser Lys Phe Tyr Tyr Pro Pro Val Ala Ala Val Ser Leu Ser Tyr Pro Lys Glu Ala Ile Arg Ser Glu Cars L~eu Ile Asn Gly Glu Leu Gln Gly Phe Gly Gln Lreu Isis Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu Phe Pro Gly Arg Ala Pro Pro Gly Arg Ile Leu Ile Leu Ser Tyr Ile Gly Gly Ala Lys Asn Pro Gly Ile Leu Asn Lys Ser Lys Asp Glu Leu Ala Lys Thr Val Asp Lys Asp Leu Arg Arg Met Leu Ile Asn Pro Asp Ala Lys Leu Pro Arg Val Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Ser Ile Gly His Phe Asp Leu Leu Asp Ala Ala Lys Ala Ala Leu Thr Asp Thr Gly Val Lys Gly Leu Phe Leu Gly Gly Asn Tyr Val Ser Gly Val Ala Leu Gly Arg Cars Ile Glu Gly Ala Tyr Glu Ser Ala Ala Glu Val Val Asp Phe Leu Ser Gln Tyr Ser Asp Lys <210> 19 <211> 1784 <212> I~VA
<213> Brassica napes <220>
<221> CDS
<222> (47)..(1654) <223> Oilseed rape protox-1 coding sequence <400> 19 gggccccccc caaaattgag gattctcctt ctcgcgggcg atcgcc atg gat tta 55 Met Asp Leu tct ctt ctc cgt ccg cag cca ttc cta tcg cca ttc tca aat cca ttt 103 Ser Leu Leu Arg Pro Gln Pro Phe Leu Ser Pro Phe Ser Asn Pro Phe cct cgg tcg cgt ccc tac aag cct ctc aac ctc cgt tgc tcc gta tcc 151 Pro Arg Ser Arg Pro Tyr Lys Pro Leu Asn Leu Arg Cars Ser Val Ser ggt gga tcc gtc gtc ggc tct tct aca atc gaa ggc gga gga gga ggt 199 Gly Gly Ser Val Val Gly Ser Ser Thr Ile Glu Gly Gly Gly Gly Gly aaa acc gtc acg gcg gac tgc gtg atc gtc ggc gga gga atc agc ggc 247 Lys Thr Val Thr Ala Asp Cars Val Ile Val Gly Gly Gly Ile Ser Gly ctg tgc att gcg caa gcg ctc gtg acg aag cac cca gac get gca aag 295 Leu Cps Ile Ala Gln Ala Leu Val Thr Lys His Pro Asp Ala Ala Lys aat gtg atg gtg acg gag gcg aag gac cgt gtg gga ggg aat atc atc 343 Asn Val Met Val Thr Glu Ala Lys Asp Arg Val Gly Gly Asn Ile Ile acg cga gag gag caa ggg ttt cta tgg gaa gaa ggt ccc aat agc ttt 391 Thr Arg Glu Glu Gln Gly Phe Leu Trp Glu Glu Gly Pro Asn Ser Phe cag ccg tct gat cct atg ctc act atg gtg gta gat agt ggt ttg aaa 439 Gln Pro Ser Asp Pro Met Leu Thr Met Val Val Asp Ser Gly Leu Lys gat gat cta gtc ttg gga gat cct act get ccg agg ttt gtg ttg tgg 487 Asp Asp Leu Val Leu Gly Asp Pro Thr Ala Pro Arg Phe Val Leu '1'rp aat ggg aag ctg agg ccg gtt ccg tcg aag cta act gac ttg cct ttc 535 Asn Gly Lys Leu Arg Pro Val Pro Ser Lys Leu Thr Asp Leu Pro Phe ttt gac ttg atg agt att gga ggg aag att aga get ggg ttt ggt gcc 583 Phe Asp Leu Met Ser Ile Gly Gly Lys Ile Arg Ala Gly Phe Gly Ala att ggt att cga cct tca cct ccg ggt cgt gag gaa tca gtg gaa gag 631 Ile Gly Ile Arg Pro Ser Pro Pro Gly Arg Glu Glu Ser Val Glu Glu ttt gta agg cgt aat ctt ggt gat gag gtt ttt gag cgc ttg att gaa 679 Phe Val Arg Arg Asn Leu Gly Asp Glu Val Phe Glu Arg Leu Ile Glu ccc ttt tgc tca ggt gtt tat gcg gga gat cct gcg aaa ctg agt atg 727 Pro Phe Cps Ser Gly Val 'I~r Ala Gly Asp Pro Ala Lys Leu Ser Met aaa gca get ttt ggg aag gtt tgg aag cta gag gag aat ggt ggg agc 775 Lys Ala Ala Phe Gly Lys Val Trp Lys Leu Glu Glu Asn Gly Gly Ser atc att ggt ggt get ttt aag gca att caa gcg aaa aat aaa get ccc 823 Ile Ile Gly Gly Ala Phe Lys Ala Ile Gln Ala Lys Asn Lys Ala Pro aag aca acc cga gat ccg cgt ctg cca aag cca aag ggc caa act gtt 871 Lys Thr Thr Arg Asp Pro Arg Leu Pro Lys Pro Lys Gly Gln Thr Val ggt tct ttc agg aaa gga ctc aca atg ctg cca gag gca atc tcc gca 919 Gly Ser Phe Arg Lys Gly Leu Thr Met Leu Pro Glu Ala Ile Ser Ala agg ttg ggt gac aag gtg aaa gtt tct tgg aag ctc tca agt atc act 967 Arg Leu Gly Asp Lys Val Lys Val Ser Trp Lys Leu Ser Ser Ile Thr aag ctg gcc agc gga gaa tat agc tta act tac gaa act ccg gag ggt 1015 Lys Leu Ala Ser Gly Glu Tyr Ser Leu Thr Tyr Glu Thr Pro Glu Gly ata gtc act gta cag agc aaa agt gta gtg atg act gtg cca tct cat 1063 Ile Val Thr Val Gln Ser Lys Ser Val Val Met Thr Val Pro Ser His gtt get agt agt ctc ttg cgc cct ctc tct gat tct gca get gaa gcg 1111 Val Ala Ser Ser Leu Leu Arg Pro Leu Ser Asp Ser Ala Ala Glu Ala ctc tca aaa ctc tac tat ccg cca gtt gca gcc gta tcc atc tca tac 1159 Leu Ser Lys Leu 'I~r Tyr Pro Pro Val Ala Ala Val Ser Ile Ser Tyr gcg aaa gaa gca atc cga agc gaa tgc tta ata gat ggt gaa cta aaa 1207 Ala Lys Glu Ala Ile Arg Ser Glu Cars Leu Ile Asp Gly Glu Leu Lys ggg ttc ggc cag ttg cat cca cgc acg caa aaa gtg gaa act ctt gga 1255 Gly Phe Gly Gln Leu His Pro Arg Thr Gln Lys Val Glu Thr L~eu Gly aca ata tac agt tca tcg ctc ttt ccc aac cga gca ccg cct gga aga 1303 Thr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Pro Gly Arg gta ttg cta ttg aac tac atc ggt gga get acc aac act ggg atc tta 1351 Val Leu Leu Leu Asn Tyr Ile Gly Gly Ala Thr Asn Thr Gly Ile Leu tca aag tcg gaa ggt gag tta gtg gaa gca gta gat aga gac ttg agg 1399 Ser Lys Ser Glu Gly Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg aag atg ctg ata aag cca agc tcg acc gat cca ctt gta ctt gga gta 1447 Lys Met Leu Ile Lys Pro Ser Ser Thr Asp Pro Leu Val Leu Gly Val aaa tta tgg cct caa gcc att cct cag ttt ctg ata ggt cac att gat 1495 Lys Leu Trp Pro Gln Ala Ile Pro Gln Phe Leu Ile Gly His Ile Asp ttg gta gac gca gcg aaa gca tcg ctc tcg tca tct ggt cat gag ggc 1543 Leu Val Asp Ala Ala Lys Ala Ser Leu Ser Ser Ser Gly His Glu Gly tta ttc ttg ggt gga aat tac gtt gcc ggt gta gca ttg ggt cgg tgt 1591 Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cys gtg gaa ggt get tat gaa act gca acc caa gtg aat gat ttc atg tca 1639 Val Glu Gly Ala Tyr Glu Thr Ala Thr Gln Val Asn Asp Phe Met Ser agg tat get tac aag taatgtaacg cagcaacgat ttgatactaa gtagtagatt 1694 Arg Tyr Ala Tyr Lys ttgcagtttt gactttaaga acactctgtt tgtgaaaaat tcaagtctgt gattgagtaa 1754 atttatgtat tattactaaa aaaaaaaaaa 1784 <210> 20 <211> 536 <212> PRT
<213> Brassica napes <400> 20 Met Asp Leu Ser Leu Leu Arg Pro Gln Pro Phe Leu Ser Pro Phe Ser Asn Pro Phe Pro Arg Ser Arg Pro Tyr Lys Pro Leu Asn Leu Arg Cps Ser Val Ser Gly Gly Ser Val Val Gly Ser Ser Thr Ile Glu Gly Gly Gly Gly Gly Lys Thr Val Thr Ala Asp Cars Val Ile Val Gly Gly Gly Ile Ser Gly Leu Cars Ile Ala Gln Ala Leu Val Z'hr Lys His Pro Asp Ala Ala Lys Asn Val Met Val Thr Glu Ala Lys Asp Arg Val Gly Gly Asn Ile Ile Thr Arg Glu Glu Gln Gly Phe Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Met Leu Thr Met Val Val Asp Ser Gly Leu Lys Asp Asp Leu Val Lee Gly Asp Pro Thr Ala Pro Arg Phe Val Leu Trp Asn Gly Lys Leu Arg Pro Val Pro Ser Lys Leu Thr Asp Leu Pro Phe Phe Asp Leu Met Ser Ile Gly Gly Lys Ile Arg Ala Gly Phe Gly Ala Ile Gly Ile Arg Pro Ser Pro Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly Asp Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cars Ser Gly Val Tyr Ala Gly Asp Pro Ala Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Lys Leu Glu Glu Asn Gly Gly Ser Ile Ile Gly Gly Ala Phe Lys Ala Ile Gln Ala Lys Asn Lys Ala Pro Lys Thr Thr Arg Asp pro Arg Leu pro Lys Pro Lys Gly Gln Thr Val Gly Ser Phe Arg Lys Gly Leu Thr Met Leu Pro Glu Ala Ile Ser Ala Arg Leu Gly Asp Lys Val Lys Val Ser Trp Lys Leu Ser Ser Ile Z'hr Lys Leu Ala Ser Gly Glu Tyr Ser Leu Thr Tyr Glu Thr Pro Glu Gly Ile Val Thr Val Gln Ser Lys Ser Val Val Met Thr Val Pro Ser His Val Ala Ser Ser Leu Leu Arg Pro Leu Ser Asp Ser Ala Ala Glu Ala Leu Ser Lys Leu Tyr Tyr pro pro Val Ala Ala Val Ser Ile Ser Tyr Ala Lys Glu Ala Ile Arg Ser Glu Cars Leu Ile Asp Gly Glu Leu Lys Gly Phe Gly Gln Leu His Pro Arg Thr Gln Lys Val Glu Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Pro Gly Arg Val Leu Leu Leu Asn Tyr Ile Gly Gly Ala Thr Asn Thr Gly Ile Leu Ser Lys Ser Glu Gly Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Lys Pro Ser Ser Thr Asp Pro Leu Val Leu Gly Val Lys Leu Tzp Pro Gln Ala Ile Pro Gln Phe Leu Ile Gly His Ile Asp Leu Val Asp Ala Ala Lys Ala Ser Leu Ser Ser Ser Gly His Glu Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Gars Val Glu Gly Ala Tyr Glu Thr Ala Thr Gln Val Asn Asp Phe Met Ser Arg Tyr Ala err Lys <210> 21 <211> 1224 <212> L~1 <213> Oryza sativa <220>
<221> CDS
<222> (1)..(936) <223> rice protox-1 partial coding sequence <400> 21 cgg get ttg aag get gca ttt ggg aag gtg tgg agg ctg gag gat act 48 Arg Ala Leu Lys Ala Ala Phe Gly Lys Val Trp Arg Leu Glu Asp Thr 1 ~ 5 10 15 gga ggt agc att att ggt gga acc atc aag aca atc cag gag agg ggg 96 Gly Gly Ser Ile Ile Gly Gly Thr Ile Lys Z'hr Ile Gln Glu Arg Gly aaa aac ccc aaa ccg ccg agg gat ccc cgc ctt cca acg cca aag ggg 144 Lys Asn Pro Lys Pro Pro Arg Asp Pro Arg Leu Pro Thr Pro Lys Gly cag aca gtt gca tct ttc agg aag ggt ctg act atg ctc ccg gat get 192 Gln Thr Val Ala Ser Phe Arg Lys Gly Leu 1'hr Met Leu Pro Asp Ala att aca tct agg ttg ggt agc aaa gtc aaa ctt tca tgg aag ttg aca 240 Ile Thr Ser Arg Leu Gly Ser Lys Val Lys Leu Ser Trp Lys Leu Thr agc att aca aag tca gac aac aaa gga tat gca tta gtg tat gaa aca 288 Ser Ile Thr Lys Ser Asp Asn Lys Gly Tyr Ala Leu Val Tyr Glu Thr cca gaa ggg gtg gtc tcg gtg caa get aaa act gtt gtc atg acc atc 336 Pro Glu Gly Val Val Ser Val Gln Ala Lys Thr Val Val Met Thr Ile cca tca tat gtt get agt gat atc ttg cgg cca ctt tca agt gat gca 384 Pro Ser 'I~r Val Ala Ser Asp Ile Leu Arg Pro Leu Ser Ser Asp Ala gca gat get ctg tca ata ttc tat tat cca cca gtt get get gta act 432 Ala Asp Ala Leu Ser Ile Phe Tyr Tyr Pro Pro Val Ala Ala Val Thr gtt tca tat cca aaa gaa gca att aga aaa gaa tgc tta att gac gga 480 Val Ser Tyr Pro Lys Glu Ala Ile Arg Lys Glu Cps Leu Ile Asp Gly gag ctc cag ggt ttc ggc cag ctg cat ccg cgt agt cag gga gtt gag 528 Glu Leu Gln Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Val Glu act tta gga aca ata tat agc tca tca ctc ttt cca aat cgt get cca 576 Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro get gga agg gtg tta ctt ctg aac tac ata gga ggt tct aca aat aca 624 Ala Gly Arg Val Leu Leu Leu Asn Tyr Ile Gly Gly Ser Thr Asn Thr ggg att gtt tcc aag act gaa.agt gag ctg gta gaa gca gtt gac cgt 672 Gly Ile Val Ser Lys Thr Glu Ser Glu Leu Val Glu Ala Val Asp Arg gac ctc agg aag atg ctg ata aat cct aga gca gtg gac cct ttg gtc 720 Asp Leu Arg Lys Met Leu Ile Asn Pro Arg Ala Val Asp Pro Leu Val ctt ggc gtc cgg gta tgg cca caa gcc ata cca cag ttc ctc att ggc 768 Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Leu Ile Gly cat ctt gat cat ctt gag get gca aaa tct gcc ctg ggc aaa ggt ggg 816 His Leu Asp His Leu Glu Ala Ala Lys Ser Ala Leu Gly Lys Gly Gly tat gat gga ttg ttc ctc gga ggg aac tat gtt gca gga gtt gcc ctg 864 Tyr Asp Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu ggc cga tgc gtt gaa ggt gca tat gag agt gcc tca caa ata tct gac 912 Gly Arg Cps Val Glu Gly Ala Tyr Glu Ser Ala Ser Gln Ile Ser Asp tac ttg acc aag tac gcc tac aag tgatcaaagt tggcctgctc cttttggcac 966 Tyr L~eu Thr Lys Tyr Ala Tyr Lys atagatgtga ggcttctagc agcaaaaatt tcatgggcat ctttttatcc tgattctaat 1026 tagttagaat ttagaattgt agaggaatgt tccatttgca gttcataata gttgttcaga 1086 tttcagccat tcaatttgtg cagccattta ctatatgtag tatgatcttg taagtactac 1146 taagaacaaa tcaattatat tttcctgcaa gtgacatctt aatcgtcagc aaatccagtt 1206 actagtaaaa aaaaaaaa <210> 22 <211> 312 <212> PRT
<213> Oryza sativa <400> 22 Arg Ala Leu Lys Ala Ala Phe Gly Lys Val Trp Arg Leu Glu Asp Thr Gly Gly Ser Ile Ile Gly Gly Thr Ile Lys Thr Ile Gln Glu Arg Gly Lys Asn Pro Lys Pro Pro Arg Asp Pro Arg Leu Pro Thr Pro Lys Gly _72_ Gln Thr Val Ala Ser Phe Arg Lys Gly Leu Thr Met Leu Pro Asp Ala Ile Thr Ser Arg Leu Gly Ser Lys Val Lys Leu Ser Trp Lys Leu Thr Ser Ile Thr Lys Ser Asp Asn Lys Gly Tyr Ala Leu Val Tyr Glu Thr Pro Glu Gly Val Val Ser Val Gln Ala Lys Thr Val Val Met Thr Ile Pro Ser Tyr Val Ala Ser Asp Ile Leu Arg Pro Leu Ser Ser Asp Ala Ala Asp Ala Leu Ser Ile Phe Tyr Tyr Pro Pro Val Ala Ala Val Thr Val Ser Tyr Pro Lys Glu Ala Ile Arg Lys Glu Cars Leu Ile Asp Gly Glu Leu Gln Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Ala Gly Arg Val Leu Leu Leu Asn Tyr Ile Gly Gly Ser Thr Asn Thr Gly Ile Val Ser Lys Thr Glu Ser Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Asn Pro Arg Ala Val Asp Pro Leu Val Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Leu Ile Gly His Leu Asp His Leu Glu Ala Ala Lys Ser Ala Leu Gly Lys Gly Gly Tyr Asp Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cps Val Glu Gly Ala Tyr Glu Ser Ala Ser Gln Ile Ser Asp Tyr Leu Thr Lys Tyr Ala Tyr Lys <210> 23 <211> 1590 <212> I~
<213> Sorghum bicolor <220>
<221> CDS
<222> (1)..(1320) <223> sorghtmn protox-1 partial coding sequence <400> 23 tcc acc gtc gag cgc ccc gag gaa ggg tac ctc tgg gag gag'ggt ccc 48 Ser Thr Val Glu Arg Pro Glu Glu Gly err Leu Trp Glu Glu Gly Pro aac agc ttc cag cca tcc gac ccc gtt ctc tcc atg gcc gtg gac agc 96 Asn Ser Phe Gln Pro Ser Asp Pro Val Leu Ser Met Ala Val Asp Ser ggg ctg aag gat gac ctg gtt ttt ggg gac ccc aac gcg cca cgg ttc 144 Gly Leu Lys Asp Asp Leu Val Phe Gly Asp Pro Asn Ala Pro Arg Phe gtg ctg tgg gag ggg aag ctg agg ccc gtg cca tcc aag ccc gcc gac 192 Val Leu Tip Glu Gly Lys Leu Arg Pro Val Pro Ser Lys Pro Ala Asp ctc ccg ttc ttc gat ctc atg agc atc cct ggc aag ctc agg gcc ggt 240 Leu Pro Phe Phe Asp Leu Met Ser Ile Pro Gly Lys Leu Arg Ala Gly ctc ggc gcg ctt ggc atc cgc ccg cct get cca ggc cgc gag gag tca 288 Leu Gly Ala Leu Gly Ile Arg Pro Pro Ala Pro Gly Arg Glu Glu Ser gtg gag gag ttt gtg cgc cgc aac ctc ggt get gag gtc ttt gag cgc 336 Val Glu Glu Phe Val Arg Arg Asn Leu Gly Ala Glu Val Phe Glu Arg cta att gag cct ttc tgc tca ggt gtc tat get ggc gat cct tcc aag 384 Leu Ile Glu Pro Phe Cps Ser Gly Val Tyr Ala Gly Asp Pro Ser Lys ctc agt atg aag get gca ttt ggg aag gtg tgg cgg tta gaa gaa get 432 Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Arg Leu Glu Glu Ala gga ggt agt att att ggt gga acc atc aag acg att cag gag agg ggc 480 Gly Gly Ser Ile Ile Gly Gly Thr Ile Lys Thr Ile Gln Glu Arg Gly aag aat cca aaa cca ccg agg gat ccc cgc ctt ccg aag cca aaa ggg 528 Lys Asn Pro Lys Pro Pro Arg Asp Pro Arg Leu Pro Lys Pro Lys Gly cag aca gtt gca tct ttc agg aag ggt ctt gcc atg ctt cca aat gcc 576 Gln Thr Val Ala Ser Phe Arg Lys Gly Leu Ala Met Leu Pro Asn Ala atc aca tcc agc ttg ggt agt aaa gtc aaa cta tca tgg aaa ctc acg 624 Ile Thr Ser Ser Leu Gly Ser Lys Val Lys Leu Ser Trp Lys Leu Thr agc atg aca aaa tca gat ggc aag ggg tat gtt ttg gag tat gaa aca 672 Ser Met Thr Lys Ser Asp Gly Lys Gly Tyr Val Leu Glu Tyr Glu Thr cca gaa ggg gtt gtt ttg gtg cag get aaa agt gtt atc atg acc att 720 Pro Glu Gly Val Val Leu Val Gln Ala Lys Ser Val Ile Met Thr Ile cca tca tat gtt get agc gac att ttg cgt cca ctt tca ggt gat get 768 Pro Ser Tyr Val Ala Ser Asp Ile Leu Arg Pro Leu Ser Gly Asp Ala gca gat gtt cta tca aga ttc tat tat cca cca gtt get get gta acg 816 Ala Asp Val Leu Ser Arg Phe Tyr Tyr Pro Pro Val Ala Ala Val Thr gtt tcg tat cca aag gaa gca att aga aaa gaa tgc tta att gat ggg 864 Val Ser Tyr Pro Lys Glu Ala Ile Arg Lys Glu Cars Leu Ile Asp Gly gaa ctc cag ggt ttt ggc cag ttg cat cca cgt agt caa gga gtt gag 912 Glu Leu Gln Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Val Glu aca tta gga aca ata tac agc tca tca ctc ttt cca aat cgt get cct 960 Thr Leu Gly 'Ihr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro get ggt agg gtg tta ctt cta aac tac ata gga ggt get aca aac aca 1008 Ala Gly Arg Val Leu Leu Leu Asn ~r Ile Gly Gly Ala Thr Asn Thr gga att gtt tcc aag act gaa agt gag ctg gta gaa gca gtt gac cgt 1056 Gly Ile Val Ser Lys Thr Glu Ser Glu Leu Val Glu Ala Val Asp Arg gac ctc cga aaa atg ctt ata aat cct aca gca gtg gac cct tta gtc 1104 Asp Leu Arg Lys Met Leu Ile Asn Pro Thr Ala Val Asp Pro Leu Val ctt ggt gtc cga gtt tgg cca caa gcc ata cct cag ttc ctg gta gga 1152 Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Leu Val Gly cat ctt gat ctt ctg gag gcc gca aaa tct gcc ctg gac caa ggt ggc 1200 His Leu Asp Leu Leu Glu Ala Ala Lys Ser Ala Leu Asp Gln Gly Gly tat aat ggg ctg ttc cta gga ggg aac tat gtt gca gga gtt gcc ctg 1248 Tyr Asn Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu ggc aga tgc att gag ggc gca tat gag agt gcc gcg caa ata tat gac 1296 Gly Arg Cys Ile Glu Gly Ala Tyr Glu Ser Ala Ala Gln Ile Tyr Asp ttc ttg acc aag tac gcc tac aag tgatggaaga agtggagcgc tgcttgttaa 1350 Phe Leu Thr Lys Tyr Ala Tyr Lys ttgttatgtt gcatagatga ggtgagacca ggagtagtaa aaggcgtcac gagtattttt 1410 cattcttatt ttgtaaattg cacttctgtt tttttttcct gtcagtaatt agttagattt 1470 tagttatgta ggagattgtt gtgttcactg ccctacaaaa gaatttttat tttgcattcg 1530 tttatgagag ctgtgcagac ttatgtaacg ttttactgta agtatcaaca aaatcaaata 1590 _77_ <210> 24 <211> 440 <212> PRT
<213> Sorghimn bicolor <400> 24 Ser Thr Val Glu Arg Pro Glu Glu Gly Tyr Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Val Leu Ser Met Ala Val Asp Ser Gly Leu Lys Asp Asp Leu Val Phe Gly Asp Pro Asn Ala Pro Arg Phe Val Leu Trp Glu Gly Lys Leu Arg Pro Val Pro Ser Lys Pro Ala Asp Leu Pro Phe Phe Asp Leu Met Ser Ile Pro Gly Lys Leu Arg Ala Gly Leu Gly Ala Leu Gly Ile Arg Pro Pro Ala Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly Ala Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cars Ser Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Arg Leu Glu Glu Ala Gly Gly Ser Ile Ile Gly Gly Thr Ile Lys Thr Ile Gln Glu Arg Gly _78_ Lys Asn Pro Lys Pro Pro Arg Asp Pro Arg Leu Pro Lys Pro Lys Gly G1n ?'hr Val Ala Ser Phe Arg Lys Gly Leu Ala Met Leu Pro Asn Ala Ile Thr Ser Ser Leu Gly Ser Lys Val Lys Leu Ser Trp Lys Leu Thr Ser Met Thr Lys Ser Asp Gly Lys Gly Tyr Val Leu Glu Tyr Glu Thr Pro Glu Gly Val Val Leu Val Gln Ala Lys Ser Val Ile Met Thr Ile Pro Ser Tyr Val Ala Ser Asp Ile Leu Arg Pro Leu Ser Gly Asp Ala Ala Asp Val Leu Ser Arg Phe Tyr Tyr Pro Pro Val Ala Ala Val Thr Val Ser Tyr Pro Lys Glu Ala Ile Arg Lys Glu Cps Leu Ile Asp Gly Glu Leu Gln Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Ala Gly Arg Val Leu Leu Leu Asn Tyr Ile Gly Gly Ala Z'hr Asn Thr Gly Ile Val Ser Lys Thr Glu Ser Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Asn Pro Thr Ala Val Asp Pro Leu Val _79_ Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Leu Val Gly His Leu Asp Leu Leu Glu Ala Ala Lys Ser Ala Leu Asp Gln Gly Gly Tyr Asn Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cars Ile Glu Gly Ala Tyr Glu Ser Ala Ala Gln Ile Tyr Asp Phe Leu Thr Lys Tyr Ala Tyr Lys <210> 25 <211> 93 <212> I~1A
<213> Zea mays <220>
<221> misc feature <222> (1)..(93) <223> maize protox-1 intron sequence <400> 25 gtacgctcct cgctggcgcc gcagcgtctt cttctcagac tcatgcgcag ccatggaatt 60 gagatgctga atggatttta tacgcgcgcg cag 93 <210> 26 <211> 2606 <212> I~1A
<213> Beta vulgaris <220>
<221> misc feature <222> (2601)..(2606) <223> SalI site <220>
<221> misc feature <222> (1)..(538) <223> partial c-L~ of sugar beet protox-1 <220>
<221> misc feature <222> (539)..(2606) <223> sugar beet protox-1 prompter region (partial sequence of the ~3 kb PstI-SalI frac~nt sucloned from pV~DC-20) <400> 26 ctgcaggggg agggaaagag agaccgcgac ggtgagggag gggagaccgc gacggtgagg 60 gaggggagaa cgcgacggtg agggagggga gaacgcgatg gtgagggagg ggagaacgcg 120 acgcgcaggg gagggggata actcgacggt gcagggaggt gagggggacg acgtgacggc 180 gcaggggagg ggggaaccgt cgcgggaagg ggaagaccgg ggggccgaca aggtggtgtt 240 actggggtag ggagaggcgg cgtggagaat agtaacagag ggaggagtgg tggtgctagg 300 gtggaagaag ggtaagaaag aggaagaaag agaattaaca ttatcttaac caaacaccac 360 tctaaatcta agggttttct tttcctttcc tctcctctcc ctttcttgat tccattccct 420 ttaccccgtt gcaaccaaac gcccccttat tatggaccgg aggaagtatg tagagatggt 480 cacaaaacta cttaagctgg taacttataa atatactggg tattaaatga attaagtggc 540 cacaaaatga ctataaatta cttcgtaatc tttaggaact atgttggtca cgaaataaca 600 taaaactggt tatttaatgg ctttatgtag gtactgcatt cataaatata tttctaacat 660 aatcgtggta tgtaggtgtt ttataacaca aggattaggt ttacaccaat gtcattttca 720 ttagaatgta gttagaatca ctttggaact ttgaagagtg atgacacatt tttattatgc 780 ttttatgaaa tgtctttgtg gtttttatga tagtattgag tttaaggcaa gttggaagta 840 tatgatggag aagtacagta tataggtgac aattggtttg cttgtttcta tgagttgaaa 900 gataagtagt acacgacact gagcaatgac ctcttcttag ttgtaatttt gtcttctcga 960 cgtagtgaaa gtacaaacaa gattatggct ttcaagcttc caagataacg agattgtatg 1020 aattttgtgg tgtatttcac atcattgttt tacgttggag acaaactaaa accaatgatg 1080 agtttgtgga ttcgagattt gcccctaagt cttatttacc catggcaagc atgctgaaac 1140 atgttagtca aacttacaca gctacaatgt ttagggattt tgagcaaaaa atttgggtat 1200 tctttgggta ccattatgtg agttgttgac tatggattaa acaaaatcac tatataaagt 1260 ctggaatgag aagcatccgc aattgacaca ccatgttact ttgattgttt caacaagttt 1320 attagatgta tttgtaggaa ttttgaagag gcggagatgt tgtgttataa ttgctttggg 1380 ggtgcttcac atgcactctg ttagtgagac atcttcagct tatattttaa ggcggttagt 1440 gagtatgatt tttttttttc aaacttttcg atttccatgt aattaaaaaa ggtgtttgat 1500 aaatacatgt taagatagcc aagaaaaggc aactttcaaa caaataaaaa aaattaagtc 1560 gcttaatcat ttttccaagt actttttact tttaacacca cttattactg aatctatagc 1620 cgttaagaat gcattttcac gctcatacat gcaaatcaag aacctcctca ttgaaggaga 1680 taatttagtc ctcataaacc ccgttaaaga catttttagc atccagagaa atttcgattc 1740 agttaaaatt gcatatataa ccagagaaac aaattcagat gttagtcagt ccagctacat 1800 aggtcaatgc ctgagagttt aaaagaatcc gtatccttaa gcataagtag gtattgaggt 1860 gagttacaaa ggtaagttac cggttacgca ccacctccac caaacaagta tggttagaag 1920 atacatgtaa tcgtttattt agagtactat ttataaaaaa ctttttaact agaaacagtt 1980 gtttcatttt gatataaggt taattagaat tcccgagcaa gcaagaaggg gatatagagg 2040 ataaggaggg cgagagagcg agagagagat gaaatcaatg gcgttatcaa actgcattcc 2100 acagacacag tgcatgccat tgcacagcag cgggcattac aggggcaatt gtatcatgtt 2160 gtcaattcca tgtagtttaa ttggaagacg aggttattat tcacataaga agaggaggat 2220 gagcatgagt tgcagcacaa gctcaggctc aaagtcagcg gttaaagaag caggatcagg 2280 atcaggatca ggagcaggag gattgctaga ctgcgtaatc gttggaggtg gaattagcgg 2340 gctttgcatc gcgcaggctc tttgtacaaa acagtcctct ttatccccaa attttatagt 2400 gacagaggcc aaagacagag ttggcggcaa catcgtcact gtggaggccg atggctatat 2460 ctgggaggag ggacccaata gcttccagcc ttccgacgcg gtgctcacca tggcggtaat 2520 tctgtctctt cattattcat aatcataatt caattcaatt caattcctaa cgtggaatgt 2580 ggaatgtggc atgtgcgtag gtcgac 2606 <210> 27 <211> 31 <212> T~TA
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <220>
<221> misc feature <222> (4)..(9) <223> EcoRI restriction site <400> 27 gcggaattca tacttattta tcattagaaa g 31 <210> 28 <211> 32 <212> I~
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <220>
<221> misc feature <222> (4)..(9) <223> XbaI restriction site <400> 28 gcgtctagaa agaactaaat actatatttc ac 32 <210> 29 <211> 30 <212> L~
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <220>
<221> misc feature <222> (4)..(9) <223> NcoI restriction site <400> 29 gcgccatggt aaatgaaaga aagaactaaa 30 <210> 30 <211> 30 <212> I~1A
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <220>
<221> misc_feature <222> (4)..(9) <223> XbaI restriction site <400> 30 gcgtctagat caaccgaaat tcaattaagg 30 <210> 31 <211> 27 <212> L'~, <213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <220>
<221> misc feature <222> (4) .. (9) <223> HindIII restriction site <400> 31 cgcaagcttc aatggaagca atgataa 27 <210> 32 <211> 36 <212> I~
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <400> 32 gggagtccct gatgattaaa taaaccaaga ttttac 36 <210> 33 <211> 40 <212> I7~TA
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <400> 33 catggtaaaa tcttggttta tttaatcatc agggactccc 40 <210> 34 <211> 32 <212> I~IA
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <220>
<221> misc feature <222> (5)..(10) <223> NcoI restriction site/ ATG start colon <400> 34 gggaccatgg attgtgtgat tgtcggcgga gg 32 <210> 35 <211> 24 <212> I7NA
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <400> 35 ctccgctctc cagcttagtg atac 24 <210> 36 <211> 633 <212> L~
_87_ <213> sugar cane <220>
<221> CDS
<222> (3).:(305) <223> sugar cane protox-1 partial coding sequence <400> 36 tt tcc aag act gaa agt gag ctg gta gaa gca gtt gac cgt gac ctc 47 Ser Lys Thr Glu Ser Glu Leu Val Glu A3a Val Asp Arg Asp Leu cgg aaa atg ctt ata aat cct aca gca gtg gac cct tta gtc ctt ggt 95 Arg Lys Met Leu Ile Asn Pro Thr Ala Val Asp Pro Leu Val Leu Gly gtc cga gtt tgg cca caa gcc ata cct cag ttc ctg gta gga cat ctt 143 Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Leu Val Gly His Leu gat ctt ctg gag gcc gca aaa tct gcc ctg gac cga ggt ggc tac gat 191 Asp Leu Leu Glu Ala Ala Lys Ser Ala Leu Asp Arg Gly Gly err Asp ggg ctg ttc cta gga ggg aac tat gtt gca gga gtt gcc cta ggc aga 239 Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg tgc gtt gag ggc gcg tat gag agt gcc tcg caa ata tat gac ttc ttg 287 Cys Val Glu Gly Ala Tyr Glu Ser Ala Ser Gln Ile Tyr Asp Phe Leu acc aag tat gcc tac aag tgatgaaaga agtggagtgc tgcttgttaa 335 Thr Lys Tyr Ala Tyr Lys ttgttatgtt gcatagatga ggtgagacca ggagtagtaa aagcgttacg agtatttttc 395 _88_ attcttattt tgtaaattgc acttctggtt ttttcctgtc agtaattagt tagattttag 455 ttctgtagga gattgttctg ttcactgccc tacaaaagaa tttttatttt gcattcgttt 515 atgagagctg tgcagactta tgtagcgttt ttctgtaagt accaacaaaa tcaaatacta 575 ttctgtaaga gctaacagaa tgtgcaactg agattgcctt ggatgaaaaa aaaaaaaa 633 <210>37 <211>101 <212>PRT
<213>sugar cane <400> 37 Ser Lys Thr Glu Ser Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Asn Pro Thr Ala Val Asp Pro Leu Val Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro G1n Phe Leu Val Gly His Leu Asp Leu Leu Glu Ala Ala Lys Ser Ala Leu Asp Arg Gly Gly Tyr Asp Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cys Val Glu Gly Ala Tyr Glu Ser Ala Ser Gln Ile Tyr Asp Phe Leu Thr Lys Tyr Ala Tyr Lys _89_ <210> 38 <211> 4 <212> PRT
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence: sub-sequence 1 <220>
<221> misc feature <222> (3) <223> Xaa = amino acid other than Arg <400> 38 Ala Pro Xaa Phe <210> 39 <211> 5 <212> PRT
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence: sub-sequence 8 <220>
<221> misc feature <222> (5) <223> Xaa = amino acid other than Ala or Ser <400> 39 Tyr Ile Gly Gly Xaa <210> 40 <211> 4 <212> PRT
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence: sub-sequence <220>
<221> misc feature <222> (4) <223> Xaa = amino acid other than Thr <400> 40 Ile Gly Gly Xaa <210> 41 <211> 5 <212> PRT
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence: sub-sequence <220>
<221> misc_feature <222> (3 ) <223> Xaa = any amino acid <220>
<221> misc_feature <222> (5) <223> Xaa = amino acid other than Ser or Thr <400> 41 Ser Trp Xaa Leu Xaa <210> 42 <211> 5 <212> PRT
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence: sub-sequence <220>
<221> misc feature <222> (2) <223> Xaa = amino acid other than Tyr, His, Phe or Val <220>
<221> misc feature <222> (3) <223> Xaa = any amino acid <400> 42 Gly Xaa Xaa Gly Leu <210> 43 <211> 4 <212> PRT
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence: sub-sequence <220>
<221> misc feature <222> (3) <223> Xaa = amino acid other than Ala or Ser <400> 43 Tyr Val Xaa Gly <210> 44 <211> 4 <212> PRT
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence: sub-sequence <220>
<221> misc feature <222> (3 ) <223> Xaa = amino acid other than Ala <400> 44 Lys Ala Xaa Phe
circular array on T agar medium and bombarded 12-14 days after sowing with 1 L~m tungsten particles (M10, Biorad, Hercules, CA) coated with DNA from plasmids pPH143 and pPH145 essentially as described in Svab, Z. and Maliga, P. (1993) PNAS 90, 913-917.
