WO2025052001A1 - Methods and compositions for improving immune response - Google Patents

Methods and compositions for improving immune response Download PDF

Info

Publication number
WO2025052001A1
WO2025052001A1 PCT/EP2024/075141 EP2024075141W WO2025052001A1 WO 2025052001 A1 WO2025052001 A1 WO 2025052001A1 EP 2024075141 W EP2024075141 W EP 2024075141W WO 2025052001 A1 WO2025052001 A1 WO 2025052001A1
Authority
WO
WIPO (PCT)
Prior art keywords
antigen
cells
cell
tumor
immune response
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
PCT/EP2024/075141
Other languages
French (fr)
Inventor
Michael SAITAKIS
Sebastian Amigorena
Guadalupe SUAREZ
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Centre National de la Recherche Scientifique CNRS
Institut National de la Sante et de la Recherche Medicale INSERM
Institut Curie
Mnemo Therapeutics SAS
Original Assignee
Centre National de la Recherche Scientifique CNRS
Institut National de la Sante et de la Recherche Medicale INSERM
Institut Curie
Mnemo Therapeutics SAS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from EP23306492.2A external-priority patent/EP4520334A1/en
Application filed by Centre National de la Recherche Scientifique CNRS, Institut National de la Sante et de la Recherche Medicale INSERM, Institut Curie, Mnemo Therapeutics SAS filed Critical Centre National de la Recherche Scientifique CNRS
Publication of WO2025052001A1 publication Critical patent/WO2025052001A1/en
Anticipated expiration legal-status Critical
Pending legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/54Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one sulfur as the ring hetero atoms, e.g. sulthiame
    • A61K31/542Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one sulfur as the ring hetero atoms, e.g. sulthiame ortho- or peri-condensed with heterocyclic ring systems
    • A61K31/545Compounds containing 5-thia-1-azabicyclo [4.2.0] octane ring systems, i.e. compounds containing a ring system of the formula:, e.g. cephalosporins, cefaclor, or cephalexine
    • A61K31/546Compounds containing 5-thia-1-azabicyclo [4.2.0] octane ring systems, i.e. compounds containing a ring system of the formula:, e.g. cephalosporins, cefaclor, or cephalexine containing further heterocyclic rings, e.g. cephalothin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46Hydrolases (3)
    • A61K38/465Hydrolases (3) acting on ester bonds (3.1), e.g. lipases, ribonucleases
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/46Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1137Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/55Lung
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y201/00Transferases transferring one-carbon groups (2.1)
    • C12Y201/01Methyltransferases (2.1.1)
    • C12Y201/01043Histone-lysine N-methyltransferase (2.1.1.43)

Definitions

  • the present invention relates to the use of KMT (lysine methyl transferase) inhibitors and in particular of HKMT (histone lysine methyl transferase) inhibitors, notably to the use of Suv39h1 inhibitors to increase immune response, and in particular immune cell mediated response, notably elicited by a vaccine or an immunogenic composition.
  • KMT lysine methyl transferase
  • HKMT histone lysine methyl transferase
  • tumor antigens are endogenous with low immunogenicity such that tumor antigens are often difficult to elicit an effective immune response.
  • the present application therefore fulfills an important need that may expand the use of broader types of cancer antigen in cancer vaccination platforms.
  • Infections also represent another major clinical burden and are often characterized by resistances of the infectious pathogens to available antibiotic or antiviral therapeutics.
  • In (chronic) infections T cells are exposed to persistent antigen and/or inflammatory signals. Vaccination therefore remains a major strategy to prevent developments of infectious diseases.
  • Suv39h1 has a broader scope effect on T cells and notably, that Suv39h1 inhibition increases the antigen sensitivity and reactivity of naive T cells, which thus demonstrate increased activation at both low antigen affinity and low antigen density upon Suv39h1 inhibition.
  • the inventors also provide further results showing that Suv39h1 primarily contributes to heterochromatin formation at stem/memory loci in differentiating naive T cells, as compared to lineage-committed central memory T cells.
  • FIG. 1 Naive OTI cells (Naive (CD44-) CD8+ T cells) from Suv39h1-KO mice or WT littermates were incubated for the indicated timepoints with antigen presenting cells loaded with the indicated peptides or with anti-CD3 anti-CD28 beads at the indicated bead:cell ratios.
  • A Scheme of the experiment.
  • B Representative dot plots of the expression of CD69 and CD44 in OTI cells incubated with antigen presenting cells loaded with the T4 peptide (10-7 M) during the indicated time points.
  • C Median Fluorescence Intensity (MFI) of CD44 as a percentage of maximum value in OTI cells incubated for 48h at the indicated bead:cell ratios.
  • MFI of CD44 (% of the maximum value) in OTI cells incubated for 48h with the indicated peptides and concentrations. * p ⁇ 0.05, **p ⁇ 0.01 , ***p ⁇ 0.001 , ****p ⁇ 0.0001 by two-way ANOVA followed by Sidak’s multiple comparison test.
  • FIG. 1 Effect of SUV39H1 inactivation in human naive T cells.
  • A Sorting strategy for naive (N, CD45RA+CCR7+CD27+), Central Memory (CM, CD45RA- CCR7+CD27+), and Effector Memory (EM, CD45RA-CCR7-) cells from PBMC-purified total CD3+ T cells.
  • B MFI of H3K9me3 levels measured by flow cytometry and relativized to the equivalent Mock after Crispr inactivation of SUV39H1. Experiment was performed in two independent donors.
  • C-E Phenotype of mock and SUV39H1- deficient cells derived from different subsets analyzed by flow cytometry. Experiment was performed in two independent donors (shown as circle and square).
  • C Percentage of CD45RO+CD27+ cells after SUV39H1 inactivation.
  • D Representative dot-plot of CD62L expression (left) and percentage of CD62L+ cells (right) in mock and SUV39H1 -deficient naive-, CM-, or total CD3- derived cells after week-long stimulation.
  • E Percentage of TIM-3+PD-1 + cells in mock and SUV39H1 -deficient naive-, CM-, or total CD3-derived cells after week-long stimulation.
  • FIG. 1 Analysis of the proportions and numbers of central memory (CM, CD62L+CD44+), effector memory (EM, CD62L-CD44+), and tissue resident memory (TRM, CD44+CD69+Ly6c- and CD44+CD69+CD103-) cells at steady state in mice deficient for Suv39h1.
  • a and B Representative dot plots (A) and quantification (B) of CD44 and CD62L expression in CD8+ T cells from the indicated organs of Suv39h1 KO and WT littermates at steady state, i LN : inguinal Lymph Node.
  • C-F Representative dot plots (A) and quantification (B) of CD44 and CD62L expression in CD8+ T cells from the indicated organs of Suv39h1 KO and WT littermates at steady state, i LN : inguinal Lymph Node.
  • FIG. 4 Naive OTI CD8+ T cells from Suv39h1-KO or WT littermate mice were adoptively transferred into B6 mice and 1 day later mice were infected with the flu strain X31 expressing OVA (X31-OVA).
  • B and C. Representative dot plots (B) and quantification (C) of the ratio of OTI cells in the indicated organs 9 days post X31-OVA infection (Acute phase of the infection).
  • D-F Representative dot plot of CD69 and CD103 expression (D) and cell numbers of CD69+CD103- and CD69+CD103+ cells (E) in WT littermate (D) or Suv39h1-KO cells (E) 28 days post infection in OTI cells in lungs (Memory phase).
  • FIG. 5 SUV39H1 -deficiency leads to the accumulation of CD8 + tissue resident memory T cells (T RM ) at steady state
  • FIG. 8 T RM precursors differentiation is increased in the absence of SUV39H1
  • A Scheme of the experiment.
  • B Quantification of the expression of CD69 and CD103 in SUV39H1 -deficient and WT OTI cells 30 days post X31-OVA infection in lungs (Memory).
  • C Quantification of the percentage of CD49d + Ly6c _ cells among SUV39H1 -deficient and WT OTI cells in the indicated organs and the percentage of CD69 + KLRGT or CD49a + CX3CRT cells among CD49d + Ly6c _ iv- CD44 + OTI cells in lungs 9 days post X31-OVA infection (Acute).
  • D Scheme of the experiment.
  • E Scheme of the experiment.
  • FIG. 9 SUV39H1 controls the formation of functional T RM CD8 + T cells able to delay lung tumor metastases
  • A Scheme of the experiment.
  • B iv staining (top) and CD49d and Ly6c expression in SUV39H1 KO and WT iv- OTI cells (bottom) in the lungs of mice at 33 days post transfer.
  • D Median tumor growth curves of SUV39H1 KO and WT OTI recipient mice in G. Each dot represents a mouse. * p ⁇ 0.05; ns: not significant by unpaired t test (B) and mixed-effects model (D).
  • the term “about” or “around” can mean within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, up to 10%, up to 5%, or up to 1 % of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, within 5-fold, or within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated the term “about” meaning within an acceptable error range for the particular value should be assumed.
  • Immune response An immune response may typically be a specific reaction of the adaptive immune system to a particular antigen (so called specific or adaptive immune response) or an unspecific reaction of the innate immune system (so called unspecific or innate immune response), or a combination thereof.
  • the immune system may protect organisms from infection. If a pathogen succeeds in passing a physical barrier of an organism and enters this organism, the innate immune system provides an immediate, but non-specific response. If pathogens evade this innate response, vertebrates possess a second layer of protection, the adaptive immune system.
  • the immune system adapts its response during an infection to improve its recognition of the pathogen. This improved response is then retained after the pathogen has been eliminated, in the form of an immunological memory, and allows the adaptive immune system to mount faster and stronger attacks each time this pathogen is encountered.
  • the immune system comprises the innate and the adaptive immune system. Each of these two parts typically contains so called humoral and cellular components.
  • the adaptive immune response is typically understood to be an antigen-specific response of the immune system. Antigen specificity allows for the generation of responses that are tailored, for example, to specific pathogens or pathogen-infected cells. The ability to mount these tailored responses is usually maintained in the body by “memory cells”. Should a pathogen infect the body more than once, these specific memory cells are used to quickly eliminate it.
  • the first step of an adaptive immune response is the activation of naive antigen-specific T cells or different immune cells able to induce an antigen-specific immune response by antigen-presenting cells. This occurs in the lymphoid tissues and organs through which naive T cells are constantly passing.
  • dendritic cells The three cell types that may serve as antigen-presenting cells are dendritic cells, macrophages, and B cells. Each of these cells has a distinct function in eliciting immune responses.
  • Dendritic cells may take up antigens by phagocytosis and macropinocytosis and may become stimulated by contact with e.g. a foreign antigen to migrate to the local lymphoid tissue, where they differentiate into mature dendritic cells.
