WO2025212475A2 - Compositions and methods to detect infectious organisms - Google Patents

Compositions and methods to detect infectious organisms

Info

Publication number
WO2025212475A2
WO2025212475A2 PCT/US2025/022250 US2025022250W WO2025212475A2 WO 2025212475 A2 WO2025212475 A2 WO 2025212475A2 US 2025022250 W US2025022250 W US 2025022250W WO 2025212475 A2 WO2025212475 A2 WO 2025212475A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
fusion protein
pos
neg
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
PCT/US2025/022250
Other languages
French (fr)
Other versions
WO2025212475A3 (en
Inventor
Christian Leutenegger
Irina SOKOLCHIK
Isabelle CAYA
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Mars Inc
Original Assignee
Mars Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Mars Inc filed Critical Mars Inc
Publication of WO2025212475A2 publication Critical patent/WO2025212475A2/en
Publication of WO2025212475A3 publication Critical patent/WO2025212475A3/en
Pending legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/29—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Richettsiales (O)
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/65—Tetracyclines
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/14—Extraction; Separation; Purification
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62—DNA sequences coding for fusion proteins
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56911—Bacteria
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00—Detection or diagnosis of diseases
    • G01N2800/26—Infectious diseases, e.g. generalised sepsis

Definitions

  • 069269.0734 PATENT COMPOSITIONS AND METHODS TO DETECT INFECTIOUS ORGANISMS CROSS-REFERENCES TO RELATED APPLICATIONS
  • This application claims the benefit of priority to U.S. Provisional Patent Application No. 63/573,691, filed April 3, 2024, the content of which is incorporated herein by reference in its entirety, and to which priority is claimed.
  • SEQUENCE LISTING The instant application contains a Sequence Listing which has been submitted electronically in xml format and is hereby incorporated by reference in its entirety. Said xml file, created on 26 March 2025, is named 0692690734.xml and is 27,608 bytes in size.
  • the present disclosure relates to compositions and methods for the detection of infectious organisms, including Ehrlichia spp.
  • the infectious organism is Ehrlichia ewingii.
  • BACKGROUND The Ehrlichiae are a group of gram-negative, obligate intracellular cocci that infect different blood cells in many animal species, as well as in humans. Although these pathogens share phylogenetic similarities, there are multiple differences from tick vectors to host-cell tropism and clinical manifestations. Dogs are susceptible to infection with multiple Ehrlichia spp.; among those are E. canis, transmitted by Rhipicephalus sanguineus (brown dog tick), and E. chaffeensis and E.
  • IFA indirect fluorescent antibody
  • CDC.gov the reference standard serologic ACTIVE 508032486.1 1 069269.0734 PATENT test for diagnosis of Ehrlichiosis (CDC.gov) and is being widely used testing method due to its simplicity and cost-effectiveness compared to other approaches.
  • the present disclosure provides a fusion protein comprising the amino sequence set forth in SEQ ID NO: 1 or a variant thereof, SEQ ID NO: 2 or a variant thereof, SEQ ID NO: 3 or a variant thereof, SEQ ID NO: 4 or a variant thereof, SEQ ID NO: 5 or a variant thereof, SEQ ID NO: 6 or a variant thereof, SEQ ID NO: 7 or a variant thereof, SEQ ID NO: 8 or a variant thereof, SEQ ID NO: 9 or a variant thereof, or a combination thereof.
  • the present disclosure also provides a fusion protein comprising the amino sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof.
  • the present disclosure provides a fusion protein comprising at least two polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof.
  • the fusion protein comprises at least five polypeptides. In certain embodiments, the fusion protein comprises at least eight polypeptides. In certain embodiments, the fusion protein comprises at least eleven polypeptides. In certain embodiments, the fusion protein further comprises a linker. In certain embodiments, the fusion protein has an isoelectric point between about 4.50 and about 4.60. In ACTIVE 508032486.1 2 069269.0734 PATENT certain embodiments, the isoelectric point is about 4.58. In certain embodiments, the fusion protein has a molecular weight between about 23.0 kDa and about 27.0 kDa.
  • the molecular weight is about 24.3 kDa, 24.4 kDa, or 24.8 kDa. In certain embodiments, the molecular weight is about 24.8 kDa.
  • the fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 15.
  • the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 15. In certain embodiments, the fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 15. In certain embodiments, the fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 12.
  • the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 12. In certain embodiments, the fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 12. In certain embodiments, the fusion protein further comprises a tag. In certain non-limiting embodiments, the present disclosure provides a nucleic acid molecule comprising a polynucleotide encoding the fusion protein disclosed herein. Moreover, the present disclosure provides a vector comprising the nucleic acid molecule disclosed herein. Also provided is a host cell comprising the fusion protein, the nucleic acid molecule, or the vector disclosed herein. In certain embodiments, the host cell is E. coli.
  • the second fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16 or SEQ ID NO: 17.
  • the ACTIVE 508032486.1 3 069269.0734 PATENT second fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 16 or SEQ ID NO: 17.
  • the composition or the solid phase support further comprises a second fusion protein and a third fusion protein.
  • the second fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 16, and b) the third fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 17.
  • the second fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16, and b) the third fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 17.
  • a) the second fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 16, and b) the third fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 17.
  • the present disclosure provides a method of detecting an antibody binding an infectious organism in a subject comprising contacting the fusion protein, the composition, or the solid phase support disclosed herein with a sample from the subject and detecting a complex formed between the antibody and the fusion protein.
  • the infectious organism is E. ewingii.
  • the antibody specifically binds to an epitope of E. ewingii.
  • the sample is a serum sample, a plasma sample, a blood sample, or a combination thereof.
  • the fusion protein is immobilized on a solid phase support.
  • the subject is a dog.
  • the present disclosure provides a method of identifying a subject having an E. ewingii infection.
  • the method comprises contacting the fusion protein, the composition, or the solid phase support disclosed herein with a sample from the subject.
  • the method comprises detecting a complex formed between the sample and the fusion protein, the composition, or the solid phase.
  • an increased level of detected complexes relative to a normal control indicates that the subject has an E. ewingii infection.
  • the sample is a serum sample, a plasma sample, a blood sample, or a combination thereof.
  • the subject is a dog.
  • the present disclosure provides a method of identifying a subject having Lyme disease.
  • the method comprises contacting the fusion protein, the composition, or the solid phase support disclosed herein with a sample from the subject.
  • the method comprises detecting a complex ACTIVE 508032486.1 4 069269.0734 PATENT formed between the sample and the fusion protein, the composition, or the solid phase.
  • an increased level of detected complexes relative to a normal control indicates that the subject has Lyme disease.
  • the sample is a serum sample, a plasma sample, a blood sample, or a combination thereof.
  • the subject is a dog.
  • the present disclosure provides a kit comprising contacting the fusion protein, the composition, or the solid phase support disclosed herein.
  • the present disclosure provides a method of preventing, treating, and/or delaying progression of E. ewingii infection of a subject in need thereof comprising administering an antibiotic to the subject.
  • the antibiotic is selected from clindamycin, metronidazole, amoxicillin, cephalexin, doxycycline, enrofloxacin, gentamicin, trimethoprim, sulfamethoxazole, clavamox, chloramphenicol, cefpodoxime, tetracycline, marbofloxacin, antirobe, ciprofloxacin, albon, amoxicillin, baytril, biomox amoxicillin, cephalexin, amoxicillin, clavulanic acid, ketoconazole, sulfadimethoxine, or a combination thereof.
  • the antibiotic is doxycycline.
  • the antibiotic is selected from clindamycin, metronidazole, amoxicillin, cephalexin, doxycycline, enrofloxacin, gentamicin, trimethoprim, sulfamethoxazole, clavamox, chloramphenicol, cefpodoxime, tetracycline, marbofloxacin, antirobe, ciprofloxacin, albon, amoxicillin, baytril, biomox amoxicillin, cephalexin, amoxicillin, clavulanic acid, ketoconazole, sulfadimethoxine, or a combination thereof.
  • the antibiotic is doxycycline.
  • the subject is a dog.
  • DETAILED DESCRIPTION T o date, there is a need to identify and differentiate Ehrlichia spp. since false negatives are often observed using conventional methods (e.g., qPCR).
  • the present disclosure relates to compositions and methods that can be used to improve the detection of infectious diseases.
  • the use of the word “a” or “an” when used in conjunction with the term “comprising” in the claims and/or the specification can mean “one,” but it is also consistent with the meaning of “one or more,” “at least one,” and “one or more than one.”
  • the term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within 3 or more than 3 standard deviations, per the practice in the art.
  • “about” can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably still up to 1% of a given value.
  • the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value.
  • the terms “comprise(s),” “include(s),” “having,” “has,” “can,” “contain(s),” and variants thereof, as used herein, are intended to be open-ended transitional phrases, terms, or words that do not preclude the possibility of additional acts or structures.
  • nucleic acid molecule and “nucleotide sequence,” as used herein, refers to a single or double-stranded covalently linked sequence of nucleotides in which phosphodiester bonds join the 3' and 5' ends on each nucleotide.
  • the nucleic acid molecule can include ACTIVE 508032486.1 6 069269.0734 PATENT deoxyribonucleotide bases or ribonucleotide bases and can be manufactured synthetically in vitro or isolated from natural sources.
  • polypeptide refers to a molecule formed from the linking of at least two amino acids.
  • the link between one amino acid residue and the next is an amide bond and is sometimes referred to as a peptide bond.
  • a polypeptide can be obtained by a suitable method known in the art, including isolation from natural sources, expression in a recombinant expression system, chemical synthesis, or enzymatic synthesis.
  • the terms can apply to amino acid polymers in which one or more amino acid residues is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.
  • Non-limiting examples of amino acids include tryptophan, phenylalanine, histidine, glycine, cysteine, alanine, tyrosine, serine, methionine, asparagine, leucine, asparagine, threonine, isoleucine, proline, glutamic acid, aspartic acid, hydroxyl proline, arginine, cystine, glutamine, lysine, valine, ornithine, taurine, and combinations thereof.
  • an expression vector refers to a recombinant DNA or RNA construct, such as a plasmid, a phage, a recombinant virus, or another vector that, upon introduction into an appropriate host cell, results in the expression of the cloned DNA.
  • Appropriate expression vectors are well known to those of skill in the art and include those that are replicable in eukaryotic cells and/or prokaryotic cells and those that remain episomal or those that integrate into the host cell genome.
  • a promoter region or promoter element refers to a segment of DNA or RNA that controls transcription of the DNA or RNA to which it is operatively linked.
  • the fusion protein includes at least six polypeptides comprising ACTIVE 508032486.1 11 069269.0734 PATENT the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof.
  • the fusion protein includes at least seven polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof.
  • the fusion protein includes at least eight polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof.
  • the fusion protein includes at least nine polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof.
  • the fusion protein includes at least ten polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof.
  • the fusion protein includes at least eleven polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof.
  • the fusion protein includes at least twelve polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein includes at least thirteen polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof.
  • the fusion protein includes at least fourteen polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof.
  • the fusion protein includes at least fifteen polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof.
  • SEQ ID NOs: 1-9 are provided below.
  • the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 1. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 2 or a variant thereof. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 2. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 3 or a variant thereof. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 3. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 4 or a variant thereof.
  • the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 4. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 5 or a variant thereof. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 5. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 6 or a variant thereof. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 6. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 7 or a variant thereof.
  • the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 7. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 8 or a variant thereof. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 8. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 9 or a variant thereof. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 9. In certain embodiments, the fusion protein comprises a tag sequence.
  • a “tag” or an “epitope tag” refers to a sequence of amino acids, typically added to the N- and/or C- terminus of a polypeptide. The inclusion of tags fused to a polypeptide can facilitate polypeptide ACTIVE 508032486.1 13 069269.0734 PATENT purification and/or detection.
  • a tag or tag polypeptide refers to a polypeptide that has enough residues to provide an epitope recognized by an antibody or can serve for detection or purification, yet is short enough such that it does not interfere with the activity of chimeric polypeptide to which it is linked.
  • the tag polypeptide typically is sufficiently unique so an antibody that specifically binds thereto does not substantially cross-react with epitopes in the polypeptide to which it is linked. Suitable tag polypeptides generally have at least 5 or 6 amino acid residues and usually between about 8-50 amino acid residues, typically between 9-30 residues.
  • the tags can be linked to one or more chimeric polypeptides in a multimer and permit detection of the multimer or its recovery from a sample or mixture. Such tags are well-known and can be readily synthesized and designed.
  • Exemplary tag polypeptides include those used for affinity purification and include His tags, the influenza hemagglutinin (HA) tag polypeptide, and its antibody 12CA5; the c-Myc tag and the 8F9, 3C7, 6E10, G4, B7 and 9E10 antibodies thereto; and the Herpes Simplex virus glycoprotein D (gD) tag and its antibody. See, e.g., Field et al. (1988) Mol. Cell. Biol.8:2159-2165; Evan et al. (1985) Mol. Cell. Biol.5:3610-3616; Paborsky et al. (1990) Protein Engineering 3:547-553.
  • His tags the influenza hemagglutinin (HA) tag polypeptide, and its antibody 12CA5
  • gD Herpes Simplex virus glycoprotein D
  • the fusion protein comprises an amino acid linker between the polypeptides.
  • Linkers are short polypeptide sequences, typically between 1 amino acid residue and 20 amino acid residues, that occur between polypeptides (e.g., one having an amino acid sequence set forth in SEQ ID Nos: 1-9).
  • Linkers are often composed of flexible residues like glycine and serine so that the adjacent polypeptides are free to move relative to one another. Conventionally, longer linkers are used when it is necessary to ensure that two adjacent domains do not sterically interfere with one another.
  • the presently disclosed fusion protein has an isoelectric point between about 4.50 and about 4.60.
  • the presently disclosed fusion protein has an isoelectric point between about 4.51 and about 4.60, between about 4.52 and about 4.60, between about 4.53 and about 4.60, between about 4.54 and about 4.60, between about 4.55 and about 4.60, between about 4.56 and about 4.60, between about 4.57 and about 4.60, between about 4.58 and about 4.60, between about 4.59 and about 4.60, between about 4.50 and about 4.59, between about 4.50 and about 4.58, between about 4.50 and about 4.57, between about 4.50 and about 4.56, between about 4.50 and about 4.55, between about 4.50 and about 4.54, between about 4.50 and about 4.53, between about 4.50 and about 4.52, between about 4.50 and about 4.51, between about 4.52 and about 4.54, between about 4.55 and about 4.57, or between about 4.57 and about 4.59.
  • the presently disclosed fusion protein has an isoelectric point of about 4.58. ACTIVE 508032486.1 14 069269.0734 PATENT In certain embodiments, the presently disclosed fusion protein has a molecular weight between about 23.0 kDa and about 27.0 kDa.
  • the presently disclosed fusion protein has a molecular weight between about 23.0 kDa and about 27.0 kDa, between about 23.0 kDa and about 26.5 kDa, between about 23.0 kDa and about 25.0 kDa, between about 23.0 kDa and about 25.5 kDa, between about 23.0 kDa and about 25.0 kDa, between about 23.0 kDa and about 24.5 kDa, between about 23.0 kDa and about 24.0 kDa, between about 24.0 kDa and about 24.1 kDa, between about 24.0 kDa and about 24.2 kDa, between about 24.0 kDa and about 24.3 kDa, between about 24.0 kDa and about 24.4 kDa, between about 24.0 kDa and about 24.5 kDa, between about 24.0 kDa and about 24.6 kDa, between about 24.0 kDa
  • the presently disclosed fusion protein has a molecular weight of about 24.3 kDa. In certain embodiments, the presently disclosed fusion protein has a molecular weight of about 24.4 kDa. In certain embodiments, the presently disclosed fusion protein has a molecular weight of about 24.8 kDa. In certain embodiments, the presently disclosed fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 10.
  • the presently disclosed fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 12. In certain embodiments, the presently disclosed fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 12. SEQ ID NO: 12 is provided below.
  • the presently disclosed fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, ACTIVE 508032486.1 16 069269.0734 PATENT about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 14.
  • the presently disclosed fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 14. In certain embodiments, the presently disclosed fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 14. SEQ ID NO: 14 is provided below.
  • the fusion protein can include the addition of an antibody epitope or other tag, to facilitate identification, targeting, and/or purification of the polypeptide.
  • 6 ⁇ His SEQ ID NO: 23
  • GST glutthione S transferase
  • a polypeptide can be tagged with the FLAG® epitope (DYKDDDDK epitope (SEQ ID NO: 22)) (N-terminal, C-terminal, or internal tagging), the c-myc epitope (C- terminal), or both the FLAG (DYKDDDDK (SEQ ID NO: 22) epitope) (N-terminal) and c-myc (C-terminal) epitopes.
  • fusion proteins and polypeptides disclosed herein can include deletions and/or substitutions of amino acids relative to the native sequence. Sequences with amino acid substitutions are contemplated, as are sequences with a deletion, and sequences with a deletion and a substitution.
  • these polypeptides can further include insertions or added amino acids.
  • Substitutional or replacement variants typically contain the exchange of one amino acid for another at one or more sites within the protein and can be designed to modulate one or more properties of the polypeptide, particularly to increase its efficacy or specificity. Substitutions of this kind can be conservative substitutions. Conservative substitution is when one amino acid is replaced with one of similar shape and charge.
  • the fusion proteins can have an insertion of one or more residues.
  • the variant amino acid sequence can be structurally equivalent to the native counterparts.
  • the variant amino acid sequence forms the appropriate structure and conformation for binding targets, proteins, or polypeptide segments. The following is a discussion based on changing of the amino acids of a polypeptide (e.g., a presently disclosed fusion protein) to create a mutant molecule.
  • amino acids can be substituted for other amino acids in a polypeptide without appreciable loss of function, such as the ability to interact with an antibody or a target polypeptide sequence. Since it is the interactive ACTIVE 508032486.1 18 069269.0734 PATENT capacity and nature of a polypeptide that defines that polypeptide's functional activity, certain amino acid substitutions can be made in a polypeptide sequence and nevertheless produce a polypeptide with like properties. In making such changes, the hydropathic index of amino acids can be considered. The importance of the hydropathic amino acid index in conferring interactive function on a protein is generally understood in the art. See Kyte and Doolittle (1982) J. Mol. Biol.157:105-132.
  • hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0 ⁇ 1); glutamate (+3.0 ⁇ 1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine ( ⁇ 0.4); proline ( ⁇ 0.5 ⁇ 1); alanine (0.5); histidine ( ⁇ 0.5); cysteine ( ⁇ 1.0); methionine ( ⁇ 1.3); valine ( ⁇ 1.5); leucine ( ⁇ 1.8); isoleucine ( ⁇ 1.8); tyrosine (2.3); phenylalanine ( ⁇ 2.5); tryptophan ( ⁇ 3.4).
  • amino acid can be substituted for another having a similar hydrophilicity value and still produce a biologically equivalent and immunologically equivalent protein.
  • substitution of amino acids whose hydrophilicity values are within ⁇ 2, within ⁇ 1, and within ⁇ 0.5 amino acid substitutions generally are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
  • a non-conservative substitution is contemplated.
  • a random substitution is also contemplated.
  • substitutions that take into consideration the various foregoing characteristics are well known to those of skill in the art and include arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine, and isoleucine.
  • Techniques for determining nucleic acid and amino acid sequence identity are known in the art. Typically, such techniques include determining the nucleotide sequence of the mRNA for a gene and/or determining the amino acid sequence encoded thereby and comparing these sequences to a second nucleotide or amino acid sequence. Genomic sequences can also be determined and compared in this fashion.
  • identity refers to an exact nucleotide-to- nucleotide or amino acid-to-amino acid correspondence of two polynucleotides or polypeptide sequences, respectively.
  • Two or more sequences can be compared ACTIVE 508032486.1 19 069269.0734 PATENT by determining their percent identity.
  • the percent identity of two sequences, whether nucleic acid or amino acid sequences is the number of exact matches between two aligned sequences divided by the length of the shorter sequences and multiplied by 100.
  • percent identity is determined for two sequences when compared and aligned for maximum correspondence over a comparison window or designated region as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters. See, e.g., the NCBI website at ncbi.nlm.nih.gov/BLAST.
  • the microorganism is a bacterium. In certain embodiments, the microorganism is selected from the group consisting of Aceiobacter aceti, Achromobacter, Acidiphilium, Acinetobacter, Actinomadura, Actinoplanes, Aeropyrumpernix, Agrobacterium.
  • Alcaligenes Ananas comosus (M), Arthrobacter, Bacillus alcalophilus, Bacillus amyloliquefaciens, Bacillus brevis, Bacillus circulars, Bacillus clausii, Bacillus lentus, Bacillus lichenifirmis, Bacillus macerans, Bacillus stearothermophilus, Bacillus subtilis, Bifidobacterium, Brevibacillus brevis, Burkholderia cepacia, Candida cylindracea, Carica papaya (L), Cellulosimicrobium. Cephalosporium, Chaetomium erraticum, Chaetomium gracile.
  • Methanogenium organophilum Methanobacterium bryantii, Microbacterium imperiale, Micrococcus lysodeikticus, Microlunatus, Mucorjavanicus, Mycobacterium, Myrothecium, Nitrobacter, Nitrosomonas, Nocardia, Papaya carica, Pediococcus.
  • Rhodococcus Sckroiina libertina, ACTIVE 508032486.1 20 069269.0734 PATENT Sphingobacterium multivorum, Sphingobium, Sphingomonas, Streptococcus.
  • Streptococcus thermophilus Y-1 Streptomyces, Streptomyces griseus, Streptomyces lividans, Streptomyces murinus, Streptomyces pulpus, Streptomyces pulpomyces pulpus, Streptomyces pulpo, Streptomyces pulpus, Streptomyces pulpus, Streptomyces pulpo, Streptomyces violaceoruber, Streptoverticillium mobaraense, Tetragenococcus. Thermus.
  • the microorganism is Escherichia coli (E. coli).
  • the E. coli is selected from the group consisting of Enterotoxigenic E. coli (ETEC), Enteropathogenic E. coli (EPEC), Enteroinvasive E. coli (EIEC), Enterohemorrhagic E. coli (EHEC), Uropathogenic E. coli (UPEC), Verotoxin-producing E. coli, E. coli O157:H7, E. coli O104:H4, E.
  • the E. coli is derived from a strain selected from the group consisting of NCTC 12757, NCTC 12779, NCTC 12790, NCTC 12796, NCTC 12811, ATCC 11229, ATCC 25922, ATCC 8739, DSM 30083, BC 5849, BC 8265, BC 8267, BC 8268, BC 8270, BC 8271, BC 8272, BC 8273, BC 8276, BC 8277, BC 8278, BC 8279, BC 8312, BC 8317, BC 8319, BC 8320, BC 8321, BC 8322, BC 8326, BC 8327, BC 8331, BC 8335, BC 8338, BC 8341, BC 8344, BC 8345, BC 8346, BC 8347, BC 8348, BC 8863, and BC
  • the E. coli is derived from a strain selected from the group consisting of BC 4734 (O26:H11), BC 4735 (O157:H-), BC 4736 , BC 4737 (n.d.), BC 4738 (O157:H7), BC 4945 (O26:H-), BC 4946 (O157:H7), BC 4947 (O111:H-), BC 4948 (O157:H), BC 4949 (O5), BC 5579 (O157:H7), BC 5580 (O157:H7), BC 5582 (O3:H), BC 5643 (O2:H5), BC 5644 (O128), BC 5645 (O55:H-), BC 5646 (O69:H-), BC 5647 (O101:H9), BC 5648 (O103:H2), BC 5850 (O22:H8), BC 5851 (O55:H-), BC 5852 (O48:H21), BC 5853 (O26:H11), BC 5854 (O157:H7),