Bombarded seedlings were incubated on T medium for two days after which leaves were excised and placed abaxial side up in bright light (350-500 Nmol photons/m2/s) on plates of RMOP medium (Svab, Z., Hajdukiewicz, P. and Maliga, P. (1990) PNAS 87, 8526-8530) containing 500 Ng/ml spectinomycin dihydrochloride (Sigma, St. Louis, MO).
Resistant shoots appearing underneath the bleached leaves three to eight weeks after bombardment were subcloned onto the same selective medium, allowed to form callus, and secondary shoots isolated and subcloned. Complete segregation of transformed plastid genome copies (homoplasmicity) in independent subclones was assessed by standard techniques of Southern blotting (Sambrook et al., (1989) Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor). BamHllEcoRl digested total cellular DNA
(Mettler, I. J. (1987) Plant Mol Biol Reporter5, 346-349) was separated on 1%
Tris-borate (TBE) agarose gels, transferred to nylon membranes (Amersham) and probed with labeled random primed DNA sequences corresponding to a 0.7 kb BamHllHindlll DNA
fragment from pC8 containing a portion of the rps7/12 plastid targeting sequence.
Homoplasmic shoots are rooted aseptically on spectinomycin-containing MS/IBA
medium (McBride, K. E. et al. (1994) PNAS 91, 7301-7305) and transferred to the greenhouse.
Example 44: Assessment of Herbicide Tolerance in Nt-pPH143 and Nt-pPH145 Plastid Transformant Lines Primary homoplasmic transformant lines transformed with pPH143 (line Nt-pPH143) or with pPH145 (line Nt-pPH145), which were obtained as described in Example 43, were grown to maturity in the greenhouse. Flowers were either: (a) self-pollinated, (b) pollinated with wildtype tobacco (c.v. Xanthi nc), or (c) used as pollen donors to fertilize emasculated flowers of wildtype Xanthi plants. Plastid segregation of the linked spectinomycin resistance marker was verified by uniparental female inheritance of the spectinomycin-resistance phenotype in each transformant line using a minimum of 50 seeds per selection pool derived from either selfed or backcross capsules. Additional self or wildtype backcross (Xanthi pollen parent) seeds were germinated in soil. 36 plants of each line (143 1 B-1, 143 1 B-4, 143 4A-2, 143 4A-5, 145 7A-5, 145 7A-6, 145 8A-3) plus 36 wildtype Xanthi plants as isogenic controls were grown in separate 6" clay pots in a controlled environment cubicle.
In order to assess tolerance to the protox inhibitor Formula XVII, plants of Xanthi and the seven transformant lines were distributed into eight identical 16-pot flats (2 plants of each type per flat). The flats were sprayed with Formula XVII until runoff at concentrations of either 0, 0.5, 2.5, 5, 10, 25, 50, or 100 mg Formula XVII per liter. Solutions were made up in water using 4 g/liter or 40 g/liter stock solutions of Formula XVII
dissolved in dimethylsulfoxide (DMSO) and used immediately after preparation. Twenty microliters of the wetting agent Silwett was added to each 200 ml volume of herbicide solution for a final concentration of 0.01 %. Flats were sprayed in the late afternoon and allowed to dry overnight before transfer to the growth cubicle. Tolerance was assesed by comparing leaf damage and wilting to the untransformed Xanthi controls at 0, 18 hrs, 48 hrs, and 6 days post-application. Severe damage was apparent on the Xanthi plants at all concentrations above 0.5 mg/I, and complete wilting/burn down occurred above 2.5 mg/I. Only slight damage occurred on the Nt_pPH143 plants even at the highest concentration (100 mg/liter), and the plants soon outgrew the bleached spots (the appearance of Xanthi at 0.5 mg/liter was approximately equivalent to Nt_pPH143 1 B-1 at 100 mg/liter, giving a tolerance of ca. 200-fold).
Example 45: Plastid Transformation of Maize Type I embryogenic callus cultures (Green et al. (1983) in A. Fazelahmad, K.
Downey, J. Schultz, R.W. Voellmy, eds. Advances in Gene Technology: Molecular Genetics of Plants and Animals. Miami Winter Symposium Series, Vol. 20.
Academic Press, N.Y.) of the proprietary genotypes CG00526 and CG00714 are initiated from immature embryos, 1.5 - 2.5 mm in length, from greenhouse grown material. Embryos are aseptically excised from surface-sterilized ears approximately 14 days after pollination.
Embryos of CG00526 are placed on D callus initiation media with 2% sucrose and 5mg/L
chloramben (Duncan et al. (1985) Planta 165: 322-332) while those of CG00714 are placed onto KM
callus initiation media with 3% sucrose and 0.75mg/L 2,4-d (Kao and Michayluk (1975) Planta 126, 105-110). Embryos and embryogenic cultures are subsequently cultured in the dark. Embryogenic responses are removed from the explants after --14 days.
responses are placed onto D callus maintenance media with 2% sucrose and 0.5mg/L 2,4-d while those of CG00714 are placed onto KM callus maintenance media with 2%
sucrose and 5mg/L Dicamba. After 3 to 8 weeks of weekly selective subculture to fresh maintenance media, high quality compact embryogenic cultures are established.
Actively growing embryogenic callus pieces are selected as target tissue for gene delivery. The callus pieces are plated onto target plates containing maintenance medium with 12%
sucrose approximately 4 hours prior to gene delivery. The callus pieces are arranged in circles, with radii of 8 and 1 Omm from the center of the target plate.
Plasmid DNA is precipitated onto gold microcarriers as described in the DuPont Biolistics manual. Two to three ~g of each plasmid is used in each 6 shot microcarrier preparation.
Genes are delivered to the target tissue cells using the PDS-1000He Biolistics device.
The settings on the Biolistics device are as follows: 8 mm between the rupture disc and the macrocarrier, mm between the macrocarrier and the stopping screen and 7 cm between the stopping screen and the target. Each target plate is shot twice using 650psi rupture discs. A 200 X
200 stainless steel mesh (McMaster-Carr, New Brunswick, NJ) is placed between the stopping screen and the target tissue.
Five days later, the bombed callus pieces are transferred to maintenance medium with 2% sucrose and 0.5mg/L 2,4-d, but without amino acids, and containing 750 or 1000 nM Formula XVII. The callus pieces are placed for 1 hour on the light shelf 4-5 hours after transfer or on the next day, and stored in the dark at 27°C for 5-6 weeks. Following the 5-6 week primary selection stage, yellow to white tissue is transferred to fresh plates containing the same medium supplemented with 500 or 750 nM Formula XVII. 4-5 hours after transfer or on the next day, the tissues are placed for 1 hour on the light shelf and stored in the dark at 27°C for 3-4 weeks. Following the 3-4 week secondary selection stage, the tissues are transferred to plates containing the same medium supplemented with 500 nM
Formula XVII.
Healthy growing tissue is placed for 1 hour on the light shelf and stored in the dark at 27°C.
It is subcultured every two weeks until the colonies are large enough for regeneration.
At that point, colonies are transferred to a modified MS medium (Murashige and Skoog (1962) Physiol. Plant 15: 473-497) containing 3% sucrose (MS3S) with no selection agent and placed in the light. For CG00526, 0.25mg/L ancymidol and 0.5mg/L kinetin are added to this medium to induce embryo germination, while for CG00714, 2mg/L benzyl adenine is added. Regenerating colonies are transferred to MS3S media without ancymidol and kinetin, or benzyl adenine, for CG00526 or CG00714, respectively, after 2 weeks.
Regenerating shoots with or without roots are transferred to boxes containing medium and small plants with roots are eventually recovered and transferred to soil in the greenhouse.
Table 1 A
Alignment of the full-length and partial protox-1 amino acid sequences from Arabidopsis ("Arabpt-1 "; SEQ ID N0:2), maize ("Mzpt-1 "; SEQ ID N0:6), wheat ("Wtpt-1 ";
SEQ ID
N0:10), soybean ("Soybeanpt-1"; SEQ ID N0:12), cotton ("Cottonpt-1"; SEQ ID
N0:16), sugar beet ("Sugpt-1"; SEQ ID N0:18), oilseed rape ("Rapept-1"; SEQ ID N0:20), rice ("Ricept-1"; SEQ ID N0:22), sorghum ("Sorghumpt-1"; SEQ ID N0:24), and sugar cane ("Scpt-1 "; SEQ ID N0:37). Alignment was performed using the Pileup program (GCG
package, University of Wisconsin, Madison, WI). Positions that may be modified according to the teachings herein to confer or enhance inhibitor resistance are shown in bold type.
Rapept-1 .......... ........., MDLSLLRP.. QPFLSPFSNP FPRSRPYKPL
Arabpt-1 .......... .....,..,. MELSLLRPTT QSLLPSFSKP NLRLNVYKPL
Sorghumpt-1 .......... .......... .......... .......... ..........
Mzpt-1 .......... .......... .......... .......... ..........
Wtpt-1 .......... .......... .........M ATATVAAASP LRGRVTGRPH
Ricept-1 .......... .......... .......... .......... ..........
Cottonpt-1 .......... ......MTAL IDLSLLRSSP SVSPFSIPHH QHPPRFRKPF
Soybeanptl ........MV SVFNEILFPP NQTLLRPSLH SPTSFFTSPT RKFPRSRPNP
Sugpt-1 MKSMALSNCI PQTQCMPLRS SGHYRGNCIM LSIPCSLIGR RGYYSHKKRR
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 NLRCSVSGGS WGSSTIEGG GGGKTVTADC VIVGGGISGL CIAQALVTKH
Arabpt-1 RLRCSVAGGP TVGSSKIEGG GGT.TITTDC VIVGGGISGL CIAQALATKH
Sorghumpt-1 .......... :......... .......... .......... ..........
_98_ Mzpt-1 .......... ... ...... .......ADC VWGGGISGL CTAQALATRH
Wtpt-1 RVRPRCATAS SATETPAAPG VRL...SAEC VIVGAGISGL CTAQALATRY
Ricept-1 .......... .......... .......... .......... ..........
Cottonpt-1 KLRCSLAEGP TISSSKIDGG ESS...IADC VIVGGGISGL CIAQALATKH
Soybeanptl ILRCSIAEES TASPPKTR.. DSA...PVDC VWGGGVSGL CIAQALATKH
Sugpt-1 MSMSCSTSSG SKSAVKEAGS GSGAGGLLDC VIVGGGISGL CIAQALCTKH
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 PDA..AKNVM VTEAKDRVGG NIIT..REEQ GFLWEEGPNS FQPSDPMLTM
Arabpt-1 PDA..APNLI VTEAKDRVGG NIIT..REEN GFLWEEGPNS FQPSDPMLTM
Sorghumpt-1 .......... .......... ..STVERPEE GYLWEEGPNS FQPSDPVLSM
Mzpt-1 ..G..VGDVL VTEARARPGG NITTVERPEE GYLWEEGPNS FQPSDPVLTM
Wtpt-1 ..G..VSDLL VTEARDRPGG NITTVERPDE GYLWEEGPNS FQPSDPVLTM
Ricept-1 .......... .......... .......... .......... ..........
Cottonpt-1 RDV..ASNVI VTEARDRVGG NITTVER..D GYLWEEGPNS FQPSDPILTM
Soybeanptl ..A..NANW VTEARDRVGG NITTMER..D GYLWEEGPNS FQPSDPMLTM
Sugpt-1 SSSSLSPNFI VTEAKDRVGG NIVTVE..AD GYIWEEGPNS FQPSDAVLTM
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 VVDSGLKDDL VLGDPTAPRF VLWNGKLRPV PSKLTDLPFF DLMSIGGKIR
Arabpt-1 VVDSGLKDDL VLGDPTAPRF VLWNGKLRPV PSKLTDLPFF DLMSIGGKIR
Sorghumpt-1 AVDSGLKDDL VFGDPNAPRF VLWEGKLRPV PSKPADLPFF DLMSIPGKLR
Mzpt-1 AVDSGLKDDL VFGDPNAPRF VLWEGKLRPV PSKPADLPFF DLMSIPGKLR
Wtpt-1 AVDSGLKDDL VFGDPNAPRF VLWEGKLRPV PSKPGDLPFF SLMSIPGKLR
Ricept-1 .......... .......... ... ...... .......... ..........
Cottonpt-1 AVDSGLKDDL VLGDPNAPRF VLWEGKLRPV PSKPTDLPFF DLMSIAGKLR
Soybeanptl VVDSGLKDEL VLGDPDAPRF VLWNRKLRPV PGKLTDLPFF DLMSIGGKIR
Sugpt-1 AVDSGLKDEL VLGDPNAPRF VLWNDKLRPV PSSLTDLPFF DLMTIPGKIR
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 AGFGAIGIRP SPPGREESVE EFVRRNLGDE VFERLIEPFC SGVYAGDPAK
Arabpt-1 AGFGALGIRP SPPGREESVE EFVRRNLGDE VFERLIEPFC SGVYAGDPSK
Sorghumpt-1 AGLGALGIRP PAPGREESVE EFVRRNLGAE VFERLIEPFC SGVYAGDPSK
Mzpt-1 AGLGALGIRP PPPGREESVE EFVRRNLGAE VFERLIEPFC SGVYAGDPSK
Wtpt-1 AGLGALGIRP PPPGREESVE EFVRRNLGAE VFERLIEPFC SGVYAGDPSK
Ricept-1 .......... .......... .......... .......... ..........
Cottonpt-1 AGFGAIGIRP PPPGYEESVE EFVRRNLGAE VFERFIEPFC SGVYAGDPSK
Soybeanptl AGFGALGIRP PPPGHEESVE EFVRRNLGDE VFERLIEPFC SGVYAGDPSK
Sugpt-1 AALGALGFRP SPPPHEESVE HFVRRNLGDE VFERLIEPFC SGVYAGDPAK
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 LSMKAAFGKV WKLEENGGSI IGGAFKAIQA KNKAPKTTRD PRLPKPKGQT
Arabpt-1 LSMKAAFGKV WKLEQNGGSI IGGTFKAIQE RKNAPKAERD PRLPKPQGQT
Sorghumpt-1 LSMKAAFGKV WRLEEAGGSI IGGTIKTIQE RGKNPKPPRD PRLPKPKGQT
Mzpt-1 LSMKAAFGKV WRLEETGGSI IGGTIKTIQE RSKNPKPPRD ARLPKPKGQT
Wtpt-1 LSMKAAFGKV WRLEEIGGSI IGGTIKAIQD KGKNPKPPRD PRLPAPKGQT
Ricept-1 RALKAAFGKV WRLEDTGGSI IGGTIKTIQE RGKNPKPPRD PRLPTPKGQT
Cottonpt-1 LSMKAAFGRV WKLEEIGGSI IGGTFKTIQE RNKTPKPPRD PRLPKPKGQT
Soybeanptl LSMKAAFGKV WKLEKNGGSI IGGTFKAIQE RNGASKPPRD PRLPKPKGQT
Sugpt-1 LSMKAAFGKV WKLEQKGGSI IGGTLKAIQE RGSNPKPPRD QRLPKPKGQT
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 VGSFRKGLTM LPEAISARLG DKVKVSWKLS SITKLASGEY SLTYETPEGI
Arabpt-1 VGSFRKGLRM LPEAISARLG SKVKLSWKLS GITKLESGGY NLTYETPDGL
Sorghumpt-1 VASFRKGLAM LPNAITSSLG SKVKLSWKLT SMTKSDGKGY VLEYETPEGV
Mzpt-1 VASFRKGLAM LPNAITSSLG SKVKLSWKLT SITKSDDKGY VLEYETPEGV
Wtpt-1 VASFRKGLAM LPNAIASRLG SKVKLSWKLT SITKADNQGY VLGYETPEGL
Ricept-1 VASFRKGLTM LPDAITSRLG SKVKLSWKLT SITKSDNKGY ALVYETPEGV
Cottonpt-1 VGSFRKGLTM LPEAIANSLG SNVKLSWKLS SITKLGNGGY NLTFETPEGM
Soybeanptl VGSFRKGLTM LPDAISARLG NKVKLSWKLS SISKLDSGEY SLTYETPEGV
Sugpt-1 VGSFRKGLVM LPTAISARLG SRVKLSWTLS SIVKSLNGEY SLTYDTPDGL
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 VTVQSKSVVM TVPSHVASSL LRPLSDSAAE ALSKLYYPPV AAVSISYAKE
Arabpt-1 VSVQSKSVVM TVPSHVASGL LRPLSESAAN ALSKLYYPPY AAVSISYPKE
Sorghumpt-1 VLVQAKSVIM TIPSYVASDI LRPLSGDAAD VLSRFYYPPV AAVTVSYPKE
Mzpt-1 VSVQAKSVIM TIPSYVASNI LRPLSSDAAD ALSRFYYPPV AAVTVSYPKE
Wtpt-1 VSVQAKSVIM TIPSYVASDI LRPLSIDAAD ALSKFYYPPV AAVTVSYPKE
Ricept-1 VSVQAKTVVM TIPSYVASDI LRPLSSDAAD ALSIFYYPPV AAVTVSYPKE
Cottonpt-1 VSLQSRSVVM TIPSHVASNL LHPLSAAAAD ALSQFYYPPV ASVTVSYPKE
Soybeanptl VSLQCKTVVL TIPSYVASTL LRPLSAAAAD ALSKFYYPPV AAVSISYPKE
Sugpt-1 VSVRTKSVVM TVPSYVASRL LRPLSDSAAD SLSKFYYPPV AAVSLSYPKE
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 AIRSECLIDG ELKGFGQLHP RTQKVETLGT IYSSSLFPNR APPGRVLLLN
Arabpt-1 AIRTECLIDG ELKGFGQLHP RTQGVETLGT IYSSSLFPNR APPGRILLLN
Sorghumpt-1 AIRKECLIDG ELQGFGQLHP RSQGVETLGT IYSSSLFPNR APAGRVLLLN
Mzpt-1 AIRKECLIDG ELQGFGQLHP RSQGVETLGT IYSSSLFPNR APDGRVLLLN
Wtpt-1 AIRKECLIDG ELQGFGQLHP RSQGVETLGT IYSSSLFPNR APAGRVLLLN
Ricept-1 AIRKECLIDG ELQGFGQLHP RSQGVETLGT IYSSSLFPNR APAGRVLLLN
Cottonpt-1 AIRKECLIDG ELKGFGQLHP RSQGIETLGT IYSSSLFPNR APSGRVLLLN
Soybeanptl AIRSECLIDG ELKGFGQLHP RSQGVETLGT IYSSSLFPNR APPGRVLLLN
Sugpt-1 AIRSECLING ELQGFGQLHP RSQGVETLGT IYSSSLFPGR APPGRILILS
Scpt-1 .......... .......... .......... .......... ..........
Rapept-1 YIGGATNTGI LSKSEGELVE AVDRDLRKML IKPSSTDPLV LGVKLWPQAI
Arabpt-1 YIGGSTNTGI LSKSEGELVE AVDRDLRKML IKPNSTDPLK LGVRVWPQAI
Sorghumpt-1 YIGGATNTGI VSKTESELVE AVDRDLRKML INPTAVDPLV LGVRVWPQAI
Mzpt-1 YIGGATNTGI VSKTESELVE AVDRDLRKML INSTAVDPLV LGVRVWPQAI
Wtpt-1 YIGGSTNTGI VSKTESDLVG AVDRDLRKML INPRAADPLA LGVRVWPQAI
Ricept-1 YIGGSTNTGI VSKTESELVE AVDRDLRKML INPRAVDPLV LGVRVWPQAI
Cottonpt-1 YIGGATNTGI LSKTEGELVE AVDRDLRKML INPNAKDPLV LGVRVWPKAI
Soybeanptl YIGGATNTGI LSKTDSELVE TVDRDLRKIL INPNAQDPFV VGVRLWPQAI
Sugpt-1 YIGGAKNPGI LNKSKDELAK TVDKDLRRML INPDAKLPRV LGVRVWPQAI
Scpt-1 .......... .SKTESELVE AVDRDLRKML INPTAVDPLV LGVRVWPQAI
Rapept-1 PQFLIGHIDL VDAAKASLSS SGHEGLFLGG NYVAGVALGR CVEGAYETAT
Arabpt-1 PQFLVGHFDI LDTAKSSLTS SGYEGLFLGG NYVAGVALGR CVEGAYETAI
Sorghumpt-1 PQFLVGHLDL LEAAKSALDQ GGYNGLFLGG NYVAGVALGR CIEGAYESAA
Mzpt-1 PQFLVGHLDL LEAAKAALDR GGYDGLFLGG NYVAGVALGR CVEGAYESAS
Wtpt-1 PQFLIGHLDR LAAAKSALGQ GGYDGLFLGG KYVAGVALGR CIEGAYESAS
Ricept-1 PQFLIGHLDH LEAAKSALGK GGYDGLFLGG NYVAGVALGR CVEGAYESAS
Cottonpt-1 PQFLVGHLDL LDSAKMALRD SGFHGLFLGG NYVSGVALGR CVEGAYEVAA
Soybeanptl PQFLVGHLDL LDVAKASIRN TGFEGLFLGG NYVSGVALGR CVEGAYEVAA
Sugpt-1 PQFSIGHFDL LDAAKAALTD TGVKGLFLGG NYVSGVALGR CIEGAYESAA
Scpt-1 PQFLVGHLDL LEAAKSALDR GGYDGLFLGG NYVAGVALGR CVEGAYESAS
Rapept-1 QVNDFMSRYA YK*
Arabpt-1 EVNNFMSRYA YK*
Sorghumpt-1 QIYDFLTKYA YK*
Mzpt-1 QISDFLTKYA YK*
Wtpt-1 QVSDFLTKYA YK*
Ricept-1 QISDYLTKYA YK*
Cottonpt-1 EVKEFLSQYA YK*
Soybeanptl EVNDFLTNRV YK*
Sugpt-1 EVVDFLSQYS DK*
Scpt-1 QIYDFLTKYA YK*
Correspon Sub- Sub-sequence4, AA ~" AA ding Exemplary mutants AA
sequence AA sequence wild-typesubstitutiposition of ons ~" in Table 1 AP~~ F R C, L 169 Mz88Cys Mz88Leu 2 FMS C F, L, 240 Mz159Phe K
Mz159Leu Mz159Lys 3 Y~G A V, T, 245 pAraC-l Val L, C, I pAraC-lThr pAraC-1 Leu pAraC-1 Cys pAraC-1 Ile pMzC-1 Val pMzC-1 Thr pMzC-1 Leu pW htC-1 Val pW htC-1 Thr pSoyC-1 Thr pSoyC-lLeu 4 AtI~D G S, L 246 pAraC-3Ser pMzC-3Ser pMzC-3Leu pW htC-3Ser Y05P P S, H 388 Soy369Ser Soy369His Cot365Ser 6 PEA V L 390 Wht356Leu D,IG Y C, I, 451 pAraC-2Cys L, T, M, V, pAraC-211e A, H, R pAraC-2Leu pAraC-2Thr pAraC-2Met pAraC-2Val pAraC-2Ala pMzC-211e pMzC-2Met pSoyC-2Leu pSoyC-211e pSugC-2Cys pSugC-2Leu pSugC-211e pSugC-2Val pSugC-2Met pCotC-2Cys pCotC-2His pCotC-2Arg 8 YIGG~ A, P 455 Wht421 S Pro 9 AO9P I T, 500 Mz419Thr H, G, N Mz419His Mz419Gly Mz419Asn W ht466Thr GO~oA V A 536 Wht502A1a Soy517Ala 18 KA~,BF A T,V 256 Mz175Thr Mz175Va1 19 QO~9H S 418 Mz337Ser L
Second-site mutations 11 QD"S P L 143 AraC1 l8Leu 12 IGG0,2 T I, 274 AraC2 A
4911e AraC2 49A1a 13 SWXLA~3 S, T L 330 AraC3 05Leu 14 L014Y N S 450 AraC4 25Ser G~,5XGL Y, H, C 523 AraC4 F, V
98Cys Double mutation 16 T0, 6G L S 428 Mz34 17 YVO"G A, (S) T 534 7Ser-453Th r Table 2 Comparison of the Arabidopsis (SEQ ID N0:4) and maize (SEQ ID N0:8) protox-2 amino acid sequences. Identical residues are denoted by the vertical bars between the two sequences. Alignment was performed using the GAP program described in Deveraux et al., Nucleic Acids Res~ 12.387-395 (1984). Percent similarity: 75.889 / percent identity: 57.905.