  • Macrophages ingest particulate antigens such as bacteria and are induced by infectious agents or other appropriate stimuli to express MHC molecules.
  • the unique ability of B cells to bind and internalize soluble protein antigens via their receptors may also be important to induce T cells.
  • MHC-molecules are, typically, responsible for presentation of an antigen to T-cells. Therein, presenting the antigen on MHC molecules leads to activation of T cells, which induces their proliferation and differentiation into armed effector T cells.
  • effector T cells The most important function of effector T cells is the killing of infected cells by CD8+ cytotoxic T cells and the activation of macrophages by Th1 cells, which together make up cell-mediated immunity, and the activation of B cells by both Th2 and Th1 cells to produce different classes of antibody, thus driving the humoral immune response.
  • T cells recognize an antigen by their T cell receptors which do not recognize and bind the antigen directly, but instead recognize short peptide fragments e.g. of pathogen-derived protein antigens, e.g. so-called epitopes, which are bound to MHC molecules on the surfaces of other cells.
  • CMI Cellular immunity/cell-mediated immune response
  • NK natural killer cells
  • cytokines in response to an antigen.
  • cellular immunity is not based on antibodies, but on the activation of cells of the immune system.
  • a cellular immune response may be characterized e.g. by activating antigen-specific cytotoxic T-lymphocytes that are able to induce apoptosis in cells, e.g. specific immune cells like dendritic cells or other cells, displaying epitopes of foreign antigens on their surface.
  • Such cells may be virus-infected or infected with intracellular bacteria, or cancer cells displaying tumor antigens. Further characteristics may be activation of macrophages and natural killer cells, enabling them to destroy pathogens and stimulation of cells to secrete a variety of cytokines that influence the function of other cells involved in adaptive immune responses and innate immune responses.
  • an “immunogenic” peptide or an “immunogenic” epitope or “peptide epitope” is a peptide that comprises an allele-specific motif such that the peptide will bind an HLA molecule and induce a cell-mediated or humoral response, for example, cytotoxic T lymphocyte (CTL ( e.g ., CD8+ )), helper T lymphocyte (Th (e.g, CD4+ )) and/or B lymphocyte response.
  • CTL cytotoxic T lymphocyte
  • Th helper T lymphocyte
  • B lymphocyte response e.g., B lymphocyte response.
  • immunogenic peptides described herein are capable of binding to an appropriate HLA molecule and thereafter inducing a CTL (cytotoxic) response, or a HTL (and humoral) response, to the peptide.
  • MHC Major Histocompatibility Complex
  • HLA human leukocyte antigen
  • Proteins or molecules of the major histocompatibility complex are to be understood as meaning proteins capable of binding peptides resulting from the proteolytic cleavage of protein antigens and representing potential lymphocyte epitopes, ( e.g ., T cell epitope and B cell epitope) transporting them to the cell surface and presenting them there to specific cells, in particular cytotoxic T-lymphocytes, T-helper cells, or B cells.
  • the major histocompatibility complex in the genome comprises the genetic region whose gene products expressed on the cell surface are important for binding and presenting endogenous and/or foreign antigens and thus for regulating immunological processes.
  • the major histocompatibility complex is classified into two gene groups coding for different proteins, namely molecules of MHC class I and molecules of MHC class IL The cellular biology and the expression patterns of the two MHC classes are adapted to these different roles.
  • HLA Human Leukocyte Antigen
  • MHC Major Histocompatibility Complex
  • an immunogen may be typically understood to be a compound or antigen that is able to stimulate an immune response.
  • an immunogen is a peptide, polypeptide, or protein.
  • an immunogen in the sense of the present invention is the product of translation of a provided nucleic acid molecule, preferably an artificial nucleic acid molecule as defined herein.
  • an immunogen elicits at least an adaptive immune response.
  • an immunostimulatory composition may be typically understood to be a composition containing at least one component which is able to induce an immune response or from which a component, which is able to induce an immune response, is derivable.
  • Such immune response may be preferably an innate immune response or a combination of an adaptive and an innate immune response.
  • an immunostimulatory composition in the context of the invention contains at least a peptide or a nucleic acid molecule encoding thereof, notably at least one artificial nucleic acid molecule, more preferably an RNA, for example an mRNA molecule.
  • the immunostimulatory component, such as the mRNA may be complexed with a suitable carrier.
  • the immunostimulatory composition may comprise an mRNA/carrier- complex.
  • the immunostimulatory composition may comprise an adjuvant and/or a suitable vehicle for the immunostimulatory component, such as the mRNA.
  • Polypeptide “peptide” and their grammatical equivalents as used herein refer to a polymer of amino acid residues linked by peptide bonds.
  • a “mature protein” is a protein which is full-length and which, optionally, includes glycosylation or other modifications typical for the protein in a given cellular environment.
  • Polypeptides and proteins disclosed herein can comprise synthetic amino acids in place of one or more naturally-occurring amino acids. Peptides typically contains less than 50 monomer units. Nevertheless, the term peptide is not a disclaimer for molecules having more than 50 monomer units. Long peptides are also called polypeptides, typically having between 50 and 600 monomeric units.
  • a peptide or polypeptide as used herein can comprise at least one flanking sequence.
  • flanking sequence refers to a fragment or region of the neoantigen peptide that is not a part of the neoepitope.
  • residue refers to an amino acid residue or amino acid mimetic residue incorporated into a peptide or protein by an amide bond or amide bond mimetic, or nucleic acid (DNA or RNA) that encodes the amino acid or amino acid mimetic.
  • a “protein” typically comprises one or more peptides or polypeptides.
  • a protein is typically folded into 3-dimensional form, which may be required for the protein to exert its biological function.
  • Nucleic acid molecule is a molecule comprising, preferably consisting of nucleic acid components.
  • the term nucleic acid molecule preferably refers to DNA or RNA molecules. It is preferably used synonymous with the term “polynucleotide”.
  • a nucleic acid molecule is a polymer comprising or consisting of nucleotide monomers, which are covalently linked to each other by phosphodiester-bonds of a sugar/phosphate-backbone.
  • the term “nucleic acid molecule” also encompasses modified nucleic acid molecules, such as base-modified, sugar-modified or backbone-modified etc. DNA or RNA molecules.
  • a nucleic acid such as RNA encoding a peptide or polypeptide is taken up by or introduced, i.e. transfected or transduced, into a cell which cell may be present in vitro or in a subject, resulting in expression of said peptide or polypeptide.
  • the cell may, e.g., express the encoded peptide or polypeptide intracellularly (e.g. in the cytoplasm and/or in the nucleus), may secrete the encoded peptide or polypeptide, and/or may express it on the surface.
  • endogenous refers to any material from or produced inside an organism, cell, tissue or system.
  • exogenous refers to any material introduced from or produced outside an organism, cell, tissue or system.
  • Heterologous sequences two sequences are typically understood to be “heterologous” if they are not derivable from the same gene; i.e., although heterologous sequences may be derivable from the same organism, they naturally (in nature) do not occur in the same nucleic acid molecule, such as in the same mRNA. Heterologous sequences can be exogenous.
  • An artificial nucleic acid molecule may typically be understood to be a nucleic acid molecule, e.g. a DNA or an RNA, that does not occur naturally.
  • an artificial nucleic acid molecule may be understood as a non-natural nucleic acid molecule.
  • Such nucleic acid molecule may be non-natural due to its individual sequence (which does not occur naturally) and/or due to other modifications, e.g. structural modifications of nucleotides, which do not occur naturally.
  • An artificial nucleic acid molecule may be a DNA molecule, an RNA molecule or a hybrid-molecule comprising DNA and RNA portions.
  • artificial nucleic acid molecules may be designed and/or generated by genetic engineering methods to correspond to a desired artificial sequence of nucleotides (heterologous sequence).
  • an artificial sequence is usually a sequence that may not occur naturally, i.e. it differs from the wild type sequence by at least one nucleotide.
  • wild type may be understood as a sequence occurring in nature.
  • artificial nucleic acid molecule is not restricted to mean “one single molecule” but is, typically, understood to comprise an ensemble of identical molecules. Accordingly, it may relate to a plurality of identical molecules contained in an aliquot.
  • Open reading frame in the context of the invention may typically be a sequence of several nucleotide triplets, which may be translated into a peptide or protein.
  • An open reading frame preferably contains a start codon, i.e. a combination of three subsequent nucleotides coding usually for the amino acid methionine (ATG), at its 5'-end and a subsequent region, which usually exhibits a length which is a multiple of 3 nucleotides.
  • An ORF is preferably terminated by a stopcodon (e.g., TAA, TAG, TGA). Typically, this is the only stop-codon of the open reading frame.
  • an open reading frame in the context of the present invention is preferably a nucleotide sequence, consisting of a number of nucleotides that may be divided by three, which starts with a start codon (e.g. ATG) and which preferably terminates with a stop codon (e.g., TAA, TGA, or TAG).
  • the open reading frame may be isolated or it may be incorporated in a longer nucleic acid sequence, for example in a vector or an mRNA.
  • An open reading frame may also be termed “(protein) coding sequence” or, preferably, “coding sequence”.
  • RNA is the usual abbreviation for ribonucleic-acid. It is a nucleic acid molecule, i.e. a polymer consisting of nucleotides. These nucleotides are usually adenosine-monophosphate, uridine-monophosphate, guanosine-monophosphate and cytidine-monophosphate monomers which are connected to each other along a so- called backbone.
  • the backbone is formed by phosphodiester bonds between the sugar, i.e. ribose, of a first and a phosphate moiety of a second, adjacent monomer. The specific succession of the monomers is called the RNA-sequence.
  • RNA may be obtainable by transcription of a DNA-sequence, e.g., inside a cell.
  • transcription is typically performed inside the nucleus or the mitochondria.
  • transcription of DNA usually results in the so-called premature RNA which has to be processed into so-called messenger-RNA, usually abbreviated as mRNA.
  • Processing of the premature RNA e.g. in eukaryotic organisms, comprises a variety of different posttranscriptional-modifications such as splicing, 5'-capping, polyadenylation, export from the nucleus or the mitochondria and the like. The sum of these processes is also called maturation of RNA.
  • the mature messenger RNA usually provides the nucleotide sequence that may be translated into an amino-acid sequence of a particular peptide or protein.
  • a mature mRNA comprises a 5'-cap, a 5 -UTR, an open reading frame, a 3 -UTR and a poly(A) sequence.
  • messenger RNA several noncoding types of RNA exist which may be involved in regulation of transcription and/or translation.
  • an expression cassette is used in the context of the present invention to refer to a nucleic acid molecule which comprises at least one nucleic acid sequence that is to be expressed, e.g. a nucleic acid encoding an antigen or a part thereof, operably linked to transcription and translation control sequences.