  • the E. coli is derived from a strain selected from the group consisting of BC 8246 (O152:K-:H-), BC 8247 (O124:K(72):H3), BC 8248 (O124), BC 8249 (O112), BC 8250 (O136:K(78):H-), BC 8251 (O124:H-), BC 8252 (O144:K-:H-), BC 8253 (O143:K:H-), BC 8254 (O143), BC 8255 (O112), BC 8256 (O28a.e), BC 8257 (O124:H-), BC 8258 (O143), BC 8259 (O167:K-:H5), BC 8260 (O128a.
  • the E. coli is derived from a strain selected from the group consisting of BC 5581 (O78:H11), BC 5583 (O2:K1), BC 8221 (O118), BC 8222 (O148:H-), BC 8223 (O111), BC 8224 (O110:H-), BC 8225 (O148), BC 8226 (O118), BC 8227 (O25:H42), BC 8229 (O6), BC 8231 (O153:H45), BC 8232 (O9), BC 8233 (O148), BC 8234 (O128), BC 8235 (O118), BC 8237 (O111), BC 8238 (O110:H17), BC 8240 (O148), BC 8241 (O6H16), BC 8243 (O153), BC 8244 (O15:H-), BC
  • the E. coli is derived from a strain selected from the group consisting of BC 7567 (O86), BC 7568 (O128), BC 7571 (O114), BC 7572 (O119), BC 7573 (O125), BC 7574 (O124), BC 7576 (O127a), BC 7577 (O126), BC 7578 (O142), BC 7579 (O26), BC 7580 (OK26), BC 7581 (O142), BC 7582 (O55), BC 7583 (O158), BC 7584 (O-), BC 7585 (O-), BC 7586 (O-), BC 8330, BC 8550 (O26), BC 8551 (O55), BC 8552 (O158), BC 8553 (O26), BC 8554 (O158), BC 8555 (O86), BC 8556 (O128), BC 8557 (OK26), BC 8558 (O55), BC 8560 (O158), BC 8561 (O158), BC 8562 (O114), BC 8563 (O86), BC 8564 (O128), BC 8565 (O158
  • the microorganism is a fungal cell.
  • the fungal cell is selected from the group consisting of Aspergillus, Aspergillus nidulans, Aspargillus niger, Aspargillus oryze, Aspergillus melleus, Aspergillus pulverulentus, Aspergillus saitoi, Aspergillus sojea, Aspergillus terreus, Aspergillus pseudoterreus, Aspergillus usamii, Candida rugosa, Issatchenkia orientalis, Kluyveromyces, Kluyveromycesfragilis. Kluyveromyces lactis.
  • culturing occurs under aerobic or anaerobic conditions based on the requirements of the microorganism and the desired metabolic state of the same. In certain embodiments, culturing includes specific conditions such as temperature, pressure, light, pH, and cell density.
  • the methods for producing the fusion protein include a culture medium for culturing the recombinant bacteria. “Culture medium,” as used herein, refers to any composition or broth that supports the growth of the microorganism disclosed herein. A culture media can be liquid or solid. In certain embodiments, the culture media includes nutrients, salts, buffers, elements, and other compounds that support the growth and viability of cells.
  • culture media can include sources of nitrogen, carbon, amino acids, carbohydrates, trace elements, vitamins, and minerals.
  • the culture media includes a complex extract (e.g., yeast extract).
  • the culture medium is enriched in order to support rapid growth.
  • the culture medium is modified in order to support slower growth.
  • the culture medium includes an agent that can inhibit the growth of or kill contaminating organisms (e.g., an antibiotic).
  • the culture medium includes an agent that can activate an inducible promoter or enzyme (e.g., IPTG).
  • Non-limiting examples of culture media encompassed by the present disclosure include M9 medium, Lysogeny Broth (LB), Terrific Broth (TB), and YT broth.
  • the fusion protein is produced in a cell-free system.
  • Nonlimiting exemplary cell-free systems are described, for example, in Sitaraman et al., Methods Mol. Biol.498: 229-44 (2009); Spirin, Trends Biotechnol.22: 538-45 (2004); Endo et al., Biotechnol. Adv.21: 695-713 (2003). 2.3.
  • Nucleic Acid Molecules and Vectors Encoding Fusion Proteins Nucleic acid molecules comprising polynucleotides that encode the presently disclosed fusion proteins are provided herein.
  • the polynucleotide comprises a nucleotide sequence that encodes a leader sequence.
  • the leader sequence is a native leader sequence.
  • the leader sequence is a heterologous leader sequence.
  • the presently disclosed nucleic acid molecule comprises a nucleotide sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the nucleotide sequence set forth in SEQ ID NO: 18.
  • the presently disclosed nucleic acid molecule comprises the nucleotide sequence set forth in SEQ ID NO: 18.
  • the presently disclosed nucleic acid molecule consists of the nucleotide sequence set forth in SEQ ID NO: 18. SEQ ID NO: 18 is provided below.
  • the presently disclosed nucleic acid molecule comprises the nucleotide sequence set forth in SEQ ID NO: 19. In certain embodiments, the presently disclosed nucleic acid molecule consists of the nucleotide sequence set forth in SEQ ID NO: 19. SEQ ID NO: 19 is provided below.
  • the presently disclosed nucleic acid molecule comprises the nucleotide sequence set forth in SEQ ID NO: 20. In certain embodiments, the presently disclosed nucleic acid molecule consists of the nucleotide sequence set forth in SEQ ID NO: 20. SEQ ID NO: 20 is provided below.
  • the presently disclosed nucleic acid molecule comprises the nucleotide sequence set forth in SEQ ID NO: 21. In certain embodiments, the presently disclosed nucleic acid molecule consists of the nucleotide sequence set forth in SEQ ID NO: 21. SEQ ID NO: 21 is provided below.
  • a nucleic acid molecule is an expression vector that is suitable for expression in a selected host cell (e.g., a host cell disclosed in Section 2.2).
  • Vectors comprising polynucleotides that encode the presently disclosed fusion proteins are also provided.
  • Such vectors include, but are not limited to, DNA vectors, phage vectors, viral vectors, retroviral vectors, etc.
  • a vector is selected that is designed for the ACTIVE 508032486.1 26 069269.0734 PATENT expression of polypeptides in bacterial cells.
  • a vector that is designed for the expression of polypeptides in E. coli cells is selected.
  • nucleic acids into a desired host cell can be accomplished by any method including, without any limitation, calcium phosphate transfection, DEAE-dextran mediated transfection, cationic lipid-mediated transfection, electroporation, transduction, infection, etc. Additional non-limiting methods are described in Sambrook et al., Molecular Cloning, A Laboratory Manual, 3 rd ed. Cold Spring Harbor Laboratory Press (2001).
  • the nucleic acids can be transiently transfected in the desired host cells.
  • nucleic acids can be stably transfected in the desired host cells.
  • the present disclosure provides fusion proteins prepared by the methods described above.
  • the fusion protein is prepared in a host cell. In certain embodiments, the fusion protein is prepared in a cell-free system. In certain embodiments, the fusion protein is purified. In certain embodiments, a cell culture media comprising the fusion protein is provided. In certain embodiments, compositions comprising the fusion proteins disclosed herein are provided. In certain embodiments, the composition comprises the fusion protein. In certain embodiments, the composition comprises the host cell comprising the fusion protein. In certain embodiments, the composition comprises the nucleic acid encoding the fusion protein. In certain embodiments, the composition comprises the vector encoding the fusion protein.
  • compositions disclosed herein further comprise a second fusion protein including a combination of polypeptides that can be recognized by antibodies targeting Ehrlichia canis.
  • the second fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 16.
  • the presently disclosed fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16.
  • the presently disclosed fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 16. SEQ ID NO: 16 is provided below.
  • the third fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 17.
  • the presently disclosed fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 17.
  • the presently disclosed fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 17. SEQ ID NO: 17 is provided below.
  • the present disclosure further provides methods for detecting various infectious organisms including E. ewingii in a subject.
  • the method can be used for diagnosis, prognosis, stratification, risk assessment, or treatment monitoring of a disease.
  • the present disclosure provides methods for detecting an antibody that specifically binds to an E. ewingii polypeptide in a sample.
  • the method comprises contacting the fusion protein disclosed herein with said sample and detecting a complex formed between the antibody and the fusion protein.
  • the method comprises contacting the compositions disclosed herein (e.g., described in Section 2.4) with said sample and detecting a complex formed between the antibody and the composition.
  • the method can be used for the classification of Lyme exposure of a subject, e.g., an animal by calculating levels of antibodies that specifically bind to the fusion protein disclosed herein using a method for detecting an antibody that specifically binds to an E. ewingii antigen in a sample disclosed herein; calculating reference values of the levels of the antibodies, and determining the type of E. ewingii infection of the subject by comparing the levels of the antibodies to the reference values.
  • the reference values can be calculated using levels of detectable signals of negative controls, and more than one reference value may be calculated for each antibody that specifically binds to a Lyme polypeptide.
  • the reference values can be established by analyzing results from experimental samples from animals that are infected with or vaccinated against E. ewingii. Empirical values can be calculated from the analysis of experimental samples and used for the calculation of reference values for the antibodies. Initially, artificial values can be set for each reference value and adjusted by an algorithm using experimental data. A minimal value for each reference value can also be established from the analysis of experimental samples and in cases where the reference value calculated is less than the minimal value, the minimal value can be used.
  • a method for detecting multiple disease antigens and/or antibodies in a sample comprises a) contacting said sample with a composition for detecting multiple disease antigens and/or antibodies comprising the presently disclosed fusion proteins; and b) detecting a complex formed between the antibody and the fusion protein.
  • the sample may be from a subject selected from the group consisting of a dog, a cat, a human, and a horse.
  • the method can be used for diagnosis, prognosis, stratification, risk assessment, or treatment monitoring of a disease.
  • the sample can be selected from the group consisting of a serum, a plasma, and a blood sample.
  • the sample may be a clinical sample.
  • the antibody can be a monoclonal or polyclonal antibody or antibody fragment.
  • the detection of antibodies and/or antigens can be achieved by immunoassays, including any immunoassay known in the art including, but not limited to, radioimmunoassay, enzyme- linked immunosorbent assay (ELISA), “sandwich” assay, precipitin reaction, agglutination assay, fluorescent immunoassay, and chemiluminescence-based immunoassay.
  • the complex formed between the antibody and the fusion protein can be assessed by a sandwich or competitive assay format, optionally with a binder or antibody.
  • the binder or antibody can be attached to a surface and functions as a capture antibody.
  • the capture binder or antibody can be attached to the surface directly or indirectly.
  • the binder or antibody can be attached to the surface via a biotin-avidin (or ACTIVE 508032486.1 29 069269.0734 PATENT streptavidin) linking pair.
  • at least one of the binders or antibodies can be labeled.
  • the complex formed between the antibody and the fusion protein can be assessed by a format selected from the group consisting of an enzyme-linked immunosorbent assay (ELISA), Western blotting, immunoblotting, immunoprecipitation, radioimmunoassay (RIA), immunostaining, latex agglutination, indirect hemagglutination assay (IHA), complement fixation, indirect immunofluorescent assay (IFA), nephelometry, flow cytometry assay, plasmon resonance assay, chemiluminescence assay, lateral flow immunoassay, u-capture assay, inhibition assay and avidity assay.
  • ELISA enzyme-linked immunosorbent assay
  • Western blotting Western blotting
  • immunoblotting immunoprecipitation
  • radioimmunoassay RIA
  • immunostaining latex agglutination
  • IHA indirect hemagglutination assay
  • IFA indirect immunofluorescent assay
  • assays employing liquid phase arrays can be performed in multiwell or microtiter plates.
  • Microtiter plates with 96, 384, or 1536 wells are widely available, and even higher numbers of wells, e.g., 3456 and 9600 can be used.
  • the choice of microtiter plates is determined by the methods and equipment, e.g., robotic handling and loading systems, used for sample preparation and analysis.
  • Exemplary systems include, e.g., the ORCATM system from Beckman- Coulter, Inc.
  • any solid support capable of withstanding the reagents and conditions necessary for performing the particular expression assay can be utilized.
  • functionalized glass, silicon, silicon dioxide, modified silicon, any of a variety of polymers, such as ACTIVE 508032486.1 30 069269.0734 PATENT (poly)tetrafluoroethylene, (poly)vinylidenedifluoride, polystyrene, polycarbonate, or combinations thereof can all serve as the substrate for a solid phase array.
  • the polypeptides/antibodies can be immobilized to solid phase support for the detection of antibody binding.
  • solid phase support is not limited to a specific type of support. Rather a large number of supports are available and are known to one of ordinary skill in the art.
  • Solid phase supports include silica gels, resins, derivatized plastic films, glass beads, cotton, plastic beads, and alumina gels.
  • a suitable solid phase support may be selected based on desired end use and suitability for various synthetic protocols.
  • solid phase support may refer to resins such as polystyrene (e.g., PAM-resin obtained from Bachem Inc., Peninsula Laboratories, etc.), POLYHIPE® resin (obtained from Aminotech, Canada), polyamide resin (obtained from Peninsula Laboratories), polystyrene resin grafted with polyethylene glycol (TENTAGEL®, Rapp Polymere, Tubingen, Germany) or polydimethylacrylamide resin (obtained from Milligen/Biosearch, California).
  • polystyrene e.g., PAM-resin obtained from Bachem Inc., Peninsula Laboratories, etc.
  • POLYHIPE® resin obtained from Aminotech, Canada
  • polyamide resin obtained from Peninsula Laboratories
  • solid phase support refers to polydimethylacrylamide resin.
  • the array can be a “chip” composed, e.g., of one of the above- specified materials.
  • Polynucleotide probes e.g., RNA or DNA, such as cDNA, synthetic oligonucleotides, and the like, or binding proteins such as antibodies or antigen-binding fragments or derivatives thereof may be affixed to the chip in a logically ordered manner, i.e., in an array.
  • Detailed discussions of methods for linking nucleic acids and proteins to a chip substrate are found in, e.g., U.S. Pat. No.5,143,854, U.S. Pat.
  • Microarray signals can be detected by scanning the microarray with a variety of laser or CCD-based scanners and extracting features with numerous software packages, for example, Imagene (Biodiscovery), Feature Extraction Software (Agilent), Scanalyze (Eisen, M. 1999. SCANALYZE User Manual; Stanford Univ., Stanford, Calif. Ver 2.32.), GenePix (Axon Instruments).
  • High-throughput protein systems include commercially available systems from Ciphergen Biosystems, Inc. (Fremont, Calif.) such as PROTEIN CHIP® arrays and the Schleicher and Schuell protein microspot array (FastQuant Human Chemokine, S&S Bioscences Inc., Keene, N.H., US).
  • the individual proteins/antibodies can be detected or quantified by any of several means well known to those of skill in the art.
  • a qualitative change in one or more proteins/antibodies is determined.
  • Qualitative changes include the appearance of a proteins/antibodies spot that is not detectable in samples obtained from normal controls or the disappearance of a proteins/antibodies spot that is detectable in normal controls but not in the sample taken from an affected subject.
  • a quantitative change in one or more proteins/antibodies may be measured.
  • the concentration of protein/antibody levels may be expressed in absolute terms, for example, optical density as read by image analysis. Additionally or alternatively, the concentrations can be expressed as a fraction, relative to normal levels of the same protein/antibody. 4 .
  • the present disclosure provides a computer-readable medium containing executable instructions that when executed perform a method of classifying E. ewingii infection of a subject, e.g., an animal, the method comprising: calculating levels of antibodies that specifically bind to the presently disclosed fusion protein using a method for detecting an antibody that specifically binds to an E. ewingii antigen in a sample; calculating reference values of the levels of the antibodies; and determining the type of E. ewingii infection of the subject by comparing the levels of the antibodies to the reference values.
  • a system for classifying E is a system for classifying E.
  • kits for detecting infectious organisms.
  • the kit includes, in a container, the polypeptides or antigenic compositions disclosed herein.
  • the container is a sealed container.
  • Non- limiting examples of containers include a microtiter plate, a bottle, a metal tube, a laminate tube, a ACTIVE 508032486.1 32 069269.0734 PATENT plastic tube, a dispenser, a pressurized container, a barrier container, a package, a compartment, or other types of containers such as injection or blow-molded plastic containers into which the dispersions or compositions or desired bottles, dispensers, or packages are retained.
  • Further examples of containers include glass or plastic vials or bottles.
  • the containers can dispense or contain a pre-determined amount of a composition of the present invention.
  • the composition can be dispensed as a liquid, a fluid, or a semi-solid.
  • the kit can also include instructions for using the kit and/or compositions.
  • the instructions can include an explanation of how to use and maintain the compositions. 6 .
  • Methods of Treatment The present disclosure provides for methods of preventing, treating, and/or delaying progression of E. ewingii infection of a subject in need thereof.
  • the subject is a dog.
  • the method comprises administering an antibiotic to the subject.
  • the antibiotic is administered at an amount of about 1 mg/kg to about 100 mg/kg.
  • the antibiotic can be administered at an amount of about 1 mg/kg to about 10 mg/kg, about 2 mg/kg to about 10 mg/kg, about 1 mg/kg to about 20 mg/kg, about 2 mg/kg to about 20 mg/kg, about 5 mg/kg to about 10 mg/kg, about 5 mg/kg to about 20 mg/kg, about 5 mg/kg to about 30 mg/kg, about 10 mg/kg to about 20 mg/kg, about 10 mg/kg to about 30 mg/kg, about 10 mg/kg to about 40 mg/kg, about 10 mg/kg to about 50 mg/kg, about 20 mg/kg to about 50 mg/kg, about 30 mg/kg to about 50 mg/kg, about 20 mg/kg to about 60 mg/kg, about 20 mg/kg to about 70 mg/kg, about 20 mg/kg to about 80 mg/kg, about 30 mg/kg to about 60 mg/kg, about 30 mg/kg to about 10 mg/kg to about 10 mg/kg, about
  • the antibiotic is administered at an amount of about 20 mg/kg to about 50 mg/kg, e.g., about 30 mg/kg. In certain embodiments, the antibiotic is administered at an amount of about 5 mg/kg to about 20 mg/kg, e.g., about 10 mg/kg.
  • ACTIVE 508032486.1 33 069269.0734 PATENT in certain embodiments, can be administered to an animal thrice every day, twice every day, once every day, once every two days, once every three days, once every four days, once every five days, once every six days, once a week, once every two weeks, once every three weeks, or once every month. In certain embodiments, the antibiotic can be administered to an animal one or more times per day.
  • the antibiotic can be administered to an animal once, twice, three, four, five, or more times a day.
  • the presently disclosed methods of treatment can include the identification of the subject having E. ewingii infection. In certain embodiments, the identification is carried out using one of the methods of detection described in Section 3 above. 7 .
  • the present disclosure provides a fusion protein comprising the amino acid sequence set forth in SEQ ID NO: 12. In certain non-limiting embodiments, the present disclosure provides a composition comprising a first fusion protein and a second fusion protein. In certain embodiments, the first fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 12.
  • the second fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16 or SEQ ID NO: 17.
  • the present disclosure provides a composition comprising a first fusion protein, a second fusion protein, and a third fusion protein.
  • the first fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 12.
  • the second fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16.
  • the third fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 17.
  • the present disclosure provides a solid phase support comprising a fusion protein comprising the amino acid sequence set forth in SEQ ID NO: 12.
  • the present disclosure provides a solid phase support comprising a first fusion protein and a second fusion protein.
  • the first fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 12.
  • the second fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16 or SEQ ID NO: 17.
  • the present disclosure provides a solid phase support comprising a first fusion protein, a second fusion protein, and a third fusion protein.
  • the first fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 12.
  • the second fusion protein comprises the amino acid sequence set forth ACTIVE 508032486.1 34 069269.0734 PATENT in SEQ ID NO: 16.
  • the third fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 17.
  • the objectives of the present example were to evaluate the performance of the newly developed Accuplex ® BioCD automated fluorescence system for the detection of antibodies against E. canis, E. chaffeensis, and E. ewingii in canine serum and compare assay sensitivity and specificity to some commercial tests.
  • the ability to detect antibodies against Ehrlichia pathogens in dogs by the Accuplex automated system was compared with an indirect fluorescent antibody assay (IFA), MFIA (Luminex), SNAP assays, as well as ELISA.
  • Canine blood samples were also assayed for pathogen DNA by polymerase chain reaction (PCR).
  • the results of the present example demonstrate that the new Accuplex ® BioCD Ehrlichia assay is more sensitive than the previous version of the test, as well as alternative commercially available immunoassays.
  • the sensitivity and specificity of the Accuplex ® Ehrlichia test are 92% and 95%, respectively, as calculated based on tested clinical canine serum samples.
  • Accuplex ® BioCD platform allows multiplexing enhanced Ehrlichia markers in order to achieve improved results. Results of field evaluations show that this test can be reliably used under typical clinical and test conditions to identify dogs exposed to the pathogens of interest.
  • Introduction The Ehrlichiae are a group of gram-negative, obligate intracellular cocci that infect different blood cells in many animal species, as well as in humans.
  • Dogs are susceptible to infection with multiple Ehrlichia spp.; among those are E. canis, transmitted by Rhipicephalus sanguineus (brown dog tick), and E. chaffeensis and E.ewingii, whose primary vector is Amblyomma americanum (lone star tick) (Beall MJ, 2012). Coinfections with multiple ehrlichial agents have been reported in dogs (Kordick, 1999).
  • IFA indirect fluorescent antibody
  • Western Blot Western Blot
  • ELISA ELISA
  • Accuplex ® BioCD an automated multiplex silicon-wafer- based system, is capable of testing for antigens and antibodies against multiple antigens using small volumes of serum. Additional information on the Accuplex ® BioCD system can be found in U.S. Patent No.10,100,092, the contents of which are incorporated by reference in their entirety. All markers for multiplexed arrays were printed on high throughput production sciFLEXARRAYER. These assays can be very beneficial in service laboratories because the automated system can lessen inter-assay variability and large numbers of samples can be assayed concurrently. Multiple proprietary peptides were printed on BioCD wafers with the sciFLEXARRAYER S100 system, Scienion.
  • the concentration was determined by assessing the signal: noise with varying antigen concentrations and buffer compositions. Wafers with printed peptides are further processed as described previously (Moroff et al, Vet J., 2014).
  • the reference methods for the detection of antibodies that specifically bind to the amino acid sequences PanEhrl, Mod1, and CanChim were Lab 4Dx Plus Test (7244), SNAP ® 4Dx ® Plus, IFA, and MFIA, comparing data from multiple technological platforms. IFA tests. Commercially available IFA tests were purchased from VMRD and Fuller laboratories. The assay was performed according to the manufacturer’s recommendations. Slides were examined using a UV microscope with filters for fluorescein.
  • MFIA Multiplexed fluorometric immunoassays (MFIA), based on Luminex xMAP technology, were performed utilizing beads coated with the same set of antigens as in the presently disclosed Accupex ® assay.
  • Ehrlichia canis Columbia pos neg neg neg pos pos pos 9 E.ewingii E.ewingii pos neg neg neg neg pos pos 10 E.ewingii E.ewingii pos neg pos neg pos pos 11 Ehrlichia canis no DNA pos neg pos pos pos pos 12 Ehrlichia canis E. canis Columbia pos pos pos pos pos 13 Ehrlichia canis * pos neg pos neg pos pos pos 14 Co-Infection E. canis Columbia pos neg neg neg neg pos pos 15 Co-Infection E. canis Turkey pos neg neg neg pos pos pos 16 Ehrlichia canis pos neg pos neg pos neg pos pos 17 Ehrlichia canis E.
  • Ehrlichia canis Turkey pos neg neg neg neg neg pos pos 27
  • Ehrlichia canis canis Jake pos neg pos neg pos pos 28
  • Ehrlichia canis canis
  • Ehrlichia canis no DNA pos pos neg pos neg pos pos 31
  • Ehrlichia canis E. canis Columbia pos neg pos neg pos pos 32 Anaplasma phagocytophilum no DNA neg pos neg neg neg neg Neg 33

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Biochemistry (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Biotechnology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Food Science & Technology (AREA)
  • Cell Biology (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Wood Science & Technology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Virology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Epidemiology (AREA)
  • Plant Pathology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)

Abstract

The present disclosure relates to compositions and methods for the detection of infectious organisms, including Ehrlichia spp. In certain embodiments, the infectious organism is Ehrlichia ewingii.