1 .....~~.....-...............MASGAVAD.HQIEAVSGKRVAV 21 ~~
122 SSVLSTQSKFQILLEPFLWKK....KSSKVSDASAEESVSEFFQRHFGQE 167 268 VLSLS..YNSGSRQENWSLSCVSHNETQRQ...NPHYDAVIMTAPLCNVK 312 ~~~~~ ~~~I~~~ ~~..~~~
363 E.QKHGFKTLGTLFSSMMFPDRSPSDVHLYTTFIGGSRNQELAKASTDEL 411 ~~
462 LPGFFYAGNHRGGLSVGKSIASGCKAADLVISYLESCSNDKKPNDSL* 509 ~~~~~
501 LPGFFYAGNSKDGLAVGSVIASGSKAADLAISYLESHTKHNNSH*... 545 Table 3A
Cross tolerance of plant protox mutants to various protox inhibitors.
Formula AraC-1 AraC-2Cys AraC-1 AraC-3Thr MzC-1 Val Val Thr XVII + + + + +
Vlla + + + - +
IV ++ - ++ ++ -XV + + + + +
XI - + + ++ +
XVI - - - - +
XI I + - ++ ++ ++
XIV + - + + +
*X
+ =1 OX or more tolerant than WT
++ = 100X or more tolerant than WT
= no cross tolerance * = this compound was tested but provided no information Table 3B
Cross tolerance of plant protox mutants to various protox inhibitors.
AraC- AraC- AraC- AraC- AraC- AraC- AraC- AraC-1 Leu 211e 1 Leu 1 Leu 211e 2Leu 2Met + + + + + +
AraC- AraC- AraC AraC AraC AraC
rmula 2Met 2Leu 305Leu 425Se 425Se 425Se r r r XVII + + + + + + + +
Vlla ++ ++ ++ ++ ++ ++ ++ ++
IV ++ - + ++ + - + +
XV ++ +++ +++ +++ +++ ++ +++ ++
XI ++ ++ ++ ++ ++ ++ ++ ++
XVI +++ +++ +++ +++ +++ + ++ ++
XII
XIV ++~+~ ++ I ++ ++ - ++ ++
Table 4 Cross tolerance to various protox inhibitors in a seed germination assay.
Formula Common name Tolerance II acifluorofen III omasafen IV luoroglycofen IVb bifenox IVc oxyfluorofen IVd lactofen Ila luthiacet-methyl +
sulfentrazone XI lupropazil +
IV lumiclorac XVI lumioxazin +++
XVII +
XXIa BAY 11340 XXI I +
~ < 1 OX more tolerant than wt + >_ 10X more tolerant than wt ++ > 100X more tolerant than wt +++ >_ 1000X more tolerant than wt Various modifications of the invention described herein will become apparent to those skilled in the art. Such modifications are intended to fall within the scope of the appended claims.
SEQUF~TCE LISTING
<110> Novartis <120> Herbicide-Tolerant Protopozphyrinogen Oxidase <130> PB/5-30911A
<140>
<141>
<150> US 09/373691 <151> 1999-08-13 <160> 44 <170> Patentln Ver. 2.2 <210> 1 <211> 1719 <212> L~lPr <213> Arabidopsis thaliana <220>
<221> CDS
<222> (31)..(1644) <223> Arabidopsis protox-1 <400> 1 tgacaaaatt ccgaattctc tgcgatttcc atg gag tta tct ctt ctc cgt ccg 54 Met Glu Leu Ser Leu Leu Arg Pro acg act caa tcg ctt ctt ccg tcg ttt tcg aag ccc aat ctc cga tta 102 Thr Thr Gln Ser Leu Leu Pro Ser Phe Ser Lys Pro Asn Leu Arg Lieu aat gtt tat aag cct ctt aga ctc cgt tgt tca gtg gcc ggt gga cca 150 Asn Val Tyr Lys Pro Leu Arg Leu Arg Cars Ser Val Ala Gly Gly Pro ~cc ~tc gga tct tca aaa atc gaa ggc gga gga ggc acc acc atc acg 198 'rhr Val Gly Ser Ser Lys Ile Glu Gly Gly Gly Gly Thr Thr Ile Thr acg gat tgt gtg att gtc ggc gga ggt att agt ggt ctt tgc atc get 246 Thr Asp Cps Val Ile Val Gly Gly Gly Ile Ser Gly Leu.C~rs Ile Ala cag gcg ctt get act aag cat cct gat get get ccg aat tta att gtg 294 Gln Ala Leu Ala Thr Lys His Pro Asp Ala Ala Pro Asn Leu Ile Val acc gag get aag gat cgt gtt gga ggc aac att atc act cgt gaa gag 342 Thr Glu Ala Lys Asp Arg Val Gly Gly Asn Ile Ile Thr Arg Glu Glu aat ggt ttt ctc tgg gaa gaa ggt ccc aat agt ttt caa ccg tct gat 390 Asn Gly Phe Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp cct atg ctc act atg gtg gta gat agt ggt ttg aag gat gat ttg gtg 438 Pro Met Leu Thr Met Val Val Asp Ser Gly Leu Lys Asp Asp Leu Val ttg gga gat cct act gcg cca agg ttt gtg ttg tgg aat ggg aaa ttg 486 Leu Gly Asp Pro Thr Ala Pro Arg Phe Val Leu Trp Asn Gly Lys Leu agg ccg gtt cca tcg aag cta aca gac tta ccg ttc ttt gat ttg atg 534 Arg Pro Val Pro Ser Lys Leu Thr Asp Leu Pro Phe Phe Asp Leu Met agt att ggt ggg aag att aga get ggt ttt ggt gca ctt ggc att cga 582 Ser Ile Gly Gly Lys Ile Arg Ala Gly Phe Gly Ala Leu Gly Ile Arg ccg tca cct cca ggt cgt gaa gaa tct gtg gag gag ttt gta cgg cgt 630 Pro Ser Pro Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg aac ctc ggt gat gag gtt ttt gag cgc ctg att gaa ccg ttt tgt tca 678 Asn Leu Gly Asp Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cps Ser ggt gtt tat get ggt gat cct tca aaa ctg agc atg aaa gca gcg ttt 726 Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe ggg aag gtt tgg aaa cta gag caa aat ggt gga agc ata ata ggt ggt 774 Gly Lys Val Trp Lys L~eu Glu Gln Asn Gly Gly Ser Ile Ile Gly Gly act ttt aag gca att cag gag agg aaa aac get ccc aag gca gaa cga 822 Thr Phe Lys Ala Ile Gln Glu Arg Lys Asn Ala Pro Lys Ala Glu Arg gac ccg cgc ctg cca aaa cca cag ggc caa aca gtt ggt tct ttc agg 870 Asp Pro Arg Leu Pro Lys Pro Gln Gly Gln 'rhr Val Gly Ser Phe Arg aag gga ctt cga atg ttg cca gaa gca ata tct gca aga tta ggt agc 918 Lys Gly Leu Arg Met Leu Pro Glu Ala Ile Ser Ala Arg Leu Gly Ser aaa gtt aag ttg tct tgg aag ctc tca ggt atc act aag ctg gag agc 966 Lys Val Lys Leu Ser Trp Lys Leu Ser Gly Ile Thr Lys Leu Glu Ser gga gga tac aac tta aca tat gag act cca gat ggt tta gtt tcc gtg 1014 Gly Gly Tyr Asn Leu Thr err Glu Thr Pro Asp Gly Leu Val Ser Val cag agc aaa agt gtt gta atg acg gtg cca tct cat gtt gca agt ggt 1062 Gln Ser Lys Ser Val Val Met Thr Val Pro Ser His Val Ala Ser Gly ctc ttg cgc cct ctt tct gaa tct get gca aat gca ctc tca aaa cta 1110 Leu Leu Arg Pro Leu Ser Glu Ser Ala Ala Asn Ala Leu Ser Lys Leu tat tac cca cca gtt gca gca gta tct atc tcg tac ccg aaa gaa gca 1158 Tyr Tyr Pro Pro Val Ala Ala Val Ser Ile Ser Tyr Pro Lys Glu Ala atc cga aca gaa tgt ttg ata gat ggt gaa cta aag ggt ttt ggg caa 1206 Ile Arg Thr Glu Cys Leu Ile Asp Gly Glu Leu Lys Gly Phe Gly Gln ttg cat cca cgc acg caa gga gtt gaa aca tta gga act atc tac agc 1254 Leu His Pro Arg Thr Gln Gly Val Glu Thr Lsu Gly Thr Ile Tyr Ser tcc tca ctc ttt cca aat cgc gca ccg ccc gga aga att ttg ctg ttg 1302 Ser Ser Leu Phe Pro Asn Arg Ala Pro Pro Gly Arg Ile Leu Leu Leu aac tac att ggc ggg tct aca aac acc gga att ctg tcc aag tct gaa 1350 Asn Tyr Ile Gly Gly Ser Thr Asn Thr Gly Ile Leu Ser Lys Ser Glu ggt gag tta gtg gaa gca gtt gac aga gat ttg agg aaa atg cta att 1398 Gly Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile aag cct aat tcg acc gat cca ctt aaa tta gga gtt agg gta tgg cct 1446 Lys Pro Asn Ser Thr Asp Pro Leu Lys Leu Gly Val Arg Val Trp Pro caa gcc att cct cag ttt cta gtt ggt cac ttt gat atc ctt gac acg 1494 Gln Ala Ile Pro Gln Phe Leu Val Gly His Phe Asp Ile Leu Asp Z'hr get aaa tca tct cta acg tct tcg ggc tac gaa ggg cta ttt ttg ggt 1542 Ala Lys Ser Ser Leu Thr Ser Ser Gly Tyr Glu Gly Leu Phe Leu Gly ggc aat tac gtc get ggt gta gcc tta ggc cgg tgt gta gaa ggc gca 1590 Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cars Val Glu Gly Ala tat gaa acc gcg att gag gtc aac aac ttc atg tca cgg tac get tac 1638 Tyr Glu Thr Ala Ile Glu Val Asn Asn Phe Met Ser Arg Tyr Ala Tyr aag taa atgtaaaaca ttaaatctcc cagcttgcgt gagttttatt aaatattttg 1694 Lys agatatccaa aaaaaaaaaa aaaaa 1719 <210> 2 <211> 537 <212> PRT
<213> Arabidopsis thaliana <400> 2 Met Glu Leu Ser Leu Leu Arg Pro Thr Thr Gln Ser Leu Leu Pro Ser Phe Ser Lys Pro Asn Leu Arg Leu Asn Val Tyr Lys Pro Leu Arg Leu Arg CSrs Ser Val Ala Gly Gly Pro Thr Val Gly Ser Ser Lys Ile Glu Gly Gly Gly Gly Thr Thr Ile Thr Thr Asp Cps Val Ile Val Gly Gly Gly Ile Ser Gly Leu Cps Ile Ala Gln Ala Leu Ala Thr Lys His Pro Asp Ala Ala Pro Asn Leu Ile Val Thr Glu Ala Lys Asp Arg Val Gly Gly Asn Ile Ile Thr Arg Glu Glu Asn Gly Phe Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Met Leu Thr Met Val Val Asp Ser Gly Leu Lys Asp Asp Leu Val Leu Gly Asp Pro Thr Ala Pro Arg Phe Val Leu Trp Asn Gly Lys L~eu Arg Pro Val Pro Ser Lys Leu Thr Asp Leu Pro Phe Phe Asp Leu Met Ser Ile Gly Gly Lys Ile Arg Ala Gly Phe Gly Ala Leu Gly Ile Arg Pro Ser Pro Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly Asp Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cps Ser Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Lys Leu Glu Gln Asn Gly Gly Ser Ile Ile Gly Gly Thr Phe Lys Ala Ile Gln Glu Arg Lys Asn Ala Pro Lys Ala Glu Arg Asp Pro Arg Leu Pro Lys Pro Gln Gly Gln 'rhr Val Gly Ser Phe Arg Lys Gly Leu Arg Met Leu Pro Glu Ala Ile Ser Ala Arg Leu Gly Ser Lys Val Lys Leu Ser Trp Lys Leu Ser Gly Ile Thr Lys Leu Glu Ser Gly Gly Tyr Asn Leu Thr Tyr Glu Thr Pro Asp Gly Leu Val Ser Val Gln Ser Lys Ser Val Val Met Thr Val Pro Ser His Val Ala Ser Gly Leu Leu Arg Pro Leu Ser Glu Ser Ala Ala Asn Ala Leu Ser Lys Leu Tyr Tyr Pro Pro Val Ala Ala Val Ser Ile Ser Tyr Pro Lys Glu Ala Ile Arg Thr Glu Cars Leu Ile Asp Gly Glu Leu Lys Gly Phe Gly Gln Leu His Pro Arg 'rhr Gln Gly Val Glu Thr Leu Gly Ttir Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Pro Gly Arg Ile Leu Leu Leu Asn Tyr Ile Gly Gly Ser Thr Asn Thr Gly Ile Leu Ser Lys Ser Glu Gly Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Lys Pro Asn Ser Thr Asp Pro Leu Lys Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Leu Val Gly His Phe Asp Ile Leu Asp Thr Ala Lys Ser Ser Leu Thr Ser Ser Gly Tyr Glu Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cys Val Glu Gly Ala Tyr Glu Thr Ala Ile Glu Val Asn Asn Phe Met Ser Arg Tyr Ala Tyr Lys <210> 3 <211> 1738 <212> I~
<213> Arabidopsis thaliana <220>
<221> C'DS
<222> (70)..(1596) <223> Arabidapsis protox-2 <400> 3 ttttttactt atttccgtca ctgctttcga ctggtcagag attttgactc tgaattgttg 60 cagatagca atg gcg tct gga gca gta gca gat cat caa att gaa gcg gtt 111 Met Ala Ser Gly Ala Val Ala Asp His Gln Ile Glu Ala Val tca gga aaa aga gtc gca gtc gta ggt gca ggt gta agt gga ctt gcg 159 Ser Gly Lys Arg Val Ala Val Val Gly Ala Gly Val Ser Gly Leu Ala _g_ gcg get tac aag ttg aaa tcg agg ggt ttg aat gtg act gtg ttt gaa 207 Ala Ala Tyr Lys Leu Lys Ser Arg Gly Leu Asn Val Thr Val Phe Glu get gat gga aga gta ggt ggg aag ttg aga agt gtt atg caa aat ggt 255 Ala Asp Gly Arg Val Gly Gly Lys Leu Arg Ser Val Met Gln Asn Gly ttg att tgg gat gaa gga gca aac acc atg act gag get gag cca gaa 303 Leu Ile Trp Asp Glu Gly Ala Asn Thr Met Thr Glu Ala Glu Pro Glu gtt ggg agt tta ctt gat gat ctt ggg ctt cgt gag aaa caa caa ttt 351 Val Gly Ser Leu Leu Asp Asp Leu Gly Leu Arg Glu Lys Gln Gln Phe cca att tca cag aaa aag cgg tat att gtg cgg aat ggt gta cct gtg 399 Pro Ile Ser Gln Lys Lys Arg Tyr Ile Val Arg Asn Gly Val Pro Val atg cta cct acc aat ccc ata gag ctg gtc aca agt agt gtg ctc tct 447 Met L~eu Pro Thr Asn Pro Ile Glu Leu Val 'I'hr Ser Ser Val L~eu Ser acc caa tct aag ttt caa atc ttg ttg gaa cca ttt tta tgg aag aaa 495 Thr Gln Ser Lys Phe Gln Ile Leu Leu Glu Pro Phe Leu Trp Lys Lys aag tcc tca aaa gtc tca gat gca tct get gaa gaa agt gta agc gag 543 Lys Ser Ser Lys Val Ser Asp Ala Ser Ala Glu Glu Ser Val Ser Glu ttc ttt caa cgc cat ttt gga caa gag gtt gtt gac tat ctc atc gac 591 Phe Phe Gln Arg His Phe Gly Gln Glu Val Val Asp err Leu Ile Asp _g_ cct ttt gtt ggt gga aca agt get gcg gac cct gat tcc ctt tca atg 639 Pro Phe Val Gly Gly 2'hr Ser Ala Ala Asp Pro Asp Ser Leu Ser Met aag cat tct ttc cca gat ctc tgg aat gta gag aaa agt ttt ggc tct 687 Lys His Ser Phe Pro Asp Leu Trp Asn Val Glu Lys Ser Phe Gly Ser att ata gtc ggt gca atc aga aca aag ttt get get aaa ggt ggt aaa 735 Ile Ile Val Gly Ala Ile Arg Thr Lys Phe Ala Ala Lys Gly Gly Lys agt aga gac aca aag agt tct cct ggc aca aaa aag ggt tcg cgt ggg 783 Ser Arg Asp Thr Lys Ser Ser Pro Gly Thr Lys Lys Gly Ser Arg Gly tca ttc tct ttt aag ggg gga atg cag att ctt cct gat acg ttg tgc 831 Ser Phe Ser Phe Lys Gly Gly Met Gln Ile Leu Pro Asp Thr Leu Cps aaa agt ctc tca cat gat gag atc aat tta gac tcc aag gta ctc tct 879 Lys Ser Leu Ser His Asp Glu Ile Asn Leu Asp Ser Lys Val Leu Ser ttg tct tac aat tct gga tca aga cag gag aac tgg tca tta tct tgt 927 L~eu Ser 'I~r Asn Ser Gly Ser Arg Gln Glu Asn Trp Ser L~eu Ser Gars gtt tcg cat aat gaa acg cag aga caa aac ccc cat tat gat get gta 975 Val Ser His Asn Glu Thr Gln Arg Gln Asn Pro His Tyr Asp Ala Val att atg acg get cct ctg tgc aat gtg aag gag atg aag gtt atg aaa 1023 Ile Met Thr Ala Pro Leu Cys Asn Val Lys Glu Met Lys Val Met Lys gga gga caa ccc ttt cag cta aac ttt ctc ccc gag att aat tac atg 1071 Gly Gly Gln Pro Phe Gln Leu Asn Phe Leu Pro Glu Ile Asn Tyr Met ccc ctc tcg gtt tta atc acc aca ttc aca aag gag aaa gta aag aga 1119 Pro Leu Ser Val Leu Ile Thr Thr Phe Thr Lys Glu Lys Val Lys Arg cct ctt gaa ggc ttt ggg gta ctc att cca tct aag gag caa aag cat 1167 Pro Leu Glu Gly Phe Gly Val Leu Ile Pro Ser Lys Glu Gln Lys His ggt ttc aaa act cta ggt aca ctt ttt tca tca atg atg ttt cca gat 1215 Gly Phe Lys Thr Leu Gly Thr Leu Phe Ser Ser Met Met Phe Pro Asp cgt tcc cct agt gac gtt cat cta tat aca act ttt att ggt ggg agt 1263 Arg Ser Pro Ser Asp Val His Leu err Thr Thr Phe Ile Gly Gly Ser agg aac cag gaa cta gcc aaa get tcc act gac gaa tta aaa caa gtt 1311 Arg Asn Gln Glu Leu Ala Lys Ala Ser 'rhr Asp Glu Leu Lys Gln Val gtg act tct gac ctt cag cga ctg ttg ggg gtt gaa ggt gaa ccc gtg 1359 Val 'I'hr Ser Asp Leu Gln Arg Leu Leu Gly Val Glu Gly Glu Pro Val tct gtc aac cat tac tat tgg agg aaa gca ttc ccg ttg tat gac agc 1407 Ser Val Asn His Tyr Tyr Trp Arg Lys Ala Phe Pro heu Tyr Asp Ser agc tat gac tca gtc atg gaa gca att gac aag atg gag aat gat cta 1455 Ser 'I~r Asp Ser Val Met Glu Ala Ile Asp Lys Met Glu Asn Asp Leu cct ggg ttc ttc tat gca ggt aat cat cga ggg ggg ctc tct gtt ggg 1503 Pro Gly Phe Phe Tyr Ala Gly Asn His Arg Gly Gly Leu Ser Val Gly aaa tca ata gca tca ggt tgc aaa gca get gac ctt gtg atc tca tac 1551 Lys Ser Ile Ala Ser Gly Cys Lys Ala Ala Asp Leu Val Ile Ser Tyr ctg gag tct tgc tca aat gac aag aaa cca aat gac agc tta taa 1596 Leu Glu Ser Cars Ser Asn Asp Lys Lys Pro Asn Asp Ser Leu cattgtcaag gttcgtccct ttttatcact tactttgtaa acttgtaaaa tgcaacaagc 1656 cgccgtgcga ttagccaaca actcagcaaa acccagattc tcataaggct cactaattcc 1716 agaataaact atttatgtaa as 1738 <210> 4 <211> 508 <212> PRT
<213> Arabidopsis thaliana <400> 4 Met Ala Ser Gly Ala Val Ala Asp His Gln Ile Glu Ala Val Ser Gly Lys Arg Val Ala Val Val Gly Ala Gly Val Ser Gly Leu Ala Ala Ala Tyr Lys Leu Lys Ser Arg Gly Leu Asn Val Thr Val Phe Glu Ala Asp Gly Arg Val Gly Gly Lys Leu Arg Ser Val Met Gln Asn Gly Leu Ile Trp Asp Glu Gly Ala Asn Thr Met Thr Glu Ala Glu Pro Glu Val Gly Ser Leu Leu Asp Asp Leu Gly Leu Arg Glu Lys Gln Gln Phe Pro Ile Ser Gln Lys Lys Arg Tyr Ile Val Arg Asn Gly Val Pro Val Met Leu Pro Thr Asn Pro Ile Glu Leu Val Thr Ser Ser Val Leu Ser Thr Gln Ser Lys Phe Gln Ile Leu Leu Glu Pro Phe Leu Tip Lys Lys Lys Ser Ser Lys Val Ser Asp Ala Ser Ala Glu Glu Ser Val Ser Glu Phe Phe Gln Arg His Phe Gly Gln Glu Val Val Asp Tyr Leu Ile Asp Pro Phe Val Gly Gly Thr Ser Ala Ala Asp Pro Asp Ser Leu Ser Met Lys His Ser Phe Pro Asp Leu Tip Asn Val Glu Lys Ser Phe Gly Ser Ile Ile Val Gly Ala Ile Arg Thr Lys Phe Ala Ala Lys Gly Gly Lys Ser Arg Asp Thr Lys Ser Ser Pro Gly Thr Lys Lys Gly Ser Arg Gly Ser Phe Ser Phe Lys Gly Gly Met Gln Ile Leu Pro Asp Thr Leu Cps Lys Ser Leu Ser His Asp Glu Ile Asn Leu Asp Ser Lys Val Leu Ser Leu Ser Tyr Asn Ser Gly Ser Arg Gln Glu Asn Trp Ser Leu Ser Cars Val Ser His Asn Glu Thr Gln Arg Gln Asn Pro.His Tyr Asp Ala Val Ile Met Thr Ala Pro Leu Cys Asn Val Lys Glu Met Lys Val Met Lys Gly Gly Gln Pro Phe Gln Leu Asn Phe Leu Pro Glu Ile Asn Tyr Met Pro Leu Ser Val Leu Ile Thr Thr Phe Thr Lys Glu Lys Val Lys Arg Pro Leu Glu Gly Phe Gly Val Leu Ile Pro Ser Lys Glu Gln Lys His Gly Phe Lys Thr Leu Gly Thr Leu Phe Ser Ser Met Met Phe Pro Asp Arg Ser Pro Ser Asp Val His Leu Tyr Thr Thr Phe Ile Gly Gly Ser Arg Asn Gln Glu Leu Ala Lys Ala Ser Thr Asp Glu Leu Lys Gln Val Val Thr Ser Asp Leu Gln Arg Leu Leu Gly Val Glu Gly Glu Pro Val Sex Val Asn His Tyr Tyr Tip Arg Lys Ala Phe Pro Leu Tyr Asp Ser Ser Tyr Asp Ser Val Met Glu Ala Ile Asp Lys Met Glu Asn Asp Leu Pro Gly Phe Phe Tyr Ala Gly Asn His Arg Gly Gly Leu Ser Val Gly Lys Ser Ile Ala Ser Gly Cps Lys Ala Ala Asp Leu Val Ile Ser Tyr Leu Glu Ser Cps Ser Asn Asp Lys Lys Pro Asn Asp Ser Leu <210> 5 <211> 1691 <212> L'8sA
<213> Zea mat's <220>
<221> CDS
<222> (1)..(1443) <223> Maize protox-1 c-L'.~1 (not full-length) <400> 5 gcg gac tgc gtc gtg gtg ggc gga ggc atc agt ggc ctc tgc acc gcg 48 Ala Asp Cps Val Val Val Gly Gly Gly Ile Ser Gly Leu Cps Thr Ala cag gcg ctg gcc acg cgg cac ggc gtc ggg gac gtg ctt gtc acg gag 96 Gln Ala Leu Ala Thr Arg His Gly Val Gly Asp Val Leu Val Thr Glu gcc cgc gcc cgc ccc ggc ggc aac att acc acc gtc gag cgc ccc gag 144 Ala Arg Ala Arg Pro Gly Gly Asn Ile Thr Thr Val Glu Arg Pro Glu gaa ggg tac ctc tgg gag gag ggt ccc aac agc ttc cag ccc tcc gac 192 Glu Gly Tyr Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp ccc gtt ctc acc atg gcc gtg gac agc gga ctg aag gat gac ttg gtt 240 Pro Val Leu 'Ihr Met Ala Val Asp Ser Gly Leu Lys Asp Asp Leu Val ttt ggg gac cca aac gcg ccg cgt ttc gtg ctg tgg gag ggg aag ctg 288 Phe Gly Asp Pro Asn Ala Pro Arg Phe Val Leu 'I~p Glu Gly Lys Leu agg ccc gtg cca tcc aag ccc gcc gac ctc ccg ttc ttc gat ctc atg 336 Arg Pro Val Pro Ser Lys Pro Ala Asp Leu Pro Phe Phe Asp Leu Met agc atc cca ggg aag ctc agg gcc ggt cta ggc gcg ctt ggc atc cgc 384 Ser Ile Pro Gly Lys Leu Arg Ala Gly Leu Gly Ala Leu Gly Ile Arg ccg cct cct cca ggc cgc gaa gag tca gtg gag gag ttc gtg cgc cgc 432 Pro Pro Pro Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg aac ctc ggt get gag gtc ttt gag cgc ctc att gag cct ttc tgc tca 480 Asn Leu Gly Ala Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cys Ser ggt gtc tat get ggt gat cct tct aag ctc agc atg aag get gca ttt 528 Gly Val Z~r Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe ggg aag gtt tgg cgg ttg gaa gaa act gga ggt agt att att ggt gga 576 Gly Lys Val Trp Arg Leu Glu Glu Thr Gly Gly Ser Ile Ile Gly Gly acc atc aag aca att cag gag agg agc aag aat cca aaa cca ccg agg 624 Thr Ile Lys Thr Ile Gln Glu Arg Ser Lys Asn Pro Lys Pro Pro Arg gat gcc cgc ctt ccg aag cca aaa ggg cag aca gtt gca tct ttc agg 672 Asp Ala Arg Leu Pro Lys Pro Lys Gly Gln Thr Val Ala Ser Phe Arg aag ggt ctt gcc atg ctt cca aat gcc att aca tcc agc ttg ggt agt 720 Lys Gly Leu Ala Met Leu Pro Asn Ala Ile Thr Ser Ser Leu Gly Ser aaa gtc aaa cta tca tgg aaa ctc acg agc att aca aaa tca gat gac 768 Lys Val Lys Leu Ser Trp Lys Leu Thr Ser Ile Thr Lys Ser Asp Asp aag gga tat gtt ttg gag tat gaa acg cca gaa ggg gtt gtt tcg gtg 816 Lys Gly Tyr Val Leu Glu Tyr Glu Thr Pro Glu Gly Val Val Ser Val cag get aaa agt gtt atc atg act att cca tca tat gtt get agc aac 864 Gln Ala Lys Ser Val Ile Met Thr Ile Pro Ser Tyr Val Ala Ser Asn att ttg cgt cca ctt tca agc gat get gca gat get cta tca aga ttc 912 Ile Leu Arg Pro Leu Ser Ser Asp Ala Ala Asp Ala Leu Ser Arg Phe tat tat cca ccg gtt get get gta act gtt tcg tat cca aag gaa gca 960 Tyr Tyr Pro Pro Val Ala Ala Val Thr Val Ser Tyr Pro Lys Glu Ala att aga aaa gaa tgc tta att gat ggg gaa ctc cag ggc ttt ggc cag 1008 Ile Arg Lys Glu Cps Leu Ile Asp Gly Glu Leu Gln Gly Phe Gly Gln ttg cat cca cgt agt caa gga gtt gag aca tta gga aca ata tac agt 1056 Leu His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser tcc tca ctc ttt cca aat cgt get cct gac ggt agg gtg tta ctt cta 1104 Ser Ser Leu Phe Pro Asn Arg Ala Pro Asp Gly Arg Val Leu Leu Leu aac tac ata gga ggt get aca aac aca gga att gtt tcc aag act gaa 1152 Asn Tyr Ile Gly Gly Ala Thr Asn Thr Gly Ile Val Ser Lys Thr Glu agt gag ctg gtc gaa gca gtt gac cgt gac ctc cga aaa atg ctt ata 1200 Ser Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile aat tct aca gca gtg gac cct tta gtc ctt ggt gtt cga gtt tgg cca 1248 Asn'Ser 'rhr Ala Val Asp Pro Leu Val Leu Gly Val Arg Val Z'rp Pro caa gcc ata cct cag ttc ctg gta gga cat ctt gat ctt ctg gaa gcc 1296 Gln Ala Ile Pro Gln Phe Leu Val Gly His Leu Asp L~eu Leu Glu Ala gca aaa get gcc ctg gac cga ggt ggc tac gat ggg ctg ttc cta gga 1344 Ala Lys Ala Ala Lsu Asp Arg Gly Gly Tyr Asp Gly Leu Phe Leu Gly ggg aac tat gtt gca gga gtt gcc ctg ggc aga tgc gtt gag ggc gcg 1392 Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cps Val Glu Gly Ala tat gaa agt gcc tcg caa ata tct gac ttc ttg acc aag tat gcc tac 1440 Tyr Glu Ser Ala Ser Gln Ile Ser Asp Phe Leu Thr Lys Tyr Ala Tyr 465 470 475' 480 aag tgatgaaaga agtggagcgc tacttgttaa tcgtttatgt tgcatagatg 1493 Lys aggtgcctcc ggggaaaaaa aagcttgaat agtatttttt attcttattt tgtaaattgc 1553 atttctgttc ttttttctat cagtaattag ttatatttta gttctgtagg agattgttct 1613 _18_ gttcactgcc cttcaaaaga aattttattt ttcattcttt tatgagagct gtgctactta 1673 aaaaaaaaaa aaaaaaaa 1691 <210> 6 <211> 481 <212> PRT
<213> Zea mays <400> 6 Ala Asp Cars Val Val Val Gly Gly Gly Ile Ser Gly Leu Gds Thr Ala Gln Ala Leu Ala Thr Arg His Gly Val Gly Asp Val Leu Val Thr Glu Ala Arg Ala Arg Pro Gly Gly Asn Ile Thr Thr Val Glu Arg Pro Glu Glu Gly Tyr Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Val Leu Thr Met Ala Val Asp Ser Gly Leu Lys Asp Asp Leu Val Phe Gly Asp Pro Asn Ala Pro Arg Phe Val Leu Trp Glu Gly Lys Leu Arg Pro Val Pro Ser Lys Pro Ala Asp Leu Pro Phe Phe Asp Leu Met Ser Ile Pro Gly Lys Leu Arg Ala Gly Leu Gly Ala Leu Gly Ile Arg Pro Pro Pro Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly Ala Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cars Ser Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Arg Leu Glu Glu Thr Gly Gly Ser Ile Ile Gly Gly Thr Ile Lys Thr Ile Gln Glu Arg Ser Lys Asn Pro Lys Pro Pro Arg 195 200 205 .