  • an expression cassette includes cis-regulating elements for efficient expression of a given gene, such as promoter, initiation-site and/or polyadenylation-site.
  • an expression cassette contains all the additional elements required for the expression of the nucleic acid in the cell of a patient.
  • a typical expression cassette thus contains a promoter operatively linked to the nucleic acid sequence to be expressed and signals required for efficient polyadenylation of the transcript, ribosome binding sites, and translation termination. Additional elements of the cassette may include, for example enhancers.
  • An expression cassette preferably also contains a transcription termination region downstream of the structural gene to provide for efficient termination. The termination region may be obtained from the same gene as the promoter sequence or may be obtained from a different gene.
  • operably linked refers to an arrangement of elements, wherein the components so described are configured so as to perform their usual function.
  • a nucleic acid is "operably linked” when it is placed into a functional relationship with another nucleic acid sequence.
  • a promoter is operably linked to one or more transgenes, if it affects the transcription of the one or more transgenes.
  • control elements operably linked to a coding sequence are capable of effecting the expression of the coding sequence. The control elements need not be contiguous with the coding sequence, so long as they function to direct the expression thereof. Thus, for example, intervening untranslated yet transcribed sequences can be present between a promoter sequence and the coding sequence and the promoter sequence can still be considered “operably linked" to the coding sequence.
  • expression vector refers to a polynucleotide or a mixture of a polynucleotide and proteins capable of being introduced or of introducing the collection of nucleic acids of the present invention or one nucleic acid that is part of the collection of nucleic acids of the invention into a cell, preferably a mammalian cell.
  • vectors include but are not limited to plasmids, cosmids, phages, viruses or artificial chromosomes.
  • a vector is used to transport the promoter and the collection of the nucleic acids or one nucleic acid that is part of the collection of nucleic acids of the invention into a suitable host cell.
  • Expression vectors may contain "replicon" polynucleotide sequences that facilitate the autonomous replication of the expression vector in a host cell. Once in the host cell, the expression vector may replicate independently of or coincidental with the host chromosomal DNA, and several copies of the vector and its inserted DNA can be generated. In case that replication incompetent expression vectors are used - which is often the case for safety reasons - the vector may not replicate but merely direct expression of the nucleic acid. Depending on the type of expression vector the expression vector may be lost from the cell, i.e only transiently expresses the CVP encoded by the nucleic acid or may be stable in the cell. Expression vectors typically contain expression cassettes, i.e. the necessary elements that permit transcription of the nucleic acid into an mRNA molecule.
  • a “fragment of a sequence” is typically a shorter portion of a full-length sequence of e.g. a nucleic acid molecule or an amino acid sequence. Accordingly, a fragment, typically, consists of a sequence that is identical to the corresponding stretch within the full-length sequence.
  • a preferred fragment of a sequence in the context of the present invention consists of a continuous stretch of entities, such as nucleotides or amino acids corresponding to a continuous stretch of entities in the molecule the fragment is derived from, which represents at least 20%, preferably at least 30%, more preferably at least 40%, more preferably at least 50%, even more preferably at least 60%, even more preferably at least 70%, and most preferably at least 80% of the total (i.e. full- length) molecule from which the fragment is derived.
  • Sequence identity Two or more sequences are identical if they exhibit the same length and order of nucleotides or amino acids.
  • the percentage of identity typically describes the extent to which two sequences are identical, i.e. it typically describes the percentage of nucleotides that correspond in their sequence position with identical nucleotides of a reference-sequence.
  • the sequences to be compared are considered to exhibit the same length, i.e. the length of the longest sequence of the sequences to be compared. This means that a first sequence consisting of 8 nucleotides is 80% identical to a second sequence consisting of 10 nucleotides comprising the first sequence.
  • identity of sequences preferably relates to the percentage of nucleotides of a sequence which have the same position in two or more sequences having the same length. Gaps are usually regarded as non-identical positions, irrespective of their actual position in an alignment.
  • Neoantigen means a class of tumor antigens that arises from a tumorspecific mutation(s) which alters the amino acid sequence of genome encoded proteins. Neoantigens encompass, but are not limited to, tumor antigens which arise from, for example, substitution in the protein sequence, frame shift mutation, fusion polypeptide, in-frame deletion, insertion, expression of endogenous retroviral polypeptides, and tumor-specific overexpression of polypeptides.
  • the terms “(neo)antigen peptide” and “(neo)antigenic peptide”, or mutant peptides can be used interchangeably with “peptide” in the present specification.
  • polypeptides or peptides can be a variety of lengths, either in their neutral (uncharged) forms or in forms which are salts, and either free of modifications such as glycosylation, side chain oxidation, or phosphorylation or containing these modifications, subject to the condition that the modification does not destroy the biological activity of the polypeptides as herein described.
  • cancers include, without limitation, leukemia (e.g., acute leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, acute myeloblastic leukemia, acute promyelocytic leukemia, acute myelomonocytic leukemia, acute monocytic leukemia, acute erythroleukemia, chronic leukemia, chronic myelocytic leukemia, chronic lymphocytic leukemia), polycythemia vera, lymphoma (e.g., Hodgkin's disease, non-Hodgkin's disease), Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors such as sarcomas and carcinomas (e.g., fibro
  • neoplasia vaccine or “tumor vaccine”, or “cancer vaccine” is typically meant to refer to a pooled sample of neoplasia/tumor antigens, for example at least two, at least three, at least four, at least five, or more antigenic peptides.
  • a “vaccine” is to be understood as meaning a composition for generating immunity for the prophylaxis and/or treatment of diseases (e.g., neoplasia/tumor or infectious disease). Accordingly, vaccines are medicaments which comprise antigens and are intended to be used in humans or animals for generating specific defense and protective substance by vaccination.
  • a “vaccine composition” or a “neoplasia vaccine composition” can include a pharmaceutically acceptable excipient, earner or diluent.
  • the term “combination” embraces the administration of an KMT inhibitor, notably a suv39h1 inhibitor and one or additional component that elicits an immune response, typically a vaccine or immunogenic composition (e.g. a pooled sample of neoplasia/tumor specific antigens or infectious disease-associated antigens), as part of a treatment regimen intended to provide a beneficial (additive or synergistic) effect from the co-action of one or more of these therapeutic agents.
  • the combination may also include one or more additional agents, for example, but not limited to, such as a checkpoint inhibitor, immune cell therapy, chemotherapeutic agents, anti-angiogenesis agents and agents that reduce immune-suppression.
  • the beneficial effect of the combination includes, but is not limited to, an improved or enhanced immunogenic response resulting from the combination of therapeutic agents.
  • Administration of these therapeutic agents or components in combination typically is carried out over a defined time period (for example, minutes, hours, days, or weeks depending upon the combination selected).
  • “Combination therapy” is intended to embrace administration of these therapeutic agents or components in a sequential manner, that is, wherein each therapeutic agent is administered at a different time, as well as administration of these therapeutic agents, or at least two of the therapeutic agents, in a substantially simultaneous manner.
  • a combination of the present invention may be formulated as separate pharmaceutical compositions that can be administered at the same or different time.
  • the term “simultaneously” is meant to refer to administration of one or more agents at the same time. Simultaneously includes administration contemporaneously, that is during the same period of time.
  • the one or more agents or components are administered simultaneously in the same hour, or simultaneously in the same day.
  • Sequential or substantially simultaneous administration of each therapeutic agent can be effected by any appropriate route including, but not limited to, oral routes, intravenous routes, subcutaneous routes, intramuscular routes, direct absorption through mucous membrane tissues (e.g., nasal, mouth, vaginal, and rectal), and ocular routes (e.g., intravitreal, intraocular, etc.).
  • the therapeutic agents can be administered by the same route or by different routes. For example, one component of a particular combination may be administered by intravenous injection while the other components ) of the combination may be administered orally.
  • the components may be administered in any appropriate route including, but not limited to, oral routes, intravenous routes, subcutaneous routes, intramuscular routes, direct absorption through mucous membrane tissues (e.g., nasal, mouth, vaginal, and rectal), and ocular routes (e.g., intravitreal, intraocular, etc.).
  • the therapeutic agents can be administered by the same route or by different routes. For example, one component of a particular combination may
  • pharmaceutically acceptable refers to approved or approvable by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals,
  • a “pharmaceutically acceptable excipient, carrier or diluent” refers to an excipient, carrier or diluent that can be administered to a subject, together with an agent, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the agent.
  • Treat,” “treated,” “treating,” “treatment,” and the like are meant to refer to reducing or ameliorating a disorder and/or symptoms associated therewith (e.g., a neoplasia or tumor). “Treating” may refer to administration of the combination therapy to a subject after the onset, or suspected onset, of a cancer. “Treating” includes the concepts of “alleviating”, which refers to lessening the frequency of occurrence or
  • treating a disorder or condition does not require that the disorder, condition, or symptoms associated therewith be completely eliminated.
  • therapeutic effect refers to some extent of relief of one or more of the symptoms of a disorder (e.g., a neoplasia or tumor) or its associated pathology.
  • “Therapeutically effective amount” as used herein refers to an amount of an agent
  • the terms “prevent,” “preventing,” “prevention,” “prophylactic treatment,” and the like refer to reducing the probability of developing a disease or condition in a subject, who does not have, but is at risk of or susceptible to developing a disease or condition.
  • the term “prime/ boost” or “prime/ boost dosing regimen” is meant to refer to the successive administrations of a vaccine or immunogenic or immunological compositions.
  • the priming administration is the administration of a first vaccine or immunogenic or immunological composition type and may comprise one, two or more administrations.
  • the boost administration is the second administration of a vaccine or immunogenic or immunological composition type and may comprise one, two or more administrations, and, for instance, may comprise or consist essentially of annual administrations.
  • administration of the neoplasia vaccine or immunogenic composition is in a prime/ boost dosing regimen.
  • T cell progenitors typically express a set of consensus markers including CD44, CD117, CD135, and/or Sca-1 but see also Petrie HT, Kincade PW. Many roads, one destination for T cell progenitors. The Journal of Experimental Medicine. 2005;202(1 ):11-13.
  • the cells typically are primary cells, such as those isolated directly from a subject and/or isolated from a subject and frozen. With reference to the subject to be treated, the cells of the disclosure may be allogeneic and/or autologous.
  • KMT Histone lysine methyltransferase
  • H3K9me3-mediated heterochromatin formation thus involves HP1 that contains a chromodomain that recognizes and binds to di- and tri-methylated H3K9.
  • the SUV39 PKMTs and their function in heterochromatin formation are evolutionarily conserved and orthologous proteins can be detected in most organisms from fission yeast to humans including plants (see Zeng W, Ball AR Jr, Yokomori K. HP1 : heterochromatin binding proteins working the genome. Epigenetics. 2010;5(4):287-292).