Description

069269.0734 PATENT COMPOSITIONS AND METHODS TO DETECT INFECTIOUS ORGANISMS CROSS-REFERENCES TO RELATED APPLICATIONS This application claims the benefit of priority to U.S. Provisional Patent Application No. 63/573,691, filed April 3, 2024, the content of which is incorporated herein by reference in its entirety, and to which priority is claimed. SEQUENCE LISTING The instant application contains a Sequence Listing which has been submitted electronically in xml format and is hereby incorporated by reference in its entirety. Said xml file, created on 26 March 2025, is named 0692690734.xml and is 27,608 bytes in size. FIELD The present disclosure relates to compositions and methods for the detection of infectious organisms, including Ehrlichia spp. In certain embodiments, the infectious organism is Ehrlichia ewingii. BACKGROUND The Ehrlichiae are a group of gram-negative, obligate intracellular cocci that infect different blood cells in many animal species, as well as in humans. Although these pathogens share phylogenetic similarities, there are multiple differences from tick vectors to host-cell tropism and clinical manifestations. Dogs are susceptible to infection with multiple Ehrlichia spp.; among those are E. canis, transmitted by Rhipicephalus sanguineus (brown dog tick), and E. chaffeensis and E. ewingii, whose primary vector is Amblyomma americanum (lone star tick) (Beall MJ, 2012). Coinfections with multiple ehrlichial agents have been reported in dogs (Kordick, 1999). The lone star tick is widely distributed in the eastern, southeastern, and south-central United States, and the brown dog tick is found worldwide (CDC.gov). In dogs, two leukotrophic diseases are caused by bacteria in the genus Ehrlichia: Canine Monocytic Ehrlichiosis (CME) mainly caused by E. canis and E. chaffeensis, and Canine Granulocytic Ehrlichiosis (CGE), caused by E. ewingii (Aziz, 2023). In recent decades, enhanced and modified transmission patterns of all vector-borne pathogens have been recorded around the globe (Dantas-Torres, 2015) due to multiple factors, including an increase in human population, deforestation, as well as frequent transport of pet animals from one continent to another. A variety of serologic tests, such as indirect fluorescent antibody (IFA), Western Blot, and ELISAs have been used to verify past or current infections. IFA is the reference standard serologic ACTIVE 508032486.1 1 069269.0734 PATENT test for diagnosis of Ehrlichiosis (CDC.gov) and is being widely used testing method due to its simplicity and cost-effectiveness compared to other approaches. However, shortcomings of the IFA test are antigenic cross-reactivity with other closely related species that infect dogs, the nature of antigens used in the tests (Stillman BA, 2014), as well as subjective endpoint interpretations and lack of standardization between laboratories (Luo, T., 2010). Since E. ewingii has not been yet cultured, IFAs for antibodies against other Ehrlichia spp. have been used for anti- E. ewingii antibodies detection (Yabsley MJ, 2011). Examination of a peripheral blood smear to identify thrombocytopenia and to visually inspect cells for morula is often the only diagnostic test performed prior to treatment (Cohn, LA, 2012). Identification and differentiation of Ehrlichia and related species with PCR testing is useful in dogs with subclinical & persistent infections, yet some dogs might be PCR negative if the organism is sequestered or persists at undetectable levels, and not so helpful after antibiotic therapy is initiated (Luo, T, 2010). According to the CDC, “a negative PCR result does not rule out the diagnosis, and treatment should not be withheld due to a negative result” (CDC.gov). Thus, there is a need for novel sensitive and reliable diagnostic tools. SUMMARY OF THE INVENTION In certain non-limiting embodiments, the present disclosure provides a fusion protein comprising the amino sequence set forth in SEQ ID NO: 1 or a variant thereof, SEQ ID NO: 2 or a variant thereof, SEQ ID NO: 3 or a variant thereof, SEQ ID NO: 4 or a variant thereof, SEQ ID NO: 5 or a variant thereof, SEQ ID NO: 6 or a variant thereof, SEQ ID NO: 7 or a variant thereof, SEQ ID NO: 8 or a variant thereof, SEQ ID NO: 9 or a variant thereof, or a combination thereof. In certain non-limiting embodiments, the present disclosure also provides a fusion protein comprising the amino sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain non-limiting embodiments, the present disclosure provides a fusion protein comprising at least two polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein comprises at least five polypeptides. In certain embodiments, the fusion protein comprises at least eight polypeptides. In certain embodiments, the fusion protein comprises at least eleven polypeptides. In certain embodiments, the fusion protein further comprises a linker. In certain embodiments, the fusion protein has an isoelectric point between about 4.50 and about 4.60. In ACTIVE 508032486.1 2 069269.0734 PATENT certain embodiments, the isoelectric point is about 4.58. In certain embodiments, the fusion protein has a molecular weight between about 23.0 kDa and about 27.0 kDa. In certain embodiments, the molecular weight is about 24.3 kDa, 24.4 kDa, or 24.8 kDa. In certain embodiments, the molecular weight is about 24.8 kDa. In certain embodiments, the fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 15. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 15. In certain embodiments, the fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 15. In certain embodiments, the fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 12. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 12. In certain embodiments, the fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 12. In certain embodiments, the fusion protein further comprises a tag. In certain non-limiting embodiments, the present disclosure provides a nucleic acid molecule comprising a polynucleotide encoding the fusion protein disclosed herein. Moreover, the present disclosure provides a vector comprising the nucleic acid molecule disclosed herein. Also provided is a host cell comprising the fusion protein, the nucleic acid molecule, or the vector disclosed herein. In certain embodiments, the host cell is E. coli. In certain non-limiting embodiments, the present disclosure provides a method of producing a fusion protein comprising culturing the host cell disclosed herein in a culture medium and purifying the fusion protein. In certain non-limiting embodiments, the present disclosure provides a composition or a solid phase support comprising a fusion protein disclosed herein. In certain embodiments, the composition or the solid phase support further comprises a second fusion protein. In certain embodiments, the second fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 16 or SEQ ID NO: 17. In certain embodiments, the second fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16 or SEQ ID NO: 17. In certain embodiments, the ACTIVE 508032486.1 3 069269.0734 PATENT second fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 16 or SEQ ID NO: 17. In certain embodiments, the composition or the solid phase support further comprises a second fusion protein and a third fusion protein. In certain embodiments, a) the second fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 16, and b) the third fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 17. In certain embodiments, a) the second fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16, and b) the third fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 17. In certain embodiments, a) the second fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 16, and b) the third fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 17. In certain non-limiting embodiments, the present disclosure provides a method of detecting an antibody binding an infectious organism in a subject comprising contacting the fusion protein, the composition, or the solid phase support disclosed herein with a sample from the subject and detecting a complex formed between the antibody and the fusion protein. In certain embodiments, the infectious organism is E. ewingii. In certain embodiments, the antibody specifically binds to an epitope of E. ewingii. In certain embodiments, the sample is a serum sample, a plasma sample, a blood sample, or a combination thereof. In certain embodiments, the fusion protein is immobilized on a solid phase support. In certain embodiments, the subject is a dog. In certain non-limiting embodiments, the present disclosure provides a method of identifying a subject having an E. ewingii infection. In certain embodiments, the method comprises contacting the fusion protein, the composition, or the solid phase support disclosed herein with a sample from the subject. In certain embodiments, the method comprises detecting a complex formed between the sample and the fusion protein, the composition, or the solid phase. In certain embodiments, an increased level of detected complexes relative to a normal control indicates that the subject has an E. ewingii infection. In certain embodiments, the sample is a serum sample, a plasma sample, a blood sample, or a combination thereof. In certain embodiments, the subject is a dog. In certain non-limiting embodiments, the present disclosure provides a method of identifying a subject having Lyme disease. In certain embodiments, the method comprises contacting the fusion protein, the composition, or the solid phase support disclosed herein with a sample from the subject. In certain embodiments, the method comprises detecting a complex ACTIVE 508032486.1 4 069269.0734 PATENT formed between the sample and the fusion protein, the composition, or the solid phase. In certain embodiments, an increased level of detected complexes relative to a normal control indicates that the subject has Lyme disease. In certain embodiments, the sample is a serum sample, a plasma sample, a blood sample, or a combination thereof. In certain embodiments, the subject is a dog. In certain non-limiting embodiments, the present disclosure provides a kit comprising contacting the fusion protein, the composition, or the solid phase support disclosed herein. In certain non-limiting embodiments, the present disclosure provides a method of preventing, treating, and/or delaying progression of E. ewingii infection of a subject in need thereof comprising administering an antibiotic to the subject. In certain embodiments, the antibiotic is selected from clindamycin, metronidazole, amoxicillin, cephalexin, doxycycline, enrofloxacin, gentamicin, trimethoprim, sulfamethoxazole, clavamox, chloramphenicol, cefpodoxime, tetracycline, marbofloxacin, antirobe, ciprofloxacin, albon, amoxicillin, baytril, biomox amoxicillin, cephalexin, amoxicillin, clavulanic acid, ketoconazole, sulfadimethoxine, or a combination thereof. In certain embodiments, the antibiotic is doxycycline. In certain embodiments, the subject is a dog. In certain non-limiting embodiments, the present disclosure provides a method of treating and/or delaying progression of E. ewingii infection of a subject in need thereof. In certain embodiments, the method comprises identifying the subject as having an E. ewingii infection, and administering an antibiotic to the subject. In certain embodiments, the identifying comprises contacting the fusion protein, the composition, or the solid phase support disclosed herein with a sample from the subject. In certain embodiments, the identifying comprises detecting a complex formed between the sample and the fusion protein, the composition, or the solid phase. In certain embodiments, an increased level of detected complexes relative to a normal control indicates that the subject has an E. ewingii infection. In certain embodiments, the antibiotic is selected from clindamycin, metronidazole, amoxicillin, cephalexin, doxycycline, enrofloxacin, gentamicin, trimethoprim, sulfamethoxazole, clavamox, chloramphenicol, cefpodoxime, tetracycline, marbofloxacin, antirobe, ciprofloxacin, albon, amoxicillin, baytril, biomox amoxicillin, cephalexin, amoxicillin, clavulanic acid, ketoconazole, sulfadimethoxine, or a combination thereof. In certain embodiments, the antibiotic is doxycycline. In certain embodiments, the subject is a dog. DETAILED DESCRIPTION To date, there is a need to identify and differentiate Ehrlichia spp. since false negatives are often observed using conventional methods (e.g., qPCR). The present disclosure relates to compositions and methods that can be used to improve the detection of infectious diseases. For ACTIVE 508032486.1 5 069269.0734 PATENT purposes of clarity of disclosure and not by way of limitation, the detailed description is divided into the following subsections: 1. Definitions; 2. Fusion Proteins; 3. Methods of Detection; 4. Computer Readable Medium; 5. Kits; and 6. Methods of Treatment. 1. Definitions The terms used in this specification generally have their ordinary meanings in the art, within the context of this invention and in the specific context where each term is used. Certain terms are discussed below, or elsewhere in the specification, to provide additional guidance to the practitioner in describing the methods and compositions of the invention and how to make and use them. As used herein, the use of the word “a” or “an” when used in conjunction with the term “comprising” in the claims and/or the specification can mean “one,” but it is also consistent with the meaning of “one or more,” “at least one,” and “one or more than one.” The term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within 3 or more than 3 standard deviations, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably still up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value. The terms “comprise(s),” “include(s),” “having,” “has,” “can,” “contain(s),” and variants thereof, as used herein, are intended to be open-ended transitional phrases, terms, or words that do not preclude the possibility of additional acts or structures. The present disclosure also contemplates other embodiments “comprising,” “consisting of”, and “consisting essentially of,” the embodiments or elements presented herein, whether explicitly set forth or not. The term “nucleic acid molecule” and “nucleotide sequence,” as used herein, refers to a single or double-stranded covalently linked sequence of nucleotides in which phosphodiester bonds join the 3' and 5' ends on each nucleotide. The nucleic acid molecule can include ACTIVE 508032486.1 6 069269.0734 PATENT deoxyribonucleotide bases or ribonucleotide bases and can be manufactured synthetically in vitro or isolated from natural sources. The terms “polypeptide,” “peptide,” “amino acid sequence” and “protein,” used interchangeably herein, refer to a molecule formed from the linking of at least two amino acids. The link between one amino acid residue and the next is an amide bond and is sometimes referred to as a peptide bond. A polypeptide can be obtained by a suitable method known in the art, including isolation from natural sources, expression in a recombinant expression system, chemical synthesis, or enzymatic synthesis. The terms can apply to amino acid polymers in which one or more amino acid residues is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers. The term “amino acid,” as used herein, can be naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function like the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine. Amino acid analogs and derivatives can refer to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, and methionine methyl sulfonium. Such analogs can have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics means chemical compounds with a structure that is different from the general chemical structure of an amino acid, but that function similarly to a naturally occurring amino acid. Non-limiting examples of amino acids include tryptophan, phenylalanine, histidine, glycine, cysteine, alanine, tyrosine, serine, methionine, asparagine, leucine, asparagine, threonine, isoleucine, proline, glutamic acid, aspartic acid, hydroxyl proline, arginine, cystine, glutamine, lysine, valine, ornithine, taurine, and combinations thereof. As used herein, the term “antibody” refers to an immunoglobulin molecule, or a fragment thereof (e.g., Fab, Fab′, F(ab′)2, Fv, single chain (scFv)), that specifically binds to a target (e.g., an antigen, a carbohydrate, polynucleotide, lipid, polypeptide, etc.), through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule. An antibody can be an immunoglobulin of any class including, for example, and without any limitation, IgG, IgM, IgA, IgD, IgE, and IgY. As used herein, an antibody can be a polyclonal antibody or a monoclonal antibody. In certain embodiments, the term antibody also refers to mutants thereof, naturally occurring variants, fusion proteins comprising an antibody portion with an antigen recognition site ACTIVE 508032486.1 7 069269.0734 PATENT of the required specificity, humanized antibodies, chimeric antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity. As used herein, the term “antigen” refers to a target molecule that is specifically bound by an antibody through its antigen recognition site. The antigen may be monovalent or polyvalent, i.e., it may have one or more epitopes recognized by one or more antibodies. Examples of kinds of antigens that can be recognized by antibodies include polypeptides, oligosaccharides, glycoproteins, polynucleotides, lipids, etc. As used herein, the term “epitope” refers to a peptide sequence of at least about 3 to 5, preferably about 5 to 10 or 15, and not more than about 1,000 amino acids (or any integer therebetween), which define a sequence that by itself or as part of a larger sequence, binds to an antibody generated in response to such sequence. There is no critical upper limit to the length of the fragment, which may, for example, comprise nearly the full length of the antigen sequence, or even a fusion protein comprising two or more epitopes from the target antigen. An epitope for use in the subject invention is not limited to a peptide having the exact sequence of the portion of the parent protein from which it is derived but also encompasses sequences identical to the native sequence, as well as modifications to the native sequence, such as deletions, additions, and substitutions (conservative). As used herein, “biological sample” refers to any sample obtained from a living or viral source or other source of macromolecules and biomolecules, and includes any cell type or tissue of a subject from which nucleic acid or protein or other macromolecule can be obtained. The biological sample can be a sample obtained directly from a biological source or a sample that is processed. For example, isolated nucleic acids that are amplified constitute a biological sample. Biological samples include but are not limited to, body fluids, such as blood, plasma, serum, cerebrospinal fluid, synovial fluid, urine and sweat, tissue and organ samples from animals and plants, and processed samples derived therefrom. Also included are soil and water samples and other environmental samples, viruses, bacteria, fungi, algae, protozoa, and components thereof. The terms “level” or “levels” are used to refer to the presence and/or amount of protein, and can be determined qualitatively or quantitatively. A “qualitative” change in the protein level refers to the appearance or disappearance of a protein spot that is not detectable or is present in samples obtained from normal controls. A “quantitative” change in the levels of one or more proteins of the profile refers to a measurable increase or decrease in the protein levels when compared to a healthy control. A “healthy control” or “normal control” is a biological sample taken from an individual who does not suffer from an infectious disorder. A “negative control,” is a sample that lacks any ACTIVE 508032486.1 8 069269.0734 PATENT of the specific analyte the assay is designed to detect and thus provides a reference baseline for the assay. The term “isolated,” as used herein, refers to a material that is removed from at least one component with which it is naturally associated (e.g., removed from its original environment). As used herein, the terms “reduce” and “reduction” refer to a measurable lessening of an endpoint (e.g., enzymatic activity, production of the compound, expression of a protein) by at least about 10%, at least about 50%, at least about 75%, or at least about 90%. In certain embodiments, the reduction can be from about 10% to about 100%. As used herein, the term “increase,” “elevate” and “elevation” refers to a measurable augmentation of an endpoint (e.g., enzymatic activity, production of compound, expression of a protein) by at least about 10%, at least about 50%, at least about 75%, or at least about 90%. In certain embodiments, the increase can be from about 10% to about 100%. In certain embodiments, the increase can be at least about 10-fold, about 100-fold, or about 1000-fold or more. In certain embodiments, the increase can be about 100-fold or more, about 1000-fold or more, or about 10,000-fold or more. As used herein, “vector (or plasmid)” refers to discrete elements that are used to introduce heterologous DNA into cells for either expression or replication thereof. Selection and use of such vehicles are well-known within the skill of the artisan. An expression vector includes vectors capable of expressing DNA that are operatively linked with regulatory sequences, such as promoter regions, that are capable of affecting the expression of such DNA fragments. Thus, an expression vector refers to a recombinant DNA or RNA construct, such as a plasmid, a phage, a recombinant virus, or another vector that, upon introduction into an appropriate host cell, results in the expression of the cloned DNA. Appropriate expression vectors are well known to those of skill in the art and include those that are replicable in eukaryotic cells and/or prokaryotic cells and those that remain episomal or those that integrate into the host cell genome. As used herein, “a promoter region or promoter element” refers to a segment of DNA or RNA that controls transcription of the DNA or RNA to which it is operatively linked. The promoter region includes specific sequences that are sufficient for RNA polymerase recognition, binding, and transcription initiation. This portion of the promoter region is referred to as the promoter. In addition, the promoter region includes sequences that modulate this recognition, binding, and transcription initiation activity of RNA polymerase. These sequences may be cis- acting or may be responsive to trans-acting factors. Promoters, depending upon the nature of the regulation, may be constitutive or regulated. Exemplary promoters contemplated for use in prokaryotes include the bacteriophage T7 and T3 promoters, and the like. ACTIVE 508032486.1 9 069269.0734 PATENT As used herein, “operatively linked or operationally associated” refers to the functional relationship of DNA with regulatory and effector sequences of nucleotides, such as promoters, enhancers, transcriptional and translational stop sites, and other signal sequences. For example, the operative linkage of DNA to a promoter refers to the physical and functional relationship between the DNA and the promoter such that the transcription of such DNA is initiated from the promoter by an RNA polymerase that specifically recognizes, binds to, and transcribes the DNA. To improve expression and/or in vitro transcription, it may be necessary to remove, add, or alter 5′ untranslated portions of the clones to eliminate extra, potentially inappropriate alternative translation initiation (i.e., start) codons or other sequences that may interfere with or reduce expression, either at the level of transcription or translation. Alternatively, consensus ribosome binding sites can be inserted immediately 5′ of the start codon and may enhance expression. See, e.g., Kozak (1991) J. Biol. Chem.266:19867-19870. The desirability of (or need for) such modification may be empirically determined. 