Asp Ala Arg Leu Pro Lys Pro Lys Gly Gln Thr Val Ala Ser Phe Arg Lys Gly Leu Ala Met Leu Pro Asn Ala Ile 'rhr Ser Ser Leu Gly Ser Lys Val Lys Leu Ser Trp Lys Leu Thr Ser Ile Thr Lys Ser Asp Asp Lys Gly Tyr Val Leu Glu Tyr Glu Thr Pro Glu Gly Val Val Ser Val Gln Ala Lys Ser Val Ile Met Thr Ile Pro Ser Tyr Val Ala Ser Asn Ile Leu Arg Pro Leu Ser Ser Asp Ala Ala Asp Ala Leu Ser Arg Phe Tyr ~r Pro Pro Val Ala Ala Val Thr Val Ser Tyr Pro Lys Glu Ala Ile Arg Lys Glu Cps Leu Ile Asp Gly Glu Leu Gln Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Sex Ser Ser Leu Phe Pro Asn Arg Ala Pro Asp Gly Arg Val Leu Leu Leu Asn Tyr Ile Gly Gly Ala Thr Asn Thr Gly Ile Val Ser Lys Thr Glu Ser Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Asn Ser Thr Ala Val Asp Pro Leu Val Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Leu Val Gly His Leu Asp Leu Leu Glu Ala Ala Lys Ala Ala Leu Asp Arg Gly Gly 'I'yr Asp Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cys Val Glu Gly Ala Tyr Glu Ser Ala Ser Gln Ile Ser Asp Phe Leu Thr Lys Tyr Ala Tyr Lys <210> 7 <211> 2061 <212> I~1A
<213> Zea mays <220>
<221> CDS
<222> (64)..(1698) <223> Maize protox-2 <400> 7 ctctcctacc tccacctcca cgacaacaag caaatcccca tccagttcca aaccctaact 60 caa atg ctc.gct ttg act gcc tca gcc tca tcc get tcg tcc cat cct 108 Met Leu Ala Leu Thr Ala Ser Ala Ser Ser Ala Ser Ser His Pro tat cgc cac gcc tcc gcg cac act cgt cgc ccc cgc cta cgt gcg gtc 156 Tyr Arg His Ala Ser Ala His Thr Arg Arg Pro Arg Leu Arg Ala Val ctc gcg atg gcg ggc tcc gac gac ccc cgt gca gcg ccc gcc aga tcg 204 Leu Ala Met Ala Gly Ser Asp Asp Pro Arg Ala Ala Pro Ala Arg Ser gtc gcc gtc gtc ggc gcc ggg gtc agc ggg ctc gcg gcg gcg tac agg 252 Val Ala Val Val Gly Ala Gly Val Ser Gly Leu Ala Ala Ala Tyr Arg ctc aga cag agc ggc gtg aac gta acg gtg ttc gaa gcg gcc gac agg 300 Leu Arg Gln Ser Gly Val Asn Val Thr Val Phe Glu Ala Ala Asp Arg gcg gga gga aag ata cgg acc aat tcc gag ggc ggg ttt gtc tgg gat 348 Ala Gly Gly Lys Ile Arg Thr Asn Ser Glu Gly Gly Phe Val Trp Asp gaa gga get aac acc atg aca gaa ggt gaa tgg gag gcc agt aga ctg 396 Glu Gly Ala Asn Thr Met Thr Glu Gly Glu Trp Glu Ala Ser Arg Leu att gat gat ctt ggt cta caa gac aaa cag cag tat cct aac tcc caa 444 Ile Asp Asp Leu Gly Leu Gln Asp Lys Gln Gln 'I~rr Pro Asn Ser Gln cac aag cgt tac att gtc aaa gat gga gca cca gca ctg att cct tcg 492 His Lys Arg Tyr Ile Val Lys Asp Gly Ala Pro Ala Leu Ile Pro Ser gat ccc att tcg cta atg aaa agc agt gtt ctt tcg aca aaa tca aag 540 Asp Pro Ile Ser Leu Met Lys Ser Ser Val Leu Ser Thr Lys Ser Lys att gcg tta ttt ttt gaa cca ttt ctc tac aag aaa get aac aca aga 588 Ile Ala Leu Phe Phe Glu Pro Phe Leu Tyr Lys Lys Ala Asn Thr Arg aac tct gga aaa gtg tct gag gag cac ttg agt gag agt gtt ggg agc 636 Asn Ser Gly Lys Val Ser Glu Glu His Leu Ser Glu Ser Val Gly Ser ttc tgt gaa cgc cac ttt gga aga gaa gtt gtt gac tat ttt gtt gat 684 Phe Cys Glu Arg His Phe Gly Arg Glu Val Val Asp Tyr Phe Val Asp cca ttt gta get gga aca agt gca gga gat cca gag tca cta tct att 732 Pro Phe Val Ala Gly Thr Ser Ala Gly Asp Pro Glu Ser Leu Ser Ile cgt cat gca ttc cca gca ttg tgg aat ttg gaa aga aag tat ggt tca 780 Arg His Ala Phe Pro Ala Leu Trp Asn Txu Glu Arg Lys Tyr Gly Ser gtt att gtt ggt gcc atc ttg tct aag cta gca get aaa ggt gat cca 828 Val Ile Val Gly Ala Ile Leu Ser Lys Leu Ala Ala Lys Gly Asp Pro gta aag aca aga cat gat tca tca ggg aaa aga agg aat aga cga gtg 876 Val Lys Thr Arg His Asp Ser Ser Gly Lys Arg Arg Asn Arg Arg Val tcg ttt tca ttt cat ggt gga atg cag tca cta ata aat gca ctt cac 924 Ser Phe Ser Phe His Gly Gly Met Gln Ser Leu Ile Asn Ala Leu His aat gaa gtt gga gat gat aat gtg aag ctt ggt aca gaa gtg ttg tca 972 Asn Glu Val Gly Asp Asp Asn Val Lys Leu Gly Thr Glu Val Leu Ser ttg gca tgt aca ttt gat gga gtt cct gca cta ggc agg tgg tca att 1020 Leu Ala Cys Thr Phe Asp Gly Val Pro Ala Leu Gly Arg Trp Ser Ile tct gtt gat tcg aag gat agc ggt gac aag gac ctt get agt aac caa 1068 Ser Val Asp Ser Lys Asp Ser Gly Asp Lys Asp Leu Ala Ser Asn Gln acc ttt gat get gtt ata atg aca get cca ttg tca aat gtc cgg agg 1116 Thr Phe Asp Ala Val Ile Met Thr Ala Pro Leu Ser Asn Val Arg Arg atg aag ttc acc aaa ggt gga get ccg gtt gtt ctt gac ttt ctt cct 1164 Met Lys Phe Thr Lys Gly Gly Ala Pro Val Val Leu Asp Phe Leu Pro aag atg gat tat cta cca cta tct ctc atg gtg act get ttt aag aag 1212 Lys Met Asp Tyr Leu Pro Leu Ser Leu Met Val Thr Ala Phe Lys Lys gat gat gtc aag aaa cct ctg gaa gga ttt ggg gtc tta ata cct tac 1260 Asp Asp Val Lys Lys Pro Leu Glu Gly Phe Gly Val Leu Ile Pro err aag gaa cag caa aaa cat ggt ctg aaa acc ctt ggg act ctc ttt tcc 1308 Lys Glu Gln Gln Lys His Gly Leu Lys Thr Leu Gly Thr Leu Phe Ser tca atg atg ttc cca gat cga get cct gat gac caa tat tta tat aca 1356 Ser Met Met Phe Pro Asp Arg Ala Pro Asp Asp Gln Tyr Leu Tyr Thr aca ttt gtt ggg ggt agc cac aat aga gat ctt get gga get cca acg 1404 Thr Phe Val Gly Gly Ser His Asn Arg Asp Leu Ala Gly Ala Pro Thr tct att ctg aaa caa ctt gtg acc tct gac ctt aaa aaa ctc ttg ggc 1452 Ser Ile Leu Lys Gln Leu Val Thr Ser Asp Leu Lys Lys Leu Leu Gly gta gag ggg caa cca act ttt gtc aag cat gta tac tgg gga aat get 1500 Val Glu Gly Gln Pro Thr Phe Val Lys His Val Tyr 'I~p Gly Asn Ala ttt cct ttg tat ggc cat gat tat agt tct gta ttg gaa get ata gaa 1548 Phe Pro Leu Tyr Gly His Asp Tyr Ser Ser Val Leu Glu Ala Ile Glu aag atg gag aaa aac ctt cca ggg ttc ttc tac gca gga aat agc aag 1596 Lys Met Glu Lys Asn Leu Pro Gly Phe Phe Tyr Ala Gly Asn Ser Lys gat ggg ctt get gtt gga agt gtt ata get tca gga agc aag get get 1644 Asp Gly Leu Ala Val Gly Ser Val Ile Ala Ser Gly Ser Lys Ala Ala gac ctt gca atc tca tat ctt gaa tct cac acc aag cat aat aat tca 1692 Asp Leu Ala Ile Ser Tyr Leu Glu Ser His Thr Lys His Asn Asn Ser cat tga aagtgtctga cctatcctct agcagttgtc gacaaatttc tccagttcat 1748 His gtacagtaga aaccgatgcg ttgcagtttc agaacatctt cacttcttca gatattaacc 1808 cttcgttgaa catccaccag aaaggtagtc acatgtgtaa gtgggaaaat gaggttaaaa 1868 actattatgg cggccgaaat gttccttttt gttttcctca caagtggcct acgacacttg 1928 atgttggaaa tacatttaaa tttgttgaat tgtttgagaa cacatgcgtg acgtgtaata 1988 tttgcctatt gtgattttag cagtagtctt ggccagatta tgctttacgc ctttaaaaaa 2048 aaaaaaaaaa aaa 2061 <210> 8 <211> 544 <212> PRT
<213> Zea mays <400> 8 Met Leu Ala Leu Thr Ala Ser Ala Ser Ser Ala Ser Ser His Pro Tyr Arg His Ala Ser Ala His Thr Arg Arg Pro Arg Leu Arg Ala Val Leu Ala Met Ala Gly Ser Asp Asp Pro Arg Ala Ala Pro Ala Arg Ser Val Ala Val Val Gly Ala Gly Val Ser Gly Leu Ala Ala Ala Tyr Arg Leu Arg Gln Ser Gly Val Asn Val Thr Val Phe Glu Ala Ala Asp Arg Ala Gly Gly Lys Ile Arg Thr Asn Ser Glu Gly Gly Phe Val Trp Asp Glu Gly Ala Asn Thr Met Thr Glu Gly Glu Trp Glu Ala Ser Arg Leu Ile Asp Asp Leu Gly Leu Gln Asp Lys Gln Gln Tyr Pro Asn Ser Gln His Lys Arg Tyr Ile Val Lys Asp Gly Ala Pro Ala Leu Ile Pro Ser Asp Pro Ile Ser Leu Met Lys Ser Ser Val Leu Ser Thr Lys Ser Lys Ile Ala Leu Phe Phe Glu Pro Phe Leu Tyr Lys Lys Ala Asn Thr Arg Asn Ser Gly Lys Val Ser Glu Glu His Leu Ser Glu Ser Val Gly Ser Phe Cps Glu Arg His Phe Gly Arg Glu Val Val Asp Tyr Phe Val Asp Pro Phe Val Ala Gly Thr Ser Ala Gly Asp Pro Glu Ser Leu Ser Ile Arg His Ala Phe Pro Ala Leu '1'rp Asn Leu Glu Arg Lys Tyr Gly Ser Val Ile Val Gly Ala Ile Leu Ser Lys Leu Ala Ala Lys Gly Asp Pro Val Lys Thr Arg His Asp Ser Ser Gly Lys Arg Arg Asn Arg Arg Val Ser Phe Ser Phe His Gly Gly Met Gln Ser Leu Ile Asn Ala Leu His Asn Glu Val Gly Asp Asp Asn Val Lys Leu Gly Thr Glu Val Leu Ser Leu Ala Cys Thr Phe Asp Gly Val Pro Ala Leu Gly Arg Trp Ser Ile Ser Val Asp Ser Lys Asp Ser Gly Asp Lys Asp Leu Ala Ser Asn Gln Thr Phe Asp Ala Val Ile Met Thr Ala Pro Leu Ser Asn Val Arg Arg Met Lys Phe Thr Lys Gly Gly Ala Pro Val Val Leu Asp Phe Leu Pro Lys Met Asp Tyr Leu Pro Leu Ser Leu Met Val Thr Ala Phe Lys Lys Asp Asp Val Lys Lys Pro Leu Glu Gly Phe Gly Val Leu Ile Pro Tyr Lys Glu Gln Gln Lys His Gly Leu Lys Thr Leu Gly Thr Leu Phe Ser Ser Met Met Phe Pro Asp Arg Ala Pro Asp Asp Gln Tyr Leu Tyr Thr Thr Phe Val Gly Gly Ser His Asn Arg Asp Leu Ala Gly Ala Pro Thr.Ser Ile Leu Lys Gln Leu Val Thr Ser Asp Leu Lys Lys Leu Leu Gly Val Glu Gly Gln Pro.Thr Phe Val Lys His Val Tyr Trp Gly Asn Ala Phe Pro Leu Tyr Gly His Asp Tyr Ser Ser Val Leu Glu Ala Ile Glu Lys _2g_ Met Glu Lys Asn Leu Pro Gly Phe Phe Tyr Ala Gly Asn Ser Lys Asp Gly Leu Ala Val Gly Ser Val Ile Ala Ser Gly Ser Lys Ala Ala Asp Leu Ala Ile Ser Tyr Leu Glu Ser His Thr Lys His Asn Asn Ser His <210> 9 <211> 1811 <212> IOTA
<213> Tritictun aestivtm~
<220>
<221> CDS
<222> (3)..(1589) <223> wheat protox-1 <400> 9 gc gca aca atg gcc acc gcc acc gtc gcg gcc gcg tcg ccg ctc cgc 47 Ala Thr Met Ala Thr Ala Thr Val Ala Ala Ala Ser Pro Leu Arg ggc agg'gtc acc ggg cgc cca cac cgc gtc cgc ccg cgt tgc get acc 95 Gly Arg Val 'hhr Gly Arg Pro His Arg.Val Arg Pro Arg Cys Ala Thr gcg agc agc gcg acc gag act ccg gcg gcg ccc ggc gtg cgg ctg tcc 143 Ala Ser Ser Ala Thr Glu Thr Pro Ala Ala Pro Gly Val Arg Leu Ser gcg gaa tgc gtc att gtg ggc gcc ggc atc agc ggc ctc tgc acc gcg 191 Ala Glu Gars Val Ile Val Gly Ala Gly Ile Ser Gly Leu Gars Thr Ala cag gcg ctg gcc acc cga tac ggc gtc agc gac ctg ctc gtc acg gag 239 Gln Ala Leu Ala Thr Arg Tyr Gly Val Ser Asp Leu Leu Val Thr Glu gcc cgc gac cgc ccg ggc ggc aac atc acc acc gtc gag cgt ccc gac 287 Ala Arg Asp Arg Pro Gly Gly Asn Ile Thr Thr Val Glu Arg Pro Asp gag ggg tac ctg tgg gag gag gga ccc aac agc ttc cag ccc tcc gac 335 Glu Gly Tyr Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp ccg gtc ctc acc atg gcc gtg gac agc ggg ctc aag gat gac ttg gtg 383 Pro Val Leu Thr Met Ala Val Asp Ser Gly Leu Lys Asp Asp L~u Val ttc ggg gac ccc aac gcg ccc cgg ttc gtg ctg tgg gag ggg aag ctg 431 Phe Gly Asp Pro Asn Ala Pro Arg Phe Val Leu Trp Glu Gly Lys Leu agg ccg gtg ccg tcg aag cca ggc gac ctg cct ttc ttc agc ctc atg 479 Arg Pro Val Pro Ser Lys Pro Gly Asp Leu Pro Phe Phe Ser Leu Met agt atc cct ggg aag ctc agg gcc ggc ctt ggc gcg ctc ggc att cgc 527 Ser Ile Pro Gly Lys Leu Arg Ala Gly Leu Gly Ala Leu Gly Ile Arg cca cct cct cca ggg cgc gag gag tcg gtg gag gag ttt gtg cgc cgc 575 Pro Pro Pro Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg aac ctc ggt gcc gag gtc ttt gag cgc ctc atc gag cct ttc tgc tca 623 Asn Leu Gly Ala Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cys Ser ggt gta tat get ggt gat cct tcg aag ctt agt atg aag get gca ttt 671 Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe ggg aag gtc tgg agg ttg gag gag att gga ggt agt att att ggt gga 719 Gly Lys Val Trp Arg Leu Glu Glu Ile Gly Gly Ser Ile Ile Gly Gly acc atc aag gcg att cag gat aaa ggg aag aac ccc aaa ccg cca agg 767 Thr Ile Lys Ala Ile Gln Asp Lys Gly Lys Asn Pro Lys Pro Pro Arg gat ccc cga ctt ccg gca cca aag gga cag acg gtg gca tct ttc agg 815 Asp Pro Arg Leu Pro Ala Pro Lys Gly Gln 'rhr Val Ala Ser Phe Arg aag ggt cta gcc atg ctc ccg aat gcc atc gca tct agg ctg ggt agt 863 Lys Gly Leu Ala Met Lzu Pro Asn Ala Ile Ala Ser Arg Leu Gly Ser aaa gtc aag ctg tca tgg aag ctt acg agc att aca aag gcg gac aac 911 Lys Val Lys Leu Ser Trp Lys Leu Thr Ser Ile Thr Lys Ala Asp Asn caa gga tat gta tta ggt tat gaa aca cca gaa gga ctt gtt tca gtg 959 Gln Gly Tyr Val Leu Gly Tyr Glu Thr Pro Glu Gly Leu Val Ser Val cag get aaa agt gtt atc atg acc atc ccg tca tat gtt get agt gat 1007 Gln Ala Lys Ser Val Ile Met Thr Ile Pro Ser Tyr Val Ala Ser Asp atc ttg cgc cca ctt tca att gat gca gca gat gca ctc tca aaa ttc 1055 Ile Leu Arg Pro Leu Ser Ile Asp Ala Ala Asp Ala Leu Ser Lys Phe tat tat ccg cca gtt get get gta act gtt tca tat cca aaa gaa get 1103 Tyr Tyr Pro Pro Val Ala Ala Val Thr Val Ser Tyr Pro Lys Glu Ala att aga aaa gaa tgc tta att gat ggg gag ctc cag ggt ttc ggc cag 1151 Ile Arg Lys Glu Cars Leu Ile Asp Gly Glu Leu Gln Gly Phe Gly Gln ttg cat cca cgt agc caa gga gtc gag act tta ggg aca ata tat agc 1199 Leu His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser tct tct ctc ttt cct aat cgt get cct get gga aga gtg tta ctt ctg 1247 Ser Ser Leu Phe Pro Asn Arg Ala Pro Ala Gly Arg Val Leu Leu Leu aac tat atc ggg ggt tct aca aat aca ggg atc gtc tcc aag act gag 1295 Asn Tyr Ile Gly Gly Ser Thr Asn Thr Gly Ile Val Ser Lys Thr Glu agt gac tta gta gga gcc gtt gac cgt gac ctc aga aaa atg ttg ata 1343 Ser Asp Leu Val Gly Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile aac cct aga gca gca gac cct tta gca tta ggg gtt cga gtg tgg cca 1391 Asn Pro Arg Ala Ala Asp Pro Leu Ala Leu Gly Val Arg Val Trp Pro caa gca ata cca cag ttt ttg att ggg cac ctt gat cgc ctt get get 1439 Gln Ala Ile Pro Gln Phe Lzu Ile Gly His Leu Asp Arg Leu Ala Ala gca aaa tct gca ctg ggc caa ggc ggc tac gac ggg ttg ttc cta gga 1487 Ala Lys Ser Ala Leu Gly Gln Gly Gly Tyr Asp Gly Leu Phe Leu Gly gga aac tac gtc gca gga gtt gcc ttg ggc cga tgc atc gag ggt gcg 1535 Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cars Ile Glu Gly Ala tac gag agt gcc tca caa gta tct gac ttc ttg acc aag tat gcc tac 1583 Tyr Glu Ser Ala Ser Gln Val Ser Asp Phe Lsu Thr Lys Tyr Ala Tyr aag tga tggaagtagt gcatctcttc attttgttgc atatacgagg tgaggctagg 1639 Lys atcggtaaaa catcatgaga ttctgtagtg tttctttaat tgaaaaaaca aattttagtg 1699 atgcaatatg tgctctttcc tgtagttcga gcatgtacat cggtatggga taaagtagaa 1759 taagctattc tgcaaaagca gtgatttttt ttgaaaaaaa aaaaaaaaaa as 1811 <210> 10 <211> 528 <212> PRT
<213> Tritictun aestiv~mi <400> 10 Ala Thr Met Ala Thr Ala Thr Val Ala Ala Ala Ser Pro Leu Arg Gly Arg Val 'I'hr Gly Arg Pro His Arg Val Arg Pro Arg Cps Ala Thr Ala Ser Ser Ala Thr Glu Thr Pro Ala Ala Pro Gly Val Arg Leu Ser Ala Glu Cars Val Ile Val Gly Ala Gly Ile Ser Gly Leu Cys Thr Ala Gln Ala Leu Ala Thr Arg Tyr Gly Val Ser Asp Leu Leu Val Z'hr Glu Ala Arg Asp Arg Pro Gly Gly Asn Ile Thr Thr Val Glu Arg Pro Asp Glu Gly Tyr Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Val Leu Thr Met Ala Val Asp Ser Gly Leu Lys Asp Asp Leu Val Phe Gly Asp Pro Asn Ala Pro Arg Phe Val Leu Trp Glu Gly Lys Leu Arg Pro Val Pro Ser Lys Pro Gly Asp Leu Pro Phe Phe Ser Leu Met Ser Ile Pro Gly Lys Leu Arg Ala Gly I~eu Gly Ala Leu Gly Ile Arg Pro Pro Pro Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly Ala Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cars Ser Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Arg Leu Glu Glu Ile Gly Gly Ser Ile Ile Gly Gly Thr Ile Lys Ala Ile Gln Asp Lys Gly Lys Asn Pro Lys Pro Pro Arg Asp Pro Arg Leu Pro Ala Pro Lys Gly Gln 'hhr Val Ala Ser Phe Arg Lys Gly Leu Ala Met Leu Pro Asn Ala Ile Ala Ser Arg Leu Gly Ser Lys Val Lys Leu Ser Trp Lys Leu Thr Ser Ile Thr Lys Ala Asp Asn Gln Gly Tyr Val Leu Gly Tyr Glu Thr Pro Glu Gly Leu Val Ser Val Gln Ala Lys Ser Val Ile Met Thr Ile Pro Ser Tyr Val Ala Ser Asp Ile Leu Arg Pro Leu Ser Ile Asp Ala Ala Asp Ala Leu Ser Lys Phe Tyr Tyr Pro Pro Val Ala Ala Val Thr Val Ser Tyr Pro Lys Glu Ala Ile Arg Lys Glu CSrs Leu Ile Asp Gly Glu Leu Gln Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Ala Gly Arg Val Leu Leu Leu Asn Tyr Ile Gly Gly Ser Thr Asn Thr Gly Ile Val Ser Lys Thr Glu Ser Asp Leu Val Gly Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Asn Pro Arg Ala Ala Asp Pro Leu Ala Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe L~eu Ile Gly His Leu.Asp Arg Leu Ala Ala Ala Lys Ser Ala L~eu Gly Gln Gly Gly Tyr Asp Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cars Ile Glu Gly Ala Tyr Glu Ser Ala Ser Gln Val Ser Asp Phe Leu Thr Lys Tyr Ala Tyr Lys <210> 11 <211> 1847 <212> IAA
<213> Glycine mzx <220>
<221> CDS
<222> (55)..(1683) <223> soybean protox-1 <400> 11 ctttagcaca gtgttgaaga taacgaacga atagtgccat tactgtaacc aacc atg 57 Met gtt tcc gtc ttc aac gag atc cta ttc ccg ccg aac caa acc ctt ctt 105 Val Ser Val Phe Asn Glu Ile Leu Phe Pro Pro Asn Gln Thr Leu Leu cgc ccc tcc ctc cat tcc cca acc tct ttc ttc acc tct ccc act cga 153 Arg Pro Ser Leu His Ser Pro Thr Sex Phe Phe Thr Ser Pro Thr Arg 20 25 30.