  • H3K9me in mammals is effected by multiple histone methyltransferases, which have distinct targeting specificities and degrees of methylation (e.g., mono-, di- or trimethylation).
  • a common feature HKMTs is the fact that they all interact with both maintenance and de novo DNA methyltrans- ferases or DNMTs.
  • HMTs histone methyltransferases
  • Suv39h1 and Suv39h2 consist of two-conserved domains, one SET- and one chromodomain.
  • the amino acid sequences of Suv39h1 and Suv39h2 are highly conserved, with 56% amino acid identity over the entire protein alignment.
  • the SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain is the catalytic domain of one large group of PKMTs, called SET-domain PKMTs.
  • the structure of the Suv39h2 SET domain shows a high similarity to the known SET domain structures of other H3K9 PKMTs such as Dim-5 or G9a.
  • Chromodomains are methylated lysine binding modules (Taverna, S.D.; Li, H.; Ruthenburg, A.; Allis, C.D.; Patel, D.J. How chromatin-binding modules interpret histone modifications: Lessons from professional pocket pickers. Nat. Struct. Mol. Biol. 2007, 14, 1025-1040 ; Patel, D.J.; Wang, Z. Readout of Epigenetic Modifications. Annu. Rev. Biochem. 2013, 82, 81-118).
  • the Suv39h1 chromodomain was shown to recognize H3K9me2/3 (Wang, T.; Xu, C.; Liu, Y.; Fan, K.; Li, Z.; Sun, X.; Ouyang, H.; Zhang, X.; Zhang, J.; Li, Y.; et al. Crystal Structure of the Human Suv39h1 Chromodomain and Its Recognition of Histone H3K9me2/3. PLoS ONE 2012, 7, e52977).
  • the trimethylases Suv39h1 and 2/KMT1A and -1 B which contribute mainly to the establishment of pericentric heterochromatin (Peters et al., 2003; Rea et al., 2000).
  • Suv39h prefers mono- or dimethylated H3K9 as a primary substrate
  • Suv39h1 has also been found to interact with the de novo DNA methyltransferase DNMT3B.
  • H3K9 HKMTs Another important family of H3K9 HKMTs comprises G9a/ Eu-HMTase2/KMT1 C and GLP/Eu-HMTase1/KMT1 D.
  • G9a catalyzes the initial mono-methylation of H3K9.
  • Human G9A is referenced as Q96KQ7 in UNIPROT and is encoded by the EHMT2gene located on chromosome 6 (p21.33) (gene ID: 10919 in NCBI).
  • Human KMT1 D is referenced as Q9H9B1 in UNIPROT and is encoded by the EHMT12 gene located on chromosome 9 (q34.3) (gene ID: 79813, in NCBI).
  • H3K9 HKMT family also includes SETDB1/ESET/KMT1 E.
  • SETDB1 alone dimethylates H3K9 but trimethylates this residue when associated with its cofactor hAM.
  • Human Setdbl is referenced as Q15047 in UNIPROT and is encoded by the Suv39h2 gene located on chromosome 1 (q21 .3) (gene ID: 9869 in NCBI).
  • H3K9me histone methyltransferase (also shortly named herein H3K9me HKMT) inhibitor can be selected among inhibitors of Suv39h1 (KMT1A), Suv39h2 (KMT1 B), G9a (EHMT2/KMT1C), G9a-like protein 1 ; GLP (EHMT1/KMT1 D), Setdbl (KMT1 E), and Setdb2 (KMT1 F).
  • the selected inhibitor is selective for one or more HKMTs as above mentioned.
  • selective it is meant that the affinity of the inhibitor is at least 10-fold, preferably 25-fold, more preferably 100-fold, and still preferably 500-fold higher than the affinity for other histone methyltransferases and in some cases for one or more of the H3K9me HKMTs.
  • the selected inhibitor has an IC50 of less than 20 pM, preferably less than 10 pM, more preferably less than 5 pM, even more preferably less than 1 pM or less than 0.5 pM.
  • the HKMT inhibitor has an IC50 for the other HKMTs, in some cases for H3K9me HKMT, such as for example EZH2, G9A and/or Setbdl , of more than 10 pM, preferably more than 20 pM, more preferably more than 50 pM.
  • the selected inhibitor is selective for Suv39h1 and/or Suv39h1. In some embodiments, the selected inhibitor does not inhibit Setdbl .
  • a selected HKMT inhibitor alternatively targets one or more heterochromatin protein 1 (HP1 ) proteins (see for review Zeng W, Ball AR Jr, Yokomori K. HP1 : heterochromatin binding proteins working the genome. Epigenetics. 2010;5(4):287-292).
  • HP1 proteins include HP1 a, encoded by Chromobox homolog 5 (CBX5); HP1 p, encoded by CBX1, and HP1y, encoded by CBX3.
  • Human CBX1 is referenced as P83916 in UNIPROT and is encoded by the CBX1 gene located on chromosome 17q (21.32) (gene ID: 10951 in NCBI). This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family .
  • the protein is enriched in the heterochromatin and associated with centromeres.
  • the protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadowdomain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins.
  • CSD C-terminal chromo shadowdomain
  • Human CBX3 (also named HP1y) is referenced as Q13185 in UNIPROT and is encoded by the CBX1 gene located on chromosome 7 (p15.2) (gene ID: 11335 in NCBI).
  • Human CBX5 (also named HP1 a) is referenced as P5973 in UNIPROT and is encoded by the CBX5 gene located on chromosome 12 (q13.13) (gene ID: 23468 in NCBI).
  • Inhibitors of HP1 proteins may prevent binding of the protein to histone H3 trimethylated and or inhibit the gene expression (at the genomic and/or transcriptomic level as detailed below).
  • Inhibitors of Suv39h1 will be described in detail below, but it is clearly intended that the definitions below can be applied by the skilled person to any the H3K9 HKMT inhibitors (including inhibitors targeting HP1 protein) as previously described and more particularly to Suv39h2. In some embodiments, the selective inhibitors inhibits both Suv39h1 and Suv39h2.
  • Human Suv39h1 methyltransferase is referenced as 043463 in UNIPROT and is encoded by the Suv39h1 gene located on chromosome X (gene ID: 6839 in NCBI).
  • One exemplary human gene sequence is SEQ ID NO: 1
  • One exemplary human protein sequence is SEQ ID NO: 2
  • Suv39h1 thus encompasses all mammalian variants of Suv39h1 , and genes that encode a protein at least 75%, 80%, or typically 85%, 90%, or 95% identical to SEQ ID NO: 2 and that has Suv39h1 activity (i.e., the methylation of Lys-9 of histone H3 by H3K9-histone methyltransferase).
  • Human Suv39h2 methyltransferase is referenced as G5E9A8 in UNIPROT and is encoded by the Suv39h2 gene located on chromosome 10 (p13) (gene ID: 79723 in NCBI).
  • Suv39h1 refers to a decrease of at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% or more of Suv39h1 protein activity, and/or protein level, Suv39h1 gene expression, and/or Suv39h1 transcript level in a cell or in an organism as compared to normal level (e.g., normal level typically refers to the expression level in a corresponding normal cell or organism, wherein the expression has not been modified). It is of course intended that reduced or decrease activity of Suv39h1 can indeed be achieved by reduced gene expression (at the genomic or transcript level) and/or by the expression of a non-functional Suv39h1 protein.
  • Suv39h1 activity can thus be achieved at the genomic, transcriptomic, and/or at the protein level.
  • an inhibitor of Suv39h1 can thus be selected among any natural compound or not having the ability to inhibit Suv39h1 methyltransferase activity and/or gene expression (transcription and/or translation).
  • the inhibiting activity of a compound may be determined using various methods as described in Greiner D. Et al. Nat Chem Biol. 2005 Aug;l(3): 143-5 or Eskeland, R. et al. Biochemistry 43, 3740-3749 (2004).
  • “Inhibition of Suv39h1 activity” as used herein refers to a decrease of Suv39h1 activity of at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% or more as compared to the activity or level of the Suv39h1 protein which is not inhibited (e.g., as compared to a corresponding cell, tissue, or organism without inhibition).
  • the inhibition of Suv39h1 activity leads to the absence in the cell, tissue, or organism of substantial detectable activity of Suv39h1.
  • the inhibition level of Suv39h1 activity can be assessed typically by assessing the levels of H3K9me3 (see as a matter of illustration HMT activity assessment in Nishioka, Kenichi et al. “Set9, a novel histone H3 methyltransferase that facilitates transcription by precluding histone tail modifications required for heterochromatin formation.” Genes & development vol. 16,4 (2002): 479-89; but see also Allan, Rhys S et al. “An epigenetic silencing pathway controlling T helper 2 cell lineage commitment.” Nature vol. 487,7406 (2012): 249-53 using chromatin immunoprecipitation (ChIP) with antibodies specific for H3K9me3 and H3K9ac).
  • ChIP chromatin immunoprecipitation
  • Reduced expression of Suv39h1 refers to a decrease of Suv39h1 protein and or/transcript expression of at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% or more as compared to normal level (e.g., normal level typically refers to the expression level in a corresponding normal cell or organism, wherein the expression has not been modified).
  • Non-functional Suv39h1 protein it is herein intended a protein with a reduced activity, or a lack of detectable activity as described above.
  • inhibitors of Suv39h1 activity in a cell according to the invention can be selected among any compound or agent natural or not having the ability of inhibiting the methylation of Lys-9 of histone H3 by H3K9-histone methyltransferase or inhibiting the H3K9-histone methyltransferase Suv39h1 gene expression.
  • a Suv39h1 inhibitor can be selected from a nucleic acid, a peptide, a ribonucleic complex, a ribonucleoprotein (RNP) complex, a small molecule, as well derivatives and combinations thereof.
  • an inhibitor Suv39h1 according to the present invention is preferably selective for Suv39h1 , as compared with other histone methyltransferases such EZH2, G9A or Setdbl .
  • an inhibitor according to the present invention inhibits both Suv39h1 and Suv39h2, preferably said inhibitor is selective for Suv39h1 and Suv39h2.
  • the inhibitor of Suv39h1 can also be selective for Suv39h1 as compared with the histone methyltransferase Suv39h2.
  • selective it is meant that the affinity of the inhibitor is at least 10-fold, preferably 25- fold, more preferably 100-fold, and still preferably 500-fold higher than the affinity for other histone methyltransferases.
  • the inhibitor of Suv39h1 of the invention has an IC50 of less than 20 pM, preferably less than 10 pM, more preferably less than 5 pM, even more preferably less than 1 pM or less than 0.5 pM.