2. Fusion Proteins In certain embodiments, the present disclosure provides compositions and methods for the detection of Ehrlichia spp. Ehrlichiae are obligate intracellular bacteria that grow within membrane-bound vacuoles in human and animal leukocytes. The two most important species to infect humans include E. chaffeensis, the causative agent of human monocytic ehrlichiosis (HME), and A. phagocytophilum, the agent of human granulocytic anaplasmosis (HGA). Less commonly, ehrlichiosis is caused by Ehrlichia ewingii, which was discovered in 1999. In 2009, a third species of Ehrlichia was identified in four patients from Wisconsin and Minnesota who had fever, malaise, headache, and lymphopenia; more than 100 cases have been subsequently reported. Molecular methods, culture techniques, and serologic testing demonstrated that this species is closely related to Ehrlichia muris, which is found in Eastern Europe and Asia. In 2007, this organism was named E. muris eauclairensis. 2.1. Fusion Proteins In certain embodiments, the present disclosure provides a fusion protein that can be used for the detection of Ehrlichiae spp. Additionally, the present disclosure provides a composition comprising the presently disclosed fusion proteins. In certain embodiments, the presently disclosed fusion protein includes a combination of peptides that can be recognized by antibodies targeting Ehrlichiae spp. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 1 or a variant thereof. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 1. In certain embodiments, the fusion protein ACTIVE 508032486.1 10 069269.0734 PATENT comprises the amino acid sequence set forth in SEQ ID NO: 2 or a variant thereof. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 2. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 3 or a variant thereof. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 3. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 4 or a variant thereof. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 4. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 5 or a variant thereof. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 5. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 6 or a variant thereof. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 6. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 7 or a variant thereof. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 7. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 8 or a variant thereof. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 8. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 9 or a variant thereof. In certain embodiments, the fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 9. In certain embodiments, the fusion protein includes at least one polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein includes at least two polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein includes at least three polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein includes at least four polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein includes at least five polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein includes at least six polypeptides comprising ACTIVE 508032486.1 11 069269.0734 PATENT the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein includes at least seven polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein includes at least eight polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein includes at least nine polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein includes at least ten polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein includes at least eleven polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein includes at least twelve polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein includes at least thirteen polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein includes at least fourteen polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. In certain embodiments, the fusion protein includes at least fifteen polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. SEQ ID NOs: 1-9 are provided below. SEQ ID NO: 1 AETKKTFGLEVSYDGAKIED SEQ ID NO: 2 AETIATFGLSKTYNGAQITD SEQ ID NO: 3 AETKKVLGLNKNYDGAKIED SEQ ID NO: 4 AETKRTFGLDKNEGLTD ACTIVE 508032486.1 12 069269.0734 PATENT SEQ ID NO: 5 AETKNSIALEKNYDGAKIED SEQ ID NO: 6 AETSKKFVLENNYDGAKIED SEQ ID NO: 7 AETKRTFGLDIGYFGAKIED SEQ ID NO: 8 AETKKTFGLESFYEGAKIED SEQ ID NO: 9 AETKKTFGLEGSYEGAKIED In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 1 or a variant thereof. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 1. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 2 or a variant thereof. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 2. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 3 or a variant thereof. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 3. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 4 or a variant thereof. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 4. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 5 or a variant thereof. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 5. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 6 or a variant thereof. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 6. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 7 or a variant thereof. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 7. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 8 or a variant thereof. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 8. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 9 or a variant thereof. In certain embodiments, the fusion protein comprises one or more copies of the amino acid sequence set forth in SEQ ID NO: 9. In certain embodiments, the fusion protein comprises a tag sequence. As used herein, a “tag” or an “epitope tag” refers to a sequence of amino acids, typically added to the N- and/or C- terminus of a polypeptide. The inclusion of tags fused to a polypeptide can facilitate polypeptide ACTIVE 508032486.1 13 069269.0734 PATENT purification and/or detection. In certain embodiments, a tag or tag polypeptide refers to a polypeptide that has enough residues to provide an epitope recognized by an antibody or can serve for detection or purification, yet is short enough such that it does not interfere with the activity of chimeric polypeptide to which it is linked. The tag polypeptide typically is sufficiently unique so an antibody that specifically binds thereto does not substantially cross-react with epitopes in the polypeptide to which it is linked. Suitable tag polypeptides generally have at least 5 or 6 amino acid residues and usually between about 8-50 amino acid residues, typically between 9-30 residues. The tags can be linked to one or more chimeric polypeptides in a multimer and permit detection of the multimer or its recovery from a sample or mixture. Such tags are well-known and can be readily synthesized and designed. Exemplary tag polypeptides include those used for affinity purification and include His tags, the influenza hemagglutinin (HA) tag polypeptide, and its antibody 12CA5; the c-Myc tag and the 8F9, 3C7, 6E10, G4, B7 and 9E10 antibodies thereto; and the Herpes Simplex virus glycoprotein D (gD) tag and its antibody. See, e.g., Field et al. (1988) Mol. Cell. Biol.8:2159-2165; Evan et al. (1985) Mol. Cell. Biol.5:3610-3616; Paborsky et al. (1990) Protein Engineering 3:547-553. In certain embodiments, the fusion protein comprises an amino acid linker between the polypeptides. Linkers are short polypeptide sequences, typically between 1 amino acid residue and 20 amino acid residues, that occur between polypeptides (e.g., one having an amino acid sequence set forth in SEQ ID Nos: 1-9). Linkers are often composed of flexible residues like glycine and serine so that the adjacent polypeptides are free to move relative to one another. Conventionally, longer linkers are used when it is necessary to ensure that two adjacent domains do not sterically interfere with one another. In certain embodiments, the presently disclosed fusion protein has an isoelectric point between about 4.50 and about 4.60. In certain embodiments, the presently disclosed fusion protein has an isoelectric point between about 4.51 and about 4.60, between about 4.52 and about 4.60, between about 4.53 and about 4.60, between about 4.54 and about 4.60, between about 4.55 and about 4.60, between about 4.56 and about 4.60, between about 4.57 and about 4.60, between about 4.58 and about 4.60, between about 4.59 and about 4.60, between about 4.50 and about 4.59, between about 4.50 and about 4.58, between about 4.50 and about 4.57, between about 4.50 and about 4.56, between about 4.50 and about 4.55, between about 4.50 and about 4.54, between about 4.50 and about 4.53, between about 4.50 and about 4.52, between about 4.50 and about 4.51, between about 4.52 and about 4.54, between about 4.55 and about 4.57, or between about 4.57 and about 4.59. In certain embodiments, the presently disclosed fusion protein has an isoelectric point of about 4.58. ACTIVE 508032486.1 14 069269.0734 PATENT In certain embodiments, the presently disclosed fusion protein has a molecular weight between about 23.0 kDa and about 27.0 kDa. In certain embodiments, the presently disclosed fusion protein has a molecular weight between about 23.0 kDa and about 27.0 kDa, between about 23.0 kDa and about 26.5 kDa, between about 23.0 kDa and about 25.0 kDa, between about 23.0 kDa and about 25.5 kDa, between about 23.0 kDa and about 25.0 kDa, between about 23.0 kDa and about 24.5 kDa, between about 23.0 kDa and about 24.0 kDa, between about 24.0 kDa and about 24.1 kDa, between about 24.0 kDa and about 24.2 kDa, between about 24.0 kDa and about 24.3 kDa, between about 24.0 kDa and about 24.4 kDa, between about 24.0 kDa and about 24.5 kDa, between about 24.0 kDa and about 24.6 kDa, between about 24.0 kDa and about 24.7 kDa, between about 24.0 kDa and about 24.8 kDa, between about 24.0 kDa and about 24.9 kDa, between about 24.2 kDa and about 24.5 kDa, between about 24.2 kDa and about 24.3 kDa, between about 24.2 kDa and about 24.4 kDa, between about 24.3 kDa and about 24.4 kDa, between about 24.3 kDa and about 24.5 kDa, between about 24.7 kDa and about 24.8 kDa, between about 24.8 kDa and about 24.9 kDa, or between about 24.7 kDa and about 24.9 kDa. In certain embodiments, the presently disclosed fusion protein has a molecular weight of about 24.3 kDa. In certain embodiments, the presently disclosed fusion protein has a molecular weight of about 24.4 kDa. In certain embodiments, the presently disclosed fusion protein has a molecular weight of about 24.8 kDa. In certain embodiments, the presently disclosed fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 10. In certain embodiments, the presently disclosed fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 10. In certain embodiments, the presently disclosed fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 10. SEQ ID NO: 10 is provided below. AETKKTFGLEVSYDGAKIEDGGAETIATFGLSKTYNGAQITDGGAETKKVLGLNKNYDGAKIEDG AETKRTFGLDKNEGLTDGGAETKNSIALEKNYDGAKIEDGGAETIATFGLSKTYNGAQITDAETS KKFVLENNYDGAKIEDGGAETKRTFGLDIGYFGAKIEDGAETKKTFGLESFYEGAKIEDAETKKT FGLEGSYEGAKIEDGAETIATFGLSKTYNGAQITD [SEQ ID NO: 10] In certain embodiments, the presently disclosed fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 11. In certain embodiments, the presently disclosed fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 11. In certain embodiments, ACTIVE 508032486.1 15 069269.0734 PATENT the presently disclosed fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 11. SEQ ID NO: 11 is provided below. AETKKTFGLEVSYDGAKIEDGGAETIATFGLSKTYNGAQITDGGAETKKVLGLNKNYDGAKIEDG AETKRTFGLDKNEGLTDGGAETKNSIALEKNYDGAKIEDGGAETIATFGLSKTYNGAQITDGAET SKKFVLENNYDGAKIEDGGAETKRTFGLDIGYFGAKIEDGAETKKTFGLESFYEGAKIEDGAETK KTFGLEGSYEGAKIEDGAETIATFGLSKTYNGAQITD [SEQ ID NO: 11] In certain embodiments, the presently disclosed fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 12. In certain embodiments, the presently disclosed fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 12. In certain embodiments, the presently disclosed fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 12. SEQ ID NO: 12 is provided below. SNIGAETKKTFGLEVSYDGAKIEDGGAETIATFGLSKTYNGAQITDGGAETKKVLGLNKNYDGAK IEDGAETKRTFGLDKNEGLTDGGAETKNSIALEKNYDGAKIEDGGAETIATFGLSKTYNGAQITD GAETSKKFVLENNYDGAKIEDGGAETKRTFGLDIGYFGAKIEDGAETKKTFGLESFYEGAKIEDG AETKKTFGLEGSYEGAKIEDGAETIATFGLSKTYNGAQITD [SEQ ID NO: 12] In certain embodiments, the presently disclosed fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 13. In certain embodiments, the presently disclosed fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 13. In certain embodiments, the presently disclosed fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 13. SEQ ID NO: 13 is provided below. AETKKTFGLEVSYDGAKIEDGAETKKTFGLEVSYDGAKIEDGGAETIATFGLSKTYNGAQITDGG AETKKVLGLNKNYDGAKIEDGAETKKTFGLEVSYDGAKIEDGGAETKNSIALEKNYDGAKIEDGG AETIATFGLSKTYNGAQITDGAETSKKFVLENNYDGAKIEDGGAETKRTFGLDIGYFGAKIEDGA ETKKTFGLESFYEGAKIEDGAETKKTFGLEGSYEGAKIEDGAETKKTFGLEGSYEGAKIED [SEQ ID NO: 13] In certain embodiments, the presently disclosed fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, ACTIVE 508032486.1 16 069269.0734 PATENT about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 14. In certain embodiments, the presently disclosed fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 14. In certain embodiments, the presently disclosed fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 14. SEQ ID NO: 14 is provided below. AETKRTFGLDKNEGLTDGAETIATFGLSKTYNGAQITDGGAETIATFGLSKTYNGAQITDGGAET KKVLGLNKNYDGAKIEDGAETKRTFGLDKNEGLTDGGAETIATFGLSKTYNGAQITDGGAETIAT FGLSKTYNGAQITDGAETIATFGLSKTYNGAQITDGGAETIATFGLSKTYNGAQITDGGAETIAT FGLSKTYNGAQITDGAETKKTFGLEGSYEGAKIEDGAETIATFGLSKTYNGAQITD [SEQ ID NO: 14] In certain embodiments, the presently disclosed fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 15. In certain embodiments, the presently disclosed fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 15. In certain embodiments, the presently disclosed fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 15. SEQ ID NO: 15 is provided below. AETKKTFGLEVSYDGAKIEDGAETIATFGLEKNYDGAKIEDGGAETIATFGLSKTYNGAQITDGG AETKKVLGLNKNYDGAKIEDGAETKRTFGLDKNEGLTDGGAETKNSIALEKNYDGAKIEDGGAET IATFGLSKTYNGAQITDGAETSKKFVLENNYDGAKIEDGGAETKRTFGLDIGYFGAKIEDGAETK KTFGLESFYEGAKIEDGAETKKTFGLEGSYEGAKIEDGAETIATFGLSKTYNGAQITD [SEQ ID NO: 15] In certain embodiments, the fusion protein can include the addition of an antibody epitope or other tag, to facilitate identification, targeting, and/or purification of the polypeptide. The use of 6×His (SEQ ID NO: 23) and GST (glutathione S transferase) as tags is well known. The inclusion of a cleavage site at or near the fusion junction will facilitate the removal of the extraneous polypeptide after purification. Other amino acid sequences that can be included in the polypeptide include functional domains, such as active sites from enzymes such as a hydrolase, glycosylation domains, cellular targeting signals, or transmembrane regions. Epitope tags are well known to those of skill in the art. Moreover, antibodies specific to a wide variety of epitope tags are commercially available. These include but are not limited to antibodies against the DYKDDDDK epitope (SEQ ID NO: 22), c-myc antibodies, the HNK-1 carbohydrate epitope, the HA epitope, the HSV epitope, the His4 (SEQ ID NO: 24), His5 (SEQ ID ACTIVE 508032486.1 17 069269.0734 PATENT NO: 25), and His6 (SEQ ID NO: 23) epitopes that are recognized by the His epitope-specific antibodies (see, e.g., Qiagen), and the like. In addition, vectors for epitope tagging proteins are commercially available. A polypeptide can be tagged with the FLAG® epitope (DYKDDDDK epitope (SEQ ID NO: 22)) (N-terminal, C-terminal, or internal tagging), the c-myc epitope (C- terminal), or both the FLAG (DYKDDDDK (SEQ ID NO: 22) epitope) (N-terminal) and c-myc (C-terminal) epitopes. In certain embodiments, fusion proteins and polypeptides disclosed herein can include deletions and/or substitutions of amino acids relative to the native sequence. Sequences with amino acid substitutions are contemplated, as are sequences with a deletion, and sequences with a deletion and a substitution. In certain embodiments, these polypeptides can further include insertions or added amino acids. Substitutional or replacement variants typically contain the exchange of one amino acid for another at one or more sites within the protein and can be designed to modulate one or more properties of the polypeptide, particularly to increase its efficacy or specificity. Substitutions of this kind can be conservative substitutions. Conservative substitution is when one amino acid is replaced with one of similar shape and charge. However, if used, conservative substitutions are well known in the art and include, for example, the changes of alanine to serine; arginine to lysine; asparagine to glutamine or histidine; aspartate to glutamate; cysteine to serine; glutamine to asparagine; glutamate to aspartate; glycine to proline; histidine to asparagine or glutamine; isoleucine to leucine or valine; leucine to valine or isoleucine; lysine to arginine; methionine to leucine or isoleucine; phenylalanine to tyrosine, leucine or methionine; serine to threonine; threonine to serine; tryptophan to tyrosine; tyrosine to tryptophan or phenylalanine; and valine to isoleucine or leucine. Changes other than those discussed above are generally considered not to be conservative substitutions. It is specifically contemplated that one or more of the conservative substitutions above can be included as embodiments. In certain embodiments, such substitutions are specifically excluded. Furthermore, in additional embodiments, substitutions that are not conservative are employed in variants. In addition to a deletion or substitution, the fusion proteins can have an insertion of one or more residues. The variant amino acid sequence can be structurally equivalent to the native counterparts. For example, the variant amino acid sequence forms the appropriate structure and conformation for binding targets, proteins, or polypeptide segments. The following is a discussion based on changing of the amino acids of a polypeptide (e.g., a presently disclosed fusion protein) to create a mutant molecule. For example, certain amino acids can be substituted for other amino acids in a polypeptide without appreciable loss of function, such as the ability to interact with an antibody or a target polypeptide sequence. Since it is the interactive ACTIVE 508032486.1 18 069269.0734 PATENT capacity and nature of a polypeptide that defines that polypeptide's functional activity, certain amino acid substitutions can be made in a polypeptide sequence and nevertheless produce a polypeptide with like properties. In making such changes, the hydropathic index of amino acids can be considered. The importance of the hydropathic amino acid index in conferring interactive function on a protein is generally understood in the art. See Kyte and Doolittle (1982) J. Mol. Biol.157:105-132. It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like. It also is understood in the art that the substitution of amino acids can be made effectively based on hydrophilicity. U.S. Pat. No.4,554,101, incorporated herein by reference, states that the greatest local average hydrophilicity of a protein, as governed by the hydrophilicity of its adjacent amino acids, correlates with a biological property of the protein. As detailed in U.S. Pat. No. 4,554,101, the following hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0±1); glutamate (+3.0±1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (−0.4); proline (−0.5±1); alanine (0.5); histidine (−0.5); cysteine (−1.0); methionine (−1.3); valine (−1.5); leucine (−1.8); isoleucine (−1.8); tyrosine (2.3); phenylalanine (−2.5); tryptophan (−3.4). It is understood that an amino acid can be substituted for another having a similar hydrophilicity value and still produce a biologically equivalent and immunologically equivalent protein. In such changes, the substitution of amino acids whose hydrophilicity values are within ±2, within ±1, and within ±0.5. As outlined above, amino acid substitutions generally are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. However, in certain embodiments, a non-conservative substitution is contemplated. In certain embodiments, a random substitution is also contemplated. Exemplary substitutions that take into consideration the various foregoing characteristics are well known to those of skill in the art and include arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine, and isoleucine. Techniques for determining nucleic acid and amino acid sequence identity are known in the art. Typically, such techniques include determining the nucleotide sequence of the mRNA for a gene and/or determining the amino acid sequence encoded thereby and comparing these sequences to a second nucleotide or amino acid sequence. Genomic sequences can also be determined and compared in this fashion. In general, identity refers to an exact nucleotide-to- nucleotide or amino acid-to-amino acid correspondence of two polynucleotides or polypeptide sequences, respectively. Two or more sequences (polynucleotide or amino acid) can be compared ACTIVE 508032486.1 19 069269.0734 PATENT by determining their percent identity. The percent identity of two sequences, whether nucleic acid or amino acid sequences, is the number of exact matches between two aligned sequences divided by the length of the shorter sequences and multiplied by 100. Unless indicated otherwise, percent identity is determined for two sequences when compared and aligned for maximum correspondence over a comparison window or designated region as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters. See, e.g., the NCBI website at ncbi.nlm.nih.gov/BLAST. For example, BLASTN and BLASTP can be used using the following default parameters: genetic code=standard; filter=none; strand=both; cutoff=60; expect=10; Matrix=BLOSUM62; Descriptions=50 sequences; sort by=HIGH SCORE; Databases=non-redundant, GenBank+EMBL+DDBJ+PDB+GenBank CDS translations+Swiss protein+Spupdate+PIR. Details of these programs can be found on the GenBank website. 