aaa ttc cct cgc tct cgc cct aac cct att cta cgc tgc tcc att gcg 201 Lys Phe Pro Arg Ser Arg Pro Asn Pro Ile Leu Arg Cps Ser Ile Ala gag gaa tcc acc gcg tct ccg ccc aaa acc aga gac tcc gcc ccc gtg 249 Glu Glu Ser Thr Ala Ser Pro Pro Lys Thr Arg Asp Ser Ala Pro Val gac tgc gtc gtc gtc ggc gga ggc gtc agc ggc ctc tgc atc gcc cag 297 Asp Cps Val Val Val Gly Gly Gly Val Ser Gly Leu Cps Ile Ala Gln gcc ctc gcc acc aaa cac gcc aat gcc aac gtc gtc gtc acg gag gcc 345 Ala Leu Ala Thr Lys His Ala Asn Ala Asn Val Val Val Thr Glu Ala cga gac cgc gtc ggc ggc aac atc acc acg atg gag agg gac gga tac 393 Arg Asp Arg Val Gly Gly Asn Ile Thr Thr Met Glu Arg Asp Gly Tyr ctc tgg gaa gaa ggc ccc aac agc ttc cag cct tct gat cca atg ctc 441 Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Met Leu acc atg gtg gtg gac agt ggt tta aag gat gag ctt gtt ttg ggg gat 489 Thr Met Val Val Asp Ser Gly Leu Lys Asp Glu Leu Val Leu Gly Asp cct gat gca cct cgg ttt gtg ttg tgg aac agg aag ttg agg ccg gtg 537 Pro Asp Ala Pro Arg Phe Val Leu Trp Asn Arg Lys Leu Arg Pro Val ccc ggg aag ctg act gat ttg cct ttc ttt gac ttg atg agc att ggt 585 Pro Gly Lys Leu Thr Asp L~eu Pro Phe Phe Asp Leu Met Ser Ile Gly ggc aaa atc agg get ggc ttt ggt gcg ctt gga att cgg cct cct cct 633 Gly Lys Ile Arg Ala Gly Phe Gly Ala L~eu Gly Ile Arg Pro Pro Pro cca ggt cat gag gaa tcg gtt gaa gag ttt gtt cgt cgg aac ctt ggt 681 Pro Gly His Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly gat gag gtt ttt gaa cgg ttg ata gag cct ttt tgt tca ggg gtc tat. 729 Asp Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cps Ser Gly Val Tyr gca ggc gat cct tca aaa tta agt atg aaa gca gca ttc ggg aaa gtt 777 Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val tgg aag ctg gaa aaa aat ggt ggt agc att att ggt gga act ttc aaa 825 Trp Lys Leu Glu Lys Asn Gly Gly Ser Ile Ile Gly Gly Thr Phe Lys gca ata caa gag aga aat gga get tca aaa cca cct cga gat ccg cgt 873 Ala Ile Gln Glu Arg Asn Gly Ala Ser Lys Pro Pro Arg Asp Pro Arg ctg cca aaa cca aaa ggt cag act gtt gga tct ttc cgg aag gga ctt 921 Leu Pro Lys Pro Lys Gly Gln Thr Val Gly Ser Phe Arg Lys Gly Leu acc atg ttg cct gat gca att tct gcc aga cta ggc aac aaa gta aag 969 Thr Met Leu Pro Asp Ala Ile Ser Ala Arg Leu Gly Asn Lys Val Lys tta tct tgg aag ctt tca agt att agt aaa ctg gat agt gga gag tac 1017 Leu Ser Trp Lys Ireu Ser Ser Ile Ser Lys Leu Asp Ser Gly Glu Tyr agt ttg aca tat gaa aca cca gaa gga gtg gtt tct ttg cag tgc aaa 1065 Ser Leu Thr Tyr Glu Thr Pro Glu Gly Val Val Ser Leu Gln Cars Lys act gtt gtc ctg acc att cct tcc tat gtt get agt aca ttg ctg cgt 1113 Thr Val Val Leu Thr Ile Pro Ser err Val Ala Ser Thr Leu Leu Arg cct ctg tct get get get gca gat gca ctt tca aag ttt tat tac cct 1161 Pro Leu Ser Ala Ala Ala Ala Asp Ala Leu Ser Lys Phe Tyr 'I~r Pro cca gtt get gca gtt tcc ata tcc tat cca aaa gaa get att aga tca 1209 Pro Val Ala Ala Val Ser Ile Ser 'I~r Pro Lys Glu Ala Ile Arg Ser gaa tgc ttg ata gat ggt gag ttg aag ggg ttt ggt caa ttg cat cca 1257 Glu Cys Leu Ile Asp Gly Glu Leu Lys Gly Phe Gly Gln Leu His Pro cgt agc caa gga gtg gaa aca tta gga act ata tac agc tca tca cta 1305 Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu ttc ccc aac cga gca cca cct gga agg gtt cta ctc ttg aat tac att 1353 Phe Pro Asn Arg Ala Pro Pro Gly Arg Val Leu Leu Leu Asn Tyr Ile gga gga gca act aat act gga att tta tcg aag acg gac agt gaa ctt 1401 Gly Gly Ala Thr Asn Thr Gly Ile Leu Ser Lys Thr Asp Ser Glu Leu gtg gaa aca gtt gat cga gat ttg agg aaa atc ctt ata aac cca aat 1449 Val Glu Thr Val Asp Arg Asp Leu Arg Lys Ile Leu Ile Asn Pro Asn gcc cag gat cca ttt gta gtg ggg gtg aga ctg tgg cct caa get att 1497 Ala Gln Asp Pro Phe Val Val Gly Val Arg Leu Trp Pro Gln Ala Ile cca cag.ttc tta gtt ggc cat ctt gat ctt cta gat gtt get aaa get 1545 Pro Gln Phe Leu Val Gly His Leu Asp Leu Leu Asp Val Ala Lys Ala tct atc aga aat act ggg ttt gaa ggg ctc ttc ctt ggg ggt aat tat 1593 Ser Ile Arg Asn Thr Gly Phe Glu Gly Leu Phe Leu Gly Gly Asn Tyr gtg tct ggt gtt gcc ttg gga cga tgc gtt gag gga gcc tat gag gta 1641 Val Ser Gly Val Ala Leu Gly Arg Cars Val Glu Gly Ala Tyr Glu Val gca get gaa gta aac gat ttt ctc aca aat aga gtg tac aaa 1683 Ala Ala Glu Val Asn Asp Phe Leu Thr Asn Arg Val Tyr Lys tagtagcagt ttttgttttt gtggtggaat gggtgatggg actctcgtgt tccattgaat 1743 tataataatg tgaaagtttc tcaaattcgt tcgataggtt tttggcggct tctattgctg 1803 ataatgtaaa atcctcttta agtttgaaaa aaaaaaaaaa aaaa 1847 <210> 12 <211> 543 <212> PRT
<213> Glycine mix <400> 12 Met Val Ser Val Phe Asn Glu Ile Leu Phe Pro Pro Asn Gln Thr Leu Leu Arg Pro Ser Leu His Ser Pro Thr Ser Phe Phe Thr Ser Pro Thr Arg Lys Phe Pro Arg Ser Arg Pro Asn Pro Ile Leu Arg Cars Ser Ile Ala Glu Glu Ser Thr Ala Ser Pro Pro Lys Thr Arg Asp Ser Ala Pro Val Asp C~5 Val Val Val Gly Gly Gly Val Ser Gly Leu Cars Ile Ala Gln Ala Leu Ala Thr Lys His Ala Asn Ala Asn Val Val Val Thr Glu Ala Arg Asp Arg Val Gly Gly Asn Ile Thr Thr Met Glu Arg Asp Gly Tyr Lsu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Met Leu Thr Met Val Val Asp Ser Gly Leu Lys Asp Glu Leu Val Leu Gly Asp Pro Asp Ala Pro Arg Phe Val Leu Trp Asn Arg Lys Leu Arg Pro Val Pro Gly Lys Leu Thr Asp Leu Pro Phe Phe Asp Leu Met Ser Ile Gly Gly Lys Ile Arg Ala Gly Phe Gly Ala Leu Gly Ile Arg Pro Pro Pro Pro Gly His Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly Asp Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cars Ser Gly Val err Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Lys Leu Glu Lys Asn Gly Gly Ser Ile Ile Gly Gly Thr Phe Lys Ala Ile Gln Glu Arg Asn Gly Ala Ser Lys Pro Pro Arg Asp Pro Arg Leu Pro Lys Pro Lys Gly Gln Thr Val Gly Ser Phe Arg Lys Gly Leu Thr Met Leu Pro Asp Ala Ile Ser Ala Arg Leu Gly Asn Lys Val Lys Leu Ser Trp Lys Leu Ser Ser Ile Ser Lys Leu Asp Ser Gly Glu Tyr Ser Leu Thr Tyr Glu Thr Pro Glu Gly Val Val Ser Leu Gln Cys Lys Thr Val Val Leu Thr Ile Pro Ser Tyr Val Ala Ser Z'hr Leu Leu Arg Pro Leu Ser Ala Ala Ala Ala Asp Ala Leu Ser Lys Phe Tyr 'I~rr Pro Pro Val Ala Ala Val Ser Ile Ser Tyr Pro Lys Glu Ala Ile Arg Ser Glu Cps Leu Ile Asp Gly Glu Leu Lys Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly 2"hr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Pro Gly Arg Val Leu Leu Leu Asn Tyr Ile Gly Gly Ala ~hr Asn Thr Gly Ile Leu Ser Lys Thr Asp Ser Glu Leu Val Glu Thr Val Asp Arg Asp Leu Arg Lys Ile Leu Ile Asn Pro Asn Ala Gln Asp Pro Phe Val Val Gly Val Arg Leu Trp Pro Gln Ala Ile Pro Gln Phe Leu Val Gly His Leu Asp Leu Leu Asp Val Ala Lys Ala Ser Ile Arg Asn Thr Gly Phe Glu Gly Leu Phe Leu Gly Gly Asn Tyr Val Ser Gly Val Ala Leu Gly Arg Cys Val Glu Gly Ala Tyr Glu Val Ala Ala Glu Val Asn Asp Phe Leu Thr Asn Arg Val Tyr Lys <210> 13 <211> 583 <212> L'~1A
<213> Arabidopsis thaliana <220>
<221> misc feature <222> (1)..(583) <223> Arabidopsis protox-1 promoter <400> 13 gaattccgat cgaattatat aattatcata aatttgaata agcatgttgc cttttattaa 60 agaggtttaa taaagtttgg taataatgga ctttgacttc aaactcgatt ctcatgtaat 120 taattaatat ttacatcaaa atttggtcac taatattacc aaattaatat actaaaatgt 180 taattcgcaa ataaaacact aattccaaat aaagggtcat tatgataaac acgtattgaa 240 cttgataaag caaagcaaaa ataatgggtt tcaaggtttg ggttatatat gacaaaaaaa 300 aaaaaaggtt tggttatata tctattgggc ctataaccat gttatacaaa tttgggccta 360 actaaaataa taaaataaac gtaatggtcc tttttatatt tgggtcaaac ccaactctaa 420 acccaaacca aagaaaaagt atacggtacg gtacacagac ttatggtgtg tgtgattgca 480 ggtgaatatt tctcgtcgtc ttctcctttc ttctgaagaa gattacccaa tctgaaaaaa 540 accaagaagc tgacaaaatt ccgaattctc tgcgatttcc atg 583 <210> 14 <211> 3848 <212> L~TP.
<213> Zea mays <220>
<221> misc feature <222> (1)..(3848) <223> maize protox-1 promoter <400> 14 tcgatctttc taggctgatc cccaaatctt cctccgaagc ccctggcgcc tctgcccctt 60 ggagctggtg gcctgaaaga gctttgctgt tgccccgaag attgtgaggt atattgtgac 120 ctctgagact gacttccttt gtcgtcactt tgagtggagt tatggattga cctgacgtgc 180 ctcagatgga ttcttcctcc gaagcccctg gtcatttcgg agaatctgta atcttattcc 240 cttctttggc gaaaatctgt cagcttggat gtactcatcc atcttctgaa gcagcttctc 300 cagagtttgt ggaggcttcc tggcgaaata ttgggctgta ggtcctggac gaagaccctt 360 gatcatggcc tcaatgacaa tctcattggg caccgtaggc gcttgtgccc tcaatcgcaa 420 gaaccttcgt acatatgcct gaaggtattc ttcgtgatct tgtgtgcatt ggaacagagc 480 ctgagctgtg accgacttcg tttgaaagcc ttggaagcta gtaaccaaca tgtgcttaag 540 cttctgccac gacgtgatag tccctggccg aagagaagaa taccatgttt gggctacatt 600 ccggactgcc atgacgaagg acttcgccat gactacagtg ttgaccccat acgaagatat 660 agttgcttcg tagctcatca gaaactgctt tggatctgag tgcccatcat acatggggag 720 ctgaggtggc ttgtatgatg ggggccatgg ggtagcctgc agttctgctg ccaagggaga 780 agcatcatca aaagtaaagg catcatgatt aaaatcatca taccatccat cctcgttgaa 840 taagccttct tgacgaagct ccctgtgttg gggccttcga tcttgttcat cttgaacaag 900 atgacgcact tcttcagtgg cttcgtcgat ctttctttgg agatcagcca gtcgcaccat 960 cttctccttc tttctttgta cttgttgatg gatgatctcc atgtccctga tctcttggtc 1020 caactcctcc tcttggagtg tcagactggt ggctttcctc ttctggcttc gagcctctcg 1080 aagagaaaga gtttcttgat ttgggtccag cggctgcagt gcagtggtcc ctggtgctga 1140 agctttcttc ggtggcatga caaaggtcag tgcttgccga aggtggtcga aaagggttca 1200 ctagaggtgg gagccaatgt tggggacttc tcaagtgcta tgagttaaga acaaggcaac 1260 acaaaatgtt aaatattaat agctttcatc tttcgaagca ttatttccct ttgggtataa 1320 tgatcttcag acgaaagagt ccttcatcat tgcgatatat gttaatagaa ggaggagcat 1380 atgaaatgta agagacaaca tgaacaatcg tgtagcattg ttaattcatc atcattttat 1440 tattatggaa aaatagaaac aatattgaat tacaaatgta cctttggctt gacagaagat 1500 aaaagtacaa gcttgacgca cgagcaagta caagtcagtg tgaacagtac gggggtactg 1560 ttcatctatt tataggcaca ggacacagcc tgtgagaaat tacagtcatg ccctttacat 1620 ttactattga cttatagaaa aatctatgag gactggatag ccttttcccc tttaagtcgg 1680 tgcctttttc cgcgattaag ccgaatctcc cttgcgcata gcttcggagc atcggcaacc 1740 ttcgtcacga tcatgccctt ctcattgtgt atgcttttaa tcctgaattc gaaggtacct 1800 gtccataaac catacttgga agacattgtt aaattatgtt tttgaggacc ttcggaggac 1860 gaaggccccc aacagtcgtg tttttgagga ccttcggaag atgaaggccc ccaacaagac 1920 ctatccataa aaccaaccta tccacaaaac cgaccccatt cacccttcat ttgcctcacc 1980 aacaacccta attaggttgt tggtttaaat tttttagggt caatttggtc atcaccatcc 2040 actgtcactc cacaaactca atatcaataa acagactcaa tcacccaaac tgaccatacc 2100 cataaaaccg ccccaccctt ctagcgcctc gccagaaacc agaaaccctg attcagagtt 2160 caaacttaaa acgaccataa ctttcacctt ggaactcgaa tcaggtccat ttttttccaa 2220 atcacacaaa attaaatttc gcatccgata atcaagccat ctcttcacta tggttttaag 2280 tgttgctcac actagtgtat ttatggacta atcacctgtg tatctcatac aataacatat 2340 cagtacatct aagttgttac tcaattacca aaaccgaatt atagccttcg aaaaaggtta 2400 tcgactagtc actcaattac caaaactaaa ctttagactt tcatgtatga catccaacat 2460 gacactgtac tggactaaac cacctttcaa gctacacaag gagcaaaaat aactaatttt 2520 cgtagttgta ggagctaaag tatatgtcca caacaatagt taagggaagc ccccaaggac 2580 ttaaaagtcc ttttacctct tgaaactttt gtcgtggtct actttttcac tttaaacttc 2640 aaaatttgac attttatcac cccttaactc ttaaaaccat ttaaattaca ttcttactag 2700 attatagatg attttgttgt gaaaagtttt taagacatgt ttacacattg attaaaatca 2760 tttgttcaat ttcctagagt taaatctaat cttattaaaa ctattagaga tactttcacg 2820 agctctaaat atttttattt tttcattatg gaattttgtt agaattctta tagacctttt 2880 tttgtggttt aaaagccttg ccatgttttt aacaagtttt ttttctattt tttgaaattt 2940 tcttggaaac cacttctaac ccggtagaag atttattttg ctacacttat atctacaaca 3000 aaatcaactt atgaaattgt cttggaaact acctctaacc cggtagaatg aatttgaatg 3060 aaaattaaac caacttacgg aatcgcccaa catatgtcga ttaaagtgga tatggataca 3120 tatgaagaag ccctagagat aatctaaatg gtttcagaat tgagggttat tttttgaagt 3180 ttgatgggaa gataagacca taacggtagt tcacagagat aaaagggtta tttttttcag 3240 aaatatttgt gctgcaattg atcctgtgcc tcaaattcag cctgcaacca aggccaggtt 3300 ctagagcgaa caaggcccac gtcacccgtg gcccgtcagg cgaagcaggt cttgtgcaga 3360 ctttgagagg gattggatat caacggaacc aatcacgcac ggcaatgcga ttcccagccc 3420 acctgtaacg ttccagtggg ccatccttaa ctccaagccc aacggcccta ccccatctcg 3480 tcgtgtcatc cactccgccg cacaggcgct cagctccgca acgccgccgg aaatggtcgc 3540 cgccacagcc accgccatgg ccaccgctgc atcgccgcta ctcaacggga cccgaatacc 3600 tgcgcggctc cgccatcgag gactcagcgt gcgctgcgct gctgtggcgg gcggcgcggc 3660 cgaggcaccg gcatccaccg gcgcgcggct gtccgcggac tgcgttgtgg tgggcggagg 3720 catcagtggc ctctgcaccg cgcaggcgct ggccacgcgg cacggcgtcg gggacgtgct 3780 tgtcacggag gcccgcgccc gccccggcgg caacattacc accgtcgagc gccccgagga 3840 agggtacc 3848 <210> 15 <211> 1826 <212> LTA
<213> Gossypiiun hirsutiun <220>
<221> CDS
<222> (31)..(1647) <223> cotton protox-1 coding sequence <400> 15 cctctcgctc gcctggcccc accaccaatc atg acg get cta atc gac ctt tct 54 Met Thr Ala Leu Ile Asp Leu Ser ctt ctc cgt tcc tcg ccc tcc gtt tcc cct ttc tcc ata ccc cac cac 102 Leu Leu Arg Ser Ser Pro Ser Val Ser Pro Phe Ser Ile Pro His His cag cat ccg ccc cgc ttt cgt aaa cct ttc aag ctc cga tgc tcc ctc 150 Gln His Pro Pro Arg Phe Arg Lys Pro Phe Lys Lsu Arg Cps Ser Leu gcc gag ggt ccc acg att tcc tca tct aaa atc gac ggg gga gaa tca 198 Ala Glu Gly Pro Thr Ile Ser Ser Ser Lys Ile Asp Gly Gly Glu Ser tcc atc gcg gat tgc gtc atc gtt gga ggt ggt atc agt gga ctt tgc 246 Ser Ile Ala Asp Cars Val Ile Val Gly Gly Gly Ile Ser Gly 1xu Gds att get caa get ctc gcc acc aag cac cgt gac gtc get tcc aat gtg 294 Ile Ala Gln Ala Leu Ala Thr Lys His Arg Asp Val Ala Ser Asn Val att gtg acg gag gcc aga gac cgt gtt ggt ggc aac atc act acc gtt 342 Ile Val Thr Glu Ala Arg Asp Arg Val Gly Gly Asn Ile 'rhr Thr Val gag aga gat gga tat ctg tgg gaa gaa ggc ccc aac agt ttt cag ccc 390 Glu Arg Asp Gly Tyr Isu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro tcc gat cct att cta acc atg gcc gtg gat agt gga ttg aag gac gat 438 Ser Asp Pro Ile Leu 'I2~r Met Ala Val Asp Ser Gly Leu Lys Asp Asp ttg gtt tta ggt gac cct aat gca ccg cga ttt gta cta tgg gag gga 486 Leu Val Leu Gly Asp Pro Asn Ala Pro Arg Phe Val Leu Trp Glu Gly aaa cta agg cct gtg ccc tcc aag cca acc gac ttg ccg ttt ttt gat 534 Lys Lsu Arg Pro Val Pro Ser Lys Pro Thr Asp Leu Pro Phe Phe Asp ttg atg agc att get gga aaa ctt agg get ggg ttc ggg get att ggc 582 Leu Met Ser Ile Ala Gly Lys Leu Arg Ala Gly Phe Gly Ala Ile Gly att cgg cct ccc cct ccg ggt tat gaa gaa tcg gtg gag gag ttt gtg 630 Ile Arg Pro Pro Pro Pro Gly Tyr Glu Glu Ser Val Glu Glu Phe Val cgc cgt aat ctt ggt get gag gtt ttt gaa cgc ttt att gaa cca ttt 678 Arg Arg Asn Leu Gly Ala Glu Val Phe Glu Arg Phe Ile Glu Pro Phe tgt tca ggt gtt tat gca ggg gat cct tca aaa tta agc atg aaa gca 726 Gds Ser Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala gca ttt gga aga gta tgg aag cta gaa gag att ggt ggc agc atc att 774 Ala Phe Gly Arg Val Trp Lys Leu Glu Glu Ile Gly Gly Ser Ile Ile ggt ggc act ttc aag aca atc cag gag aga aat aag aca cct aag cca 822 Gly Gly Thr Phe Lys Thr Ile Gln Glu Arg Asn Lys Thr Pro Lys Pro ccc aga gac ccg cgt ctg cca aaa ccg aag ggc caa aca gtt gga tct 870 Pro Arg Asp Pro Arg Leu Pro Lys Pro Lys Gly Gln Thr Val Gly Ser ttt agg aag gga ctt acc atg ctg cct gag gca att get aac agt ttg 918 Phe Arg Lys Gly Leu Thr Met Leu Pro Glu Ala Ile Ala Asn Ser Leu ggt agc aat gta aaa tta tct tgg aag ctt tcc agt att acc aaa ttg 966 Gly Ser Asn Val Lys Leu Ser Trp Lys Leu Ser Ser Ile Thr Lys Leu ggc aat gga ggg tat aac ttg aca ttt gaa aca cct gaa gga atg gta 1014 Gly Asn Gly Gly Tyr Asn Leu Thr Phe Glu Thr Pro Glu Gly Met Val tct ctt cag agt aga agt gtt gta atg acc att cca tcc cat gtt gcc 1062 Ser Leu Gln Ser Arg Ser Val Val Met Thr Ile Pro Ser His Val Ala agt aac ttg ttg cat cct ctc tcg get get get gca gat gca tta tcc 1110 Ser Asn Leu Leu His Pro Leu Ser Ala Ala Ala Ala Asp Ala Leu Ser caa ttt tat tat cct cca gtt gca tca gtc aca gtc tcc tat cca aaa 1158 Gln Phe Tyr Tyr Pro Pro Val Ala Ser Val Thr Val Ser Tyr Pro Lys gaa gcc att cga aaa gaa tgt ttg att gat ggt gaa ctt aag ggg ttt 1206 Glu Ala Ile Arg Lys Glu Cps Leu Ile Asp Gly Glu Leu Lys Gly Phe ggc cag ttg cac cca cgc agc caa gga att gaa act tta ggg acg ata 1254 Gly Gln Leu His Pro Arg Ser Gln Gly Ile Glu Thr Leu Gly Thr Ile tac agt tca tca ctt ttc ccc aat cga get cca tct ggc agg gtg ttg 1302 Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Ser Gly Arg Val Leu ctc ttg aac tac ata gga gga get acc aac act gga att ttg tcc aag 1350 Leu Leu Asn Tyr Ile Gly Gly Ala Thr Asn Thr Gly Ile Leu Ser Lys act gaa ggg gaa ctt gta gaa gca gtt gat cgt gat ttg aga aaa atg 1398 Thr Glu Gly Glu L~eu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met ctt ata aat cct aat gca aag gat cct ctt gtt ttg ggt gta aga gta 1446 Leu Ile Asn Pro Asn Ala Lys Asp Pro Leu Val Lsu Gly Val Arg Val tgg cca aaa gcc att cca cag ttc ttg gtt ggt cat ttg gat ctc ctt 1494 Trp Pro Lys Ala Ile Pro Gln Phe Leu Val Gly His Leu Asp Leu L~eu gat agt gca aaa atg get ctc agg gat tct ggg ttt cat gga ctg ttt 1542 Asp Ser Ala Lys Met Ala Leu Arg Asp Ser Gly Phe His Gly Leu Phe ctt ggg ggc aac tat gta tct ggt gtg gca tta gga cgg tgt gtg gaa 1590 Leu Gly Gly Asn Tyr Val Ser Gly Val Ala Leu Gly Arg Cars Val Glu ggt get tac gag gtt gca get gaa gtg aag gaa ttc ctg tca caa tat 1638 Gly Ala Tyr Glu Val Ala Ala Glu Val Lys Glu Phe Leu Ser Gln Tyr gca tac aaa taatattgaa attcttgtca ggctgcaaat gtagaagtca 1687 Ala Tyr Lys gttattggat agtatctctt tagctaaaaa attgggtagg gttttttttg ttagttcctt 1747 gaccactttt tggggttttc attagaactt catatttgta tatcatgttg caatatcaaa 1807 aaaaaaaaaa aaaaaaaaa 1826 <210> 16 <211> 539 <212> PRT
<213> Gossypium hirsutum <400> 16 Met Thr Ala Leu Ile Asp Leu Ser Leu Leu Arg Ser Ser Pro Ser Val Ser Pro Phe Ser Ile Pro His His Gln His Pro Pro Arg Phe Arg Lys Pro Phe Lys Leu Arg Cys Ser Leu Ala Glu Gly Pro Thr Ile Ser Ser Ser Lys Ile Asp Gly Gly Glu Ser Ser Ile Ala Asp Gars Val Ile Val Gly Gly Gly Ile Ser Gly Leu Cars Ile Ala Gln Ala Leu Ala Thr Lys His Arg Asp Val Ala Ser Asn Val Ile Val Thr Glu Ala Arg Asp Arg Val Gly Gly Asn Ile Thr Thr Val Glu Arg Asp Gly Tyr Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Ile Leu Thr Met Ala Val Asp Ser Gly Leu Lys Asp Asp Leu Val Leu Gly Asp Pro Asn Ala Pro Arg Phe Val Leu 'I'rp Glu Gly Lys Leu Arg Pro Val Pro Ser Lys Pro Thr Asp Leu Pro Phe Phe Asp Leu Met Ser Ile Ala Gly Lys Leu Arg Ala Gly Phe Gly Ala Ile Gly Ile Arg Pro Pro Pro Pro Gly Tyr Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly Ala Glu Val Phe Glu Arg Phe Ile Glu Pro Phe Cars Ser Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe Gly Arg Val Trp Lys Leu Glu Glu Ile Gly Gly Ser Ile Ile Gly Gly Thr Phe Lys Thr Ile Gln Glu Arg Asn Lys Thr Pro Lys Pro Pro Arg Asp Pro Arg Leu Pro Lys Pro Lys Gly Gln Thr Val Gly Ser Phe Arg Lys Gly Leu 'rhr Met Leu Pro Glu Ala Ile Ala Asn Ser Leu Gly Ser Asn Val Lys L~etz Ser '1'rp Lys Leu Ser Ser Ile Thr Lys Leu Gly Asn Gly Gly Tyr Asn Leu Thr Phe Glu Thr Pro Glu Gly Met Val Ser Leu Gln Ser Arg Ser Val Val Met Thr Ile Pro Ser His Val Ala Ser Asn Leu Leu His Pro Leu Ser Ala Ala Ala Ala Asp Ala Leu Ser Gln Phe Tyr Tyr Pro Pro Val Ala Ser Val Thr Val Ser Tyr Pro Lys Glu Ala Ile Arg Lys Glu Cars Leu Ile Asp Gly Glu Leu Lys Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Ile Glu Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Ser Gly Arg Val Leu Leu Leu Asn 'I~rr Ile Gly Gly Ala Thr Asn Thr Gly Ile Leu Ser Lys ~'hr Glu Gly Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Asn Pro Asn Ala Lys Asp Pro Leu Val Leu Gly Val Arg Val Trp Pro Lys Ala Ile Pro Gln Phe Leu Val Gly His Leu Asp Leu Leu Asp Ser Ala Lys Met Ala Leu Arg Asp Ser Gly Phe His Gly Leu Phe Leu Gly Gly Asn Tyr Val Ser Gly Val Ala Leu Gly Arg Cps Val Glu Gly Ala Tyr Glu Val Ala Ala Glu Val Lys Glu Phe L'eu Ser Gln Tyr Ala Tyr Lys <210> 17 <211> 1910 <212> I~iA
<213> Beta vulgaris <220>
<221> CDS
<222> (1)..(1680) <223> sugar beet protox-1 coding sequence <400> 17 atg aaa tca atg gcg tta tca aac tgc att cca cag aca cag tgc atg 48 Met Lys Ser Met Ala Leu Ser Asn Cps Ile Pro Gln Thr Gln Cars Met cca ttg cgc agc agc ggg cat tac agg ggt aat tgt atc atg ttg tca 96 Pro Leu Arg Ser Ser Gly His Tyr Arg Gly Asn Cps Ile Met Leu Ser att cca tgt agt tta att gga aga cga ggt tat tat tca cat aag aag 144 Ile Pro Cars Ser Leu Ile Gly Arg Arg Gly Tyr Tyr Ser His Lys Lys agg agg atg agc atg agt tgc agc aca agc tca ggc tca aag tca gcg 192 Arg Arg Met Ser Met Ser Cars Ser Thr Ser Ser Gly Ser Lys Ser Ala gtt aaa gaa gca gga tca gga tca ggt gca gga gga ttg cta gac tgc 240 Val Lys Glu Ala Gly Ser Gly Ser Gly Ala Gly Gly Leu Leu Asp Cps gta atc gtt gga ggt gga att agc ggg ctt tgc.atc gcg cag get ctt 288 Val Ile Val Gly Gly Gly Ile Ser Gly Leu Cys Ile Ala Gln Ala Leu tgt aca aaa cac tcc tct tcc tct tta tcc cca aat ttt ata gtt aca 336 Cys Thr Lys His Ser Ser Ser Ser Leu Ser Pro Asn Phe Ile Val Thr gag gcc aaa gac aga gtt ggc ggc aac atc gtc act gtg gag gcc gat 384 Glu Ala Lys Asp Arg Val Gly Gly Asn Ile Val Thr Val Glu Ala Asp ggc tat atc tgg gag gag gga ccc aat agc ttc cag cct tcc gac gcg 432 Gly Tyr Ile Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Ala gtg ctc acc atg gcg gtc gac agt ggc ttg aaa gat gag ttg gtg ctc 480 Val Leu Thr Met Ala Val Asp Ser Gly Leu Lys Asp Glu Leu Val Leu gga gat ccc aat get cct cgc ttt gtg cta tgg aat gac aaa tta agg 528 Gly Asp Pro Asn Ala Pro Arg Phe Val Leu Trp Asn Asp Lys Leu Arg ccc gta cct tcc agt ctc acc gac ctc cct ttc ttc gac ctc atg acc 576 Pro Val Pro Ser Ser Lreu Thr Asp Leu Pro Phe Phe Asp L~eu Met Thr att ccg ggc aag att agg get get ctt ggt get ctc gga ttt cgc cct 624 Ile Pro Gly Lys Ile Arg Ala Ala Leu Gly Ala Leu Gly Phe Arg Pro tct cct cca cct cat gag gaa tct gtt gaa cac ttt gtg cgt cgt aat 672 Ser Pro Pro Pro His Glu Glu Ser Val Glu His Phe Val Arg Arg Asn ctc gga gat gag gtc ttt gaa cgc ttg att gaa ccc ttt tgt tca ggt 720 Leu Gly Asp Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cars Ser Gly gtg tat gcc ggt gat cct gcc aag ctg agt atg aaa get get ttt ggg 768 Val Tyr Ala Gly Asp Pro Ala Lys Leu Ser Met Lys Ala Ala Phe Gly aag gtc tgg aag ttg gag caa aag ggt ggc agc ata att ggt ggc act 816 Lys Val Trp Lys Leu Glu Gln Lys Gly Gly Ser Ile Ile Gly Gly Thr ctc aaa get ata cag gaa aga ggg agt aat cct aag ccg ccc cgt gac 864 Leu Lys Ala Ile Gln Glu Arg Gly Ser Asn Pro Lys Pro Pro Arg Asp cag cgc ctc cct aaa cca aag ggt cag act gtt gga tcc ttt aga aag 912 Gln Arg L~eu Pro Lys Pro Lys Gly Gln Thr Val Gly Ser Phe Arg Lys gga ctc gtt atg ttg cct acc gcc att tct get cga ctt ggc agt aga 960 Gly Leu Val Met Leu Pro Thr Ala Ile Ser Ala Arg Leu Gly Ser Arg gtg aaa cta tct tgg acc ctt tct agt atc gta aag tca ctc aat gga 1008 Val Lys Leu Ser Trp Thr Leu Ser Ser Ile Val Lys Ser Leu Asn Gly gaa tat agt ctg act tat gat acc cca gat ggc ttg gtt tct gta aga 1056 Glu Tyr Ser Leu 'rhr Tyr Asp Thr Pro Asp Gly Leu Val Ser Val Arg acc aaa agt gtt gtg atg act gtt cca tca tat gtt gca agt agg ctt 1104 'I'hr Lys Ser Val Val Met Thr Val Pro Ser Tyr Val Ala Ser Arg Leu ctt cgt cca ctt tca gac tct get gca gat tct ctt tca aaa ttt tac 1152 Leu Arg Pro Leu Ser Asp Ser Ala Ala Asp Ser Leu Ser Lys Phe Tyr tat cca cca gtt gca gca gtg tca ctt tcc tat cct aaa gaa gcg atc 1200 Tyr Pro Pro Val Ala Ala Val Ser Isu Ser Tyr Pro Lys Glu Ala Ile aga tca gaa tgc ttg att aat ggt gaa ctt caa ggt ttc ggg caa cta 1248 Arg Ser Glu Cys Leu Ile Asn Gly Glu Leu Gln Gly Phe Gly Gln Leu cat ccc cgc agt cag ggt gtg gaa acc ttg gga aca att tat agt tcg 1296 His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser Ser tct ctt ttc cct ggt cga gca cca cct ggt agg atc ttg atc ttg agc 1344 Ser Leu Phe Pro Gly Arg Ala Pro Pro Gly Arg Ile Leu Ile Leu Ser tac atc gga ggt get aaa aat cct ggc ata tta aac aag tcg aaa gat 1392 Tyr Ile Gly Gly Ala Lys Asn Pro Gly Ile L~eu Asn Lys Ser Lys Asp gaa ctt gcc aag aca gtt gac aag gac ctg aga aga atg ctt ata aat 1440 Glu Leu Ala Lys Thr Val Asp Lys Asp Leu Arg Arg Met Leu Ile Asn cct gat gca aaa ctt cct cgt gta ctg ggt gtg aga gta tgg cct caa 1488 Pro Asp Ala Lys Leu Pro Arg Val Leu Gly Val Arg Val Trp Pro Gln gca ata ccc cag ttt tct att ggg cac ttt gat ctg ctc gat get gca 1536 Ala Ile Pro Gln Phe Ser Ile Gly His Phe Asp Leu Leu Asp Ala Ala aaa get get ctg aca gat aca ggg gtc aaa gga ctg ttt ctt ggt ggc 1584 Lys Ala Ala Leu Thr Asp Thr Gly Val Lys Gly Leu Phe Leu Gly Gly aac tat gtt tca ggt gtt gcc ttg ggg cgg tgt ata gag ggt get tat 1632 Asn Tyr Val Ser Gly Val Ala Leu Gly Arg Cars Ile Glu Gly Ala Tyr gag tct gca get gag gta gta gat ttc ctc tca cag tac tca gac aaa 1680 Glu Ser Ala Ala Glu Val Val Asp Phe Leu Ser Gln Tyr Ser Asp Lys tagagcttca gcatcctgtg taattcaaca caggcctttt tgtatctgtt gtgcgcgcat 1740 gtagtctggt cgtggtgcta ggattgatta gttgctctgc tgtgtgatcc acaagaattt 1800 tgatggaatt tttccagatg tgggcattat atgttgctgt cttataaatc cttaatttgt 1860 acgtttagtg aattacaccg catttgatga ctaaaaaaaa aaaaaaaaaa 1910 <210> 18 <211> 560 <212> PRT