  • the inhibitor of SUV39H1 has an IC50 for the other methyltransferase such as for example EZH2, G9A or Setbdl of more than 10 pM, preferably more than 20 pM, more preferably more than 50 pM.
  • the Suv39h1 inhibitor specifically inhibits Suv39h1 activity (e.g. relative to other histone methyltransferases (HMTs) such as one or more of G9a, DOT1 , EZH1 , EZH2, GLP, MLL1 , MLL2, MLL3, MLL4, NSD2, SETIb, SET7/9, SET8, SETMAR, SMYD2, Suv39h2).
  • HMTs histone methyltransferases
  • the inhibition may be at least about 2, 3, 4, 5, 10, 100, or 1000 fold greater inhibition relative to inhibition of other histone methyltransferases such as one or more of G9a, DOT1 , EZH1 , EZH2, GLP, MLL1 , MLL2, MLL3, MLL4, NSD2, Setlb, SET7/9, SET8, SETMAR, SMYD2, Suv39h2.
  • the inhibition of Suv39h1 may be at least 2; 3; 4; 5; 6; 7; 8; 9 or 10 fold greater than the inhibition of other HMTs described herein.
  • the inhibition of Suv39h1 may be at least 10; 20, 30, 40; 50; 60, 70; 80; 90 or 100-fold greater than the inhibition of other HMTs described herein.
  • Suv39h1 inhibition is achieved using a Suv39h1 inhibitor selected among natural compounds or not, having the ability to inhibit the methylation of Lys-9 of histone H3 by H3K9-histone methyltransferase, for example by using a small molecule inhibitor (i.e., a small organic molecule).
  • a small molecule inhibitor i.e., a small organic molecule.
  • the inhibitor of Suv39h1 according to the present invention is not triptolide and/or is not chaetocin.
  • Small molecules refers to a molecule of a size comparable to those organic molecules generally used in pharmaceuticals.
  • Preferred small organic molecules range in size up to about 5000 Da, more preferably up to 2000 Da, and most preferably up to about 1000 Da.
  • the inhibitor of H3K9 -histone methyltransferase Suv39h1 is chaetocin (CAS 28097-03-2) as described by Greiner D, Bonaldi T, Eskeland R, Roemer E, Imhof A. “Identification of a specific inhibitor of the histone methyltransferase SU(VAR)3-9”. Nat Chem Biol. 2005 Aug;l(3): 143-5.; Weber, H.
  • ETP epipolythiodioxopiperazine
  • An inhibitor of Suv39h1 can also be ETP69 (Rac-(3S,6S,7S,8aS)-6- (benzo[d][1 ,3]dioxol-5-yl)-2,3,7-trimethyl-1 ,4-dioxohexahydro-6H-3,8a- epidithiopyrrolo[1 ,2-a]pyrazine-7-carbonitrile), a racemic analog of the epidithiodiketopiperazine alkaloid chaetocin A (see WO2014066435 but see also Baumann M, Dieskau AP, Loertscher BM, et al.
  • the inhibitor Suv39h1 is an aptamer.
  • Aptamers are a class of molecules that represents an alternative to antibodies in term of molecular recognition. Aptamers are oligonucleotide or oligopeptide sequences with the capacity to recognize virtually any class of target molecules with high affinity and specificity.
  • ligands may be isolated through Systematic Evolution of Ligands by Exponential enrichment (SELEX) of a random sequence library, as described in Tuerk C. and Gold L., 1990.
  • the random sequence library is obtainable by combinatorial chemical synthesis of DNA. In this library, each member is a linear oligomer of a unique sequence that is optionally chemically modified.
  • Peptide aptamers consists of a conformationally constrained antibody variable region displayed by a platform protein, such as E. coli Thioredoxin A that are selected from combinatorial libraries by two hybrid methods (Colas P, Cohen B, Jessen T, Grishina I, McCoy J, Brent R. “Genetic selection of peptide aptamers that recognize and inhibit cyclin- dependent kinase 2”. Nature. 1996 Apr 11 ;380(6574):548-50).
  • Intrabodies are antibodies that bind intracellularly to their antigen after being produced in the same cell (for a review se for example, Marschall AL, Dubel S and Boldicke T “Specific in vivo knockdown of protein function by intrabodies”, MAbs. 2015;7(6): 1010-35. but see also Van Impe K, Bethuyne J, Cool S, Impens F, Ruano- Gallego D, De Wever O, Vanloo B, Van Troys M, Lambein K, Boucherie C, et al. “A nanobody targeting the F-actin capping protein CapG restrains breast cancer metastasis”.
  • Intrabodies can be generated by cloning the respective cDNA from an existing hybridoma clone or more conveniently, new scFvs/Fabs can be selected from in vitro display techniques such as phage display which provide the necessary gene encoding the antibody from the onset and allow a more detailed predesign of antibody fine specificity.
  • in vitro display techniques such as phage display which provide the necessary gene encoding the antibody from the onset and allow a more detailed predesign of antibody fine specificity.
  • bacterial-, yeast-, mammalian cell surface display and ribosome display can be employed.
  • the most commonly used in vitro display system, for selection of specific antibodies is phage display. In a procedure called panning (affinity selection), recombinant antibody phages are selected by incubation of the antibody phage repertoire with the antigen.
  • the most frequent format for intrabodies is the scFv, which consists of the H- and L- chain variable antibody domain (VH and VL) held together by a short, flexible linker sequence (frequently (Gly4Ser)3), to avoid the need for separate expression and assembly of the 2 antibody chains of a full IgG or Fab molecule.
  • the Fab format comprising additionally the C1 domain of the heavy chain, and the constant region of the light chain has been used.
  • scFab a new possible format for intrabodies, the scFab, has been described.
  • the scFab format promises easier subcloning of available Fab genes into the intracellular expression vector, but it remains to be seen whether this provides any advantage over the well-established scFv format.
  • bispecific formats have been used as intrabodies.
  • a bispecific transmembrane intrabody has been developed as a special format to simultaneously recognize intra- and extracellular epitopes of the epidermal growth factor, combining the distinct features of the related monospecific antibodies, i.e., inhibition of autophosphorylation and ligand binding.
  • Another intrabody format particularly suitable for cytoplasmic expression are single domain antibodies (also called nanobodies) derived from camels or consisting of one human VH domain or human VL domain. These single domain antibodies often have advantageous properties, e.g., high stability; good solubility; ease of library cloning and selection; high expression yield in E. coli and yeasts.
  • the intrabody gene can be expressed inside the target cell after transfection with an expression plasmid or viral transduction with a recombinant virus. Typically, the choice is aimed at providing optimal intrabody transfection and production levels. Successful transfection and subsequent intrabody production can be analyzed by immunoblot detection of the produced antibody, but, for the evaluation of correct intrabody/antigen- interaction, co-immunoprecipitation from HEK293 cell extracts transiently cotransfected with the corresponding antigen and intrabody expression plasmids may be used.
  • inhibition of Suv39h1 in a cell may also be achieved with affibody molecules.
  • Affibody are small proteins engineered to bind to a large number of target proteins or peptides with high affinity, imitating monoclonal antibodies, which are therefore a member of the family of antibody mimetics (see for review Lofblom J, Feldwisch J, Tolmachev V, Carlsson J, Stahl S, Frejd FY. Affibody molecules: engineered proteins for therapeutic, diagnostic and biotechnological applications. FEBS Lett. 2010 Jun 18;584(12):2670-80).
  • Affibody molecules are based on an engineered variant (the Z domain) of the B-domain in the immunoglobulin-binding regions of staphylococcal protein A, with specific binding for theoretically any given target.
  • Affibody molecule libraries are generally constructed by combinatorial randomization of 13 amino acid positions in helices one and two that comprise the original Fc-binding surface of the Z-domain. The libraries have typically been displayed on phages, followed by bio-panning against desired targets. Should the affinity of the primary be increased, affinity maturation generally results in improved binders and may be achieved by either helix shuffling or sequence alignment combined with directed combinatorial mutagenesis. The newly identified molecules with their altered binding surface generally keep the original helical structure as well as the high stability, although unique exceptions with interesting properties have been reported. Due to their small size and rapid folding properties, affibody molecules can be produced by chemical peptide synthesis.
  • Suv39h1 inhibition is achieved through repression of the Suv39h1 gene expression, through inactivation of the Suv39h1 gene of the cell, or through expression of exogenous inhibitors.
  • Suv39h1 repression at the genomic and/or transcriptomic level
  • Gene disruption may a lead to a reduced expression of the Suv39h1 protein or to the expression of a non-functional Suv39h1 protein.
  • Inhibition or repression of Suv39h1 activity notably including inhibition or repression of Suv39h1 expression, in one or more cell, or in an individual, according to the present invention can be permanent and irreversible or transient or reversible.
  • Suv39h1 inhibition, disruption or repression is permanent and irreversible.
  • a Suv39h1 inhibitor reduces the expression of a Suv39h1 protein, for example by gene repression/suppression through gene knockdown using antagonistic nucleic acids which are typically capable of inhibiting or reducing the expression of a gene or a transcript thereof and/or translation into a protein.
  • Antagonistic nucleic acids also named herein nucleic acis inhibitors or inhibitor polynucleotides
  • Suitable Suv39h1 inhibitors include, for example, agents that hybridize or bind to the Suv39h1 gene or its regulatory elements, such as aptamers that block or inhibit Suv39h1 expression or activity as well as nucleic acid molecules that block transcription or translation, such as antisense molecules complementary to Suv39h1 (e.g. anti-sense RNAs) such as RNA interfering agents (such as a small interfering RNAs (siRNAs), small hairpin RNAs (shRNAs), microRNAs (miRNAs), piwiRNAs (piRNAs)); long non-coding RNAs (IncRNAs), antisense oligonucleotides (ASOs), ribozymes and combinations thereof.
  • antisense molecules complementary to Suv39h1 e.g. anti-sense RNAs
  • RNA interfering agents such as a small interfering RNAs (siRNAs), small hairpin RNAs (shRNAs), microRNAs
  • RNAi double-stranded RNA
  • RNAi can be transfected as plasmid vectors encoding thereof, transcribed by heterologous promoters, or can be delivered into mammalian cells through infection of the cell with virally produced vectors.
  • RNA interfering agent is defined as any agent, which interferes with or inhibits expression of a target biomarker gene by RNA interference (RNAi).
  • RNA interfering agents include, but are not limited to, nucleic acid molecules including RNA molecules, which are homologous to the target gene of the invention (e.g., Suv39h1 ), or a fragment thereof, short interfering RNA (siRNA), and small molecules which interfere with or inhibit expression of the target nucleic acid by RNA interference (RNAi).
  • siRNAs are small ( ⁇ 12-35 nucleotide) non-coding RNA molecules capable of inducing RNAi.