2.2. Host Cells The present disclosure also provides recombinant microorganisms comprising the presently disclosed fusion proteins (e.g., fusion proteins set forth in SEQ ID Nos: 10-17). In certain embodiments, the microorganism is a bacterium. In certain embodiments, the microorganism is selected from the group consisting of Aceiobacter aceti, Achromobacter, Acidiphilium, Acinetobacter, Actinomadura, Actinoplanes, Aeropyrumpernix, Agrobacterium. Alcaligenes, Ananas comosus (M), Arthrobacter, Bacillus alcalophilus, Bacillus amyloliquefaciens, Bacillus brevis, Bacillus circulars, Bacillus clausii, Bacillus lentus, Bacillus lichenifirmis, Bacillus macerans, Bacillus stearothermophilus, Bacillus subtilis, Bifidobacterium, Brevibacillus brevis, Burkholderia cepacia, Candida cylindracea, Carica papaya (L), Cellulosimicrobium. Cephalosporium, Chaetomium erraticum, Chaetomium gracile. Clostridium, Clostridium butyricum, Clostridium acetobutylicum, Clostridium thermocellum, Corynebacterium (glutamicum), Corynebacterium efficiens, Escherichia coli, Enterococcus, Erwina chrysanthemi, Gliconobacter. Gluconacetobacter, Haloarcula. Humicola insolens, Kitasatospora setae. Klebsiella, Klebsiella oxytoca, Kocuria, Lactlactis, Lactobacillus. Lactobacillus fermentum, Lactobacillus sake, Lactococcus, Lactococcus lactis. Leuconostoc, Methylocystis, Methanolobus siciliae. Methanogenium organophilum. Methanobacterium bryantii, Microbacterium imperiale, Micrococcus lysodeikticus, Microlunatus, Mucorjavanicus, Mycobacterium, Myrothecium, Nitrobacter, Nitrosomonas, Nocardia, Papaya carica, Pediococcus. Pediococcus halophilus, Paracoccus pantotrophus, Propionibacterium, Pseudomonas, Pseudomonasfluorescens, Pseudomonas denitrificans, Pyrococcus, Pyrococcusfuriosus, Pyrococcus horikoshii, Rhizobium, Rhizomucor miehei, Rhizomucor pusillus Lindt, Rhizopus, Rhizopus delemar, Rhizopus japonicas, Rhizopus niveus. Rhizopus oryzae, Rhizopus oligosporus. Rhodococcus, Sckroiina libertina, ACTIVE 508032486.1 20 069269.0734 PATENT Sphingobacterium multivorum, Sphingobium, Sphingomonas, Streptococcus. Streptococcus thermophilus Y-1, Streptomyces, Streptomyces griseus, Streptomyces lividans, Streptomyces murinus, Streptomyces ruhiginosus. Streptomyces violaceoruber, Streptoverticillium mobaraense, Tetragenococcus. Thermus. Thiosphaera pantotropha, Trametes, Vibrio alginolyticus, Xanthomonas, Zymomonas, and Zymomonus mobilis. In certain embodiments, the microorganism is Escherichia coli (E. coli). In certain embodiments, the E. coli is selected from the group consisting of Enterotoxigenic E. coli (ETEC), Enteropathogenic E. coli (EPEC), Enteroinvasive E. coli (EIEC), Enterohemorrhagic E. coli (EHEC), Uropathogenic E. coli (UPEC), Verotoxin-producing E. coli, E. coli O157:H7, E. coli O104:H4, E. coli O121, E. coli O104:H21, E. coli Kl, and E. coli NC101. In certain embodiments, the E. coli is derived from a strain selected from the group consisting of NCTC 12757, NCTC 12779, NCTC 12790, NCTC 12796, NCTC 12811, ATCC 11229, ATCC 25922, ATCC 8739, DSM 30083, BC 5849, BC 8265, BC 8267, BC 8268, BC 8270, BC 8271, BC 8272, BC 8273, BC 8276, BC 8277, BC 8278, BC 8279, BC 8312, BC 8317, BC 8319, BC 8320, BC 8321, BC 8322, BC 8326, BC 8327, BC 8331, BC 8335, BC 8338, BC 8341, BC 8344, BC 8345, BC 8346, BC 8347, BC 8348, BC 8863, and BC 8864. In certain embodiments, the E. coli is derived from a strain selected from the group consisting of BC 4734 (O26:H11), BC 4735 (O157:H-), BC 4736 , BC 4737 (n.d.), BC 4738 (O157:H7), BC 4945 (O26:H-), BC 4946 (O157:H7), BC 4947 (O111:H-), BC 4948 (O157:H), BC 4949 (O5), BC 5579 (O157:H7), BC 5580 (O157:H7), BC 5582 (O3:H), BC 5643 (O2:H5), BC 5644 (O128), BC 5645 (O55:H-), BC 5646 (O69:H-), BC 5647 (O101:H9), BC 5648 (O103:H2), BC 5850 (O22:H8), BC 5851 (O55:H-), BC 5852 (O48:H21), BC 5853 (O26:H11), BC 5854 (O157:H7), BC 5855 (O157:H-), BC 5856 (O26:H-), BC 5857 (O103:H2), BC 5858 (O26:H11), BC 7832, BC 7833 (O raw form:H-), BC 7834 (ONT:H-), BC 7835 (O103:H2), BC 7836 (O57:H-), BC 7837 (ONT:H-), BC 7838, BC 7839 (O128:H2), BC 7840 (O157:H-), BC 7841 (O23:H-), BC 7842 (O157:H-), BC 7843, BC 7844 (O157:H-), BC 7845 (O103:H2), BC 7846 (O26:H11), BC 7847 (O145:H-), BC 7848 (O157:H-), BC 7849 (O156:H47), BC 7850, BC 7851 (O157:H-), BC 7852 (O157:H-), BC 7853 (O5:H-), BC 7854 (O157:H7), BC 7855 (O157:H7), BC 7856 (O26:H-), BC 7857, BC 7858, BC 7859 (ONT:H-), BC 7860 (O129:H-), BC 7861, BC 7862 (O103:H2), BC 7863, BC 7864 (O raw form:H-), BC 7865, BC 7866 (O26:H-), BC 7867 (O raw form:H-), BC 7868, BC 7869 (ONT:H-), BC 7870 (O113:H-), BC 7871 (ONT:H-), BC 7872 (ONT:H-), BC 7873, BC 7874 (O raw form:H-), BC 7875 (O157:H-), BC 7876 (O111:H-), BC 7877 (O146:H21), BC 7878 (O145:H-), BC 7879 (O22:H8), BC 7880 (O raw form:H-), BC 7881 (O145:H-), BC 8275 (O157:H7), BC 8318 (O55:K-:H-), BC 8325 (O157:H7), BC 8332 (ONT), and BC 8333. ACTIVE 508032486.1 21 069269.0734 PATENT In certain embodiments, the E. coli is derived from a strain selected from the group consisting of BC 8246 (O152:K-:H-), BC 8247 (O124:K(72):H3), BC 8248 (O124), BC 8249 (O112), BC 8250 (O136:K(78):H-), BC 8251 (O124:H-), BC 8252 (O144:K-:H-), BC 8253 (O143:K:H-), BC 8254 (O143), BC 8255 (O112), BC 8256 (O28a.e), BC 8257 (O124:H-), BC 8258 (O143), BC 8259 (O167:K-:H5), BC 8260 (O128a. c.:H35), BC 8261 (O164), BC 8262 (O164:K-:H-), BC 8263 (O164), and BC 8264 (O124). In certain embodiments, the E. coli is derived from a strain selected from the group consisting of BC 5581 (O78:H11), BC 5583 (O2:K1), BC 8221 (O118), BC 8222 (O148:H-), BC 8223 (O111), BC 8224 (O110:H-), BC 8225 (O148), BC 8226 (O118), BC 8227 (O25:H42), BC 8229 (O6), BC 8231 (O153:H45), BC 8232 (O9), BC 8233 (O148), BC 8234 (O128), BC 8235 (O118), BC 8237 (O111), BC 8238 (O110:H17), BC 8240 (O148), BC 8241 (O6H16), BC 8243 (O153), BC 8244 (O15:H-), BC 8245 (O20), BC 8269 (O125a.c:H-), BC 8313 (O6:H6), BC 8315 (O153:H-), BC 8329, BC 8334 (O118:H12), and BC 8339. In certain embodiments, the E. coli is derived from a strain selected from the group consisting of BC 7567 (O86), BC 7568 (O128), BC 7571 (O114), BC 7572 (O119), BC 7573 (O125), BC 7574 (O124), BC 7576 (O127a), BC 7577 (O126), BC 7578 (O142), BC 7579 (O26), BC 7580 (OK26), BC 7581 (O142), BC 7582 (O55), BC 7583 (O158), BC 7584 (O-), BC 7585 (O-), BC 7586 (O-), BC 8330, BC 8550 (O26), BC 8551 (O55), BC 8552 (O158), BC 8553 (O26), BC 8554 (O158), BC 8555 (O86), BC 8556 (O128), BC 8557 (OK26), BC 8558 (O55), BC 8560 (O158), BC 8561 (O158), BC 8562 (O114), BC 8563 (O86), BC 8564 (O128), BC 8565 (O158), BC 8566 (O158), BC 8567 (O158), BC 8568 (O111), BC 8569 (O128), BC 8570 (O114), BC 8571 (O128), BC 8572 (O128), BC 8573 (O158), BC 8574 (O158), BC 8575 (O158), BC 8576 (O158), BC 8577 (O158), BC 8578 (O158), BC 8581 (O158), BC 8583 (O128), BC 8584 (O158), BC 8585 (O128), BC 8586 (O158), BC 8588 (O26), BC 8589 (O86), BC 8590 (O127), BC 8591 (O128), BC 8592 (O114), BC 8593 (O114), BC 8594 (O114), BC 8595 (O125), BC 8596 (O158), BC 8597 (O26), BC 8598 (O26), BC 8599 (O158), BC 8605 (O158), BC 8606 (O158), BC 8607 (O158), BC 8608 (O128), BC 8609 (O55), BC 8610 (O114), BC 8615 (O158), BC 8616 (O128), BC 8617 (O26), BC 8618 (O86), BC 8619, BC 8620, BC 8621, BC 8622, BC 8623, BC 8624 (O158), and BC 8625 (O158). In certain embodiments, the microorganism is a fungal cell. In certain embodiments, the fungal cell is selected from the group consisting of Aspergillus, Aspergillus nidulans, Aspargillus niger, Aspargillus oryze, Aspergillus melleus, Aspergillus pulverulentus, Aspergillus saitoi, Aspergillus sojea, Aspergillus terreus, Aspergillus pseudoterreus, Aspergillus usamii, Candida rugosa, Issatchenkia orientalis, Kluyveromyces, Kluyveromycesfragilis. Kluyveromyces lactis. Kluyveromyces marxianas, Penicillium, Penicillium camemberti, Penicillium citrinum, ACTIVE 508032486.1 22 069269.0734 PATENT Penicillium emersonii, Penicillium roqueforti, Penicillum lilactinum, Penicillum multicolor, Rhodosporidium toruloides, Saccharomyces cerevisiae, Schizosaccharomyces pombe, Trichoderma, Trichoderma longibrachiatum, Trichoderma reesei, Trichoderma viride, Trichosporon penicillaium, Yarrowia lipolytica, and Zygosaccharomyces rouxii. In certain embodiments, the microorganism is a yeast cell. In certain embodiments, the yeast cell is Saccharomyces cerevisiae. 2.2. Methods of Preparation The present disclosure also provides methods for producing the presently disclosed fusion proteins. In certain embodiments, the presently disclosed methods for producing the fusion protein include culturing microorganisms (e.g., one disclosed in above) and purifying the fusion protein. As used herein, “culturing” a cell refers to introducing an appropriate culture medium, under appropriate conditions, to promote the growth of a cell. In certain embodiments, culturing is performed using a liquid or solid growth medium. In certain embodiments, culturing occurs under aerobic or anaerobic conditions based on the requirements of the microorganism and the desired metabolic state of the same. In certain embodiments, culturing includes specific conditions such as temperature, pressure, light, pH, and cell density. In certain embodiments, the methods for producing the fusion protein include a culture medium for culturing the recombinant bacteria. “Culture medium,” as used herein, refers to any composition or broth that supports the growth of the microorganism disclosed herein. A culture media can be liquid or solid. In certain embodiments, the culture media includes nutrients, salts, buffers, elements, and other compounds that support the growth and viability of cells. Additionally, culture media can include sources of nitrogen, carbon, amino acids, carbohydrates, trace elements, vitamins, and minerals. In certain embodiments, the culture media includes a complex extract (e.g., yeast extract). In certain embodiments, the culture medium is enriched in order to support rapid growth. In certain embodiments, the culture medium is modified in order to support slower growth. In certain embodiments, the culture medium includes an agent that can inhibit the growth of or kill contaminating organisms (e.g., an antibiotic). In certain embodiments, the culture medium includes an agent that can activate an inducible promoter or enzyme (e.g., IPTG). Non-limiting examples of culture media encompassed by the present disclosure include M9 medium, Lysogeny Broth (LB), Terrific Broth (TB), and YT broth. The fusion proteins disclosed herein can be purified by any suitable method. Such methods include but are not limited to, the use of affinity matrices or hydrophobic interaction chromatography. For example, without any limitation, a Protein A, Protein G, Protein A/G, or an antibody affinity column can be used to bind and/or to purify the fusion protein. Hydrophobic ACTIVE 508032486.1 23 069269.0734 PATENT interactive chromatography, for example, a butyl or phenyl column, can also be suitable for purifying some polypeptides. Ion exchange chromatography (for example anion exchange chromatography and/or cation exchange chromatography) can also be suitable for purifying some polypeptides. Mixed-mode chromatography (for example reversed phase/anion exchange, reversed phase/cation exchange, hydrophilic interaction/anion exchange, hydrophilic interaction/cation exchange, etc.) can also be suitable for purifying some polypeptides. Many methods of purifying polypeptides are known in the art. In certain embodiments, the fusion protein is produced in a cell-free system. Nonlimiting exemplary cell-free systems are described, for example, in Sitaraman et al., Methods Mol. Biol.498: 229-44 (2009); Spirin, Trends Biotechnol.22: 538-45 (2004); Endo et al., Biotechnol. Adv.21: 695-713 (2003). 2.3. Nucleic Acid Molecules and Vectors Encoding Fusion Proteins Nucleic acid molecules comprising polynucleotides that encode the presently disclosed fusion proteins are provided herein. In certain embodiments, the polynucleotide comprises a nucleotide sequence that encodes a leader sequence. In certain embodiments, the leader sequence is a native leader sequence. In certain embodiments, the leader sequence is a heterologous leader sequence. In certain embodiments, the presently disclosed nucleic acid molecule comprises a nucleotide sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the nucleotide sequence set forth in SEQ ID NO: 18. In certain embodiments, the presently disclosed nucleic acid molecule comprises the nucleotide sequence set forth in SEQ ID NO: 18. In certain embodiments, the presently disclosed nucleic acid molecule consists of the nucleotide sequence set forth in SEQ ID NO: 18. SEQ ID NO: 18 is provided below. GCGGAAACCAAGAAAACCTTTGGTCTGGAAGTGAGCTATGACGGCGCGAAAATCGAAGATGGTGG CGCGGAGACCATTGCGACCTTCGGTCTGAGCAAGACCTACAACGGTGCGCAGATCACCGATGGTG GCGCGGAAACCAAGAAAGTTCTGGGTCTGAACAAAAACTATGACGGTGCGAAGATTGAAGATGGC GCGGAGACCAAACGTACCTTTGGTCTGGATAAGAACGAAGGTCTGACCGATGGTGGCGCGGAGAC TAAAAACAGCATCGCGCTGGAGAAGAACTACGATGGTGCGAAGATCGAGGACGGTGGCGCGGAAA CCATCGCGACCTTCGGCCTGAGCAAAACCTATAACGGTGCGCAAATCACCGACGGCGCGGAGACC AGCAAGAAATTTGTGCTGGAAAACAACTATGACGGTGCGAAAATTGAGGACGGTGGCGCGGAGAC CAAGCGTACCTTCGGCCTGGATATCGGTTACTTTGGCGCGAAAATTGAAGACGGTGCGGAGACCA AGAAAACCTTCGGCCTGGAAAGCTTTTATGAGGGTGCGAAGATCGAGGATGGTGCTGAAACCAAG ACTIVE 508032486.1 24 069269.0734 PATENT AAAACCTTCGGTCTGGAAGGCAGCTACGAGGGTGCGAAAATCGAAGACGGCGCGGAAACCATTGC GACCTTTGGTCTGAGCAAGACCTATAACGGCGCGCAGATTACCGATTAA [SEQ ID NO: 18] In certain embodiments, the presently disclosed nucleic acid molecule comprises a nucleotide sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the nucleotide sequence set forth in SEQ ID NO: 19. In certain embodiments, the presently disclosed nucleic acid molecule comprises the nucleotide sequence set forth in SEQ ID NO: 19. In certain embodiments, the presently disclosed nucleic acid molecule consists of the nucleotide sequence set forth in SEQ ID NO: 19. SEQ ID NO: 19 is provided below. AGCAACATTGGTGCGGAAACCAAGAAAACCTTTGGTCTGGAAGTGAGCTATGACGGCGCGAAAAT CGAAGATGGTGGCGCGGAGACCATTGCGACCTTCGGTCTGAGCAAGACCTACAACGGTGCGCAGA TCACCGATGGTGGCGCGGAAACCAAGAAAGTTCTGGGTCTGAACAAAAACTATGACGGTGCGAAG ATTGAAGATGGCGCGGAGACCAAACGTACCTTTGGTCTGGATAAGAACGAAGGTCTGACCGATGG TGGCGCGGAGACTAAAAACAGCATCGCGCTGGAGAAGAACTACGATGGTGCGAAGATCGAGGACG GTGGCGCGGAAACCATCGCGACCTTCGGCCTGAGCAAAACCTATAACGGTGCGCAAATCACCGAC GGCGCGGAGACCAGCAAGAAATTTGTGCTGGAAAACAACTATGACGGTGCGAAAATTGAGGACGG TGGCGCGGAGACCAAGCGTACCTTCGGCCTGGATATCGGTTACTTTGGCGCGAAAATTGAAGACG GTGCGGAGACCAAGAAAACCTTCGGCCTGGAAAGCTTTTATGAGGGTGCGAAGATCGAGGATGGT GCTGAAACCAAGAAAACCTTCGGTCTGGAAGGCAGCTACGAGGGTGCGAAAATCGAAGACGGCGC GGAAACCATTGCGACCTTTGGTCTGAGCAAGACCTATAACGGCGCGCAGATTACCGATTAA [SEQ ID NO: 19] In certain embodiments, the presently disclosed nucleic acid molecule comprises a nucleotide sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the nucleotide sequence set forth in SEQ ID NO: 20. In certain embodiments, the presently disclosed nucleic acid molecule comprises the nucleotide sequence set forth in SEQ ID NO: 20. In certain embodiments, the presently disclosed nucleic acid molecule consists of the nucleotide sequence set forth in SEQ ID NO: 20. SEQ ID NO: 20 is provided below. GCGGAGACCAAGAAAACCTTTGGCCTGGAAGTGAGCTATGACGGTGCGAAGATTGAGGATGGCGC GGAAACCAAGAAAACCTTCGGTCTGGAAGTGAGCTACGACGGCGCGAAGATCGAGGATGGTGGCG CGGAAACCATTGCGACCTTTGGTCTGAGCAAAACCTATAACGGCGCGCAAATTACCGACGGTGGC GCGGAGACCAAGAAAGTGCTGGGTCTGAACAAGAACTACGACGGTGCGAAAATCGAAGACGGTGC TGAGACCAAGAAAACCTTCGGCCTGGAAGTGAGCTATGACGGGGCGAAAATTGAAGACGGTGGCG ACTIVE 508032486.1 25 069269.0734 PATENT CGGAAACCAAAAACAGCATTGCGCTGGAAAAGAACTATGATGGTGCGAAAATTGAAGATGGTGGC GCGGAGACCATTGCGACCTTCGGCCTGAGCAAAACCTACAACGGTGCGCAAATCACCGATGGTGC GGAGACCAGCAAGAAATTTGTGCTGGAAAACAATTACGATGGCGCGAAGATTGAGGACGGTGGCG CGGAGACTAAACGTACCTTCGGTCTGGACATCGGTTACTTCGGTGCGAAAATTGAGGATGGTGCT GAAACCAAGAAAACCTTTGGTCTGGAGAGCTTTTATGAAGGTGCGAAAATCGAGGACGGTGCCGA GACCAAGAAAACCTTCGGGCTGGAGGGCAGCTACGAAGGCGCGAAAATCGAAGACGGAGCTGAGA CCAAGAAAACCTTCGGACTGGAGGGCAGCTATGAAGGCGCGAAGATCGAAGACTAA [SEQ ID NO: 20] In certain embodiments, the presently disclosed nucleic acid molecule comprises a nucleotide sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the nucleotide sequence set forth in SEQ ID NO: 21. In certain embodiments, the presently disclosed nucleic acid molecule comprises the nucleotide sequence set forth in SEQ ID NO: 21. In certain embodiments, the presently disclosed nucleic acid molecule consists of the nucleotide sequence set forth in SEQ ID NO: 21. SEQ ID NO: 21 is provided below. GCGGAAACCAAGCGTACCTTTGGCCTGGACAAAAACGAGGGTCTGACCGATGGCGCGGAAACCAT TGCGACCTTTGGTCTGAGCAAGACCTATAACGGTGCGCAGATCACCGATGGTGGCGCGGAGACCA TTGCGACCTTCGGTCTGAGCAAAACCTACAACGGTGCGCAAATTACCGATGGTGGCGCGGAAACC AAGAAAGTGCTGGGTCTGAACAAGAACTATGACGGTGCGAAAATTGAGGATGGCGCGGAGACCAA ACGTACCTTCGGTCTGGACAAAAACGAGGGCCTGACCGACGGTGGCGCGGAGACCATCGCGACCT TCGGCCTGAGCAAGACCTACAACGGCGCGCAAATCACCGACGGTGGCGCGGAAACCATCGCGACC TTTGGCCTGAGCAAAACCTATAATGGCGCGCAGATCACCGACGGTGCTGAGACTATCGCTACTTT TGGCCTGAGCAAGACCTATAATGGCGCGCAAATAACTGATGGTGGCGCGGAGACTATCGCTACTT TCGGTCTGAGCAAGACCTACAATGGTGCGCAAATCACTGATGGTGGCGCGGAAACTATCGCTACT TTTGGTCTGAGCAAAACCTATAACGGTGCGCAAATCACCGACGGCGCGGAGACCAAGAAAACCTT TGGTCTGGAGGGCAGCTATGAAGGTGCGAAGATCGAGGACGGTGCTGAAACCATCGCTACTTTCG GATTAAGCAAAACCTATAACGGCGCGCAGATTACCGACTAA [SEQ ID NO: 21] Nucleic acid molecules can be constructed using recombinant DNA techniques conventional in the art. In certain embodiments, a nucleic acid molecule is an expression vector that is suitable for expression in a selected host cell (e.g., a host cell disclosed in Section 2.2). Vectors comprising polynucleotides that encode the presently disclosed fusion proteins are also provided. Such vectors include, but are not limited to, DNA vectors, phage vectors, viral vectors, retroviral vectors, etc. In certain embodiments, a vector is selected that is designed for the ACTIVE 508032486.1 26 069269.0734 PATENT expression of polypeptides in bacterial cells. For example, but without any limitation, a vector that is designed for the expression of polypeptides in E. coli cells is selected. Introduction of one or more nucleic acids into a desired host cell can be accomplished by any method including, without any limitation, calcium phosphate transfection, DEAE-dextran mediated transfection, cationic lipid-mediated transfection, electroporation, transduction, infection, etc. Additional non-limiting methods are described in Sambrook et al., Molecular Cloning, A Laboratory Manual, 3rd ed. Cold Spring Harbor Laboratory Press (2001). In certain embodiments, the nucleic acids can be transiently transfected in the desired host cells. In certain embodiments, the nucleic acids can be stably transfected in the desired host cells. 2.4. Compositions In certain embodiments, the present disclosure provides fusion proteins prepared by the methods described above. In certain embodiments, the fusion protein is prepared in a host cell. In certain embodiments, the fusion protein is prepared in a cell-free system. In certain embodiments, the fusion protein is purified. In certain embodiments, a cell culture media comprising the fusion protein is provided. In certain embodiments, compositions comprising the fusion proteins disclosed herein are provided. In certain embodiments, the composition comprises the fusion protein. In certain embodiments, the composition comprises the host cell comprising the fusion protein. In certain embodiments, the composition comprises the nucleic acid encoding the fusion protein. In certain embodiments, the composition comprises the vector encoding the fusion protein. In certain embodiments, compositions disclosed herein further comprise a second fusion protein including a combination of polypeptides that can be recognized by antibodies targeting Ehrlichia canis. In certain embodiments, the second fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 16. In certain embodiments, the presently disclosed fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16. In certain embodiments, the presently disclosed fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 16. SEQ ID NO: 16 is provided below. SNIGTEDSVSAPATEDSVSAPATEDSVSAPATEDSVSAPATEDSVSAPATEDSVSAPAGGGSYNH NTGLLDLDSDILNMLYSYNHNTGLLDLDSDILNMLYSYNHNTGLLDLDSDILNMLYGGGSKEEST PEVKAEDLQPAVDSKEESTPEVKAEDLQPAVDSKEESTPEVKAEDLQPAVD [SEQ ID NO: 16] ACTIVE 508032486.1 27 069269.0734 PATENT In certain embodiments, compositions disclosed herein further comprise a third fusion protein including a combination of polypeptides that can be recognized by antibodies targeting Ehrlichiae spp. In certain embodiments, the third fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 17. In certain embodiments, the presently disclosed fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 17. In certain embodiments, the presently disclosed fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 17. SEQ ID NO: 17 is provided below. SNIGNTTTGVFGLKQDWDGATIKDGGNTTVGVFGLKQNWDGSAISNGGNPTVALYGLKQDWNGVS AGGNTTVGVFGIEQDWDRCVISGGNPTVALYGLKQDWEGISSGGKSTVGVFGLKHDWDGSPILKG GNTTTGVFGLKQDWDGSTISGGNTTTGVFGLKQDWDGATIKDGGNPTVALYGLKQDWNGVSAGGK STVGVFGLKHDWDGSPILKGGNTTVGVFGIEQDWDRCVISGGNTTTGVFGLKQDWDGATIKDGGN TTVGVFGLKQNWDGSAISNGGKSTVGVFGLKHDWDGSPILK [SEQ ID NO: 17] 3. Methods of Detection The present disclosure further provides methods for detecting various infectious organisms including E. ewingii in a subject. In certain embodiments, the method can be used for diagnosis, prognosis, stratification, risk assessment, or treatment monitoring of a disease. In certain embodiments, the present disclosure provides methods for detecting an antibody that specifically binds to an E. ewingii polypeptide in a sample. In certain embodiments, the method comprises contacting the fusion protein disclosed herein with said sample and detecting a complex formed between the antibody and the fusion protein. In certain embodiments, the method comprises contacting the compositions disclosed herein (e.g., described in Section 2.4) with said sample and detecting a complex formed between the antibody and the composition. In certain embodiments, the present disclosure provides methods of identifying a subject having an E. ewingii infection. In certain embodiments, the method comprises contacting the fusion protein disclosed herein with a sample from the subject. Additionally or alternatively, the method comprises contacting the compositions or solid supports disclosed herein (e.g., described in Section 2.4) with said sample. In certain embodiments, the method comprises detecting a complex formed between the sample and the fusion protein, the composition, or the solid support. In certain embodiments, an increased level of detected complexes relative to a normal control indicates that the subject has an E. ewingii infection. ACTIVE 508032486.1 28 069269.0734 PATENT In certain embodiments, the method can be used to detect Lyme disease. In certain embodiments, the method can be used for the classification of Lyme exposure of a subject, e.g., an animal by calculating levels of antibodies that specifically bind to the fusion protein disclosed herein using a method for detecting an antibody that specifically binds to an E. ewingii antigen in a sample disclosed herein; calculating reference values of the levels of the antibodies, and determining the type of E. ewingii infection of the subject by comparing the levels of the antibodies to the reference values. The reference values can be calculated using levels of detectable signals of negative controls, and more than one reference value may be calculated for each antibody that specifically binds to a Lyme polypeptide. The reference values can be established by analyzing results from experimental samples from animals that are infected with or vaccinated against E. ewingii. Empirical values can be calculated from the analysis of experimental samples and used for the calculation of reference values for the antibodies. Initially, artificial values can be set for each reference value and adjusted by an algorithm using experimental data. A minimal value for each reference value can also be established from the analysis of experimental samples and in cases where the reference value calculated is less than the minimal value, the minimal value can be used. Further provided