<213> Beta vulgaris <400> 18 Met Lys Ser Met Ala Leu Ser Asn Cps Ile Pro Gln Thr Gln Cps Met Pro Leu Arg Ser Ser Gly His Tyr Arg Gly Asn Gds Ile Met Leu Ser Ile Pro Cars Ser Leu Ile Gly Arg Arg Gly Tyr Tyr Ser His Lys Lys Arg Arg Met Ser Met Ser Cps Ser Thr Ser Ser Gly Ser Lys Ser Ala Val Lys Glu Ala Gly,Ser Gly Ser Gly Ala Gly Gly Leu Leu Asp Cars Val Ile Val Gly Gly Gly Ile Ser Gly Leu Cps Ile Ala Gln Ala Leu Cps Thr Lys His Ser Ser Ser Ser Leu Ser Pro Asn Phe Ile Val 'I'hr Glu Ala Lys Asp Arg Val Gly Gly Asn Ile Val Thr Val Glu Ala Asp Gly Tyr Ile Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Ala Val Leu Thr Met Ala Val Asp Ser Gly Leu Lys Asp Glu Leu Val Leu Gly Asp Pro Asn Ala Pro Arg Phe Val Leu Trp Asn Asp Lys Lieu Arg Pro Val Pro Ser Ser Leu Thr Asp Leu Pro Phe Phe Asp Lieu Met 'rhr Ile Pro Gly Lys Ile Arg Ala Ala Leu Gly Ala Leu Gly Phe Arg Pro Ser Pro Pro Pro His Glu Glu Ser Val Glu His Phe Val Arg Arg Asn Leu Gly Asp Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cps Ser Gly Val err Ala Gly Asp Pro Ala Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Lys Leu Glu Gln Lys Gly Gly Ser Ile Ile Gly Gly Thr Leu Lys Ala Ile Gln Glu Arg Gly Ser Asn Pro Lys Pro Pro Arg Asp Gln Arg Leu Pro Lys Pro Lys Gly Gln Thr Val Gly Ser Phe Arg Lys Gly Leu Val Met Leu Pro Thr Ala Ile Ser Ala Arg Leu Gly Ser Arg Val Lys Leu Ser Trp Thr Leu Ser Ser Ile Val Lys Ser Leu Asn Gly Glu Tyr Ser Leu Thr 'I~r Asp Thr Pro Asp Gly Leu Val Ser Val Arg Thr Lys Ser Val Val Met 'I'hr Val Pro Ser Tyr Val Ala Ser Arg Leu Leu Arg Pro Leu Ser Asp Ser Ala Ala Asp Ser Leu Ser Lys Phe Tyr Tyr Pro Pro Val Ala Ala Val Ser Leu Ser Tyr Pro Lys Glu Ala Ile Arg Ser Glu Cars L~eu Ile Asn Gly Glu Leu Gln Gly Phe Gly Gln Lreu Isis Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu Phe Pro Gly Arg Ala Pro Pro Gly Arg Ile Leu Ile Leu Ser Tyr Ile Gly Gly Ala Lys Asn Pro Gly Ile Leu Asn Lys Ser Lys Asp Glu Leu Ala Lys Thr Val Asp Lys Asp Leu Arg Arg Met Leu Ile Asn Pro Asp Ala Lys Leu Pro Arg Val Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Ser Ile Gly His Phe Asp Leu Leu Asp Ala Ala Lys Ala Ala Leu Thr Asp Thr Gly Val Lys Gly Leu Phe Leu Gly Gly Asn Tyr Val Ser Gly Val Ala Leu Gly Arg Cars Ile Glu Gly Ala Tyr Glu Ser Ala Ala Glu Val Val Asp Phe Leu Ser Gln Tyr Ser Asp Lys <210> 19 <211> 1784 <212> I~VA
<213> Brassica napes <220>
<221> CDS
<222> (47)..(1654) <223> Oilseed rape protox-1 coding sequence <400> 19 gggccccccc caaaattgag gattctcctt ctcgcgggcg atcgcc atg gat tta 55 Met Asp Leu tct ctt ctc cgt ccg cag cca ttc cta tcg cca ttc tca aat cca ttt 103 Ser Leu Leu Arg Pro Gln Pro Phe Leu Ser Pro Phe Ser Asn Pro Phe cct cgg tcg cgt ccc tac aag cct ctc aac ctc cgt tgc tcc gta tcc 151 Pro Arg Ser Arg Pro Tyr Lys Pro Leu Asn Leu Arg Cars Ser Val Ser ggt gga tcc gtc gtc ggc tct tct aca atc gaa ggc gga gga gga ggt 199 Gly Gly Ser Val Val Gly Ser Ser Thr Ile Glu Gly Gly Gly Gly Gly aaa acc gtc acg gcg gac tgc gtg atc gtc ggc gga gga atc agc ggc 247 Lys Thr Val Thr Ala Asp Cars Val Ile Val Gly Gly Gly Ile Ser Gly ctg tgc att gcg caa gcg ctc gtg acg aag cac cca gac get gca aag 295 Leu Cps Ile Ala Gln Ala Leu Val Thr Lys His Pro Asp Ala Ala Lys aat gtg atg gtg acg gag gcg aag gac cgt gtg gga ggg aat atc atc 343 Asn Val Met Val Thr Glu Ala Lys Asp Arg Val Gly Gly Asn Ile Ile acg cga gag gag caa ggg ttt cta tgg gaa gaa ggt ccc aat agc ttt 391 Thr Arg Glu Glu Gln Gly Phe Leu Trp Glu Glu Gly Pro Asn Ser Phe cag ccg tct gat cct atg ctc act atg gtg gta gat agt ggt ttg aaa 439 Gln Pro Ser Asp Pro Met Leu Thr Met Val Val Asp Ser Gly Leu Lys gat gat cta gtc ttg gga gat cct act get ccg agg ttt gtg ttg tgg 487 Asp Asp Leu Val Leu Gly Asp Pro Thr Ala Pro Arg Phe Val Leu '1'rp aat ggg aag ctg agg ccg gtt ccg tcg aag cta act gac ttg cct ttc 535 Asn Gly Lys Leu Arg Pro Val Pro Ser Lys Leu Thr Asp Leu Pro Phe ttt gac ttg atg agt att gga ggg aag att aga get ggg ttt ggt gcc 583 Phe Asp Leu Met Ser Ile Gly Gly Lys Ile Arg Ala Gly Phe Gly Ala att ggt att cga cct tca cct ccg ggt cgt gag gaa tca gtg gaa gag 631 Ile Gly Ile Arg Pro Ser Pro Pro Gly Arg Glu Glu Ser Val Glu Glu ttt gta agg cgt aat ctt ggt gat gag gtt ttt gag cgc ttg att gaa 679 Phe Val Arg Arg Asn Leu Gly Asp Glu Val Phe Glu Arg Leu Ile Glu ccc ttt tgc tca ggt gtt tat gcg gga gat cct gcg aaa ctg agt atg 727 Pro Phe Cps Ser Gly Val 'I~r Ala Gly Asp Pro Ala Lys Leu Ser Met aaa gca get ttt ggg aag gtt tgg aag cta gag gag aat ggt ggg agc 775 Lys Ala Ala Phe Gly Lys Val Trp Lys Leu Glu Glu Asn Gly Gly Ser atc att ggt ggt get ttt aag gca att caa gcg aaa aat aaa get ccc 823 Ile Ile Gly Gly Ala Phe Lys Ala Ile Gln Ala Lys Asn Lys Ala Pro aag aca acc cga gat ccg cgt ctg cca aag cca aag ggc caa act gtt 871 Lys Thr Thr Arg Asp Pro Arg Leu Pro Lys Pro Lys Gly Gln Thr Val ggt tct ttc agg aaa gga ctc aca atg ctg cca gag gca atc tcc gca 919 Gly Ser Phe Arg Lys Gly Leu Thr Met Leu Pro Glu Ala Ile Ser Ala agg ttg ggt gac aag gtg aaa gtt tct tgg aag ctc tca agt atc act 967 Arg Leu Gly Asp Lys Val Lys Val Ser Trp Lys Leu Ser Ser Ile Thr aag ctg gcc agc gga gaa tat agc tta act tac gaa act ccg gag ggt 1015 Lys Leu Ala Ser Gly Glu Tyr Ser Leu Thr Tyr Glu Thr Pro Glu Gly ata gtc act gta cag agc aaa agt gta gtg atg act gtg cca tct cat 1063 Ile Val Thr Val Gln Ser Lys Ser Val Val Met Thr Val Pro Ser His gtt get agt agt ctc ttg cgc cct ctc tct gat tct gca get gaa gcg 1111 Val Ala Ser Ser Leu Leu Arg Pro Leu Ser Asp Ser Ala Ala Glu Ala ctc tca aaa ctc tac tat ccg cca gtt gca gcc gta tcc atc tca tac 1159 Leu Ser Lys Leu 'I~r Tyr Pro Pro Val Ala Ala Val Ser Ile Ser Tyr gcg aaa gaa gca atc cga agc gaa tgc tta ata gat ggt gaa cta aaa 1207 Ala Lys Glu Ala Ile Arg Ser Glu Cars Leu Ile Asp Gly Glu Leu Lys ggg ttc ggc cag ttg cat cca cgc acg caa aaa gtg gaa act ctt gga 1255 Gly Phe Gly Gln Leu His Pro Arg Thr Gln Lys Val Glu Thr L~eu Gly aca ata tac agt tca tcg ctc ttt ccc aac cga gca ccg cct gga aga 1303 Thr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Pro Gly Arg gta ttg cta ttg aac tac atc ggt gga get acc aac act ggg atc tta 1351 Val Leu Leu Leu Asn Tyr Ile Gly Gly Ala Thr Asn Thr Gly Ile Leu tca aag tcg gaa ggt gag tta gtg gaa gca gta gat aga gac ttg agg 1399 Ser Lys Ser Glu Gly Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg aag atg ctg ata aag cca agc tcg acc gat cca ctt gta ctt gga gta 1447 Lys Met Leu Ile Lys Pro Ser Ser Thr Asp Pro Leu Val Leu Gly Val aaa tta tgg cct caa gcc att cct cag ttt ctg ata ggt cac att gat 1495 Lys Leu Trp Pro Gln Ala Ile Pro Gln Phe Leu Ile Gly His Ile Asp ttg gta gac gca gcg aaa gca tcg ctc tcg tca tct ggt cat gag ggc 1543 Leu Val Asp Ala Ala Lys Ala Ser Leu Ser Ser Ser Gly His Glu Gly tta ttc ttg ggt gga aat tac gtt gcc ggt gta gca ttg ggt cgg tgt 1591 Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cys gtg gaa ggt get tat gaa act gca acc caa gtg aat gat ttc atg tca 1639 Val Glu Gly Ala Tyr Glu Thr Ala Thr Gln Val Asn Asp Phe Met Ser agg tat get tac aag taatgtaacg cagcaacgat ttgatactaa gtagtagatt 1694 Arg Tyr Ala Tyr Lys ttgcagtttt gactttaaga acactctgtt tgtgaaaaat tcaagtctgt gattgagtaa 1754 atttatgtat tattactaaa aaaaaaaaaa 1784 <210> 20 <211> 536 <212> PRT
<213> Brassica napes <400> 20 Met Asp Leu Ser Leu Leu Arg Pro Gln Pro Phe Leu Ser Pro Phe Ser Asn Pro Phe Pro Arg Ser Arg Pro Tyr Lys Pro Leu Asn Leu Arg Cps Ser Val Ser Gly Gly Ser Val Val Gly Ser Ser Thr Ile Glu Gly Gly Gly Gly Gly Lys Thr Val Thr Ala Asp Cars Val Ile Val Gly Gly Gly Ile Ser Gly Leu Cars Ile Ala Gln Ala Leu Val Z'hr Lys His Pro Asp Ala Ala Lys Asn Val Met Val Thr Glu Ala Lys Asp Arg Val Gly Gly Asn Ile Ile Thr Arg Glu Glu Gln Gly Phe Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Met Leu Thr Met Val Val Asp Ser Gly Leu Lys Asp Asp Leu Val Lee Gly Asp Pro Thr Ala Pro Arg Phe Val Leu Trp Asn Gly Lys Leu Arg Pro Val Pro Ser Lys Leu Thr Asp Leu Pro Phe Phe Asp Leu Met Ser Ile Gly Gly Lys Ile Arg Ala Gly Phe Gly Ala Ile Gly Ile Arg Pro Ser Pro Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly Asp Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cars Ser Gly Val Tyr Ala Gly Asp Pro Ala Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Lys Leu Glu Glu Asn Gly Gly Ser Ile Ile Gly Gly Ala Phe Lys Ala Ile Gln Ala Lys Asn Lys Ala Pro Lys Thr Thr Arg Asp pro Arg Leu pro Lys Pro Lys Gly Gln Thr Val Gly Ser Phe Arg Lys Gly Leu Thr Met Leu Pro Glu Ala Ile Ser Ala Arg Leu Gly Asp Lys Val Lys Val Ser Trp Lys Leu Ser Ser Ile Z'hr Lys Leu Ala Ser Gly Glu Tyr Ser Leu Thr Tyr Glu Thr Pro Glu Gly Ile Val Thr Val Gln Ser Lys Ser Val Val Met Thr Val Pro Ser His Val Ala Ser Ser Leu Leu Arg Pro Leu Ser Asp Ser Ala Ala Glu Ala Leu Ser Lys Leu Tyr Tyr pro pro Val Ala Ala Val Ser Ile Ser Tyr Ala Lys Glu Ala Ile Arg Ser Glu Cars Leu Ile Asp Gly Glu Leu Lys Gly Phe Gly Gln Leu His Pro Arg Thr Gln Lys Val Glu Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Pro Gly Arg Val Leu Leu Leu Asn Tyr Ile Gly Gly Ala Thr Asn Thr Gly Ile Leu Ser Lys Ser Glu Gly Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Lys Pro Ser Ser Thr Asp Pro Leu Val Leu Gly Val Lys Leu Tzp Pro Gln Ala Ile Pro Gln Phe Leu Ile Gly His Ile Asp Leu Val Asp Ala Ala Lys Ala Ser Leu Ser Ser Ser Gly His Glu Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Gars Val Glu Gly Ala Tyr Glu Thr Ala Thr Gln Val Asn Asp Phe Met Ser Arg Tyr Ala err Lys <210> 21 <211> 1224 <212> L~1 <213> Oryza sativa <220>
<221> CDS
<222> (1)..(936) <223> rice protox-1 partial coding sequence <400> 21 cgg get ttg aag get gca ttt ggg aag gtg tgg agg ctg gag gat act 48 Arg Ala Leu Lys Ala Ala Phe Gly Lys Val Trp Arg Leu Glu Asp Thr 1 ~ 5 10 15 gga ggt agc att att ggt gga acc atc aag aca atc cag gag agg ggg 96 Gly Gly Ser Ile Ile Gly Gly Thr Ile Lys Z'hr Ile Gln Glu Arg Gly aaa aac ccc aaa ccg ccg agg gat ccc cgc ctt cca acg cca aag ggg 144 Lys Asn Pro Lys Pro Pro Arg Asp Pro Arg Leu Pro Thr Pro Lys Gly cag aca gtt gca tct ttc agg aag ggt ctg act atg ctc ccg gat get 192 Gln Thr Val Ala Ser Phe Arg Lys Gly Leu 1'hr Met Leu Pro Asp Ala att aca tct agg ttg ggt agc aaa gtc aaa ctt tca tgg aag ttg aca 240 Ile Thr Ser Arg Leu Gly Ser Lys Val Lys Leu Ser Trp Lys Leu Thr agc att aca aag tca gac aac aaa gga tat gca tta gtg tat gaa aca 288 Ser Ile Thr Lys Ser Asp Asn Lys Gly Tyr Ala Leu Val Tyr Glu Thr cca gaa ggg gtg gtc tcg gtg caa get aaa act gtt gtc atg acc atc 336 Pro Glu Gly Val Val Ser Val Gln Ala Lys Thr Val Val Met Thr Ile cca tca tat gtt get agt gat atc ttg cgg cca ctt tca agt gat gca 384 Pro Ser 'I~r Val Ala Ser Asp Ile Leu Arg Pro Leu Ser Ser Asp Ala gca gat get ctg tca ata ttc tat tat cca cca gtt get get gta act 432 Ala Asp Ala Leu Ser Ile Phe Tyr Tyr Pro Pro Val Ala Ala Val Thr gtt tca tat cca aaa gaa gca att aga aaa gaa tgc tta att gac gga 480 Val Ser Tyr Pro Lys Glu Ala Ile Arg Lys Glu Cps Leu Ile Asp Gly gag ctc cag ggt ttc ggc cag ctg cat ccg cgt agt cag gga gtt gag 528 Glu Leu Gln Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Val Glu act tta gga aca ata tat agc tca tca ctc ttt cca aat cgt get cca 576 Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro get gga agg gtg tta ctt ctg aac tac ata gga ggt tct aca aat aca 624 Ala Gly Arg Val Leu Leu Leu Asn Tyr Ile Gly Gly Ser Thr Asn Thr ggg att gtt tcc aag act gaa.agt gag ctg gta gaa gca gtt gac cgt 672 Gly Ile Val Ser Lys Thr Glu Ser Glu Leu Val Glu Ala Val Asp Arg gac ctc agg aag atg ctg ata aat cct aga gca gtg gac cct ttg gtc 720 Asp Leu Arg Lys Met Leu Ile Asn Pro Arg Ala Val Asp Pro Leu Val ctt ggc gtc cgg gta tgg cca caa gcc ata cca cag ttc ctc att ggc 768 Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Leu Ile Gly cat ctt gat cat ctt gag get gca aaa tct gcc ctg ggc aaa ggt ggg 816 His Leu Asp His Leu Glu Ala Ala Lys Ser Ala Leu Gly Lys Gly Gly tat gat gga ttg ttc ctc gga ggg aac tat gtt gca gga gtt gcc ctg 864 Tyr Asp Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu ggc cga tgc gtt gaa ggt gca tat gag agt gcc tca caa ata tct gac 912 Gly Arg Cps Val Glu Gly Ala Tyr Glu Ser Ala Ser Gln Ile Ser Asp tac ttg acc aag tac gcc tac aag tgatcaaagt tggcctgctc cttttggcac 966 Tyr L~eu Thr Lys Tyr Ala Tyr Lys atagatgtga ggcttctagc agcaaaaatt tcatgggcat ctttttatcc tgattctaat 1026 tagttagaat ttagaattgt agaggaatgt tccatttgca gttcataata gttgttcaga 1086 tttcagccat tcaatttgtg cagccattta ctatatgtag tatgatcttg taagtactac 1146 taagaacaaa tcaattatat tttcctgcaa gtgacatctt aatcgtcagc aaatccagtt 1206 actagtaaaa aaaaaaaa <210> 22 <211> 312 <212> PRT
<213> Oryza sativa <400> 22 Arg Ala Leu Lys Ala Ala Phe Gly Lys Val Trp Arg Leu Glu Asp Thr Gly Gly Ser Ile Ile Gly Gly Thr Ile Lys Thr Ile Gln Glu Arg Gly Lys Asn Pro Lys Pro Pro Arg Asp Pro Arg Leu Pro Thr Pro Lys Gly _72_ Gln Thr Val Ala Ser Phe Arg Lys Gly Leu Thr Met Leu Pro Asp Ala Ile Thr Ser Arg Leu Gly Ser Lys Val Lys Leu Ser Trp Lys Leu Thr Ser Ile Thr Lys Ser Asp Asn Lys Gly Tyr Ala Leu Val Tyr Glu Thr Pro Glu Gly Val Val Ser Val Gln Ala Lys Thr Val Val Met Thr Ile Pro Ser Tyr Val Ala Ser Asp Ile Leu Arg Pro Leu Ser Ser Asp Ala Ala Asp Ala Leu Ser Ile Phe Tyr Tyr Pro Pro Val Ala Ala Val Thr Val Ser Tyr Pro Lys Glu Ala Ile Arg Lys Glu Cars Leu Ile Asp Gly Glu Leu Gln Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Ala Gly Arg Val Leu Leu Leu Asn Tyr Ile Gly Gly Ser Thr Asn Thr Gly Ile Val Ser Lys Thr Glu Ser Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Asn Pro Arg Ala Val Asp Pro Leu Val Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Leu Ile Gly His Leu Asp His Leu Glu Ala Ala Lys Ser Ala Leu Gly Lys Gly Gly Tyr Asp Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cps Val Glu Gly Ala Tyr Glu Ser Ala Ser Gln Ile Ser Asp Tyr Leu Thr Lys Tyr Ala Tyr Lys <210> 23 <211> 1590 <212> I~
<213> Sorghum bicolor <220>
<221> CDS
<222> (1)..(1320) <223> sorghtmn protox-1 partial coding sequence <400> 23 tcc acc gtc gag cgc ccc gag gaa ggg tac ctc tgg gag gag'ggt ccc 48 Ser Thr Val Glu Arg Pro Glu Glu Gly err Leu Trp Glu Glu Gly Pro aac agc ttc cag cca tcc gac ccc gtt ctc tcc atg gcc gtg gac agc 96 Asn Ser Phe Gln Pro Ser Asp Pro Val Leu Ser Met Ala Val Asp Ser ggg ctg aag gat gac ctg gtt ttt ggg gac ccc aac gcg cca cgg ttc 144 Gly Leu Lys Asp Asp Leu Val Phe Gly Asp Pro Asn Ala Pro Arg Phe gtg ctg tgg gag ggg aag ctg agg ccc gtg cca tcc aag ccc gcc gac 192 Val Leu Tip Glu Gly Lys Leu Arg Pro Val Pro Ser Lys Pro Ala Asp ctc ccg ttc ttc gat ctc atg agc atc cct ggc aag ctc agg gcc ggt 240 Leu Pro Phe Phe Asp Leu Met Ser Ile Pro Gly Lys Leu Arg Ala Gly ctc ggc gcg ctt ggc atc cgc ccg cct get cca ggc cgc gag gag tca 288 Leu Gly Ala Leu Gly Ile Arg Pro Pro Ala Pro Gly Arg Glu Glu Ser gtg gag gag ttt gtg cgc cgc aac ctc ggt get gag gtc ttt gag cgc 336 Val Glu Glu Phe Val Arg Arg Asn Leu Gly Ala Glu Val Phe Glu Arg cta att gag cct ttc tgc tca ggt gtc tat get ggc gat cct tcc aag 384 Leu Ile Glu Pro Phe Cps Ser Gly Val Tyr Ala Gly Asp Pro Ser Lys ctc agt atg aag get gca ttt ggg aag gtg tgg cgg tta gaa gaa get 432 Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Arg Leu Glu Glu Ala gga ggt agt att att ggt gga acc atc aag acg att cag gag agg ggc 480 Gly Gly Ser Ile Ile Gly Gly Thr Ile Lys Thr Ile Gln Glu Arg Gly aag aat cca aaa cca ccg agg gat ccc cgc ctt ccg aag cca aaa ggg 528 Lys Asn Pro Lys Pro Pro Arg Asp Pro Arg Leu Pro Lys Pro Lys Gly cag aca gtt gca tct ttc agg aag ggt ctt gcc atg ctt cca aat gcc 576 Gln Thr Val Ala Ser Phe Arg Lys Gly Leu Ala Met Leu Pro Asn Ala atc aca tcc agc ttg ggt agt aaa gtc aaa cta tca tgg aaa ctc acg 624 Ile Thr Ser Ser Leu Gly Ser Lys Val Lys Leu Ser Trp Lys Leu Thr agc atg aca aaa tca gat ggc aag ggg tat gtt ttg gag tat gaa aca 672 Ser Met Thr Lys Ser Asp Gly Lys Gly Tyr Val Leu Glu Tyr Glu Thr cca gaa ggg gtt gtt ttg gtg cag get aaa agt gtt atc atg acc att 720 Pro Glu Gly Val Val Leu Val Gln Ala Lys Ser Val Ile Met Thr Ile cca tca tat gtt get agc gac att ttg cgt cca ctt tca ggt gat get 768 Pro Ser Tyr Val Ala Ser Asp Ile Leu Arg Pro Leu Ser Gly Asp Ala gca gat gtt cta tca aga ttc tat tat cca cca gtt get get gta acg 816 Ala Asp Val Leu Ser Arg Phe Tyr Tyr Pro Pro Val Ala Ala Val Thr gtt tcg tat cca aag gaa gca att aga aaa gaa tgc tta att gat ggg 864 Val Ser Tyr Pro Lys Glu Ala Ile Arg Lys Glu Cars Leu Ile Asp Gly gaa ctc cag ggt ttt ggc cag ttg cat cca cgt agt caa gga gtt gag 912 Glu Leu Gln Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Val Glu aca tta gga aca ata tac agc tca tca ctc ttt cca aat cgt get cct 960 Thr Leu Gly 'Ihr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro get ggt agg gtg tta ctt cta aac tac ata gga ggt get aca aac aca 1008 Ala Gly Arg Val Leu Leu Leu Asn ~r Ile Gly Gly Ala Thr Asn Thr gga att gtt tcc aag act gaa agt gag ctg gta gaa gca gtt gac cgt 1056 Gly Ile Val Ser Lys Thr Glu Ser Glu Leu Val Glu Ala Val Asp Arg gac ctc cga aaa atg ctt ata aat cct aca gca gtg gac cct tta gtc 1104 Asp Leu Arg Lys Met Leu Ile Asn Pro Thr Ala Val Asp Pro Leu Val ctt ggt gtc cga gtt tgg cca caa gcc ata cct cag ttc ctg gta gga 1152 Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Leu Val Gly cat ctt gat ctt ctg gag gcc gca aaa tct gcc ctg gac caa ggt ggc 1200 His Leu Asp Leu Leu Glu Ala Ala Lys Ser Ala Leu Asp Gln Gly Gly tat aat ggg ctg ttc cta gga ggg aac tat gtt gca gga gtt gcc ctg 1248 Tyr Asn Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu ggc aga tgc att gag ggc gca tat gag agt gcc gcg caa ata tat gac 1296 Gly Arg Cys Ile Glu Gly Ala Tyr Glu Ser Ala Ala Gln Ile Tyr Asp ttc ttg acc aag tac gcc tac aag tgatggaaga agtggagcgc tgcttgttaa 1350 Phe Leu Thr Lys Tyr Ala Tyr Lys ttgttatgtt gcatagatga ggtgagacca ggagtagtaa aaggcgtcac gagtattttt 1410 cattcttatt ttgtaaattg cacttctgtt tttttttcct gtcagtaatt agttagattt 1470 tagttatgta ggagattgtt gtgttcactg ccctacaaaa gaatttttat tttgcattcg 1530 tttatgagag ctgtgcagac ttatgtaacg ttttactgta agtatcaaca aaatcaaata 1590 _77_ <210> 24 <211> 440 <212> PRT
<213> Sorghimn bicolor <400> 24 Ser Thr Val Glu Arg Pro Glu Glu Gly Tyr Leu Trp Glu Glu Gly Pro Asn Ser Phe Gln Pro Ser Asp Pro Val Leu Ser Met Ala Val Asp Ser Gly Leu Lys Asp Asp Leu Val Phe Gly Asp Pro Asn Ala Pro Arg Phe Val Leu Trp Glu Gly Lys Leu Arg Pro Val Pro Ser Lys Pro Ala Asp Leu Pro Phe Phe Asp Leu Met Ser Ile Pro Gly Lys Leu Arg Ala Gly Leu Gly Ala Leu Gly Ile Arg Pro Pro Ala Pro Gly Arg Glu Glu Ser Val Glu Glu Phe Val Arg Arg Asn Leu Gly Ala Glu Val Phe Glu Arg Leu Ile Glu Pro Phe Cars Ser Gly Val Tyr Ala Gly Asp Pro Ser Lys Leu Ser Met Lys Ala Ala Phe Gly Lys Val Trp Arg Leu Glu Glu Ala Gly Gly Ser Ile Ile Gly Gly Thr Ile Lys Thr Ile Gln Glu Arg Gly _78_ Lys Asn Pro Lys Pro Pro Arg Asp Pro Arg Leu Pro Lys Pro Lys Gly G1n ?'hr Val Ala Ser Phe Arg Lys Gly Leu Ala Met Leu Pro Asn Ala Ile Thr Ser Ser Leu Gly Ser Lys Val Lys Leu Ser Trp Lys Leu Thr Ser Met Thr Lys Ser Asp Gly Lys Gly Tyr Val Leu Glu Tyr Glu Thr Pro Glu Gly Val Val Leu Val Gln Ala Lys Ser Val Ile Met Thr Ile Pro Ser Tyr Val Ala Ser Asp Ile Leu Arg Pro Leu Ser Gly Asp Ala Ala Asp Val Leu Ser Arg Phe Tyr Tyr Pro Pro Val Ala Ala Val Thr Val Ser Tyr Pro Lys Glu Ala Ile Arg Lys Glu Cps Leu Ile Asp Gly Glu Leu Gln Gly Phe Gly Gln Leu His Pro Arg Ser Gln Gly Val Glu Thr Leu Gly Thr Ile Tyr Ser Ser Ser Leu Phe Pro Asn Arg Ala Pro Ala Gly Arg Val Leu Leu Leu Asn Tyr Ile Gly Gly Ala Z'hr Asn Thr Gly Ile Val Ser Lys Thr Glu Ser Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Asn Pro Thr Ala Val Asp Pro Leu Val _79_ Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Leu Val Gly His Leu Asp Leu Leu Glu Ala Ala Lys Ser Ala Leu Asp Gln Gly Gly Tyr Asn Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cars Ile Glu Gly Ala Tyr Glu Ser Ala Ala Gln Ile Tyr Asp Phe Leu Thr Lys Tyr Ala Tyr Lys <210> 25 <211> 93 <212> I~1A
<213> Zea mays <220>
<221> misc feature <222> (1)..(93) <223> maize protox-1 intron sequence <400> 25 gtacgctcct cgctggcgcc gcagcgtctt cttctcagac tcatgcgcag ccatggaatt 60 gagatgctga atggatttta tacgcgcgcg cag 93 <210> 26 <211> 2606 <212> I~1A
<213> Beta vulgaris <220>
<221> misc feature <222> (2601)..(2606) <223> SalI site <220>
<221> misc feature <222> (1)..(538) <223> partial c-L~ of sugar beet protox-1 <220>
<221> misc feature <222> (539)..(2606) <223> sugar beet protox-1 prompter region (partial sequence of the ~3 kb PstI-SalI frac~nt sucloned from pV~DC-20) <400> 26 ctgcaggggg agggaaagag agaccgcgac ggtgagggag gggagaccgc gacggtgagg 60 gaggggagaa cgcgacggtg agggagggga gaacgcgatg gtgagggagg ggagaacgcg 120 acgcgcaggg gagggggata actcgacggt gcagggaggt gagggggacg acgtgacggc 180 gcaggggagg ggggaaccgt cgcgggaagg ggaagaccgg ggggccgaca aggtggtgtt 240 actggggtag ggagaggcgg cgtggagaat agtaacagag ggaggagtgg tggtgctagg 300 gtggaagaag ggtaagaaag aggaagaaag agaattaaca ttatcttaac caaacaccac 360 tctaaatcta agggttttct tttcctttcc tctcctctcc ctttcttgat tccattccct 420 ttaccccgtt gcaaccaaac gcccccttat tatggaccgg aggaagtatg tagagatggt 480 cacaaaacta cttaagctgg taacttataa atatactggg tattaaatga attaagtggc 540 cacaaaatga ctataaatta cttcgtaatc tttaggaact atgttggtca cgaaataaca 600 taaaactggt tatttaatgg ctttatgtag gtactgcatt cataaatata tttctaacat 660 aatcgtggta tgtaggtgtt ttataacaca aggattaggt ttacaccaat gtcattttca 720 ttagaatgta gttagaatca ctttggaact ttgaagagtg atgacacatt tttattatgc 780 ttttatgaaa tgtctttgtg gtttttatga tagtattgag tttaaggcaa gttggaagta 840 tatgatggag aagtacagta tataggtgac aattggtttg cttgtttcta tgagttgaaa 900 gataagtagt acacgacact gagcaatgac ctcttcttag ttgtaatttt gtcttctcga 960 cgtagtgaaa gtacaaacaa gattatggct ttcaagcttc caagataacg agattgtatg 1020 aattttgtgg tgtatttcac atcattgttt tacgttggag acaaactaaa accaatgatg 1080 agtttgtgga ttcgagattt gcccctaagt cttatttacc catggcaagc atgctgaaac 1140 atgttagtca aacttacaca gctacaatgt ttagggattt tgagcaaaaa atttgggtat 1200 tctttgggta ccattatgtg agttgttgac tatggattaa acaaaatcac tatataaagt 1260 ctggaatgag aagcatccgc aattgacaca ccatgttact ttgattgttt caacaagttt 1320 attagatgta tttgtaggaa ttttgaagag gcggagatgt tgtgttataa ttgctttggg 1380 ggtgcttcac atgcactctg ttagtgagac atcttcagct tatattttaa ggcggttagt 1440 gagtatgatt tttttttttc aaacttttcg atttccatgt aattaaaaaa ggtgtttgat 1500 aaatacatgt taagatagcc aagaaaaggc aactttcaaa caaataaaaa aaattaagtc 1560 gcttaatcat ttttccaagt actttttact tttaacacca cttattactg aatctatagc 1620 cgttaagaat gcattttcac gctcatacat gcaaatcaag aacctcctca ttgaaggaga 1680 taatttagtc ctcataaacc ccgttaaaga catttttagc atccagagaa atttcgattc 1740 agttaaaatt gcatatataa ccagagaaac aaattcagat gttagtcagt ccagctacat 1800 aggtcaatgc ctgagagttt aaaagaatcc gtatccttaa gcataagtag gtattgaggt 1860 gagttacaaa ggtaagttac cggttacgca ccacctccac caaacaagta tggttagaag 1920 atacatgtaa tcgtttattt agagtactat ttataaaaaa ctttttaact agaaacagtt 1980 gtttcatttt gatataaggt taattagaat tcccgagcaa gcaagaaggg gatatagagg 2040 ataaggaggg cgagagagcg agagagagat gaaatcaatg gcgttatcaa actgcattcc 2100 acagacacag tgcatgccat tgcacagcag cgggcattac aggggcaatt gtatcatgtt 2160 gtcaattcca tgtagtttaa ttggaagacg aggttattat tcacataaga agaggaggat 2220 gagcatgagt tgcagcacaa gctcaggctc aaagtcagcg gttaaagaag caggatcagg 2280 atcaggatca ggagcaggag gattgctaga ctgcgtaatc gttggaggtg gaattagcgg 2340 gctttgcatc gcgcaggctc tttgtacaaa acagtcctct ttatccccaa attttatagt 2400 gacagaggcc aaagacagag ttggcggcaa catcgtcact gtggaggccg atggctatat 2460 ctgggaggag ggacccaata gcttccagcc ttccgacgcg gtgctcacca tggcggtaat 2520 tctgtctctt cattattcat aatcataatt caattcaatt caattcctaa cgtggaatgt 2580 ggaatgtggc atgtgcgtag gtcgac 2606 <210> 27 <211> 31 <212> T~TA
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <220>
<221> misc feature <222> (4)..(9) <223> EcoRI restriction site <400> 27 gcggaattca tacttattta tcattagaaa g 31 <210> 28 <211> 32 <212> I~