  • siRNAs comprise an RNA duplex (double-stranded region) formed by complement base pairing with phosphorylated 5'-ends and hydroxylated 3'-ends, optionally with one or two single-stranded overhanging nucleotides.
  • the duplex portion typically comprises between 17 and 29 nucleotides.
  • siRNA may de generated from two RNA molecules that hybridize together or may alternatively be generated from a single RNA molecule that includes a self-hybridizing portion (shRNA).
  • shRNA self-hybridizing portion
  • the duplex portion of an siRNA may, but typically does not, include one or more bulges containing one or more unpaired and/or mismatched nucleotides in one or both strands of the duplex or may contain one or more non-complementary nucleotide pairs.
  • One strand of a siRNA includes a portion that hybridizes with a target transcript (e.g. a target mRNA).
  • the antisense strand may be precisely complementary with a complementary region of the target transcript (i.e. the siRNA antisense strand may hybridize to the target sequence without a single mismatch, wobble base pairing or nucleotide bulge) or one or more mismatches, wobble (G:ll) base pairings and/or nucleotide bulges between the siRNA antisense strand and the complementary region of the target transcript may exist.
  • siRNAs of the invention are also advantageously protected, for example, using the technique described above for protecting the phosphodiester bonds.
  • the siRNAs sequences advantageously comprise at least twelve contiguous dinucleotides or derivatives thereof.
  • Anti-sense oligonucleotides can act to directly block the translation of H3K9-histone methyltransferase Suv39h1 and thus preventing protein translation and/or increasing mRNA degradation, thus decreasing the level of H3K9-histone methyltransferase SUV39H1 and thus its activity in a cell.
  • antisense oligonucleotides of at least about 15 bases and complementary to unique regions of the mRNA transcript sequence encoding H3K9-histone methyltransferase SUV39H1 can be synthesized, e.g., by conventional phosphodiester techniques and administered by e.g., intravenous injection or infusion.
  • Methods for using antisense techniques for specifically inhibiting gene expression of genes whose sequence is known are well known in the art (see for example U.S. Pat. Nos. 6,566,135; 6,566, 131 ; 6,365,354; 6,410,323; 6,107,091 ; 6,046,321 ; and 5,981 ,732).
  • Antisense RNAs or asRNAs are typically single or double-stranded RNA molecules exhibiting preferably at least 90%, more preferably 95% and especially 100% (of the nucleotides of a dsRNA) sequence identity to a section of a naturally occurring mRNA sequence, such as herein a portion of a SUV39H1 mRNA.
  • MicroRNAs or “miRNAs” are small ( ⁇ 20-24 nucleotide) non-coding double-stranded RNAs (dsRNAs) capable of recruiting the AGO-2 RISC complex to a complementary target transcript, thereby preferably inducing the miRNA-mediated RNAi pathway. MicroRNAs are typically processed from pri-microRNA to short stem-loop structures called pre-microRNA and finally to mature miRNA. Both strands of the stem of the pre- microRNA may be processed to a mature microRNA.
  • dsRNAs non-coding double-stranded RNAs
  • microRNAs After processing, the mature single-stranded microRNAs, associated with Argonaute 2 (AG02) in the RNA-induced silencing complex (RISC), typically bind to the 3' UTRs of their cytosolic mRNA targets, resulting in either reduced translation or deadenylation and degradation of the mRNA transcript.
  • the predominant function of microRNAs is thus to (negatively) regulate protein translation by binding to complementary sequences of target mRNAs.
  • microRNA includes miRNAs, mature single stranded miRNAs, precursor miRNAs (pre-miRNA), primary miRNA transcripts (pri-miRNA), duplex miRNAs and variants thereof.
  • MicroRNAs are particularly envisaged to be capable of binding to a target site within a 3" untranslated region of a target nucleic acid.
  • shRNAs short hairpin RNA
  • shRNAs can also function as inhibitors of expression for use in the present invention.
  • shRNAs are typically composed of a short (e.g., 19-25 nucleotide) antisense strand, followed by a 5-9 nucleotide loop, and the analogous sense strand. Alternatively, the sense strand may precede the nucleotide loop structure and the antisense strand may follow.
  • Principles and design of shRNA is for example described in Moore CB, Guthrie EH, Huang MT, Taxman DJ. Short hairpin RNA (shRNA): design, delivery, and assessment of gene knockdown.
  • shRNAs are capable of DNA integration and typically consist of two complementary 19-22 bp RNA sequences linked by a short loop of 4-11 nt similar to the hairpin found in naturally occurring miRNA. Examples loop sequences are also described herein but any variation thereof based on the classical knowledge of the skilled person can be used.
  • shRNA specific for Suv39h1 inhibition have been described in WO/2023/139269 and are included herein by reference.
  • one or more of the following shRNA sequences can be used:
  • shRNA #1 GTTGCAAGTCTTCTTGGAATCAGCTG -TTGATATCCG - CAGCTGATTCCAAGAAGACTTGCAAC
  • shRNA #2 AGTCGAGTACCTGTGCGATTA - CTCGAG - TAATCGCACAGGTACTCGACT
  • SEQ ID NO : 9 shRNA #3 AGATCCGCGAACAGGAATATT - CTCGAG - AATATTCCTGTTCGCGGATCT
  • loop sequences are provided herein (see sequences in italic in the above SEQ ID 4-8) but any variation thereof based on the classical knowledge of the skilled person can be used.
  • Ribozymes can also function as inhibitors of expression for use in the present invention.
  • Ribozymes are enzymatic RNA molecules capable of catalyzing the specific cleavage of RNA.
  • the mechanism of ribozyme action involves sequence specific hybridization of the ribozyme molecule to complementary target RNA, followed by endonucleolytic cleavage.
  • Engineered hairpin or hammerhead motif ribozyme molecules that specifically and efficiently catalyze endonucleolytic cleavage of H3K9- histone methyltransferase SUV39H1 mRNA sequences are thereby useful within the scope of the present invention.
  • ribozyme cleavage sites within any potential RNA target are initially identified by scanning the target molecule for ribozyme cleavage sites, which typically include the following sequences, GUA, GUU, and GUC. Once identified, short RNA sequences of between about 15 and 20 ribonucleotides corresponding to the region of the target gene containing the cleavage site can be evaluated for predicted structural features, such as secondary structure, that can render the oligonucleotide sequence unsuitable.
  • the Suv39h1 inhibitor is a IncRNA. It has indeed been shown that antisense IncRNA, AF196970.3 has silencing function against SUV39H1 in human cells, inhibiting SUV39H1 expression and thus lowering levels of SUV39H1 protein in the cell. AF196970.3 has an expression pattern very similar to the expression pattern of SUV39H1. It is detected in many different cell types, with endothelial cells, fibroblasts and myocytes showing the highest levels, similar to SUV39H1. The gene locus of SUV39H1 is on the X chromosome (position p11 .23, 48695554-48709016, in the GRCh38.p13 assembly).
  • SEQ ID NO: 3 is a 925 base sequence that includes three exons.
  • AF196970.3 exon 1 (SEQ ID NO: 4) is 125 bases in length and does not have significant complementarity to the SUV39H1 gene.
  • AF196970.3 exon 2 (SEQ ID NO: 5) is 600 bases in length and is anti-parallel to a substantial portion of exon 3 of the SUV39H1 gene with 100% similarity.
  • AF196970.3 exon 3 (SEQ ID NO: 6) is 200 bases in length and is anti-parallel to a portion (42.5% similarity) of exon 2 of the SUV39H1 gene, as well as a portion of the adjacent intron.
  • IncRNA sequences specific for Suv39h1 are also described in WO/2023/139269 included herein as reference.
  • Inhibitory polynucleotides of the disclosure for use in the cells and methods of the disclosure, include AF196970.3 (SEQ ID NO: 3) or fragments or variants thereof. Such fragments include fragments of any of SEQ ID NOs: 3-6, of about 12-50, 50-100, 100- 150, 150-200, 200-250, 250-300, 300-350, 350-400, 400-450, 450-500, 500-550, 550-
  • variants include polynucleotides, or chemically modified polynucleotides, in which SEQ ID NO: 3 or the foregoing fragments of SEQ ID NO: 3 have been mutated, including deletions, substitutions, modifications (including chemical modifications), or insertions.
  • Such variants can have a nudeobase sequence
  • Variants include, for example, any of the foregoing fragments of SEQ ID NO:1 linked to additional nucleotides at either the 5’ end or 3’ end or both. Variants also include RNA produced by alternative splicing of
  • ENSG00000232828 SEQ ID NO: 6
  • RNA produced by allelic variants of ENSG00000232828 SEQ ID NO: 6
  • oligonucleotides and ribozymes useful as inhibitors of expression can be prepared by well-known methods in the field. These include techniques for chemical synthesis such as, e.g., by solid phase phosphoramadite chemical synthesis.
  • anti-sense RNA molecules can be generated by in vitro or in vivo transcription of exogenous DNA sequences encoding the RNA molecule(s).
  • DNA sequences can be incorporated into a wide variety of vectors that incorporate suitable RNA polymerase promoters (such as the T7 or SPG polymerase promoters).
  • suitable RNA polymerase promoters such as the T7 or SPG polymerase promoters.
  • Possible modifications include but are not limited to the addition of flanking sequences of ribonucleotides or deoxyribonucleotides to the 5' and/or 3' ends of the molecule, or the use of phosphorothioate or 2'-0-methyl rather than phosphodiesterase linkages within the oligonucleotide backbone.
  • the disruption results in a premature stop codon being incorporated into the gene, such that the Suv39h1 protein is not expressed or is non-functional.
  • the disruption is generally carried out at the DNA level.
  • the disruption generally is permanent, irreversible, or not transient.
  • Suitable Suv39h1 inhibitors can therefore include gene editing agent such as targeted nucleases, including e.g., Zinc finger, TALE and Cas nucleases.
  • a Suv39h1 inhibitor can include an exogenous nucleic acid comprising a) an engineered, non-naturally occurring Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) guide RNA (gRNA) that hybridizes with Suv39h1 genomic nucleic acid sequence and/or b) a CRISPR Cas protein (for example a Type-ll Cas9 protein) or a derivative thereof or a nucleotide sequence encoding thereof.
  • CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
  • Suitable Suv39h1 inhibitors can also include non-functional Suv39h1.
  • the inhibitor is a dominant negative Suv39h1 gene that expresses nonfunctional gene product at a level that inhibits activity of the wildtype Suv39h1. This may comprise overexpression of the dominant negative (typically recombinant) Suv39h1 gene.
  • the gene inactivation is achieved using gene editing agents such as a DNA-targeting molecule, such as a DNA-binding protein or DNA-binding nucleic acid, or complex, compound, or composition, containing the same, which specifically binds to or hybridizes to the gene.