herein is a method for detecting multiple disease antigens and/or antibodies in a sample, which method comprises a) contacting said sample with a composition for detecting multiple disease antigens and/or antibodies comprising the presently disclosed fusion proteins; and b) detecting a complex formed between the antibody and the fusion protein. In certain embodiments, the sample may be from a subject selected from the group consisting of a dog, a cat, a human, and a horse. In certain embodiments, the method can be used for diagnosis, prognosis, stratification, risk assessment, or treatment monitoring of a disease. In certain embodiments, the sample can be selected from the group consisting of a serum, a plasma, and a blood sample. In certain embodiments, the sample may be a clinical sample. In some embodiments, the antibody can be a monoclonal or polyclonal antibody or antibody fragment. The detection of antibodies and/or antigens can be achieved by immunoassays, including any immunoassay known in the art including, but not limited to, radioimmunoassay, enzyme- linked immunosorbent assay (ELISA), “sandwich” assay, precipitin reaction, agglutination assay, fluorescent immunoassay, and chemiluminescence-based immunoassay. In certain embodiments, the complex formed between the antibody and the fusion protein can be assessed by a sandwich or competitive assay format, optionally with a binder or antibody. In certain embodiments, the binder or antibody can be attached to a surface and functions as a capture antibody. In certain embodiments, the capture binder or antibody can be attached to the surface directly or indirectly. In some embodiments, the binder or antibody can be attached to the surface via a biotin-avidin (or ACTIVE 508032486.1 29 069269.0734 PATENT streptavidin) linking pair. In certain embodiments, at least one of the binders or antibodies can be labeled. In certain embodiments, the complex formed between the antibody and the fusion protein can be assessed by a format selected from the group consisting of an enzyme-linked immunosorbent assay (ELISA), Western blotting, immunoblotting, immunoprecipitation, radioimmunoassay (RIA), immunostaining, latex agglutination, indirect hemagglutination assay (IHA), complement fixation, indirect immunofluorescent assay (IFA), nephelometry, flow cytometry assay, plasmon resonance assay, chemiluminescence assay, lateral flow immunoassay, u-capture assay, inhibition assay and avidity assay. In certain embodiments, the complex formed between the antibody and the fusion protein can be assessed in a homogeneous or heterogeneous assay format. In certain embodiments, multiple reagents for detecting infectious organisms can be included in the same assay, such as parallel immunoassay. For example, but without any limitation, a parallel immunoassay can include at least about 2, about 3, about 4, about 5, about 10, about 100, about 1000 or more reagents, such as antibodies or antigenic polypeptides, in the same assay system. Numerous technological platforms for performing parallel immunoassays are known. Generally, such methods involve a logical or physical array of either the subject samples, the protein markers, or both. Common array formats include both liquid and solid phase arrays. For example, assays employing liquid phase arrays, e.g., for hybridization of nucleic acids, binding of antibodies or other receptors to ligands, etc., can be performed in multiwell or microtiter plates. Microtiter plates with 96, 384, or 1536 wells are widely available, and even higher numbers of wells, e.g., 3456 and 9600 can be used. In general, the choice of microtiter plates is determined by the methods and equipment, e.g., robotic handling and loading systems, used for sample preparation and analysis. Exemplary systems include, e.g., the ORCA™ system from Beckman- Coulter, Inc. (Fullerton, Calif.) and the Zymate systems from Zymark Corporation (Hopkinton, Mass.). Additionally or alternatively, a variety of solid phase arrays can favorably be employed for parallel immunoassays in the context of the invention. Exemplary formats include membrane or filter arrays (e.g., nitrocellulose, nylon), pin arrays, and bead arrays (e.g., in a liquid “slurry”). Typically, probes corresponding to nucleic acid or protein reagents that specifically interact with (e.g., hybridize to or bind to) an expression product corresponding to a member of the candidate library, are immobilized, for example by direct or indirect cross-linking, to the solid support. Essentially any solid support capable of withstanding the reagents and conditions necessary for performing the particular expression assay can be utilized. For example, functionalized glass, silicon, silicon dioxide, modified silicon, any of a variety of polymers, such as ACTIVE 508032486.1 30 069269.0734 PATENT (poly)tetrafluoroethylene, (poly)vinylidenedifluoride, polystyrene, polycarbonate, or combinations thereof can all serve as the substrate for a solid phase array. The polypeptides/antibodies can be immobilized to solid phase support for the detection of antibody binding. As used herein, “solid phase support” is not limited to a specific type of support. Rather a large number of supports are available and are known to one of ordinary skill in the art. Solid phase supports include silica gels, resins, derivatized plastic films, glass beads, cotton, plastic beads, and alumina gels. A suitable solid phase support may be selected based on desired end use and suitability for various synthetic protocols. For example, for polypeptide synthesis, solid phase support may refer to resins such as polystyrene (e.g., PAM-resin obtained from Bachem Inc., Peninsula Laboratories, etc.), POLYHIPE® resin (obtained from Aminotech, Canada), polyamide resin (obtained from Peninsula Laboratories), polystyrene resin grafted with polyethylene glycol (TENTAGEL®, Rapp Polymere, Tubingen, Germany) or polydimethylacrylamide resin (obtained from Milligen/Biosearch, California). In certain embodiments, solid phase support refers to polydimethylacrylamide resin. In certain embodiments, the array can be a “chip” composed, e.g., of one of the above- specified materials. Polynucleotide probes, e.g., RNA or DNA, such as cDNA, synthetic oligonucleotides, and the like, or binding proteins such as antibodies or antigen-binding fragments or derivatives thereof may be affixed to the chip in a logically ordered manner, i.e., in an array. Detailed discussions of methods for linking nucleic acids and proteins to a chip substrate are found in, e.g., U.S. Pat. No.5,143,854, U.S. Pat. No.5,837,832, U.S. Pat. No.6,087,112, U.S. Pat. No. 5,215,882, U.S. Pat. No. 5,707,807, U.S. Pat. No. 5,807,522, U.S. Pat. No. 5,958,342, U.S. Pat. No. 5,994,076, U.S. Pat. No. 6,004,755, U.S. Pat. No. 6,048,695, U.S. Pat. No. 6,060,240, U.S. Pat. No. 6,090,556, and U.S. Pat. No. 6,040,138, each of which is hereby incorporated in its entirety. Microarray signals can be detected by scanning the microarray with a variety of laser or CCD-based scanners and extracting features with numerous software packages, for example, Imagene (Biodiscovery), Feature Extraction Software (Agilent), Scanalyze (Eisen, M. 1999. SCANALYZE User Manual; Stanford Univ., Stanford, Calif. Ver 2.32.), GenePix (Axon Instruments). High-throughput protein systems include commercially available systems from Ciphergen Biosystems, Inc. (Fremont, Calif.) such as PROTEIN CHIP® arrays and the Schleicher and Schuell protein microspot array (FastQuant Human Chemokine, S&S Bioscences Inc., Keene, N.H., US). In one embodiment, the high-throughput protein assay system may be the Bio-CD system using the SDI™ (Spinning Disc Interferometry) technology by Quadraspec, Inc. (West Lafayette, Ind.). Detailed discussions of the Bio-CD system are found in, e.g., U.S. Pat. No. 6,685,885, U.S. Pat. ACTIVE 508032486.1 31 069269.0734 PATENT No. 7,405,831, U.S. Pat. No. 7,552,282, U.S. Pat. No. 7,659,968, U.S. Pat. No. 7,663,092, U.S. Pat. No.7,787,126, U.S. Pat. No.7,910,356, U.S. Pat. Pub. No.2004/0166593, U.S. Pat. Pub. No. 2006/0256676, U.S. Pat. Pub. No.2007/0023643, U.S. Pat. Pub. No.2007/0212257, U.S. Pat. Pub. No.2007/0259366, U.S. Pat. Pub. No.2008/0175755, U.S. Pat. Pub. No.2009/0002716, U.S. Pat. Pub. No.2009/0263913, U.S. Pat. Pub. No.2010/0145627, and Canadian Pat. Pub. No.2681722, each of which is hereby incorporated in its entirety. The parallel immunoassay results obtained as described above can then be used for diagnosis of the specific disorder. The individual proteins/antibodies can be detected or quantified by any of several means well known to those of skill in the art. In certain embodiments, a qualitative change in one or more proteins/antibodies is determined. Qualitative changes include the appearance of a proteins/antibodies spot that is not detectable in samples obtained from normal controls or the disappearance of a proteins/antibodies spot that is detectable in normal controls but not in the sample taken from an affected subject. In certain embodiments, a quantitative change in one or more proteins/antibodies may be measured. The concentration of protein/antibody levels may be expressed in absolute terms, for example, optical density as read by image analysis. Additionally or alternatively, the concentrations can be expressed as a fraction, relative to normal levels of the same protein/antibody. 4. Computer Readable Medium In certain non-limiting embodiments, the present disclosure provides a computer-readable medium containing executable instructions that when executed perform a method of classifying E. ewingii infection of a subject, e.g., an animal, the method comprising: calculating levels of antibodies that specifically bind to the presently disclosed fusion protein using a method for detecting an antibody that specifically binds to an E. ewingii antigen in a sample; calculating reference values of the levels of the antibodies; and determining the type of E. ewingii infection of the subject by comparing the levels of the antibodies to the reference values. Further provided herein is a system for classifying E. ewingii infection of a subject, e.g., an animal comprising the computer-readable medium disclosed herein and an antigenic composition comprising the fusion protein disclosed herein. 5. Kits In certain embodiments, the present disclosure provides kits for detecting infectious organisms. In certain embodiments, the kit includes, in a container, the polypeptides or antigenic compositions disclosed herein. In certain embodiments, the container is a sealed container. Non- limiting examples of containers include a microtiter plate, a bottle, a metal tube, a laminate tube, a ACTIVE 508032486.1 32 069269.0734 PATENT plastic tube, a dispenser, a pressurized container, a barrier container, a package, a compartment, or other types of containers such as injection or blow-molded plastic containers into which the dispersions or compositions or desired bottles, dispensers, or packages are retained. Further examples of containers include glass or plastic vials or bottles. In certain embodiments, the containers can dispense or contain a pre-determined amount of a composition of the present invention. For example, but without any limitation, the composition can be dispensed as a liquid, a fluid, or a semi-solid. In certain embodiments, the kit can also include instructions for using the kit and/or compositions. In certain embodiments, the instructions can include an explanation of how to use and maintain the compositions. 6. Methods of Treatment The present disclosure provides for methods of preventing, treating, and/or delaying progression of E. ewingii infection of a subject in need thereof. In certain embodiments, the subject is a dog. In certain embodiments, the method comprises administering an antibiotic to the subject. Non-limiting examples of antibiotics to be administered to the dog include clindamycin, metronidazole, amoxicillin, cephalexin, doxycycline, enrofloxacin, gentamicin, trimethoprim, sulfamethoxazole, clavamox, chloramphenicol, cefpodoxime, tetracycline, marbofloxacin, antirobe, ciprofloxacin, albon, amoxicillin, baytril, biomox amoxicillin, cephalexin, amoxicillin, clavulanic acid, ketoconazole, and sulfadimethoxine. In certain embodiments, the antibiotic is doxycycline. In certain embodiments, the antibiotic is administered at an amount of about 1 mg/kg to about 100 mg/kg. For example, and not by way of limitation, the antibiotic can be administered at an amount of about 1 mg/kg to about 10 mg/kg, about 2 mg/kg to about 10 mg/kg, about 1 mg/kg to about 20 mg/kg, about 2 mg/kg to about 20 mg/kg, about 5 mg/kg to about 10 mg/kg, about 5 mg/kg to about 20 mg/kg, about 5 mg/kg to about 30 mg/kg, about 10 mg/kg to about 20 mg/kg, about 10 mg/kg to about 30 mg/kg, about 10 mg/kg to about 40 mg/kg, about 10 mg/kg to about 50 mg/kg, about 20 mg/kg to about 50 mg/kg, about 30 mg/kg to about 50 mg/kg, about 20 mg/kg to about 60 mg/kg, about 20 mg/kg to about 70 mg/kg, about 20 mg/kg to about 80 mg/kg, about 30 mg/kg to about 60 mg/kg, about 30 mg/kg to about 70 mg/kg, about 30 mg/kg to about 80 mg/kg, about 40 mg/kg to about 60 mg/kg, about 40 mg/kg to about 70 mg/kg, about 40 mg/kg to about 80 mg/kg or about 50 mg/kg to about 80 mg/kg. In certain embodiments, the antibiotic is administered at an amount of about 20 mg/kg to about 50 mg/kg, e.g., about 30 mg/kg. In certain embodiments, the antibiotic is administered at an amount of about 5 mg/kg to about 20 mg/kg, e.g., about 10 mg/kg. ACTIVE 508032486.1 33 069269.0734 PATENT In certain embodiments, the antibiotic can be administered to an animal thrice every day, twice every day, once every day, once every two days, once every three days, once every four days, once every five days, once every six days, once a week, once every two weeks, once every three weeks, or once every month. In certain embodiments, the antibiotic can be administered to an animal one or more times per day. For example, and not by way of limitation, the antibiotic can be administered to an animal once, twice, three, four, five, or more times a day. In certain embodiments, the presently disclosed methods of treatment can include the identification of the subject having E. ewingii infection. In certain embodiments, the identification is carried out using one of the methods of detection described in Section 3 above. 7. Non-limiting Exemplary Embodiments In certain non-limiting embodiments, the present disclosure provides a fusion protein comprising the amino acid sequence set forth in SEQ ID NO: 12. In certain non-limiting embodiments, the present disclosure provides a composition comprising a first fusion protein and a second fusion protein. In certain embodiments, the first fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 12. In certain embodiments, the second fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16 or SEQ ID NO: 17. In certain non-limiting embodiments, the present disclosure provides a composition comprising a first fusion protein, a second fusion protein, and a third fusion protein. In certain embodiments, the first fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 12. In certain embodiments, the second fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16. In certain embodiments, the third fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 17. In certain non-limiting embodiments, the present disclosure provides a solid phase support comprising a fusion protein comprising the amino acid sequence set forth in SEQ ID NO: 12. In certain non-limiting embodiments, the present disclosure provides a solid phase support comprising a first fusion protein and a second fusion protein. In certain embodiments, the first fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 12. In certain embodiments, the second fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16 or SEQ ID NO: 17. In certain non-limiting embodiments, the present disclosure provides a solid phase support comprising a first fusion protein, a second fusion protein, and a third fusion protein. In certain embodiments, the first fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 12. In certain embodiments, the second fusion protein comprises the amino acid sequence set forth ACTIVE 508032486.1 34 069269.0734 PATENT in SEQ ID NO: 16. In certain embodiments, the third fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 17. EXAMPLES The presently disclosed subject matter will be better understood by reference to the following Examples, which are provided as exemplary of the invention, and not by way of limitation. Example 1 Ehrlichia spp. are responsible for several emerging zoonoses and capable of causing significant illness in dogs with a potentially fatal rickettsial disease. Accurate diagnostic assays are needed in order to determine appropriate therapy, risk assessment, and treatment monitoring. The objectives of the present example were to evaluate the performance of the newly developed Accuplex® BioCD automated fluorescence system for the detection of antibodies against E. canis, E. chaffeensis, and E. ewingii in canine serum and compare assay sensitivity and specificity to some commercial tests. The ability to detect antibodies against Ehrlichia pathogens in dogs by the Accuplex automated system was compared with an indirect fluorescent antibody assay (IFA), MFIA (Luminex), SNAP assays, as well as ELISA. Canine blood samples were also assayed for pathogen DNA by polymerase chain reaction (PCR). The results of the present example demonstrate that the new Accuplex® BioCD Ehrlichia assay is more sensitive than the previous version of the test, as well as alternative commercially available immunoassays. The sensitivity and specificity of the Accuplex® Ehrlichia test are 92% and 95%, respectively, as calculated based on tested clinical canine serum samples. Accuplex® BioCD platform allows multiplexing enhanced Ehrlichia markers in order to achieve improved results. Results of field evaluations show that this test can be reliably used under typical clinical and test conditions to identify dogs exposed to the pathogens of interest. Introduction The Ehrlichiae are a group of gram-negative, obligate intracellular cocci that infect different blood cells in many animal species, as well as in humans. Although these pathogens share phylogenetic similarities, there are multiple differences from tick vectors to host-cell tropism and clinical manifestations. Dogs are susceptible to infection with multiple Ehrlichia spp.; among those are E. canis, transmitted by Rhipicephalus sanguineus (brown dog tick), and E. chaffeensis and E.ewingii, whose primary vector is Amblyomma americanum (lone star tick) (Beall MJ, 2012). Coinfections with multiple ehrlichial agents have been reported in dogs (Kordick, 1999). The lone ACTIVE 508032486.1 35 069269.0734 PATENT star tick is widely distributed in the eastern, southeastern, and south-central United States, and the brown dog tick is found worldwide (CDC.gov). In dogs, two leukotrophic diseases are caused by bacteria in the genus Ehrlichia: Canine Monocytic Ehrlichiosis (CME) mainly caused by E. canis and E. chaffeensis, and Canine Granulocytic Ehrlichiosis (CGE), caused by E. ewingii (Aziz, 2023). In recent decades, enhanced and modified transmission patterns of all vector-borne pathogens have been recorded around the globe (Dantas-Torres, 2015) due to multiple factors, including an increase in human population, deforestation, as well as frequent transport of pet animals from one continent to another. A variety of serologic tests, such as indirect fluorescent antibody (IFA), Western Blot, and ELISAs have been used to verify past or current infections. IFA is the reference standard serologic test for the diagnosis of Ehrlichiosis (CDC.gov) and is being widely used testing method due to its simplicity and cost-effectiveness compared to other approaches. However, shortcomings of the IFA test are antigenic cross-reactivity with other closely related species that infect dogs, the nature of antigens used in the tests (Stillman BA, 2014), as well as subjective endpoint interpretations and lack of standardization between laboratories (Luo, T., 2010). Since E. ewingii has not been yet cultured, IFAs for antibodies against other Ehrlichia spp. have been used for anti- E. ewingii antibodies detection (Yabsley MJ, 2011). Examination of a peripheral blood smear to identify thrombocytopenia and to visually inspect cells for morula is often the only diagnostic test performed prior to treatment (Cohn, LA, 2012). Identification and differentiation of Ehrlichia and related species with PCR testing is useful in dogs with subclinical & persistent infections, yet some dogs might be PCR negative if the organism is sequestered or persists at undetectable levels, and not so helpful after antibiotic therapy is initiated (Luo, T, 2010). According to the CDC, “a negative PCR result does not rule out the diagnosis, and treatment should not be withheld due to a negative result” (CDC.gov). In the present example, a newly developed sensitive and reliable immunodiagnostic set of antigens for E. canis, E. chaffeensis, and E. ewingii infection detection were evaluated using the Accuplex® BioCD multiplex system. The presently disclosed Accuplex® advances in characterization of Ehrlichia spp. immune responses have provided new possibilities to significantly improve immunodiagnostics for ehrlichiosis. Material and Methods Study design and samples. Dog blood and serum samples were collected at VCA veterinary clinics and practices. After blood was collected, 1.5 ml was placed into an ethylene diamine tetra- acetic acid (EDTA) tube and then 0.25 ml was pipetted into a 1.5 Eppendorf tube and stored at −80°C until evaluated for DNA by proprietary PCR assay. The remaining blood was placed into ACTIVE 508032486.1 36 069269.0734 PATENT a tube without anticoagulant, allowed to clot, centrifuged at 1,500 × g for 10 min, and the sera stored in multiple aliquots at −80°C until assayed. On the day of collection, the blood samples in EDTA were shipped on cold packs by overnight express to a commercial laboratory for the performance of proprietary PCR assays that amplify the DNA of A. phagocytophilum, A. platys, E. canis, Ehrlichia chaffeensis, and Ehrlichia ewingii using the standard operating procedures of the laboratory (Antech Laboratories, Lake Success, NY). Sera samples were ultimately assayed for Ehrlichia antibodies by IFA, SNAP®4DX®Plus, and Lab 4Dx (4Dx ELISA), IDEXX laboratories assays from commercial manufacturers, following the manufacturer’s guidelines, as well as by MFIA (BioVet) and Accuplex® assay. Accuplex® BioCD System. Accuplex® BioCD, an automated multiplex silicon-wafer- based system, is capable of testing for antigens and antibodies against multiple antigens using small volumes of serum. Additional information on the Accuplex® BioCD system can be found in U.S. Patent No.10,100,092, the contents of which are incorporated by reference in their entirety. All markers for multiplexed arrays were printed on high throughput production sciFLEXARRAYER. These assays can be very beneficial in service laboratories because the automated system can lessen inter-assay variability and large numbers of samples can be assayed concurrently. Multiple proprietary peptides were printed on BioCD wafers with the sciFLEXARRAYER S100 system, Scienion. The concentration was determined by assessing the signal: noise with varying antigen concentrations and buffer compositions. Wafers with printed peptides are further processed as described previously (Moroff et al, Vet J., 2014). The reference methods for the detection of antibodies that specifically bind to the amino acid sequences PanEhrl, Mod1, and CanChim were Lab 4Dx Plus Test (7244), SNAP®4Dx®Plus, IFA, and MFIA, comparing data from multiple technological platforms. IFA tests. Commercially available IFA tests were purchased from VMRD and Fuller laboratories. The assay was performed according to the manufacturer’s recommendations. Slides were examined using a UV microscope with filters for fluorescein. To determine the cross- reactivity of samples, IFA tests were performed not only with E. canis and E. chaffeensis kits but also with A. Phagocytophilum slides. MFIA. Multiplexed fluorometric immunoassays (MFIA), based on Luminex xMAP technology, were performed utilizing beads coated with the same set of antigens as in the presently disclosed Accupex® assay. A suspension of beads coupled with Ehrlichia spp. and Anaplasma recombinant proteins mixed at a concentration of 5x104 beads/ml per bead subset in an assay buffer A (PBS 0.1M,1% BSA,5%FBS, NaCl 0.15M). 