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <220>
<221> misc feature <222> (4)..(9) <223> XbaI restriction site <400> 28 gcgtctagaa agaactaaat actatatttc ac 32 <210> 29 <211> 30 <212> L~
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <220>
<221> misc feature <222> (4)..(9) <223> NcoI restriction site <400> 29 gcgccatggt aaatgaaaga aagaactaaa 30 <210> 30 <211> 30 <212> I~1A
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <220>
<221> misc_feature <222> (4)..(9) <223> XbaI restriction site <400> 30 gcgtctagat caaccgaaat tcaattaagg 30 <210> 31 <211> 27 <212> L'~, <213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <220>
<221> misc feature <222> (4) .. (9) <223> HindIII restriction site <400> 31 cgcaagcttc aatggaagca atgataa 27 <210> 32 <211> 36 <212> I~
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <400> 32 gggagtccct gatgattaaa taaaccaaga ttttac 36 <210> 33 <211> 40 <212> I7~TA
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <400> 33 catggtaaaa tcttggttta tttaatcatc agggactccc 40 <210> 34 <211> 32 <212> I~IA
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <220>
<221> misc feature <222> (5)..(10) <223> NcoI restriction site/ ATG start colon <400> 34 gggaccatgg attgtgtgat tgtcggcgga gg 32 <210> 35 <211> 24 <212> I7NA
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence:
oligonucleotide <400> 35 ctccgctctc cagcttagtg atac 24 <210> 36 <211> 633 <212> L~
_87_ <213> sugar cane <220>
<221> CDS
<222> (3).:(305) <223> sugar cane protox-1 partial coding sequence <400> 36 tt tcc aag act gaa agt gag ctg gta gaa gca gtt gac cgt gac ctc 47 Ser Lys Thr Glu Ser Glu Leu Val Glu A3a Val Asp Arg Asp Leu cgg aaa atg ctt ata aat cct aca gca gtg gac cct tta gtc ctt ggt 95 Arg Lys Met Leu Ile Asn Pro Thr Ala Val Asp Pro Leu Val Leu Gly gtc cga gtt tgg cca caa gcc ata cct cag ttc ctg gta gga cat ctt 143 Val Arg Val Trp Pro Gln Ala Ile Pro Gln Phe Leu Val Gly His Leu gat ctt ctg gag gcc gca aaa tct gcc ctg gac cga ggt ggc tac gat 191 Asp Leu Leu Glu Ala Ala Lys Ser Ala Leu Asp Arg Gly Gly err Asp ggg ctg ttc cta gga ggg aac tat gtt gca gga gtt gcc cta ggc aga 239 Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg tgc gtt gag ggc gcg tat gag agt gcc tcg caa ata tat gac ttc ttg 287 Cys Val Glu Gly Ala Tyr Glu Ser Ala Ser Gln Ile Tyr Asp Phe Leu acc aag tat gcc tac aag tgatgaaaga agtggagtgc tgcttgttaa 335 Thr Lys Tyr Ala Tyr Lys ttgttatgtt gcatagatga ggtgagacca ggagtagtaa aagcgttacg agtatttttc 395 _88_ attcttattt tgtaaattgc acttctggtt ttttcctgtc agtaattagt tagattttag 455 ttctgtagga gattgttctg ttcactgccc tacaaaagaa tttttatttt gcattcgttt 515 atgagagctg tgcagactta tgtagcgttt ttctgtaagt accaacaaaa tcaaatacta 575 ttctgtaaga gctaacagaa tgtgcaactg agattgcctt ggatgaaaaa aaaaaaaa 633 <210>37 <211>101 <212>PRT
<213>sugar cane <400> 37 Ser Lys Thr Glu Ser Glu Leu Val Glu Ala Val Asp Arg Asp Leu Arg Lys Met Leu Ile Asn Pro Thr Ala Val Asp Pro Leu Val Leu Gly Val Arg Val Trp Pro Gln Ala Ile Pro G1n Phe Leu Val Gly His Leu Asp Leu Leu Glu Ala Ala Lys Ser Ala Leu Asp Arg Gly Gly Tyr Asp Gly Leu Phe Leu Gly Gly Asn Tyr Val Ala Gly Val Ala Leu Gly Arg Cys Val Glu Gly Ala Tyr Glu Ser Ala Ser Gln Ile Tyr Asp Phe Leu Thr Lys Tyr Ala Tyr Lys _89_ <210> 38 <211> 4 <212> PRT
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence: sub-sequence 1 <220>
<221> misc feature <222> (3) <223> Xaa = amino acid other than Arg <400> 38 Ala Pro Xaa Phe <210> 39 <211> 5 <212> PRT
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence: sub-sequence 8 <220>
<221> misc feature <222> (5) <223> Xaa = amino acid other than Ala or Ser <400> 39 Tyr Ile Gly Gly Xaa <210> 40 <211> 4 <212> PRT
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence: sub-sequence <220>
<221> misc feature <222> (4) <223> Xaa = amino acid other than Thr <400> 40 Ile Gly Gly Xaa <210> 41 <211> 5 <212> PRT
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence: sub-sequence <220>
<221> misc_feature <222> (3 ) <223> Xaa = any amino acid <220>
<221> misc_feature <222> (5) <223> Xaa = amino acid other than Ser or Thr <400> 41 Ser Trp Xaa Leu Xaa <210> 42 <211> 5 <212> PRT
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence: sub-sequence <220>
<221> misc feature <222> (2) <223> Xaa = amino acid other than Tyr, His, Phe or Val <220>
<221> misc feature <222> (3) <223> Xaa = any amino acid <400> 42 Gly Xaa Xaa Gly Leu <210> 43 <211> 4 <212> PRT
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence: sub-sequence <220>
<221> misc feature <222> (3) <223> Xaa = amino acid other than Ala or Ser <400> 43 Tyr Val Xaa Gly <210> 44 <211> 4 <212> PRT
<213> Artificial Sequence <220>
<223> Description of Artificial Sequence: sub-sequence <220>
<221> misc feature <222> (3 ) <223> Xaa = amino acid other than Ala <400> 44 Lys Ala Xaa Phe
Claims (54)
1. A nucleic acid molecule comprising a nucleotide sequence that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is resistant to an inhibitor of the naturally occurring form of said enzyme, wherein said modified enzyme comprises at least one of the following amino acid sub-sequences:
(a) KA.DELTA.18F, wherein .DELTA.18 is an amino acid other than alanine, (b) Q.DELTA.19H, wherein .DELTA.19 is an amino acid other than leucine, (c) AP.DELTA.1F, wherein .DELTA.1 is an amino acid other than arginine, (d) F.DELTA.2S, wherein .DELTA.2 is leucine, (e) Y.DELTA.3G, wherein .DELTA.3 is isoleucine, (f) .DELTA.7IG, wherein .DELTA.7 is histidine or alanine, (g) T.DELTA.16G wherein .DELTA.16 is an amino acid other than leucine and YVO"G, wherein .DELTA.17 is an amino acid other than alanine, wherein the nucleotide sequence that encodes the naturally occurring form of said enzyme is derived from a plant.
(a) KA.DELTA.18F, wherein .DELTA.18 is an amino acid other than alanine, (b) Q.DELTA.19H, wherein .DELTA.19 is an amino acid other than leucine, (c) AP.DELTA.1F, wherein .DELTA.1 is an amino acid other than arginine, (d) F.DELTA.2S, wherein .DELTA.2 is leucine, (e) Y.DELTA.3G, wherein .DELTA.3 is isoleucine, (f) .DELTA.7IG, wherein .DELTA.7 is histidine or alanine, (g) T.DELTA.16G wherein .DELTA.16 is an amino acid other than leucine and YVO"G, wherein .DELTA.17 is an amino acid other than alanine, wherein the nucleotide sequence that encodes the naturally occurring form of said enzyme is derived from a plant.
2. A nucleotide acid molecule according to claim 1 comprising a nucleotide sequence that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is resistant to an inhibitor of the naturally occurring form of said enzyme, wherein said modified enzyme comprises at least one amino acid sub-sequence selected from the group consisting of:
(a) KA.DELTA.16F, wherein .DELTA.16 is an amino acid other than alanine, (b) Q.DELTA.19H wherein .DELTA.19 is an amino acid other than leucine, (c) AP1.DELTA.F, wherein .DELTA.1 is an amino acid other than arginine, (d) F.DELTA.2S, wherein .DELTA.2 is leucine, (e) Y.DELTA.3G, wherein .DELTA.3 is isoleucine, (f) .DELTA.7IG, wherein .DELTA.7 is histidine or alanine, (g) T.DELTA.16G, wherein .DELTA.16 is an amino acid other than leucine and YV.DELTA.17G, wherein .DELTA.17 is an amino acid other than alanine, wherein said nucleotide sequence that encodes said modified enzyme hybridizes to any one of the nucleotide sequences set forth in SEQ ID NO:1, SEQ ID NO:5, SEQ ID
NO:9, SEQ ID NO:11, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID
NO:23 or SEQ ID NO:36 under the following conditions:
(i) hybridization in 7% sodium dodecyl sulfate (SDS), 0.5 M NaPO4 pH 7.0, 1 mM EDTA at 50° C; and (ii) wash in 2X SSC, 1% SDS at 50° C.
(a) KA.DELTA.16F, wherein .DELTA.16 is an amino acid other than alanine, (b) Q.DELTA.19H wherein .DELTA.19 is an amino acid other than leucine, (c) AP1.DELTA.F, wherein .DELTA.1 is an amino acid other than arginine, (d) F.DELTA.2S, wherein .DELTA.2 is leucine, (e) Y.DELTA.3G, wherein .DELTA.3 is isoleucine, (f) .DELTA.7IG, wherein .DELTA.7 is histidine or alanine, (g) T.DELTA.16G, wherein .DELTA.16 is an amino acid other than leucine and YV.DELTA.17G, wherein .DELTA.17 is an amino acid other than alanine, wherein said nucleotide sequence that encodes said modified enzyme hybridizes to any one of the nucleotide sequences set forth in SEQ ID NO:1, SEQ ID NO:5, SEQ ID
NO:9, SEQ ID NO:11, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID
NO:23 or SEQ ID NO:36 under the following conditions:
(i) hybridization in 7% sodium dodecyl sulfate (SDS), 0.5 M NaPO4 pH 7.0, 1 mM EDTA at 50° C; and (ii) wash in 2X SSC, 1% SDS at 50° C.
3. A nucleic acid molecule according to any one of claims 1 or 2 comprising a nucleotide sequence that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is resistant to an inhibitor of the naturally occurring form of said enzyme, wherein said modified enzyme comprises at least one of the following amino acid sub-sequences:
(a) KA.DELTA.18F, wherein .DELTA.18 is an amino acid other than alanine, (b) Q.DELTA.19H, wherein .DELTA.19 is an amino acid other than leucine, (c) AP.DELTA.1F, wherein .DELTA.1 is an amino acid other than arginine;
(d) .DELTA.7IG, wherein .DELTA.7 is histidine, wherein the nucleotide sequence that encodes the naturally occurring form of said enzyme is derived from a plant.
(a) KA.DELTA.18F, wherein .DELTA.18 is an amino acid other than alanine, (b) Q.DELTA.19H, wherein .DELTA.19 is an amino acid other than leucine, (c) AP.DELTA.1F, wherein .DELTA.1 is an amino acid other than arginine;
(d) .DELTA.7IG, wherein .DELTA.7 is histidine, wherein the nucleotide sequence that encodes the naturally occurring form of said enzyme is derived from a plant.
4. The nucleic acid molecule according to claim 1, wherein said modified enzyme comprises the amino acid sub-sequence KA.DELTA.18F, wherein .DELTA.18 is an amino acid other than alanine, preferably threonine or valine, but especially valine..
5. The nucleic acid molecule according to claim 1, wherein said modified enzyme comprises the amino acid sub-sequence Q.DELTA.19H, wherein .DELTA.19 is an amino acid other than leucine, preferably serine.
6. The nucleic acid molecule according to claim 1, wherein said modified enzyme comprises the amino acid sub-sequence AP.DELTA.1F, wherein .DELTA.1 is leucine or cysteine.
7. The nucleic acid molecule according to claim 1, wherein said modified enzyme comprises the amino acid sub-sequence .DELTA.7IG, wherein .DELTA.7 is histidine or alanine, preferably histidine.
8. A nucleic acid molecule comprising a nucleotide sequence that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is resistant to an inhibitor of the naturally occurring form of said enzyme, and wherein said modified enzyme comprises a first amino acid sub-sequence and further at least one additional amino acid sub-sequence selected from the group consisting of:
(a) Q.DELTA.11S, wherein .DELTA.11 is an amino acid other than proline;
(b) IGG.DELTA.12, wherein .DELTA.12 is an amino acid other than threonine;
(c) SWXL.DELTA.13, wherein .DELTA.13 is an amino acid other than serine;
(d) L.DELTA.14Y, wherein .DELTA.14 is an amino acid other than asparagine;
(e) G1.DELTA.15XGL, wherein .DELTA.15 is an amino acid other than tyrosine.
(a) Q.DELTA.11S, wherein .DELTA.11 is an amino acid other than proline;
(b) IGG.DELTA.12, wherein .DELTA.12 is an amino acid other than threonine;
(c) SWXL.DELTA.13, wherein .DELTA.13 is an amino acid other than serine;
(d) L.DELTA.14Y, wherein .DELTA.14 is an amino acid other than asparagine;
(e) G1.DELTA.15XGL, wherein .DELTA.15 is an amino acid other than tyrosine.
9. A nucleic acid molecule according to claim 8, wherein said first sub-sequence is a sequence according to any one of claims 1 to 7.
10. The nucleic acid molecule according to any one of claims 8 and 9, wherein said additional sub-sequence is Q.DELTA.11S, wherein .DELTA.11 is an amino acid other than proline, preferably leucine.
11. The nucleic acid molecule according to any one of claims 8 and 9, wherein said additional sub-sequence is IGG.DELTA.12, wherein .DELTA.12 is an amino acid other than threonine, preferably isoleucine or alanine.
12. The nucleic acid molecule according to any one of claims 8 and 9, wherein said additional sub-sequence is SWXL.DELTA.13, wherein .DELTA.13 is an amino acid other than serine, preferably leucine.
13. The nucleic acid molecule according to any one of claims 8 and 9, wherein said additional sub-sequence is L.DELTA.14Y, wherein .DELTA.14 is an amino acid other than asparagine, preferably serine.
14. The nucleic acid molecule according to any one of claims 8 and 9, wherein said additional sub-sequence is G.DELTA.15XGL, wherein .DELTA.15 is an amino acid other than tyrosine, preferably cysteine.
15. The nucleic acid molecule according to any one of claims 1 to 9, wherein wherein the modified enzyme comprises: the amino acid sub-sequence .DELTA.7IG, wherein .DELTA.7 is an amino acid other than tyrosine; preferably isoleucine, the amino acid sub-sequences IGG.DELTA.12, wherein .DELTA.12 is an amino acid other than threonine; preferably isoleucine, and the amino acid sub-sequence SWXL.DELTA.13, wherein .DELTA.13 is an amino acid other than serine, preferably leucine.
16. A nucleic acid molecule according to any one of claims 1 and 8 to 9 comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the nucleotide sequence is further characterized in that at least one of the following conditions is met:
(a) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence AP.DELTA.1F, wherein .DELTA.1 is leucine;
(b) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence F.DELTA.2S, wherein .DELTA.2 is leucine;
(c) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence Y.DELTA.3G, wherein .DELTA.3 is isoleucine;
(d) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence .DELTA.7IG, wherein .DELTA.7 is alanine or histidine;
(e) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence Y.DELTA.3G, wherein .DELTA.3 is an amino acid other than alanine, but preferably cysteine or isoleucine, more preferably isoleucine, and the nucleic acid sequence also has a sequence that encodes one of the group consisting of:
(1) sub-sequence Q.DELTA.11S, wherein .DELTA.11 is an amino acid other than proline, (2) sub-sequence IGG.DELTA.12, wherein .DELTA.12 is an amino acid other than threonine, (3) sub-sequence SWXL.DELTA.13, wherein .DELTA.13 is an amino acid other than serene, (4) sub-sequence L.DELTA.14Y, wherein .DELTA.14 is an amino acid other than asparagine, and (5) sub-sequence G.DELTA.15XGL, wherein .DELTA.15 is an amino acid other than tyrosine;
(f) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence .DELTA.7IG, wherein .DELTA.7 is an amino acid other than tyrosine, but preferably threonine, alanine or histidine, more preferably alanine or histidine and most preferably histidine, and the nucleic acid sequence also has a sequence that encodes one of the group consisting of:
(1) sub-sequence Q.DELTA.11S wherein .DELTA.11 is an amino acid other than proline, (2) sub-sequence IGG.DELTA.12, wherein .DELTA.12 is an amino acid other than threonine, (3) sub-sequence SWXL.DELTA.13, wherein .DELTA.13 is an amino acid other than serine, (4) sub-sequence L.DELTA.14Y, wherein .DELTA.14 is an amino acid other than asparagine, and (5) sub-sequence G.DELTA.15XGL, wherein .DELTA.15 is an amino acid other than tyrosine; and (g) the nucleic has a sequence that encodes amino acid sub-sequence T.DELTA.16G, wherein .DELTA.16 is an amino acid other than leucine, and the nucleic acid sequence also has a sequence that encodes amino acid sub-sequence YV.DELTA.17G, wherein .DELTA.17 is an amino acid other than alanine.
(h) KA.DELTA.18F, wherein .DELTA.18 is an amino acid other than alanine;
(i) Q.DELTA.19H, wherein .DELTA.19 is an amino acid other than leucine.
(a) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence AP.DELTA.1F, wherein .DELTA.1 is leucine;
(b) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence F.DELTA.2S, wherein .DELTA.2 is leucine;
(c) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence Y.DELTA.3G, wherein .DELTA.3 is isoleucine;
(d) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence .DELTA.7IG, wherein .DELTA.7 is alanine or histidine;
(e) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence Y.DELTA.3G, wherein .DELTA.3 is an amino acid other than alanine, but preferably cysteine or isoleucine, more preferably isoleucine, and the nucleic acid sequence also has a sequence that encodes one of the group consisting of:
(1) sub-sequence Q.DELTA.11S, wherein .DELTA.11 is an amino acid other than proline, (2) sub-sequence IGG.DELTA.12, wherein .DELTA.12 is an amino acid other than threonine, (3) sub-sequence SWXL.DELTA.13, wherein .DELTA.13 is an amino acid other than serene, (4) sub-sequence L.DELTA.14Y, wherein .DELTA.14 is an amino acid other than asparagine, and (5) sub-sequence G.DELTA.15XGL, wherein .DELTA.15 is an amino acid other than tyrosine;
(f) the nucleic acid sequence has a sequence that encodes amino acid sub-sequence .DELTA.7IG, wherein .DELTA.7 is an amino acid other than tyrosine, but preferably threonine, alanine or histidine, more preferably alanine or histidine and most preferably histidine, and the nucleic acid sequence also has a sequence that encodes one of the group consisting of:
(1) sub-sequence Q.DELTA.11S wherein .DELTA.11 is an amino acid other than proline, (2) sub-sequence IGG.DELTA.12, wherein .DELTA.12 is an amino acid other than threonine, (3) sub-sequence SWXL.DELTA.13, wherein .DELTA.13 is an amino acid other than serine, (4) sub-sequence L.DELTA.14Y, wherein .DELTA.14 is an amino acid other than asparagine, and (5) sub-sequence G.DELTA.15XGL, wherein .DELTA.15 is an amino acid other than tyrosine; and (g) the nucleic has a sequence that encodes amino acid sub-sequence T.DELTA.16G, wherein .DELTA.16 is an amino acid other than leucine, and the nucleic acid sequence also has a sequence that encodes amino acid sub-sequence YV.DELTA.17G, wherein .DELTA.17 is an amino acid other than alanine.
(h) KA.DELTA.18F, wherein .DELTA.18 is an amino acid other than alanine;
(i) Q.DELTA.19H, wherein .DELTA.19 is an amino acid other than leucine.
17. A nucleic acid molecule according to claim 16, wherein said sub-sequence encodes amino acid sub-sequence T.DELTA.16G, wherein .DELTA.16 is an amino acid other than leucine, preferably serine, and said nucleic acid sequence also has a sequence that encodes amino acid sub-sequence YV.DELTA.17G, wherein .DELTA.17 is an amino acid other than alanine, preferably threonine.
18. A nucleic acid molecule according to claim 1 encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the arginine occurring at the position corresponding to amino acid 88 of SEQ ID NO:6 is replaced with another amino acid, preferably with a leucine, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity.
19. A nucleic acid molecule according to claim 1 encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the cysteine occurring at the position corresponding to amino acid 159 of SEQ ID NO:6 is replaced with a leucine.
20. A nucleic acid molecule according to claim 1 encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the alanine occurring at the position corresponding to amino acid 175 of SEQ ID NO:6 is replaced with another amino acid, preferably with a valine or threonine, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity.
21. A nucleic acid molecule according to claim 1 encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the leucine occurring at the position corresponding to amino acid 337 of SEQ ID NO:6 is replaced with another amino acid, preferably with a serine, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity.
22. A nucleic acid molecule according to claim 1 encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the tyrosine occurring at the position corresponding to amino acid 428 of SEQ ID NO:16 is replaced with a histidine or alanine, preferably with a histidine.
23. A nucleic acid molecule according to claim 1 encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the alanine occurring at the position corresponding to amino acid 220 of SEQ ID NO:2 is replaced with a isoleucine or a tyrosine.
24. A nucleic acid molecule according to claim 1 encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the tyrosine occurring at the position corresponding to amino acid 426 of SEQ ID NO:2 is replaced with a alanine.
25. A nucleic acid molecule according to any one of claims 1 and 8 to 9 encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox having a first amino acid substitution and a second amino acid substitution; the first amino acid substitution having the property of conferring resistance to a protox inhibitor; and the second amino acid substitution having the property of enhancing the resistance conferred by the first amino acid substitution but especially a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox, wherein the plant is selected from the group consisting of maize, wheat, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, sugar cane, and Arabidopsis
26. A nucleic acid molecule according to claim 25 wherein the first amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the arginine at amino acid 88 of SEQ ID
NO:6(b) the position corresponding to the alanine at amino acid 175 of SEQ ID NO:6;
and (c) the position corresponding to the leucine at amino acid 337 of SEQ ID
NO:6.
(a) the position corresponding to the arginine at amino acid 88 of SEQ ID
NO:6(b) the position corresponding to the alanine at amino acid 175 of SEQ ID NO:6;
and (c) the position corresponding to the leucine at amino acid 337 of SEQ ID
NO:6.
27. Particularly preferred is a DNA molecule wherein the first amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the arginine at amino acid 88 of SEQ ID
NO:6;
(b) the position corresponding to the alanine at amino acid 164 of SEQ ID
NO:6;
(c) the position corresponding to the glycine at amino acid 165 of SEQ ID
NO:6;
(d) the position corresponding to the tyrosine at amino acid 370 of SEQ ID
NO:6;
(e) the position corresponding to the cysteine at amino acid 159 of SEQ ID
NO:6;
(f) the position corresponding to the isoleucine at amino acid 419 of SEQ ID
NO:6.
(g) the position corresponding to the valine at amino acid 356 of SEQ ID
NO:10;
(h) the position corresponding to the serine at amino acid 421 of SEQ ID
NO:10;
(i) the position corresponding to the valine at amino acid 502 of SEQ ID
NO:10;
(j) the position corresponding to the alanine at amino acid 211 of SEQ ID
NO:10;
(k) the position corresponding to the glycine at amino acid 212 of SEQ ID
NO:10;
(l) the position corresponding to the isoleucine at amino acid 466 of SEQ ID
NO:10;
(m) the position corresponding to the proline at amino acid 369 of SEQ ID
NO:12;
(n) the position corresponding to the alanine at amino acid 226 of SEQ ID
NO:12;
(o) the position corresponding to the tyrosine at amino acid 432 of SEQ ID
NO:12;
(p) the position corresponding to the valine at amino acid 517 of SEQ ID
NO:12;
(q) the position corresponding to the tyrosine at amino acid 428 of SEQ ID
NO:16;
(r) the position corresponding to the proline at amino acid 365 of SEQ ID
NO:16;
(s) the position corresponding to the tyrosine at amino acid 449 of SEQ ID
NO:18;
(t) the position corresponding to the alanine at amino acid 175 of SEQ ID
NO:6;
and (u) the position corresponding to the leucine at amino acid 337 of SEQ ID
NO:6;
and wherein the second amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the serine at amino acid 305 of SEQ ID NO:2;
(b) the position corresponding to the threonine at amino acid 249 of SEQ ID
NO:2;
(c) the position corresponding to the proline at amino acid 118 of SEQ ID
NO:2;
(d) the position corresponding to the asparagine at amino acid 425 of SEQ ID
NO:2; and (e) the position corresponding to the tyrosine at amino acid 498 of SEQ ID
NO:2.