  • a DNA-targeting molecule such as a DNA-binding protein or DNA-binding nucleic acid, or complex, compound, or composition, containing the same, which specifically binds to or hybridizes to the gene.
  • the DNA- targeting molecule comprises a DNA-binding domain, e.g., a zinc finger protein (ZFP) DNA-binding domain, a transcription activator-like protein (TAL) orTAL effector (TALE) DNA-binding domain, a clustered regularly interspaced short palindromic repeats (CRISPR) DNA-binding domain, or a DNA-binding domain from a meganuclease.
  • ZFP zinc finger protein
  • TAL transcription activator-like protein
  • TALE
  • Zinc finger, TALE, and CRISPR system binding domains can be "engineered” to bind to a predetermined nucleotide sequence.
  • the DNA-targeting molecule, complex, or combination contains a DNA-binding molecule and one or more additional domain, such as an effector domain to facilitate the repression or disruption of the gene.
  • the gene disruption is carried out by fusion proteins that comprise DNA- binding proteins and a heterologous regulatory domain or functional fragment thereof.
  • the additional domain is a nuclease domain.
  • gene disruption is facilitated by gene or genome editing, using engineered proteins, such as nucleases and nuclease-containing complexes or fusion proteins, composed of sequence-specific DNA-binding domains fused to, or complexed with, non-specific DNA-cleavage molecules such as nucleases.
  • nuclease is an endonuclease, such as a zinc finger nuclease (ZFN), TALE nuclease (TALEN), an RNA-guided endonuclease (RGEN), such as a CRISPR-associated (Cas) protein, or a meganuclease.
  • ZFN zinc finger nuclease
  • TALEN TALE nuclease
  • RGEN RNA-guided endonuclease
  • Cas CRISPR-associated protein
  • ZFPs and ZFNs ZFPs and ZFNs; TALs, TALEs, and TALENs
  • the DNA-targeting molecule includes a DNA-binding protein such as one or more zinc finger protein (ZFP) or transcription activator-like protein (TAL), fused to an effector protein such as an endonuclease.
  • ZFP zinc finger protein
  • TAL transcription activator-like protein
  • an effector protein such as an endonuclease. Examples include ZFNs, TALEs, and TALENs. See Lloyd et al., Frontiers in Immunology, 4(221 ), 1-7 (2013).
  • the DNA-targeting molecule comprises one or more zinc-finger proteins (ZFPs) or domains thereof that bind to DNA in a sequence- specific manner.
  • ZFPs zinc-finger proteins
  • a ZFP or domain thereof is a protein or domain within a larger protein, that binds DNA in a sequence-specific manner through one or more zinc fingers regions of amino acid sequence within the binding domain whose structure is stabilized through coordination of a zinc ion.
  • sequence-specificity of a ZFP may be altered by making amino acid substitutions at the four helix positions (-1 , 2, 3 and 6) on a zinc finger recognition helix.
  • the ZFP or ZFP-containing molecule is non- naturally occurring, e.g., is engineered to bind to the target site of choice.
  • the ZFP or ZFP-containing molecule is non- naturally occurring, e.g., is engineered to bind to the target site of choice.
  • Beerli et al. (2002) Nature Biotechnol. 20: 135-141 ; Pabo et al. (2001 ) Ann. Rev. Biochem. 70:313-340; Isalan et al. (2001 ) Nature Biotechnol. 19:656-660; Segal et al. (2001 ) Curr. Opin. Biotechnol. 12:632-637; Choo et al. (2000) Curr. Opin. Struct. Biol. 10:411-416.
  • the DNA-targeting molecule is or comprises a zinc-finger DNA binding domain fused to a DNA cleavage domain to form a zinc-finger nuclease (ZFN).
  • fusion proteins comprise the cleavage domain (or cleavage half-domain) from at least one Type IIS restriction enzyme and one or more zinc finger binding domains, which may or may not be engineered.
  • the cleavage domain is from the Type IIS restriction endonuclease Fok I. See, for example, U.S. Pat. Nos. 5,356,802; 5,436,150 and 5,487,994; as well as Li et al. (1992) Proc. Natl. Acad. Sci.
  • the ZFNs efficiently generate a double strand break (DSB), for example at a predetermined site in the coding region of the targeted gene (i.e. SUV39H1 ).
  • Typical targeted gene regions include exons, regions encoding N-terminal regions, first exon, second exon, and promoter or enhancer regions.
  • transient expression of the ZFNs promotes highly efficient and permanent disruption of the target gene in the engineered cells.
  • delivery of the ZFNs results in the permanent disruption of the gene with efficiencies surpassing 50%.
  • Many gene-specific engineered zinc fingers are available commercially.
  • the DNA-targeting molecule comprises a naturally occurring or engineered (non-naturally occurring) transcription activator-like protein (TAL) DNA binding domain, such as in a transcription activator-like protein effector (TALE) protein, See, e.g., U.S. Patent Publication No. 20110301073.
  • the molecule is a DNA binding endonuclease, such as a TALE-nuclease (TALEN).
  • TALEN is a fusion protein comprising a DNA-binding domain derived from a TALE and a nuclease catalytic domain to cleave a nucleic acid target sequence.
  • the TALE DNA-binding domain has been engineered to bind a target sequence within genes that encode the target antigen and/or the immunosuppressive molecule.
  • the TALE DNA-binding domain may target CD38 and/or an adenosine receptor, such as A2AR.
  • the TALEN recognizes and cleaves the target sequence in the gene.
  • cleavage of the DNA results in double-stranded breaks.
  • the breaks stimulate the rate of homologous recombination or non- homologous end joining (NHEJ).
  • NHEJ non- homologous end joining
  • repair mechanisms involve rejoining of what remains of the two DNA ends through direct re-ligation (Critchlow and Jackson, Trends Biochem Sci. 1998 Oct;23(10):394-8) or via the so-called microhomology-mediated end joining.
  • repair via NHEJ results in small insertions or deletions and can be used to disrupt and thereby repress the gene.
  • the modification may be a substitution, deletion, or addition of at least one nucleotide.
  • cells in which a cleavage-induced mutagenesis event, i.e. a mutagenesis event consecutive to an NHEJ event, has occurred can be identified and/or selected by well-known methods in the art.
  • TALE repeats can be assembled to specifically target Suv39h1. (Gaj et al., Trends in Biotechnology, 2013, 31 (7), 397-405). A library of TALENs targeting 18,740 human protein-coding genes has been constructed (Kim et al., Nature Biotechnology. 31 , 251- 258 (2013)). Custom-designed TALE arrays are commercially available through Cellectis Bioresearch (Paris, France), Transposagen Biopharmaceuticals (Lexington, KY, USA), and Life Technologies (Grand Island, NY, USA).
  • the TALENs are introduced as transgenes encoded by one or more plasmid vectors.
  • the plasmid vector can contain a selection marker which provides for identification and/or selection of cells which received said vector.
  • the gene repression or downregulation as per the present method can be carried out using one or more DNA -binding nucleic acids, such as disruption via an RNA-guided endonuclease (RGEN), or other form of repression by another RNA-guided effector molecule.
  • RGEN RNA-guided endonuclease
  • the gene repression can be carried out using clustered regularly interspaced short palindromic repeats (CRISPR) and CRISPR-associated proteins (See Sander and Joung, Nature Biotechnology, 32(4): 347-355).
  • CRISPR clustered regularly interspaced short palindromic repeats
  • CRISPR-associated proteins See Sander and Joung, Nature Biotechnology, 32(4): 347-355.
  • CRISPR system refers collectively to transcripts and other elements involved in the expression of, or directing the activity of, CRISPR-associated (“Cas") genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g. tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a "direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a "spacer” in the context of an endogenous CRISPR system), and/or other sequences and transcripts from a CRISPR locus.
  • a tracr trans-activating CRISPR
  • tracr-mate sequence encompassing a "direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system
  • guide sequence also referred to as a "spacer” in the context of an endogenous C
  • the CRISPR/Cas nuclease or CRISPR/Cas nuclease system includes a noncoding RNA molecule (guide) RNA, which sequence-specifically binds to DNA, and a CRISPR protein, with nuclease functionality (e.g., two nuclease domains).
  • a CRISPR system can derive from a type I, type II, or type III CRISPR system, such as a Cas protein (e.g. a Cas nuclease).
  • Cas proteins include Cas1 , Cas1 B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csn1 and Csx12), Cas10, Csy1 , Csy2, Csy3, Cse1 , Cse2, Csc1 , Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1 , Cmr3, Cmr4, Cmr5, Cmr6, Csb1 , Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1 , Csx15, Csf1 , Csf2, Csf3, Csf4, Cpf1 , or a variant thereof.
  • the Cas protein is Cas9 nuclease.
  • the CRISPR protein is a Cas enzyme such as Cas9.
  • Cas enzymes are well- known in the field; for example, the amino acid sequence of S. pyogenes Cas9 protein may be found in the SwissProt database under accession number Q99ZW2.
  • a Cas nuclease and gRNA are introduced into the cell.
  • the CRISPR system induces DSBs at the target site, followed by disruptions as discussed herein.
  • Common to all these Cas9 or Casg-like)-mediated editing strategies is the induction of double-strand breaks (DSBs) in DNA which are subsequently repaired by either non-homologous end joining (NHEJ) or homology- directed repair (HDR). Incomplete repair of these breakage points may give rise to indels leading to frameshift mutations and subsequent knock-out of one or more targeted genes.
  • NHEJ non-homologous end joining
  • HDR homology- directed repair
  • Incomplete repair of these breakage points may give rise to indels leading to frameshift mutations and subsequent knock-out of one or more targeted genes.
  • the same toolkit allows the targeted integration of exogenous DNA inserts at defined genomic loci.
  • a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of the target sequence.
  • target sequence generally refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between the target sequence and a guide sequence promotes the formation of a CRISPR complex. Full complementarity is not necessarily required, provided there is sufficient complementarity to cause hybridization and promote formation of a CRISPR complex.
  • the target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides.
  • a sequence or template that may be used for recombination into the targeted locus comprising the target sequences is referred to as an "editing template” or “editing polynucleotide” or “editing sequence”.
  • an exogenous template polynucleotide may be referred to as an editing template.
  • the recombination is homologous recombination.
  • Cas9 variants, deemed “nickases” can be used to nick a single strand at the target site. Paired nickases can also be used, e.g., to improve specificity, each directed by a pair of different gRNAs targeting sequences.
  • catalytically inactive Cas9 can be fused to a heterologous effector domain, such as a transcriptional repressor, to affect gene expression.