50 µl of the bead suspension was added to white round-bottom 96 well plates (Corning, Kennebunk, ME, USA) with 50 µl of dog serum diluted in assay buffer A (final serum dilution 1:200). All incubations were performed at room temperature ACTIVE 508032486.1 37 069269.0734 PATENT in the dark on a rotating shaker (Compact digital microplate shaker ThermoFisher). After every incubation, the plate was washed twice with washing buffer (PBS, 0.02% Tween 20, 0.1% BSA). Plates were incubated for 60 min and washed. Next, 100 µl of biotin-conjugated rabbit anti-dog IgG (304-065-003 Jackson ImmunoResearch) was added per well in dilution buffer B (1 µg/ml in PBS,1% BSA) and incubated for 30 min. 100 µl/well of Streptavidin R-Phycoerythrin (5866 Invitrogen) was added at a final concentration of 2 µg/ml in assay buffer B and incubated for 30 min. The beads were then resuspended in a washing buffer and results were read out in a FLEX MAP dispositive (Luminex). The signal was measured as the median fluorescence intensity (MFI) of at least 50 events of each bead region. Antigens. All expression constructs were generated by GenScript, NJ, USA; antigens were expressed and purified as described earlier (Moroff et al, 2015). MOD1 (E. ewingii detection) is set forth as SEQ ID NO: 12, CanChimera (Ehrlichia) is set forth as SEQ ID NO: 16, and PanEhrlichia (Ehrlichia) is set forth as SEQ ID NO: 17. SEQ ID Nos: 12, 16, and 17 are reproduced below. SNIGAETKKTFGLEVSYDGAKIEDGGAETIATFGLSKTYNGAQITDGGAETKKVLGLNKNYDGAK IEDGAETKRTFGLDKNEGLTDGGAETKNSIALEKNYDGAKIEDGGAETIATFGLSKTYNGAQITD GAETSKKFVLENNYDGAKIEDGGAETKRTFGLDIGYFGAKIEDGAETKKTFGLESFYEGAKIEDG AETKKTFGLEGSYEGAKIEDGAETIATFGLSKTYNGAQITD [SEQ ID NO: 12] SNIGTEDSVSAPATEDSVSAPATEDSVSAPATEDSVSAPATEDSVSAPATEDSVSAPAGGGSYNH NTGLLDLDSDILNMLYSYNHNTGLLDLDSDILNMLYSYNHNTGLLDLDSDILNMLYGGGSKEEST PEVKAEDLQPAVDSKEESTPEVKAEDLQPAVDSKEESTPEVKAEDLQPAVD [SEQ ID NO: 16] SNIGNTTTGVFGLKQDWDGATIKDGGNTTVGVFGLKQNWDGSAISNGGNPTVALYGLKQDWNGVS AGGNTTVGVFGIEQDWDRCVISGGNPTVALYGLKQDWEGISSGGKSTVGVFGLKHDWDGSPILKG GNTTTGVFGLKQDWDGSTISGGNTTTGVFGLKQDWDGATIKDGGNPTVALYGLKQDWNGVSAGGK STVGVFGLKHDWDGSPILKGGNTTVGVFGIEQDWDRCVISGGNTTTGVFGLKQDWDGATIKDGGN TTVGVFGLKQNWDGSAISNGGKSTVGVFGLKHDWDGSPILK [SEQ ID NO: 17] Results Clinical samples of dogs were tested for E. canis, E. chaffeensis, and E. ewingii infections using conventional assays such as IFA, SNAP®4Dx®Plus, Lab4Dx tests (IDEXX Laboratories), as well as MFIA (BioVet), and the presently disclosed multiplex Ehrlichia assay (ACCUPLEX®, Antech). Three (3) sets of samples were evaluated: a) a set of 155 clinical samples from New York reference laboratories; b) 38 clinical samples confirmed with a proprietary qPCR; and c) 32 samples selected in collaboration with Colorado State University (CSU). Table 1 shows a data ACTIVE 508032486.1 38 069269.0734 PATENT comparison of tested canine serum samples using the presently disclosed Accuplex®, SNAP®4Dx®, MFIA, and IFA. Table 1 is provided below. After the analysis of all the samples, 60 samples were determined as positive with SNAP®4Dx®Plus, and 72 samples, 71 samples, and 80 samples were determined as positive with the presently disclosed Accuplex® set of antigens, MFIA, and IFA, respectively. Sensitivity and specificity for the presently disclosed Accuplex® were 93.3% and 83.2%, respectively, without consideration of IFA confirmatory test results (Table 2). 16 serum samples that were Accuplex® positive and SNAP®4Dx® negative were further confirmed as positive with IFA, bringing the specificity of the presently disclosed Accuplex® to 97.53%. Table 2 is provided below. The results of 155 clinical sample tests show that the presently disclosed Accuplex® is capable of reliably detecting Ehrlichia spp. in canine serum. 147 samples were tested, and their results were compared on the presently disclosed Accuplex® and Lab4Dx platforms (8 samples did not have sufficient volume for submission). Responses from 147 samples generated 58 positive results (39%) with 4Dx®ELISA, 64 positives (44%) on the presently disclosed Accuplex® platform, and 65(44%) and 73(50%) with MFIA and IFA respectively. Table 3A shows Ehrlichia spp. detection with the presently disclosed Accuplex® and Lab4Dx® for 147 canine clinical samples. Table 3B shows Accuplex® and Lab4Dx performance comparison. Tables 3A and 3B are provided below. Statistical analysis of the sensitivity and specificity of the presently disclosed Accuplex® and 4Dx®ELISA was done considering a potential cross-reactivity between Ehrlichia spp. and Anaplasma spp, particularly when the pathogens were present at very high titers (Sainz, A 2015). Similar cross-reactivity observations were stated in the IFA kit performance characteristics document (Fuller laboratory). Sensitivity and specificity for the newly developed Ehrlichia Accuplex® enhancement markers were 86% and 96% when Anaplasma spp cross-reactivity was not considered, and 92% and 95%, respectively, with the consideration of such possibility. The sensitivity and specificity of reference Lab4Dx® Ehrlichia calculated with the consideration of the Anaplasma factor was 77% and 98%, respectively. Statistically calculated comparison between two assay platforms shows strong overall agreement (0.8-0.9), with negative and positive agreements being 0.87 and 0.9, respectively. To evaluate the performance of MOD1 antigen in detecting and differentiating E. ewingii, a set of 32 samples, selected and confirmed by serology and PCR at CSU, was tested on the BioCD platform in a blind mode. Table 4A shows the results. Table 4B shows the summary of the same. Tables 4A and 4B are provided below. ACTIVE 508032486.1 39 069269.0734 PATENT 32 samples were analyzed at CSU by qPCR and serology before the presently disclosed Accuplex®, MFIA, and SNAP®4Dx®Plus testing, with 16 samples confirmed as E. ewingii positive. All 16 E. ewingii positive samples were detected by the presently disclosed Accuplex® markers, and 13 samples were detected by SNAP®4Dx®Plus. Sensitivity and specificity for the presently disclosed Accuplex® was 100% for this set, with SNAP®4Dx®Plus sensitivity/specificity at 81.2% and 100%, accordingly. The presently disclosed Accuplex® platform detected all positive E. ewingii samples in this set. All positive sequencing results confirmed E. ewingii sequences for the samples identified as such by Accuplex®. Table 5A shows Accuplex® results on Ehrlichia spp. detection for qPCR-confirmed samples. Table 5B shows a summary of results of Table 5A. Tables 5A and 5B are provided below. 38 canine DNA samples were tested with a proprietary qPCR system (Antech) to determine Ehrlichia spp. and/or Anaplasma Spp.34 samples were qPCR Ehrlichia spp. positive (E. canis and E.ewingii) and 4 samples were positive for A. phagocytophilum. Corresponding serum samples were analyzed with the presently disclosed Accuplex®, MFIA, and SNAP®4Dx®Plus. Accuplex® and MFIA positively identified 33 out of 34 qPCR-confirmed samples with one sample not having sufficient volume for testing on Accuplex®. Genotype reports of the tested samples clearly show that presently disclosed Accuplex® markers are capable of detecting Ehrlichia spp. of various genotypes, i.e., Columbia, Turkey, and Thailand strains among others. Worldwide distribution of E. canis and other Ehrlichia spp. has been reported in an increasing number of publications (Aguiar, 2008, Sainz A. 2015). The combination of PCR detection with an immunodiagnostic approach significantly improves early diagnosis in the acute stage of infection with better sensitivity, providing the best evidence of recent infection, helping with result interpretation, and treatment selection and ensuring better prognosis. Correct and timely testing and reporting of vector-borne infections are important to improve understanding of evolving trends, the geographical distribution of these diseases, and how common these infections are. Summary Conventional assays used to diagnose ehrlichiosis, such as IFA, have limitations related to the nature of antigens used in the tests. Because E. ewingii has not been successfully cultured, IFAs for antibodies against other Ehrlichia spp. (E. canis and E. chaffeensis) have been widely used for detecting anti-E. ewingii antibodies in dogs. Serologic cross-reactivity among E. canis, E. ewingii, and E. chaffeensis has been reported, as a result, diagnosis on the basis of whole-cell ELISA or IFA results is limited (Stillman et al, 2014). In the present example, it was evaluated Accuplex® assay performance developed with novel species-specific recombinant antigens. It has ACTIVE 508032486.1 40 069269.0734 PATENT been determined that the sensitivity and specificity of the presently disclosed Accuplex® Ehrlichia assay are 92% and 95%, respectively. ACTIVE 508032486.1 41 069269.0734 PATENT Tables Table 1. Accuplex®, SNAP®4Dx®, MFIA, and IFA data comparison of 155 canine serum samples. ® ® ® Sample ID SNAP 4Dx Plus Accuplex MFIA Ehrlichia GP36 Ehrlichia Ehrlichia IFA 1 Neg neg Neg Neg pos 2 Neg neg Neg Neg pos 3 Neg neg Pos Pos pos 4 Pos Pos Pos Pos pos 5 Pos neg Pos Pos pos 6 Neg neg Neg Neg neg 7 Neg neg Neg Neg neg 8 Neg neg Neg Neg neg 9 Neg neg Neg Neg neg 10 Neg neg Neg Neg neg 11 Neg neg Neg Neg neg 12 Neg neg Neg Neg neg 13 Neg neg Neg Neg neg 14 Neg neg Neg Neg neg 15 Pos pos Pos Pos pos 16 Neg neg Neg Neg neg 17 Neg neg Pos BDL pos 18 Neg neg Neg Neg neg 19 Neg neg Neg Neg neg 20 Neg neg Neg Neg neg 21 Neg neg Neg Neg neg 22 Neg neg Neg Neg neg 23 Neg neg Neg Neg neg 24 Neg neg Neg Neg pos 25 Neg neg Pos Pos pos 26 Neg neg Pos Pos pos 27 Neg neg Neg Neg neg 28 Pos pos Pos Pos pos 29 Pos pos Pos Pos pos 30 Pos pos Pos Pos pos 31 Pos pos Pos Pos pos 32 Neg pos Pos Pos pos 33 Neg neg Pos Neg pos 34 Neg neg Neg Neg pos 35 Neg pos Neg Neg pos 36 Neg neg Pos Pos pos 37 Neg neg Neg Neg neg 38 Neg neg Neg Neg neg ACTIVE 508032486.1 42 069269.0734 PATENT SNAP®4D ® ® Sample ID x Plus GP Accuplex MFIA Ehrlichia 36 Ehrlichia Ehrlichia IFA 39 Neg neg Neg Neg neg 40 Neg neg Neg Neg neg 41 Neg neg Neg Neg neg 42 Neg neg Neg Neg neg 43 Neg neg Neg Neg neg 44 Neg neg Neg Neg neg 45 Neg pos Pos Pos pos 46 Neg pos Pos Pos pos 47 Pos neg Pos Pos pos 48 Neg neg Neg Neg neg 49 Neg neg Neg Neg neg 50 Neg pos Pos Pos pos 51 Neg neg Neg Neg neg 52 Neg neg Neg Neg neg 53 Pos neg Pos Pos pos 54 Neg neg Neg Neg neg 55 Neg neg Neg Neg neg 56 Neg neg Neg Neg neg 57 Neg neg Neg Neg neg 58 Neg neg Neg Neg neg 59 Neg neg Neg Neg neg 60 Neg neg Neg Neg neg 61 Neg neg Neg Neg neg 62 Pos neg Pos Pos pos 63 Neg neg Neg Neg neg 64 Neg neg Neg Neg neg 65 Neg neg Neg Neg neg 66 Neg neg Neg Neg neg 67 Neg neg Neg Neg neg 68 Neg pos Pos Pos neg 69 Pos pos Pos Pos pos 70 Neg neg Pos Neg pos 71 Neg pos Pos Pos pos 72 Neg neg Neg Neg neg 73 Pos pos Pos Pos pos 74 Neg neg Neg Neg neg 75 Neg neg Neg Neg neg 76 Pos pos Pos Pos pos 77 Pos pos Pos Pos pos 78 Neg neg Neg Neg pos 79 Pos pos Pos Pos pos 80 Pos neg Pos Pos pos 81 Pos pos Pos Pos pos 82 Neg pos Pos Neg pos ACTIVE 508032486.1 43 069269.0734 PATENT SNAP®4Dx® ® Sample ID Plus GP36 Accuplex MFIA Ehrlichia Ehrlichia Ehrlichia IFA 83 Pos pos Pos Pos pos 84 Neg neg Neg Neg neg 85 Neg neg Neg Neg neg 86 Neg neg Pos Pos neg 87 Pos neg Pos Pos pos 88 Neg neg Pos Pos pos 89 Neg neg Neg Neg neg 90 Neg neg Neg Neg neg 91 Neg neg Neg Neg neg 92 Neg neg Neg Neg neg 93 Neg neg Neg Neg neg 94 Neg neg Neg Neg neg 95 Neg neg Neg Neg neg 96 Neg neg Neg Neg neg 97 Neg neg Neg Neg neg 98 Neg neg Neg Neg neg 99 Neg neg Neg Neg neg 100 Neg neg Neg Neg neg 101 Neg neg Neg Pos neg 102 Neg neg Neg Pos pos 103 Neg neg Neg Neg neg 104 Neg neg Neg Neg neg 105 Neg neg Neg Neg neg 106 Neg neg Neg Neg neg 107 Neg neg Neg Neg neg 108 Neg neg Neg Neg neg 109 Neg neg Neg Neg neg 110 Neg neg Neg Neg neg 111 Neg neg Neg Neg neg 112 Pos neg Pos Pos pos 113 Pos neg Pos Pos pos 114 Pos pos Pos Pos pos 115 Pos pos Pos Pos pos 116 Pos neg Neg Neg pos 117 Pos neg Pos Pos pos 118 Pos pos Pos Pos pos 119 Pos pos Pos Pos pos 120 Pos pos Pos Pos pos 121 Pos pos Pos Pos pos 122 Neg neg Neg Neg neg 123 Pos pos Pos Pos pos 124 Pos pos Pos Pos pos 125 Pos 6363 Pos Pos pos 126 Pos pos Pos Pos pos ACTIVE 508032486.1 44 069269.0734 PATENT Sample ID SNAP®4Dx®Plus Accuplex® MFIA Ehrlichia GP36 Ehrlichia Ehrlichia IFA 127 Pos neg Pos Pos pos 128 Pos pos Pos Pos pos 129 Pos neg Neg Neg pos 130 Neg neg Neg Neg neg 131 Pos neg Neg Pos pos 132 Pos neg Pos Pos pos 133 Pos pos Pos Pos pos 134 Pos neg Pos Pos pos 135 Pos pos Pos Pos pos 136 Pos neg Pos Pos pos 137 Pos neg Pos Pos pos 138 Pos neg Pos Pos pos 139 Pos neg Neg Neg pos 140 Pos neg Pos Pos pos 141 Pos neg Pos Pos pos 142 Pos pos Pos Pos pos 143 Pos neg Pos Pos pos 144 Neg neg Neg Neg neg 145 Pos pos Pos Pos pos 146 Pos neg Pos Pos pos 147 Pos pos Pos Pos pos 148 Pos pos Pos Pos pos 149 Pos pos Pos Pos pos 150 Pos neg Pos Pos neg 151 Pos pos Pos Pos pos 152 Pos neg Pos Pos pos 153 Pos pos Pos Pos pos 154 Pos pos Pos Pos pos SAMPOOL00582 Pos pos Pos Pos pos Positives 60 42 72 71 80 ACTIVE 508032486.1 45 069269.0734 PATENT Table 2. Sensitivity and Specificity analysis for the set of 155 canine serum samples: Accuplex® SNAP®4Dx®Pl Accuplex Ehrlichia us ® POS NEG SNAP®4Dx®Plu POS 56 4 60 Sensitivit s, y 77.78 93.3 NE 16 79 95 Specificit Ehrlichia G y 95.18 83.2 72 83 155 With IFA data, Accuplex® Specificity: 97.53% TN 79 FP: out of 16 samples, 14 were confirmed with ELISA or IFA. FP 2 Table 3A. Ehrlichia spp. detection with Accuplex® and Lab 4Dx® (4Dx ELISA) Animal ID Ehrlichia 4Dx ACCUPLEX® EHRLICHIA IFA (Ehrlichia) MFIA ELISA 1 Neg Neg pos Neg 2 Neg Neg pos Neg 3 Neg Pos pos Pos 4 Pos Pos pos Pos 5 Pos Pos pos Pos 6 Neg Neg Neg Neg 7 Neg Neg Neg Neg 8 Neg Neg Neg Neg 9 Neg Neg Neg Neg 10 Neg Neg Neg Neg 11 Neg Neg Neg Neg 12 Neg Neg Neg Neg 13 Neg Neg Neg Neg 14 Neg Neg Neg Neg 15 Pos Pos pos Pos 16 Neg Neg Neg Neg 17 Neg Pos pos Neg 18 Neg Neg Neg Neg 19 Neg Neg Neg Neg 20 Neg Neg Neg Neg 21 Neg Neg Neg Neg 22 Neg Neg Neg Neg ACTIVE 508032486.1 46 069269.0734 PATENT Animal ID Ehrlichia 4Dx ACCUPLEX® EHRLICHIA IFA (Ehrlichia) MFIA ELISA 23 Neg Neg Neg Neg 24 Neg Neg pos Neg 25 Neg Pos pos Pos 26 Neg Pos pos Pos 27 Neg Neg Neg Neg 28 Pos Pos pos Pos 29 Pos Pos pos Pos 30 Pos Pos pos Pos 31 Pos Pos pos Pos 32 Neg Pos pos Neg 33 Neg Neg pos Neg 34 Neg Neg pos Neg 35 Neg Neg Neg Neg 36 Neg Neg Neg Neg 37 Neg Neg Neg Neg 38 Neg Neg Neg Neg 39 Neg Neg Neg Neg 40 Neg Neg Neg Neg 41 Neg Neg Neg Neg 42 Neg Neg Neg Neg 43 Neg Pos pos Pos 44 Pos Pos pos Pos 45 Neg Neg Neg Neg 46 Neg Neg Neg Neg 47 Neg Pos pos Pos 48 Neg Neg Neg Neg 49 Neg Neg Neg Neg 50 Pos Pos pos Pos 51 Neg Neg Neg Neg 52 Neg Neg Neg Neg 53 Neg Neg Neg Neg 54 Neg Neg Neg Neg 55 Neg Neg Neg Neg 56 Neg Neg Neg Neg 57 Neg Neg Neg Neg 58 Neg Neg Neg Neg 59 Pos Pos pos Pos 60 Neg Neg Neg Neg 61 Neg Neg Neg Neg 62 Neg Neg Neg Neg 63 Neg Neg Neg Neg 64 Neg Neg Neg Neg 65 Neg Pos neg Pos 66 Pos Pos pos Pos ACTIVE 508032486.1 47 069269.0734 PATENT Animal ID Ehrlichia 4Dx ACCUPLEX® EHRLICHIA IFA (Ehrlichia) MFIA ELISA 67 Neg Pos pos Pos 68 Neg Pos pos Pos 69 Neg Neg Neg Neg 70 Neg Neg Neg Neg 71 Neg Neg Neg Neg 72 Pos Pos pos Pos 73 Neg Neg pos Neg 74 Pos Pos pos Pos 75 Pos Pos pos Pos 76 Pos Pos pos Pos 77 Neg Pos pos Pos 78 Pos Pos pos Pos 79 Neg Neg Neg Neg 80 Neg Neg Neg Neg 81 Pos Pos pos Pos 82 Neg Pos pos Pos 83 Neg Neg Neg Neg 84 Neg Neg Neg Neg 85 Neg Neg Neg Neg 86 Neg Neg Neg Neg 87 Pos Neg Neg Neg 88 Neg Neg Neg Neg 89 Neg Neg Neg Neg 90 Neg Neg Neg Neg 91 Neg Neg Neg Neg 92 Neg Neg Neg Neg 93 Neg Neg Neg Neg 94 Neg Neg Neg Neg 95 Neg Neg Neg Pos 96 Neg Neg pos Pos 97 Neg Neg Neg Neg 98 Neg Neg Neg Neg 99 Neg Neg Neg Neg 100 Neg Neg Neg Neg 101 Neg Neg Neg Neg 102 Neg Neg Neg Neg 103 Neg Neg Neg Neg 104 Neg Neg Neg Neg 105 Neg Neg Neg Neg 106 Pos Pos pos Pos 107 Pos Pos pos Pos 108 Pos Pos pos Pos 109 Pos Pos pos Pos 110 Neg Neg pos Neg ACTIVE 508032486.1 48 069269.0734 PATENT Animal ID Ehrlichia 4Dx ACCUPLEX® EHRLICHIA IFA (Ehrlichia) MFIA ELISA 111 Pos Pos pos Pos 112 Pos Pos pos Pos 113 Pos Pos pos Pos 114 Pos Pos pos Pos 115 Pos Pos pos Pos 116 Pos Neg Neg Neg 117 Pos Pos pos Pos 118 Pos Pos pos Pos 119 Pos Pos pos Pos 120 Pos Pos pos Pos 121 Pos Pos pos Pos 122 Pos Pos pos Pos 123 Pos Neg pos Neg 124 Pos Neg Neg Neg 125 Pos Neg pos Pos 126 Pos Pos pos Pos 127 Pos Pos pos Pos 128 Pos Pos pos Pos 129 Pos Pos pos Pos 130 Pos Pos pos Pos 131 Pos Pos pos Pos 132 Pos Neg pos Neg 133 Pos Pos pos Pos 134 Pos Pos pos Pos 135 Pos Pos pos Pos 136 Pos Pos pos Pos 137 Neg Neg Neg Neg 138 Pos Pos pos Pos 139 Pos Pos pos Pos 140 Pos Pos pos Pos 141 Pos Pos pos Pos 142 Pos Pos Neg Pos 143 Pos Pos pos Pos 144 Pos Pos pos Pos 145 Pos Pos pos Pos 146 Pos Pos pos Pos 147 Pos Pos pos Pos 147 58 64 73 65 39% 44% 50% 44% Table 3B. Ehrlichia 4Dx® ACCUPL ® Animal ID EX ELISA EHRLICHIA IFA (Ehrlichia) MFIA 147 58 64 73 65 ACTIVE 508032486.1 49 069269.0734 PATENT Ehrlich ® ® Animal ID ia 4Dx ACCUPLEX ELISA EHRLICHIA IFA (Ehrlichia) MFIA 39% 44% 50% 44% Table 4A. Accuplex® results on detecting and differentiating E. ewingii. SNAP® M ® ID FIA Accuplex qP CR 4Dx 4Dx ®Plu ®Plu E. Other E. Other E. s s ew Positive ewingii Positive ewi Seq hrli Anap in uencing E gii responses result responses ngii chia l 1 Pos neg POS POS PO E. ewingii S EF116932.1 Ewingii 2 neg neg neg neg - sequencing - no ID 3 Pos neg POS POS PO S Ewingii 4 neg neg neg neg - sequencing - no ID Ewingii 5 neg neg neg neg - sequencing - no ID Ewingii 6 neg neg neg neg - sequencing - no ID Ewingii 7 neg neg neg neg - sequencing - no ID 8 Pos neg POS POS PO E. ewingii S EF116932.1 9 neg neg Neg POS PO E. ewingii S AF287962.1 10 neg neg Neg neg - 11 Pos neg POS E. E. PO chaffeensis POS chaffeensis S 12 Pos neg POS POS PO S 13 Pos neg Neg E. canis / E. E. canis / E. E. E. cani sis n s chaffeen eg chaffeensis cani s Q085429 14 neg neg POS POS PO E. ewingii S EF116932.1 15 neg neg Neg neg - 16 neg neg POS POS PO S 17 Pos neg POS Ehrlichia POS PO S ACTIVE 508032486.1 50 069269.0734 PATENT 18 neg neg Neg neg - 19 neg neg Neg neg - 20 neg neg Neg neg - 21 neg neg Neg Neg - 22 Pos neg POS Ehrlichia POS PO E. ewingii S EF116932.1 23 Pos neg POS POS PO S Ewingii 24 Pos neg POS POS - sequencing - no ID 25 neg Pos Neg POS - E. cani 26 Pos neg POS E. canis POS E. canis s & E. canis A. KT357369 plat ys, 27 Pos neg POS POS PO S E. ewi ngii GP36 28 Pos neg POS E. canis POS E. canis & sequencing - E. E.Ewingii cani s 29 neg neg Neg neg - 30 neg neg Neg neg - 31 neg neg Neg neg - 32 Neg neg Neg neg - E. ewingii Only NA 14 16 13 Total Ehrlichia 13 15 17 15 spp Table 4B. Platform Accuplex® qPCR SNAP® MFIA E. ewingii result E. ewingii 4Dx®Plus Ehrlichia E.ewingii E. ewingii Only 16 13 NA 14 Total Ehrlichia spp 17 15 13 15 Table 5A. Accuplex® results on Ehrlichia spp. detection for qPCR-confirmed samples. 4Dx® F ® Accupl LUMIN Animal Ehrlichia V PCR 4Dx P ® ® FV qPCR result EHR lus GP ex EX ID Genotyping LIC Plus HIA Anapl Ehrlic 36 Ehrlich Ehrlichi hia ia a ACTIVE 508032486.1 51 069269.0734 PATENT 1 Anaplasma phagocytophilum no DNA neg neg neg neg neg Neg 2 Anaplasma phagocytophilum no DNA neg neg neg neg neg Neg 3 Ehrlichia canis E. canis Columbia pos neg pos neg pos pos 4 Ehrlichia canis no DNA pos neg pos neg pos pos 5 Ehrlichia canis E. canis Peru pos neg pos neg pos pos 6 Ehrlichia canis E. canis Thailand pos pos pos neg pos pos 7 Ehrlichia canis E. canis Columbia pos neg pos neg pos pos 8 Ehrlichia canis E. canis Columbia pos neg neg pos pos pos 9 E.ewingii E.ewingii pos neg neg neg pos pos 10 E.ewingii E.ewingii pos neg pos neg pos pos 11 Ehrlichia canis no DNA pos neg pos pos pos pos 12 Ehrlichia canis E. canis Columbia pos pos pos pos pos pos 13 Ehrlichia canis * pos neg pos neg pos pos 14 Co-Infection E. canis Columbia pos neg neg neg pos pos 15 Co-Infection E. canis Turkey pos neg neg pos pos pos 16 Ehrlichia canis pos neg pos neg pos pos 17 Ehrlichia canis E. canis Columbia pos neg pos neg pos pos 18 Ehrlichia canis * pos neg pos pos pos pos 19 Ehrlichia canis * pos neg pos neg pos pos 20 Ehrlichia canis * pos neg neg neg pos pos 21 Ehrlichia canis E. canis Columbia pos pos pos NA NA pos 22 Ehrlichia canis * pos pos pos neg pos pos 23 Ehrlichia canis * pos pos pos pos pos pos 24 Ehrlichia ewingii * pos neg pos neg pos pos 25 Ehrlichia canis * pos neg pos neg pos pos 26 Ehrlichia canis E. canis Turkey pos neg neg neg pos pos 27 Ehrlichia canis E. canis Jake pos neg pos neg pos pos 28 Ehrlichia canis E. canis Columbia pos neg pos neg pos pos 29 Ehrlichia canis * pos neg pos neg pos pos 30 Ehrlichia canis no DNA pos pos pos neg pos pos 31 Ehrlichia canis E. canis Columbia pos neg pos neg pos pos 32 Anaplasma phagocytophilum no DNA neg pos neg neg neg Neg 33 Ehrlichia canis E. canis Columbia pos neg pos neg pos pos ACTIVE 508032486.1 52 069269.0734 PATENT 34 Anaplasma phagocytophilum * neg neg pos neg pos pos 35 Ehrlichia canis * pos neg pos neg pos pos 36 Ehrlichia canis * pos neg neg neg pos pos 37 Ehrlichia canis * pos neg pos neg pos pos 38 Ehrlichia canis * pos neg neg neg pos Neg 34 27 6 34 34 Table 5B. Ehrlichia Positives FV Samples tested qPCR SNAP®4Dx®Pl ® Total us GP36 Accuplex MFIA Ehrlichia Ehrlichia Ehrlichia Ehrlichia Ehrlichia 38 34 27 6 34 34 ACTIVE 508032486.1 53 069269.0734 PATENT * * * Although the presently disclosed subject matter and its advantages have been described in detail, it should be understood that various changes, substitutions and alterations can be made herein without departing from the spirit and scope of the invention as defined by the appended claims. Moreover, the scope of the present application is not intended to be limited to the particular embodiments of the process, machine, manufacture, composition of matter, means, methods and steps described in the specification. As one of ordinary skill in the art will readily appreciate from the disclosure of the presently disclosed subject matter, processes, machines, manufacture, compositions of matter, means, methods, or steps, presently existing or later to be developed that perform substantially the same function or achieve substantially the same result as the corresponding embodiments described herein can be utilized according to the presently disclosed subject matter. Accordingly, the appended claims are intended to include within their scope such processes, machines, manufacture, compositions of matter, means, methods, or steps. Patents, patent applications, publications, product descriptions and protocols are cited throughout this application the disclosures of which are incorporated herein by reference in their entireties for all purposes. ACTIVE 508032486.1 54