(a) the position corresponding to the arginine at amino acid 88 of SEQ ID
NO:6;
(b) the position corresponding to the alanine at amino acid 164 of SEQ ID
NO:6;
(c) the position corresponding to the glycine at amino acid 165 of SEQ ID
NO:6;
(d) the position corresponding to the tyrosine at amino acid 370 of SEQ ID
NO:6;
(e) the position corresponding to the cysteine at amino acid 159 of SEQ ID
NO:6;
(f) the position corresponding to the isoleucine at amino acid 419 of SEQ ID
NO:6.
(g) the position corresponding to the valine at amino acid 356 of SEQ ID
NO:10;
(h) the position corresponding to the serine at amino acid 421 of SEQ ID
NO:10;
(i) the position corresponding to the valine at amino acid 502 of SEQ ID
NO:10;
(j) the position corresponding to the alanine at amino acid 211 of SEQ ID
NO:10;
(k) the position corresponding to the glycine at amino acid 212 of SEQ ID
NO:10;
(l) the position corresponding to the isoleucine at amino acid 466 of SEQ ID
NO:10;
(m) the position corresponding to the proline at amino acid 369 of SEQ ID
NO:12;
(n) the position corresponding to the alanine at amino acid 226 of SEQ ID
NO:12;
(o) the position corresponding to the tyrosine at amino acid 432 of SEQ ID
NO:12;
(p) the position corresponding to the valine at amino acid 517 of SEQ ID
NO:12;
(q) the position corresponding to the tyrosine at amino acid 428 of SEQ ID
NO:16;
(r) the position corresponding to the proline at amino acid 365 of SEQ ID
NO:16;
(s) the position corresponding to the tyrosine at amino acid 449 of SEQ ID
NO:18;
(t) the position corresponding to the alanine at amino acid 175 of SEQ ID
NO:6;
and (u) the position corresponding to the leucine at amino acid 337 of SEQ ID
NO:6;
and wherein the second amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the serine at amino acid 305 of SEQ ID NO:2;
(b) the position corresponding to the threonine at amino acid 249 of SEQ ID
NO:2;
(c) the position corresponding to the proline at amino acid 118 of SEQ ID
NO:2;
(d) the position corresponding to the asparagine at amino acid 425 of SEQ ID
NO:2; and (e) the position corresponding to the tyrosine at amino acid 498 of SEQ ID
NO:2.
28. A nucleic acid molecule according to claim 27, wherein the first amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the arginine at amino acid 88 of SEQ ID
NO:6;
(b) the position corresponding to the alanine at amino acid 175 of SEQ ID
NO:6;
and (c) the position corresponding to the leucine at amino acid 337 of SEQ ID
NO:6.
and .
wherein the second amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the serine at amino acid 305 of SEQ ID NO:2;
(b) the position corresponding to the threonine at amino acid 249 of SEQ ID
NO:2;
(c) the position corresponding to the proline at amino acid 118 of SEQ ID
NO:2;
(d) the position corresponding to the asparagine at amino acid 425 of SEQ ID
NO:2; and (e) the position corresponding to the tyrosine at amino acid 498 of SEQ ID
NO:2.
(a) the position corresponding to the arginine at amino acid 88 of SEQ ID
NO:6;
(b) the position corresponding to the alanine at amino acid 175 of SEQ ID
NO:6;
and (c) the position corresponding to the leucine at amino acid 337 of SEQ ID
NO:6.
and .
wherein the second amino acid substitution occurs at a position selected from the group consisting of:
(a) the position corresponding to the serine at amino acid 305 of SEQ ID NO:2;
(b) the position corresponding to the threonine at amino acid 249 of SEQ ID
NO:2;
(c) the position corresponding to the proline at amino acid 118 of SEQ ID
NO:2;
(d) the position corresponding to the asparagine at amino acid 425 of SEQ ID
NO:2; and (e) the position corresponding to the tyrosine at amino acid 498 of SEQ ID
NO:2.
29. A nucleic acid molecule according to claim 1 having a double amino acid substitution, wherein one amino acid substitution occurs at the position corresponding to the leucine at amino acid 347 of SEQ ID NO:6, and wherein the second amino acid substitution occurs at the position corresponding to the alanine at amino acid 453 of SEQ ID NO:6.
30. A nucleic acid molecule according to claim 29 having a double amino acid substitution, wherein a leucine occurring at the position corresponding to amino acid 347 of SEQ ID NO:6 is replaced with a serine, and wherein an alanine occurring at the position corresponding to amino acid 453 of SEQ ID NO:6 is replaced with a threonine.
31. The nucleic acid molecule according to any one of claims 1 to 30, wherein said plant is selected from the group consisting of Arabidopsis, maize, wheat, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, and sugar cane, preferably maize or cotton.
32. A modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is encoded by the nucleotide sequence of any one of claims 1 to 30.
33. A chimeric gene comprising a promoter that is active in a plant operatively linked to the nucleic acid molecule any one of claims 1 to 30.
34. A recombinant vector comprising the chimeric gene according to claim 33.
35. A plant cell comprising the nucleic acid molecule according to any one of claims 1 to 30.
36. A plant, plant tissue, plant cell, or plant seed, including the progeny thereof, comprising the nucleic acid molecule according to any one of claims 1 to 30, wherein said nucleic acid molecule is expressed in said plant, plant tissue, plant cell, or plant seed or the progeny thereof confers tolerance thereupon to an inhibitor of naturally occurring protox activity.
37. A plant, plant tissue, plant cell, or plant seed, including the progeny thereof, according to claim 36, wherein said plant, plant tissue, plant cell, or plant seed or the progeny thereof is selected from the group consisting of Arabidopsis, sugar cane, soybean, barley, cotton, tobacco, sugar beet, oilseed rape, maize, wheat, sorghum, rye, oats, turf and forage grasses, millet, forage and rice.
38. A plant, plant tissue, plant cell, or plant seed, including the progeny thereof, according to claim 36, wherein said plant, plant tissue, plant cell, or plant seed or the progeny thereof is selected from the group consisting of Arabidopsis, soybean, cotton, sugar beet, oilseed rape, maize, wheat, sorghum, rice, and sugar cane.
39. A plant, plant tissue, plant cell, or plant seed, including the progeny thereof, selected from the group consisting of Arabidopsis, soybean, cotton, sugar beet, oilseed rape, maize, wheat, sorghum, rice, and sugar cane, comprising the nucleic acid molecule according to any one of claims 1 to 30.
40. A chimeric gene according to claim 33 comprising a promoter functional in a plant plastid operatively linked to the nucleic acid molecule according to any one of claims 1 to 30.
41. A chimeric gene according to claim 40, wherein said promoter functional in a plant plastid is a clpP gene promoter.
42. A plastid transformation vector comprising the nucleic acid molecule according to any one of claims 1 to 30.
43. A plant plastid comprising the plastid transformation vector according to claim 42.
44. A plant, plant tissue, plant cell, or plant seed, including the progeny thereof, comprising a plant plastid according to claim 43, wherein said modified plant protox enzyme is expressed in said plant, plant tissue, plant cell, or plant seed and confers upon said plant, plant tissue, plant cell, or plant seed tolerance to an inhibitor of naturally occurring protox activity.
45. A method for controlling the growth of undesired vegetation, which comprises applying to a population of a plant comprising a plant cell according to any one of claims 35 to 39 and 44 an effective amount of a protox-inhibiting herbicide.
46. A method for controlling the growth of undesired vegetation, which comprises applying to a population of a plant comprising a plant plastid according to claim 43 an effective amount of a protox-inhibiting herbicide.
47. A method according to any one of claims 45 and 46, wherein said protox-inhibiting herbicide is selected from the group consisting of an aryluracil, a diphenylether, an oxidiazole, an imide, a phenyl pyrazole, a pyridine derivative, a 3-substituted-2-aryl-4,5,6,7-tetrahydroindazole, a phenopylate and O-phenylpyrrolidino- and piperidinocarbamate analogs of said phenopylate.
48. A method according to claim 47, wherein said protox-inhibiting herbicide is an imide having formula V, VI, VII, VIIa, VIII, IX, IXa, or IXb.
49. A method according to claim 47, wherein said protox-inhibiting herbicide is a pyridyl pyrazole having formula XXIIIa or XXIIIb.
50. A method according to claim 47, wherein said protox-inhibiting herbicide is a phenylpyrazole having formula XXIV.
51. A method for selectively suppressing the growth of weeds in a field containing a crop of planted crop seeds or plants, comprising the steps of:
(a) planting herbicide tolerant crops or crop seeds, which comprise a plant cell according to any one of claims 35 to 39 and 44; or a plant plastid according to claim 43; and (b) applying to the crops or crop seeds and the weeds in the field a protox-inhibiting herbicide in amounts that inhibit naturally occurring protox activity, wherein the herbicide suppresses the growth of the weeds without significantly suppressing the growth of the crops.
(a) planting herbicide tolerant crops or crop seeds, which comprise a plant cell according to any one of claims 35 to 39 and 44; or a plant plastid according to claim 43; and (b) applying to the crops or crop seeds and the weeds in the field a protox-inhibiting herbicide in amounts that inhibit naturally occurring protox activity, wherein the herbicide suppresses the growth of the weeds without significantly suppressing the growth of the crops.
52. A nucleic acid molecule comprising a nucleotide sequence that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is resistant to an inhibitor of the naturally occurring form of said enzyme, wherein said modified enzyme comprises at least one amino acid sub-sequence selected from the group consisting of:
(a) KA.DELTA.18F, wherein .DELTA.18 is an amino acid other than alanine, (b) Q.DELTA.19H, wherein .DELTA.19 is an amino acid other than leucine, (c) AP.DELTA.1F, wherein .DELTA.1 is leucine, (d) .OMEGA.7IG, wherein .DELTA.7 is histidine, wherein said nucleotide sequence that encodes said modified enzyme hybridizes to any one of the nucleotide sequences set forth in SEQ ID NO:1, SEQ ID NO:5, SEQ
ID
NO:9, SEQ ID NO:11, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ
ID NO:23 or SEQ ID NO:36 under the following conditions:
(i) hybridization in 7% sodium dodecyl sulfate (SDS), 0.5 M NaPO4 pH 7.0, 1 mM EDTA at 50°C; and (ii) wash in 2X SSC, 1 % SDS at 50°C.
(a) KA.DELTA.18F, wherein .DELTA.18 is an amino acid other than alanine, (b) Q.DELTA.19H, wherein .DELTA.19 is an amino acid other than leucine, (c) AP.DELTA.1F, wherein .DELTA.1 is leucine, (d) .OMEGA.7IG, wherein .DELTA.7 is histidine, wherein said nucleotide sequence that encodes said modified enzyme hybridizes to any one of the nucleotide sequences set forth in SEQ ID NO:1, SEQ ID NO:5, SEQ
ID
NO:9, SEQ ID NO:11, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ
ID NO:23 or SEQ ID NO:36 under the following conditions:
(i) hybridization in 7% sodium dodecyl sulfate (SDS), 0.5 M NaPO4 pH 7.0, 1 mM EDTA at 50°C; and (ii) wash in 2X SSC, 1 % SDS at 50°C.
53. The nucleic acid molecule according to claim 52, wherein the nucleotide sequence that encodes the naturally occurring form of said enzyme is derived from a plant.
54. A modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is encoded by the nucleotide sequence of claim 52.
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US37369199A | 1999-08-13 | 1999-08-13 | |
| US09/373,691 | 1999-08-13 | ||
| PCT/EP2000/006127 WO2001012825A1 (en) | 1999-08-13 | 2000-06-30 | Herbicide-tolerant protoporphyrinogen oxidase |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CA2381927A1 true CA2381927A1 (en) | 2001-02-22 |
Family
ID=23473465
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CA002381927A Abandoned CA2381927A1 (en) | 1999-08-13 | 2000-06-30 | Herbicide-tolerant protoporphyrinogen oxidase |
Country Status (7)
| Country | Link |
|---|---|
| EP (1) | EP1200611A1 (en) |
| JP (1) | JP2003507019A (en) |
| CN (1) | CN1373811A (en) |
| AR (1) | AR024642A1 (en) |
| AU (1) | AU5536000A (en) |
| CA (1) | CA2381927A1 (en) |
| WO (1) | WO2001012825A1 (en) |
Families Citing this family (92)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2662092C (en) | 2003-04-29 | 2012-07-17 | Pioneer Hi-Bred International, Inc. | Novel glyphosate-n-acetyltransferase (gat) genes |
| JP4720223B2 (en) | 2004-05-18 | 2011-07-13 | 住友化学株式会社 | Plants resistant to herbicidal active compounds |
| BRPI0610371A2 (en) | 2005-05-02 | 2010-06-15 | Purdue Research Foundation | processes for increasing the yield of fermentable sugars from vegetable straw |
| AR059724A1 (en) | 2006-03-02 | 2008-04-23 | Athenix Corp | METHODS AND COMPOSITIONS TO IMPROVE ENZYMATIC ACTIVITY IN TRANSGENIC PLANTS |
| US7951995B2 (en) | 2006-06-28 | 2011-05-31 | Pioneer Hi-Bred International, Inc. | Soybean event 3560.4.3.5 and compositions and methods for the identification and detection thereof |
| EP2561749A1 (en) * | 2007-04-04 | 2013-02-27 | BASF Plant Science GmbH | AHAS mutants |
| US7964774B2 (en) | 2008-05-14 | 2011-06-21 | Monsanto Technology Llc | Plants and seeds of spring canola variety SCV384196 |
| US8697941B2 (en) | 2008-07-23 | 2014-04-15 | Pioneer Hi-Bred International, Inc. | Molecular markers linked to PPO inhibitor tolerance in soybeans |
| US8748695B2 (en) | 2008-07-23 | 2014-06-10 | Pioneer Hi-Bred International, Inc. | Molecular markers linked to PPO inhibitor tolerance in soybeans |
| NZ592464A (en) | 2008-09-26 | 2013-05-31 | Basf Agrochemical Products Bv | Herbicide resistant acetohydroxyacid synthase large subunit (AHAS) mutants and methods of use thereof |
| US8373025B2 (en) | 2009-02-09 | 2013-02-12 | Chromatin Germplasm, Llc | Herbicide resistant sorghum |
| MX2011013224A (en) | 2009-06-09 | 2012-06-01 | Pioneer Hi Bred Int | Early endosperm promoter and methods of use. |
| JP2011083260A (en) * | 2009-10-19 | 2011-04-28 | Chubu Electric Power Co Inc | Chrysanthemum plant and method for creating the same |
| US8778672B2 (en) | 2009-10-26 | 2014-07-15 | Pioneer Hi Bred International Inc | Somatic ovule specific promoter and methods of use |
| CA2788198C (en) | 2010-01-26 | 2021-01-19 | Pioneer Hi-Bred International, Inc. | Hppd-inhibitor herbicide tolerance |
| WO2013028188A1 (en) * | 2011-08-24 | 2013-02-28 | Cibus Us Llc | Mutated protoporphyrinogen ix oxidase (ppx) genes |
| CN103237894A (en) | 2010-08-13 | 2013-08-07 | 先锋国际良种公司 | Compositions and methods comprising sequences having hydroxyphenylpyruvate dioxygenase (HPPD) activity |
| AU2010364322C1 (en) | 2010-11-24 | 2013-09-19 | E. I. Du Pont De Nemours And Company | Brassica GAT event DP-073496-4 and compositions and methods for the identification and/or detection thereof |
| WO2012071039A1 (en) | 2010-11-24 | 2012-05-31 | Pioner Hi-Bred International, Inc. | Brassica gat event dp-061061-7 and compositions and methods for the identification and/or detection thereof |
| TWI667347B (en) | 2010-12-15 | 2019-08-01 | 瑞士商先正達合夥公司 | Soybean event syht0h2 and compositions and methods for detection thereof |
| US8785729B2 (en) | 2011-08-09 | 2014-07-22 | Nunhems, B.V. | Lettuce variety redglace |
| US8754293B2 (en) | 2011-09-09 | 2014-06-17 | Nunhems B.V. | Lettuce variety intred |
| BR112014005951A2 (en) | 2011-09-13 | 2017-04-04 | Monsanto Technology Llc | Weed control methods and compositions |
| CA2848695A1 (en) | 2011-09-13 | 2013-03-21 | Monsanto Technology Llc | Methods and composition for weed control comprising inhibiting ppg oxidase |
| CN103958539B (en) | 2011-09-13 | 2019-12-17 | 孟山都技术公司 | Methods and compositions for weed control |
| ES2645927T3 (en) | 2011-09-13 | 2017-12-11 | Monsanto Technology Llc | Procedures and compositions for weed control |
| EP2756086B1 (en) | 2011-09-13 | 2018-02-21 | Monsanto Technology LLC | Methods and compositions for weed control |
| UA116091C2 (en) | 2011-09-13 | 2018-02-12 | Монсанто Текнолоджи Ллс | Methods and compositions for weed control |
| CA2848576A1 (en) | 2011-09-13 | 2013-03-21 | Monsanto Technology Llc | Methods and compositions for weed control comprising topical application of 4-hydroxyphenyl-pyruvate-dioxygenase (hppd)-inhibiting polynucleotides |
| CN103957696B (en) | 2011-09-13 | 2019-01-18 | 孟山都技术公司 | Method and composition for Weeds distribution |
| WO2013096818A1 (en) | 2011-12-21 | 2013-06-27 | The Curators Of The University Of Missouri | Soybean variety s05-11268 |
| WO2013096810A1 (en) | 2011-12-21 | 2013-06-27 | The Curators Of The University Of Missouri | Soybean variety s05-11482 |
| US9380756B2 (en) | 2012-01-04 | 2016-07-05 | Nunhems B.V. | Lettuce variety multigreen 50 |
| US9006515B2 (en) | 2012-01-06 | 2015-04-14 | Pioneer Hi Bred International Inc | Pollen preferred promoters and methods of use |
| EP2800816A1 (en) | 2012-01-06 | 2014-11-12 | Pioneer Hi-Bred International Inc. | Ovule specific promoter and methods of use |
| US9499831B2 (en) | 2012-01-17 | 2016-11-22 | Pioneer Hi-Bred International, Inc. | Plant transcription factors, promoters and uses thereof |
| EA201491670A1 (en) | 2012-03-13 | 2015-07-30 | Пайонир Хай-Бред Интернэшнл, Инк. | GENETIC REDUCTION OF MALE REPRODUCTIVE FUNCTION IN PLANTS |
| WO2013138309A1 (en) | 2012-03-13 | 2013-09-19 | Pioneer Hi-Bred International, Inc. | Genetic reduction of male fertility in plants |
| US8859857B2 (en) | 2012-04-26 | 2014-10-14 | Monsanto Technology Llc | Plants and seeds of spring canola variety SCV259778 |
| US8878009B2 (en) | 2012-04-26 | 2014-11-04 | Monsanto Technology, LLP | Plants and seeds of spring canola variety SCV318181 |
| US8835720B2 (en) | 2012-04-26 | 2014-09-16 | Monsanto Technology Llc | Plants and seeds of spring canola variety SCV967592 |
| WO2013188291A2 (en) | 2012-06-15 | 2013-12-19 | E. I. Du Pont De Nemours And Company | Methods and compositions involving als variants with native substrate preference |
| AR091489A1 (en) * | 2012-06-19 | 2015-02-11 | Basf Se | PLANTS THAT HAVE A GREATER TOLERANCE TO HERBICIDES INHIBITORS OF PROTOPORFIRINOGENO OXIDASA (PPO) |
| WO2014059155A1 (en) | 2012-10-11 | 2014-04-17 | Pioneer Hi-Bred International, Inc. | Guard cell promoters and uses thereof |
| US20140173781A1 (en) | 2012-12-13 | 2014-06-19 | Pioneer Hi-Bred International, Inc. | Methods and compositions for producing and selecting transgenic wheat plants |
| US20150351390A1 (en) | 2012-12-21 | 2015-12-10 | Pioneer Hi-Bred International, Inc. | Compositions and methods for auxin-analog conjugation |
| AU2014241045B2 (en) | 2013-03-13 | 2017-08-31 | Pioneer Hi-Bred International, Inc. | Glyphosate application for weed control in brassica |
| BR112015023304A2 (en) | 2013-03-14 | 2017-07-18 | Pioneer Hi Bred Int | method to improve abiotic stress tolerance of a plant, plant and seed |
| BR112015023286A2 (en) | 2013-03-14 | 2018-03-06 | Arzeda Corp | recombinant polypeptide with dicamba decarboxylase activity, polynucleotide construct, cell, method of producing a host cell comprising a heterologous polynucleotide encoding a dicamba decarboxylase activity, method for decarboxylating dicamba, a dicamba derivative or a dicamba metabolite, method for detecting a polypeptide and method for detecting the presence of a polynucleotide encoding a polypeptide having dicamba decarboxylase activity |
| AU2014236154A1 (en) | 2013-03-14 | 2015-09-17 | Pioneer Hi-Bred International, Inc. | Compositions having dicamba decarboxylase activity and methods of use |
| CN108998471B (en) | 2013-03-14 | 2022-11-04 | 先锋国际良种公司 | Compositions and methods for controlling insect pests |
| US10023877B2 (en) | 2013-03-15 | 2018-07-17 | Pioneer Hi-Bred International, Inc. | PHI-4 polypeptides and methods for their use |
| US20140283216A1 (en) | 2013-03-15 | 2014-09-18 | Pioneer Hi Bred International Inc | Compositions and methods of use of acc oxidase polynucleotides and polypeptides |
| US20160219812A1 (en) | 2013-07-25 | 2016-08-04 | Pioneer Hi-Bred International, Inc. | Method for producing hybrid brassica seed |
| EA030896B1 (en) | 2013-08-16 | 2018-10-31 | Пайонир Хай-Бред Интернэшнл, Инк. | Insecticidal proteins and methods for their use |
| ES2937045T3 (en) | 2013-09-13 | 2023-03-23 | Pioneer Hi Bred Int | Insecticidal proteins and methods of their use |
| WO2015057600A1 (en) | 2013-10-18 | 2015-04-23 | E. I. Du Pont De Nemours And Company | Glyphosate-n-acetyltransferase (glyat) sequences and methods of use |
| US20160272997A1 (en) | 2013-10-25 | 2016-09-22 | Pioneer Hi-Bred International, Inc. | Stem canker tolerant soybeans and methods of use |
| MX368629B (en) | 2014-01-15 | 2019-10-08 | Monsanto Technology Llc | Methods and compositions for weed control using epsps polynucleotides. |
| CN114763376A (en) | 2014-02-07 | 2022-07-19 | 先锋国际良种公司 | Insecticidal proteins and methods of use thereof |
| CN117903266A (en) | 2014-02-07 | 2024-04-19 | 先锋国际良种公司 | Insecticidal proteins and methods of use thereof |
| CA2955828A1 (en) | 2014-08-08 | 2016-02-11 | Pioneer Hi-Bred International, Inc. | Ubiquitin promoters and introns and methods of use |
| US20170247719A1 (en) | 2014-09-17 | 2017-08-31 | Pioneer Hi-Bred International, Inc. | Compositions and methods to control insect pests |
| BR112017007932A2 (en) | 2014-10-16 | 2018-01-23 | Du Pont | insecticide proteins and methods for their use |
| US20170359965A1 (en) | 2014-12-19 | 2017-12-21 | E I Du Pont De Nemours And Company | Polylactic acid compositions with accelerated degradation rate and increased heat stability |
| WO2016186986A1 (en) | 2015-05-19 | 2016-11-24 | Pioneer Hi Bred International Inc | Insecticidal proteins and methods for their use |
| BR112017027382A2 (en) | 2015-06-16 | 2018-08-28 | Pioneer Hi-Bred International, Inc. | silencing element, dna construct, expression construct, expression cassette, host cell, composition, plant cell, plant or plant part, transgenic seed, method for controlling a plant insect pest, kit for controlling insect pests |
| UA126894C2 (en) * | 2015-08-03 | 2023-02-22 | Монсанто Текнолоджі Ллс | Methods and compositions for herbicide tolerance in plants |
| CN116003550A (en) | 2015-08-06 | 2023-04-25 | 先锋国际良种公司 | Insecticidal proteins of plant origin and methods of use thereof |
| WO2017105987A1 (en) | 2015-12-18 | 2017-06-22 | Pioneer Hi-Bred International, Inc. | Insecticidal proteins and methods for their use |
| WO2017112006A1 (en) | 2015-12-22 | 2017-06-29 | Pioneer Hi-Bred International, Inc. | Tissue-preferred promoters and methods of use |
| BR112018016057A2 (en) | 2016-02-05 | 2019-01-29 | Pioneer Hi Bred Int | methods for selecting a soybean plant or soybean germplasm with enhanced resistance to brown stem rot infection and kit |
| EP3451837B1 (en) | 2016-05-04 | 2021-08-25 | Pioneer Hi-Bred International, Inc. | Insecticidal proteins and methods for their use |
| CA3022858A1 (en) | 2016-06-16 | 2017-12-21 | Pioneer Hi-Bred International, Inc. | Compositions and methods to control insect pests |
| US10563218B2 (en) | 2016-06-16 | 2020-02-18 | Nuseed Pty Ltd | Inbred transgenic canola line NS-B50027-4 and seeds thereof |
| EP3472281A4 (en) | 2016-06-16 | 2020-02-19 | Nuseed Pty Ltd | Elite event canola ns-b50027-4 |
| EP3475430B1 (en) | 2016-06-24 | 2022-06-01 | Pioneer Hi-Bred International, Inc. | Plant regulatory elements and methods of use thereof |
| WO2018005411A1 (en) | 2016-07-01 | 2018-01-04 | Pioneer Hi-Bred International, Inc. | Insecticidal proteins from plants and methods for their use |
| WO2018013333A1 (en) | 2016-07-12 | 2018-01-18 | Pioneer Hi-Bred International, Inc. | Compositions and methods to control insect pests |
| EP4050021A1 (en) | 2016-11-01 | 2022-08-31 | Pioneer Hi-Bred International, Inc. | Insecticidal proteins and methods for their use |
| MX2019007469A (en) | 2016-12-20 | 2020-02-07 | Basf Agro Bv | Plants having increased tolerance to herbicides. |
| BR112020006045A2 (en) | 2017-09-25 | 2020-10-06 | Pioneer Hi-Bred International, Inc. | nucleic acid molecule, expression cassette, vector, plant cell, plant, plant seed, method for producing a transgenic plant, transgenic plant, transgenic plant seed, method for improving somatic embryo maturation efficiency and method for producing a transgenic dicot plant or a transgenic gymnosperm plant |
| BR112020023800A2 (en) | 2018-05-22 | 2021-02-23 | Pioneer Hi-Bred International, Inc. | plant regulatory elements and methods of using them |
| EP3833747A1 (en) | 2018-06-28 | 2021-06-16 | Pioneer Hi-Bred International, Inc. | Methods for selecting transformed plants |
| CA3111090A1 (en) | 2018-10-31 | 2020-05-07 | Pioneer Hi-Bred International, Inc. | Compositions and methods for ochrobactrum-mediated plant transformation |
| CA3186978A1 (en) | 2020-07-14 | 2022-01-20 | Pioneer Hi-Bred International, Inc. | Insecticidal proteins and methods for their use |
| EP4203677A1 (en) | 2020-08-26 | 2023-07-05 | Vindara, Inc. | Method and/or compositions for lettuce (lactuca sativa) breeding and/or varieties developed thereby |
| CN112175985B (en) * | 2020-09-11 | 2022-08-19 | 南开大学 | Method for improving herbicide resistance of leguminous plants and application thereof |
| CN115340987B (en) * | 2021-05-12 | 2023-12-01 | 北京大北农生物技术有限公司 | Herbicide tolerance protein, coding gene and application thereof |
| CN115336534A (en) * | 2021-05-12 | 2022-11-15 | 北京大北农生物技术有限公司 | Use of protoporphyrinogen oxidase |
| WO2023185306A1 (en) * | 2022-03-29 | 2023-10-05 | 青岛清原化合物有限公司 | Ppo2 polypeptide having tolerance to ppo inhibitor herbicide and application |
| WO2023206126A1 (en) * | 2022-04-27 | 2023-11-02 | 北京大北农生物技术有限公司 | Use of protoporphyrinogen oxidase |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5767373A (en) * | 1994-06-16 | 1998-06-16 | Novartis Finance Corporation | Manipulation of protoporphyrinogen oxidase enzyme activity in eukaryotic organisms |
| US6084155A (en) * | 1995-06-06 | 2000-07-04 | Novartis Ag | Herbicide-tolerant protoporphyrinogen oxidase ("protox") genes |
| KR100493500B1 (en) * | 1996-02-28 | 2006-09-20 | 신젠타 파티서페이션즈 아게 | Dna molecules encoding plant protoporphyrinogen oxidase and inhibitor-resistant mutants thereof |
-
2000
- 2000-06-30 EP EP00940419A patent/EP1200611A1/en not_active Withdrawn
- 2000-06-30 WO PCT/EP2000/006127 patent/WO2001012825A1/en not_active Application Discontinuation
- 2000-06-30 CA CA002381927A patent/CA2381927A1/en not_active Abandoned
- 2000-06-30 AU AU55360/00A patent/AU5536000A/en not_active Abandoned
- 2000-06-30 CN CN 00812881 patent/CN1373811A/en active Pending
- 2000-06-30 JP JP2001516912A patent/JP2003507019A/en active Pending
- 2000-07-03 AR ARP000103390 patent/AR024642A1/en unknown
Also Published As
| Publication number | Publication date |
|---|---|
| AR024642A1 (en) | 2002-10-16 |
| JP2003507019A (en) | 2003-02-25 |
| AU5536000A (en) | 2001-03-13 |
| EP1200611A1 (en) | 2002-05-02 |
| WO2001012825A1 (en) | 2001-02-22 |
| CN1373811A (en) | 2002-10-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US6308458B1 (en) | Herbicide-tolerant plants and methods of controlling the growth of undesired vegetation | |
| US6808904B2 (en) | Herbicide-tolerant protox genes produced by DNA shuffling | |
| AU724893B2 (en) | DNA molecules encoding plant protoporphyrinogen oxidase and inhibitor-resistant mutants thereof | |
| CA2381927A1 (en) | Herbicide-tolerant protoporphyrinogen oxidase | |
| US5939602A (en) | DNA molecules encoding plant protoporphyrinogen oxidase and inhibitor-resistant mutants thereof | |
| US20020073443A1 (en) | Herbicide tolerance achieved through plastid transformation | |
| US5767373A (en) | Manipulation of protoporphyrinogen oxidase enzyme activity in eukaryotic organisms | |
| WO2001068826A2 (en) | Protoporphyrinogen oxidase ('protox') genes | |
| US6023012A (en) | DNA molecules encoding plant protoporphyrinogen oxidase |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| EEER | Examination request | ||
| FZDE | Discontinued |