Claims

069269.0734 PATENT WHAT IS CLAIMED IS: 1. A fusion protein comprising the amino sequence set forth in SEQ ID NO: 1 or a variant thereof, SEQ ID NO: 2 or a variant thereof, SEQ ID NO: 3 or a variant thereof, SEQ ID NO: 4 or a variant thereof, SEQ ID NO: 5 or a variant thereof, SEQ ID NO: 6 or a variant thereof, SEQ ID NO: 7 or a variant thereof, SEQ ID NO: 8 or a variant thereof, SEQ ID NO: 9 or a variant thereof, or a combination thereof. 2. A fusion protein comprising the amino sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. 3. A fusion protein comprising at least two polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or a combination thereof. 4. The fusion protein of claim 3 comprising at least five polypeptides. 5. The fusion protein of claim 3 or 4 comprising at least eight polypeptides. 6. The fusion protein of any one of claims 3-5 comprising at least eleven polypeptides. 7. The fusion protein of any one of claims 1-6 further comprising a linker. 8. The fusion protein of any one of claims 1-7, wherein the fusion protein has an isoelectric point between about 4.50 and about 4.60. 9. The fusion protein of claim 8, wherein the isoelectric point is about 4.58. 10. The fusion protein of any one of claims 1-9, wherein the fusion protein has a molecular weight between about 23.0 kDa and about 27.0 kDa. 11. The fusion protein of claim 10, wherein the molecular weight is about 24.3 kDa, 24.4 kDa, or 24.8 kDa. 12. The fusion protein of claim 10 or 11, wherein the molecular weight is about 24.8 kDa. 13. The fusion protein of any one of claims 1-12 comprising an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 15. 14. The fusion protein of claim 13 comprising the amino acid sequence set forth in SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 15. 15. The fusion protein of claim 13 or 14 consisting of the amino acid sequence set forth in SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, or SEQ ID NO: 15. ACTIVE 508032486.1 55
069269.0734 PATENT 16. The fusion protein of any one of claims 1-13 comprising an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 12. 17. The fusion protein of claim 16 comprising the amino acid sequence set forth in SEQ ID NO: 12. 18. The fusion protein of claim 16 or 17 consisting of the amino acid sequence set forth in SEQ ID NO: 12. 19. The fusion protein of any one of claims 1-18 further comprising a tag. 20. A nucleic acid molecule comprising a polynucleotide encoding the fusion protein of any one of claims 1-19. 21. A vector comprising the nucleic acid molecule of claim 20. 22. A host cell comprising the fusion protein of any one of claims 1-19, the nucleic acid molecule of claim 20, or the vector of claim 21. 23. The host cell of claim 22, wherein the host cell is E. coli. 24. A method of producing a fusion protein comprising culturing the host cell of claim 22 or 23 in a culture medium and purifying the fusion protein. 25. A composition comprising a fusion protein of any one of claims 1-19. 26. The composition of claim 25, further comprising a second fusion protein. 27. The composition of claim 26, wherein the second fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 16 or SEQ ID NO: 17. 28. The composition of claim 26 or 27, wherein the second fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16 or SEQ ID NO: 17. 29. The composition of any one of claims 26-28, wherein the second fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 16 or SEQ ID NO: 17. 30. The composition of claim 25, further comprising a second fusion protein and a third fusion protein. 31. The composition of claim 30, wherein a) the second fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 16, and b) the third fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, ACTIVE 508032486.1 56
069269.0734 PATENT about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 17. 32. The composition of claim 30 or 31, wherein a) the second fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16, and b) the third fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 17. 33. The composition of any one of claims 30-32, wherein a) the second fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 16, and b) the third fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 17. 34. A composition comprising a nucleic acid of claim 20, a vector of claim 21, or a host cell of claim 22 or 23. 35. A solid phase support comprising a fusion protein of any one of claims 1-19. 36. The solid phase support of claim 35, further comprising a second fusion protein. 37. The solid phase support of claim 36, wherein the second fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 16 or SEQ ID NO: 17. 38. The solid phase support of claim 36 or 37, wherein the second fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16 or SEQ ID NO: 17. 39. The solid phase support of any one of claims 36-38, wherein the second fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 16 or SEQ ID NO: 17. 40. The solid phase support of claim 35, further comprising a second fusion protein and a third fusion protein. 41. The solid phase support of claim 40, wherein a) the second fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 16, and b) the third fusion protein comprises an amino acid sequence that is at least about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, or about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence set forth in SEQ ID NO: 17. 42. The solid phase support of claim 40 or 41, wherein a) the second fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 16, and b) the third fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 17. 43. The solid phase support of any one of claims 40-42, wherein a) the second fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 16, and b) the third fusion protein consists of the amino acid sequence set forth in SEQ ID NO: 17. ACTIVE 508032486.1 57
069269.0734 PATENT 44. A method of detecting an antibody binding an infectious organism in a subject comprising contacting the fusion protein of any one of claims 1-19, the composition of any one of claims 25- 34, or the solid phase support of any one of claims 35-43 with a sample from the subject and detecting a complex formed between the antibody and the fusion protein, the composition, or the solid phase. 45. The method of claim 44, wherein the infectious organism is E. ewingii. 46. The method of claim 44 or 45, wherein the antibody specifically binds to an epitope of E. ewingii. 47. The method of any one of claims 44-46, wherein the sample is a serum sample, a plasma sample, a blood sample, or a combination thereof. 48. The method of any one of claims 44-47, wherein the fusion protein is immobilized on a solid phase support. 49. The method of any one of claims 44-48, wherein the subject is a dog. 50. A method of identifying a subject having an E. ewingii infection, comprising: a) contacting the fusion protein of any one of claims 1-19, the composition of any one of claims 25-34, or the solid phase support of any one of claims 35-43 with a sample from the subject; b) detecting a complex formed between the sample and the fusion protein, the composition, or the solid phase; wherein an increased level of detected complexes relative to a normal control indicates that the subject has an E. ewingii infection. 51. The method of claim 50, wherein the sample is a serum sample, a plasma sample, a blood sample, or a combination thereof. 52. The method of claim 50 or 51, wherein the subject is a dog. 53. A method of identifying a subject having Lyme disease, comprising: a) contacting the fusion protein of any one of claims 1-19, the composition of any one of claims 25-34, or the solid phase support of any one of claims 35-43 with a sample from the subject; b) detecting a complex formed between the sample and the fusion protein, the composition, or the solid phase; wherein an increased level of detected complexes relative to a normal control indicates that the subject has Lyme disease. 54. The method of claim 53, wherein the sample is a serum sample, a plasma sample, a blood sample, or a combination thereof. 55. The method of claim 53 or 54, wherein the subject is a dog. ACTIVE 508032486.1 58
069269.0734 PATENT 56. A kit comprising contacting the fusion protein of any one of claims 1-19, the composition of any one of claims 25-34, or the solid phase support of any one of claims 35-43. 57. A method of preventing, treating, and/or delaying progression of E. ewingii infection of a subject in need thereof comprising administering an antibiotic to the subject. 58. The method of claim 57, wherein the antibiotic is selected from clindamycin, metronidazole, amoxicillin, cephalexin, doxycycline, enrofloxacin, gentamicin, trimethoprim, sulfamethoxazole, clavamox, chloramphenicol, cefpodoxime, tetracycline, marbofloxacin, antirobe, ciprofloxacin, albon, amoxicillin, baytril, biomox amoxicillin, cephalexin, amoxicillin, clavulanic acid, ketoconazole, sulfadimethoxine, or a combination thereof. 59. The method of claim 57 or 58, wherein the antibiotic is doxycycline. 60. The method of any one of claims 57-59, wherein the subject is a dog. 61. A method of treating and/or delaying progression of E. ewingii infection of a subject in need thereof comprising: a) identifying the subject as having an E. ewingii infection; and b) administering an antibiotic to the subject. 62. The method of claim 61, wherein the identifying comprises: a) contacting the fusion protein of any one of claims 1-19, the composition of any one of claims 25-34, or the solid phase support of any one of claims 35-43 with a sample from the subject; and b) detecting a complex formed between the sample and the fusion protein, the composition, or the solid phase; wherein an increased level of detected complexes relative to a normal control indicates that the subject has an E. ewingii infection. 63. The method of claim 61 or 62, wherein the antibiotic is selected from clindamycin, metronidazole, amoxicillin, cephalexin, doxycycline, enrofloxacin, gentamicin, trimethoprim, sulfamethoxazole, clavamox, chloramphenicol, cefpodoxime, tetracycline, marbofloxacin, antirobe, ciprofloxacin, albon, amoxicillin, baytril, biomox amoxicillin, cephalexin, amoxicillin, clavulanic acid, ketoconazole, sulfadimethoxine, or a combination thereof. 64. The method of any one of claims 61-63, wherein the antibiotic is doxycycline. 65. The method of any one of claims 61-64, wherein the subject is a dog. ACTIVE 508032486.1 59
PCT/US2025/022250 2024-04-03 2025-03-31 Compositions and methods to detect infectious organisms Pending WO2025212475A2 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202463573691P 2024-04-03 2024-04-03
US63/573,691 2024-04-03

Publications (2)

Publication Number Publication Date
WO2025212475A2 true WO2025212475A2 (en) 2025-10-09
WO2025212475A3 WO2025212475A3 (en) 2025-11-13

Family

ID=95519138

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2025/022250 Pending WO2025212475A2 (en) 2024-04-03 2025-03-31 Compositions and methods to detect infectious organisms

Country Status (2)

Country Link
US (1) US20250314664A1 (en)
WO (1) WO2025212475A2 (en)

Citations (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US5143854A (en) 1989-06-07 1992-09-01 Affymax Technologies N.V. Large scale photolithographic solid phase synthesis of polypeptides and receptor binding screening thereof
US5215882A (en) 1989-11-30 1993-06-01 Ortho Diagnostic Systems, Inc. Method of immobilizing nucleic acid on a solid surface for use in nucleic acid hybridization assays
US5707807A (en) 1995-03-28 1998-01-13 Research Development Corporation Of Japan Molecular indexing for expressed gene analysis
US5807522A (en) 1994-06-17 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods for fabricating microarrays of biological samples
US5837832A (en) 1993-06-25 1998-11-17 Affymetrix, Inc. Arrays of nucleic acid probes on biological chips
US5958342A (en) 1996-05-17 1999-09-28 Incyte Pharmaceuticals, Inc. Jet droplet device
US5994076A (en) 1997-05-21 1999-11-30 Clontech Laboratories, Inc. Methods of assaying differential expression
US6004755A (en) 1998-04-07 1999-12-21 Incyte Pharmaceuticals, Inc. Quantitative microarray hybridizaton assays
US6040138A (en) 1995-09-15 2000-03-21 Affymetrix, Inc. Expression monitoring by hybridization to high density oligonucleotide arrays
US6048695A (en) 1998-05-04 2000-04-11 Baylor College Of Medicine Chemically modified nucleic acids and methods for coupling nucleic acids to solid support
US6060240A (en) 1996-12-13 2000-05-09 Arcaris, Inc. Methods for measuring relative amounts of nucleic acids in a complex mixture and retrieval of specific sequences therefrom
US6087112A (en) 1998-12-30 2000-07-11 Oligos Etc. Inc. Arrays with modified oligonucleotide and polynucleotide compositions
US6090556A (en) 1997-04-07 2000-07-18 Japan Science & Technology Corporation Method for quantitatively determining the expression of a gene
US6685885B2 (en) 2001-06-22 2004-02-03 Purdue Research Foundation Bio-optical compact dist system
US20040166593A1 (en) 2001-06-22 2004-08-26 Nolte David D. Adaptive interferometric multi-analyte high-speed biosensor
US20070023643A1 (en) 2005-02-01 2007-02-01 Nolte David D Differentially encoded biological analyzer planar array apparatus and methods
US20070212257A1 (en) 2006-02-16 2007-09-13 Purdue Research Foundation In-line quadrature and anti-reflection enhanced phase quadrature interferometric detection
US20070259366A1 (en) 2006-05-03 2007-11-08 Greg Lawrence Direct printing of patterned hydrophobic wells
US7405831B2 (en) 2005-02-01 2008-07-29 Purdue Research Foundation Laser scanning interferometric surface metrology
CA2681722A1 (en) 2007-03-26 2008-10-02 Purdue Research Foundation Method and apparatus for conjugate quadrature interferometric detection of an immunoassay
US20090002716A1 (en) 2005-02-01 2009-01-01 David Nolte Laser scanning interferometric surface metrology
US7552282B1 (en) 2004-08-04 2009-06-23 Emc Corporation Method, computer readable medium, and data storage system for selective data replication of cached data
US7659968B2 (en) 2007-01-19 2010-02-09 Purdue Research Foundation System with extended range of molecular sensing through integrated multi-modal data acquisition
US7910356B2 (en) 2005-02-01 2011-03-22 Purdue Research Foundation Multiplexed biological analyzer planar array apparatus and methods
US10100092B2 (en) 2011-11-03 2018-10-16 Vca, Inc. Compositions and methods to detect various infectious organisms

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE69841899D1 (en) * 1997-09-19 2010-10-28 Ohio State Res Found PROTEINS OF THE OUTER MEMBRANE OF EHRLICHIA CHAFFEENSIS
US9442112B2 (en) * 2014-04-04 2016-09-13 Abaxis, Inc. Compositions and methods for identifying Ehrlichia species

Patent Citations (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US5143854A (en) 1989-06-07 1992-09-01 Affymax Technologies N.V. Large scale photolithographic solid phase synthesis of polypeptides and receptor binding screening thereof
US5215882A (en) 1989-11-30 1993-06-01 Ortho Diagnostic Systems, Inc. Method of immobilizing nucleic acid on a solid surface for use in nucleic acid hybridization assays
US5837832A (en) 1993-06-25 1998-11-17 Affymetrix, Inc. Arrays of nucleic acid probes on biological chips
US5807522A (en) 1994-06-17 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods for fabricating microarrays of biological samples
US5707807A (en) 1995-03-28 1998-01-13 Research Development Corporation Of Japan Molecular indexing for expressed gene analysis
US6040138A (en) 1995-09-15 2000-03-21 Affymetrix, Inc. Expression monitoring by hybridization to high density oligonucleotide arrays
US5958342A (en) 1996-05-17 1999-09-28 Incyte Pharmaceuticals, Inc. Jet droplet device
US6060240A (en) 1996-12-13 2000-05-09 Arcaris, Inc. Methods for measuring relative amounts of nucleic acids in a complex mixture and retrieval of specific sequences therefrom
US6090556A (en) 1997-04-07 2000-07-18 Japan Science & Technology Corporation Method for quantitatively determining the expression of a gene
US5994076A (en) 1997-05-21 1999-11-30 Clontech Laboratories, Inc. Methods of assaying differential expression
US6004755A (en) 1998-04-07 1999-12-21 Incyte Pharmaceuticals, Inc. Quantitative microarray hybridizaton assays
US6048695A (en) 1998-05-04 2000-04-11 Baylor College Of Medicine Chemically modified nucleic acids and methods for coupling nucleic acids to solid support
US6087112A (en) 1998-12-30 2000-07-11 Oligos Etc. Inc. Arrays with modified oligonucleotide and polynucleotide compositions
US20060256676A1 (en) 2001-06-22 2006-11-16 Nolte David D Method for inteferometric detection of presence or absence of a target analyte of a biological sample on a planar array
US20080175755A1 (en) 2001-06-22 2008-07-24 Nolte David D Apparatus for interferometric detection of presence or absence of a target analyte of a biological sample on a planar array
US6685885B2 (en) 2001-06-22 2004-02-03 Purdue Research Foundation Bio-optical compact dist system
US20040166593A1 (en) 2001-06-22 2004-08-26 Nolte David D. Adaptive interferometric multi-analyte high-speed biosensor
US7552282B1 (en) 2004-08-04 2009-06-23 Emc Corporation Method, computer readable medium, and data storage system for selective data replication of cached data
US7663092B2 (en) 2005-02-01 2010-02-16 Purdue Research Foundation Method and apparatus for phase contrast quadrature interferometric detection of an immunoassay
US7405831B2 (en) 2005-02-01 2008-07-29 Purdue Research Foundation Laser scanning interferometric surface metrology
US20090002716A1 (en) 2005-02-01 2009-01-01 David Nolte Laser scanning interferometric surface metrology
US20090263913A1 (en) 2005-02-01 2009-10-22 Nolte David D Differentially encoded biological analyzer planar array apparatus and methods
US20070023643A1 (en) 2005-02-01 2007-02-01 Nolte David D Differentially encoded biological analyzer planar array apparatus and methods
US7910356B2 (en) 2005-02-01 2011-03-22 Purdue Research Foundation Multiplexed biological analyzer planar array apparatus and methods
US20070212257A1 (en) 2006-02-16 2007-09-13 Purdue Research Foundation In-line quadrature and anti-reflection enhanced phase quadrature interferometric detection
US20070259366A1 (en) 2006-05-03 2007-11-08 Greg Lawrence Direct printing of patterned hydrophobic wells
US7659968B2 (en) 2007-01-19 2010-02-09 Purdue Research Foundation System with extended range of molecular sensing through integrated multi-modal data acquisition
US20100145627A1 (en) 2007-01-19 2010-06-10 Xuefeng Wang System with extended range of molecular sensing through integrated multi-modal data acquisition
CA2681722A1 (en) 2007-03-26 2008-10-02 Purdue Research Foundation Method and apparatus for conjugate quadrature interferometric detection of an immunoassay
US7787126B2 (en) 2007-03-26 2010-08-31 Purdue Research Foundation Method and apparatus for conjugate quadrature interferometric detection of an immunoassay
US10100092B2 (en) 2011-11-03 2018-10-16 Vca, Inc. Compositions and methods to detect various infectious organisms

Non-Patent Citations (11)

* Cited by examiner, † Cited by third party
Title
EISEN, M.: "SCANALYZE User Manual", 1999, STANFORD UNIV.
ENDO ET AL., BIOTECHNOL. ADV., vol. 21, 2003, pages 695 - 713
EVAN ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 3610 - 3616
FIELD, MOL. CELL. BIOL., vol. 8, 1988, pages 2159 - 2165
KOZAK, J. BIOL. CHEM., vol. 266, 1991, pages 19867 - 19870
KYTEDOOLITTLE, J. MOL. BIOL., vol. 157, 1982, pages 105 - 132
MOROFF ET AL., VET J., 2014
PABORSKY ET AL., PROTEIN ENGINEERING, vol. 3, 1990, pages 547 - 553
SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS
SITARAMAN ET AL., METHODS MOL. BIOL., vol. 498, 2009, pages 229 - 44
SPIRIN, TRENDS BIOTECHNOL., vol. 22, 2004, pages 538 - 45

Also Published As

Publication number Publication date
WO2025212475A3 (en) 2025-11-13
US20250314664A1 (en) 2025-10-09

Similar Documents

Publication Publication Date Title
JP5946218B2 (en) Assay for JC virus antibody
JP6383422B2 (en) Improved diagnostic test for CSFV antibodies
JP5874122B2 (en) Detection method for Vibrio parahaemolyticus
JPWO2007043582A1 (en) Measuring method for measuring SARS virus nucleocapsid protein, measuring reagent kit, test device, monoclonal antibody against SARS virus nucleocapsid protein, and hybridoma producing said monoclonal antibody
US20230375548A1 (en) Indirect enzyme-linked immunosorbent assay detection kit based on p30 protein and p22 protein of african swine fever virus
JP2009185037A (en) Composition and method for detecting ehrlichiacanis and ehrlichiachaffeensis antibody
Van den Doel et al. A novel antigen capture ELISA for the specific detection of IgG antibodies to elephant endotheliotropic herpes virus
Pal et al. Evaluation of recombinant proteins of Burkholderia mallei for serodiagnosis of glanders
AU2017341952A1 (en) Rep protein as protein antigen for use in diagnostic assays
US10100092B2 (en) Compositions and methods to detect various infectious organisms
CN114152748A (en) Double-antibody sandwich ELISA diagnostic kit for detecting African swine fever virus and method thereof
Bayat et al. Development of IgY‐Based Sandwich ELISA as a Robust Tool for Rapid Detection and Discrimination of Toxigenic Vibrio cholerae
US20230168247A1 (en) Specificity enhancing reagents for covid-19 antibody testing
US20250314664A1 (en) Compositions and methods to detect infectious organisms
Konieczna et al. Detection of antibodies against synthetic peptides mimicking ureases fragments in sera of rheumatoid arthritis patients
CN103197078A (en) Application of salmonella pullorum secreted protein SpiC
CN118308307A (en) Hybridoma cell strain, antibody and kit for generating cholera toxin A subunit monoclonal antibody and application of hybridoma cell strain
CN118852371B (en) Clostridium perfringens epsilon antibody detection test paper strip, kit and application thereof
JP7595938B2 (en) Method for detecting Salmonella infection using SsaK protein
Buhling et al. Simultaneous detection and differentiation of anti-Helicobacter pylori antibodies by flow microparticle immunofluorescence assay
US12631635B2 (en) Species-specific antigen sequences for tick-borne relapsing fever (TBRF) and methods of use
JP7550454B2 (en) Method for detecting Salmonella infection using BamA protein
CN121270716A (en) Recombinant antigen, reagent containing same and application thereof
US20220229055A1 (en) Species-specific antigen sequences for tick-borne relapsing fever (tbrf) and methods of use
WO2026024794A1 (en) Diagnostic test for brucellosis

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 25721363

Country of ref document: EP

Kind code of ref document: A2