  • nuclease-inactive platforms including base and prime editors can be used as they offer a potentially safer route to rewriting genetic sequences and introducing large segments of transgenic DNA without inducing double-strand breaks (DSBs) (see notably Biederstadt A, Manzar GS, Daher M. Multiplexed engineering and precision gene editing in cellular immunotherapy. Front Immunol. 2022; 13: 1063303; and Liang, Y., Chen, F., Wang, K., & Lai, L. (2023).
  • Base editors development and applications in biomedicine. Frontiers of medicine, 10.1007/s11684-023-1013-y; see also Collantes JC, Tan VM, Xu H, et al. Development and Characterization of a Modular CRISPR and RNA Aptamer Mediated Base Editing System. CRISPR J. 2021 ;4(1 ):58-68, related to Pin-Point editing).
  • Base editing typically refers to the sgRNA-directed exchange of single nucleotides mediated by modified forms of Cas9 protein, Cas9 nickases (nCas9), which lack the capacity to cleave DNA, but instead are fused to bacterial deaminases to substitute single nucleotides, (see Komor AC, Kim YB, Packer MS, Zuris JA, Liu DR. Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage. Nature (2016) 533(7603):420-4) (see also for CAR-T cell engineering: Webber BR, Lonetree C-l, Kluesner MG, Johnson MJ, Pomeroy EJ, Diers MD, et al.
  • Cytosine base editors that convert C G to T A base pairs
  • Komor A.C. Kim Y.B., Packer M.S., Zuris J.A., Liu D.R. Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage. Nature. 2016;533:420-424
  • adenine base editors that convert A-T to G C base pairs
  • Gaudelli N.M. Komor A.C., Rees H.A., Packer M.S., Badran A.H., Bryson D.I., Liu D.R. Programmable base editing of A • T to G • C in genomic DNA without DNA cleavage. Nature.
  • Prime editing links nCas9 to a reverse transcriptase both of which are guided to a desired genomic locus by a customizable prime editing guide RNA (pegRNA).
  • pegRNA prime editing guide RNA
  • pegRNA prime editing guide RNA
  • Prime editing allows for single base exchanges as well as insertions and deletions of synthetic DNA sequences of limited length.
  • Prime editing notably allows to incorporate DNA sequences of up to 5kb length using a platform dubbed twin prime editing (TwinPE) (Anzalone AV, Gao XD, Podracky CJ, Nelson AT, Koblan LW, Raguram A, et al..
  • CRISPR-Cas systems comprising a) an engineered, non-naturally occurring Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) guide RNA that hybridizes with the Suv39h1 target genomic nucleic acid sequence and/or b) a CRISPR Cas protein (e.g., a Type-ll Cas9 protein or a Cpf1/Cas12 protein) have been described in WO/2023/222928.
  • the Cas protein can be administered as a protein or as a nucleic acid encoding thereof.
  • Suv39h1 inhibitor can be performed in vitro, ex vivo, or in vivo in an individual. Selection of the suitable inhibitor will of course depend on the type of administration. Suv39h1 gene inhibitors such as agents that hybridize or bind to the Suv39h1 gene or its regulatory elements can be favored.
  • Suv39h1 nucleic acid inhibitors also include Suv39h1 gRNA as described in WO/2023/222928 and included herein by reference. Furthermore, selection a Suv39h1 inhibitor may also depends on the selected immunogenic composition (e.g. the vaccine composition). For example, nucleic acid inhibitors of Suv39h1 may be favored in combination with nucleic acid-based vaccine compositions.
  • Nucleic acid (i.e., polynucleotides) inhibitors can be delivered directly, such as heterologous RNA or as heterologous polynucleotides, e.g., chemically modified polynucleotides that have been modified to increase their serum half-life and/or affinity.
  • nucleic acid inhibitors of Suv39h1 as previously described can be chemically modified.
  • Chemical modifications include one or more of a modified backbone linkage, a modified sugar moiety, a modified phosphate moiety, a modified nucleobase, or a chemically conjugated moiety. Such chemical modifications can be present throughout the polynucleotide, or in alternating patterns. Chemical modifications can be present at the 5’ end or 3’ end or both, e.g. the 5-10 bases at the 5’ and/or 3’ end comprise one or more of a modified backbone linkage, a modified sugar moiety, a modified phosphate moiety, a modified nucleobase, or a chemically conjugated moiety.
  • RNA in vitro transcribed, chemically synthesized, or partially chemically synthesized RNAs can be delivered.
  • an RNA may be in vitro transcribed and chemically linked to chemically synthesized RNA at the 5’ end and/or 3’ end.
  • Direct injection or transfection of in vitro-transcribed IncRNAs has been performed to demonstrate IncRNA function. Ulitsky et al. (2011 ) Cell, 147(7): 1537-1550.
  • oligonucleotides also referred to as polynucleotides
  • Modified oligonucleotides comprise chemical modifications including one or more of a modified backbone linkage, a modified phosphate moiety, a modified sugar moiety, a modified nucleobase, or a chemically conjugated moiety, or any combinations thereof.
  • One, two, three, four, five, 10, 15, 20 or more of the same type of modification, optionally in combination with 1 , 2, 3, 4, 5, 10, 15, 20 or more of another type of modification, or patterns of modifications are contemplated.
  • Patterns include alternating modifications throughout the oligonucleotide, such as 2’-fluoro and 2’-methoxy, or end modifications wherein, for example, 1 , 2, 3, 4, 5, or more of the bases, sugars, or linkages at the 5’ and/or 3’ end of the oligonucleotide are modified.
  • modified backbone linkages include phosphorothioate, phosphothioate (PhTx) group or phosphonoacetate, thiophosphonoacetate, methylphosphonate, boranophosphate, or phosphorodithioate.
  • Other internucleotide bridging modified phosphates may be used, such as methyl phosphonothioates, phosphoromorpholidates, phosphoropiperazidates and phosphoramidates.
  • every one or every other one of the internucleotide bridging phosphate residues can be modified as described.
  • modified sugar moieties include deoxyribose, or replacement of the 2’ OH-group by another group. Although the majority of sugar analog alterations are localized to the 2’ position, other sites are amenable to modification, including the 4’ position.
  • Example replacement groups include H, — OR, — R (wherein R can be, such as, alkyl, cycloalkyl, aryl, aralkyl, heteroaryl or sugar), lower alkyl moiety (e.g., C1-C4, linear or branched, saturated or unsaturated alkyl, such as methyl, ethyl, ethenyl, propyl, 1 -propenyl, 2-propenyl, and isopropyl), halo, -F, -Br, -Cl or -I, — SH, — SR (wherein R can be, such as, alkyl, cycloalkyl, aryl, aralkyl, heteroaryl or sugar),
  • modified 2’-sugar include 2’-F or 2’-O-methyl, adenosine (A), 2’-F or 2’-O-methyl, cytidine (C), 2’-F or 2’-O-methyl, uridine (U), 2’-F or 2’-O-methyl, thymidine (T), 2’-F or 2’-O-methyl, guanosine (G), 2’-O-methoxyethyl- 5-methyluridine (Teo), 2’-O-methoxyethyladenosine (Aeo), 2’-O-methoxyethyl-5- methylcytidine (m5Ceo), and any combinations thereof.
  • every one or every other one of the nucleotides can be
  • modified nucleobases include, but are not limited to, 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5- carboxymethylaminomet-hyluracil, di hydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2- methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7- methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta- D-mannosylqueosine, 5'-meth
  • Polynucleotides can also be stabilized by complexing to lipids or liposomes.
  • the liposome comprises 1 ,2-dioleoyl-sn-glycero-3-phosphatidylcholine (DOPC).
  • DOPC 1 ,2-dioleoyl-sn-glycero-3-phosphatidylcholine
  • the lipid particle comprises cholesterol, 1 ,2- distearoyl-sn-glycero-3-phosphocholine (DSPC), PEG-cDMA or PEG-cDSA, and 1 ,2- dilinoleyloxy-3-(N,N-dimethyl)aminopropane (DLinDMA).
  • inhibitory polynucleotides can be expressed ectopically from DNA or vectors expressing such inhibitory polynucleotides.
  • endogenous expression of such inhibitory polynucleotides can be upregulated, e.g., by inserting expression control sequences, such as constitutive, inducible, strong or tissue-specific promoters.
  • RNA vectors for expressing polynucleotides such as RNA are well known in the art and commercially available.
  • Known vectors include viral vectors and pseudotyped viral vectors, such as retroviral, lentivirus, adenoviral, adeno-associated (AAV), alphavirus, vaccinia virus, poxvirus, EBV, and herpes simplex virus papillomavirus, foamivirus, or Semliki Forest virus vectors, or transposase systems, such as Sleeping Beauty transposase vectors.
  • Non-viral systems for delivery of naked plasmids to cells include lipids, cationic lipid complexes, liposomes, nanoparticle, gold particle, or polymer complex, poly-lysine conjugates, synthetic polyamino polymers and artificial viral envelopes.
  • polymerase III promoters are commonly used. Examples include U6, H1 , or 7SK promoters.
  • polymerase II promoters are commonly used. Examples include CMV, EF-1 a, hPGK and RPBSA. CAG promoters have been used to overexpress IncRNA. Yin et al Cell Stem Cell. 2015 May 7; 16(5):504-16. Inducible promoters that are driven by signals from activated T cells include nuclear factor of activated T cells (NFAT) promoter.
  • NFAT nuclear factor of activated T cells
  • RNA promoters for T cell expression of RNA include CIFT chimeric promoter (containing portions of cytomegalovirus (CMV) enhancer, core interferon gamma (IFN-y) promoter, and a T- lymphotropic virus long terminal repeat sequence (TLTR)), endogenous TRAC promoter or TRBC promoter. Inducible, constitutive, or tissue-specific promoters are contemplated.
  • CMV cytomegalovirus
  • IFN-y core interferon gamma
  • T- lymphotropic virus long terminal repeat sequence T- lymphotropic virus long terminal repeat sequence
  • Viral vectors have been used to overexpress IncRNAs, see Yang et al. (2013) Mol Cell 49: 1083-1096; Lu et al. (2016) Mol Ther Nucleic Acids 10: 387-397.
  • IncRNA has been expressed from lentivectors and SB transposase systems. See, e.g., Zhang et al., Overexpression of IncRNAs with endogenous lengths and functions using a IncRNA delivery system based on transposon. J Nanobiotechnol 19, 303 (2021 ).
  • dsRNA such as RNAi is produced in the cell by a vector comprising an expression control sequence operatively linked to a nucleotide sequence that expresses (is a template for one or both strands of) the dsRNA.
  • a promoter can flank either end of the template nucleotide sequence, wherein the promoters drive expression of each individual DNA strand, thereby generating two complementary (or substantially complementary) RNAs that hybridize and form the dsRNA.
  • dsRNA is produced in the cell by a vector that expresses an shRNA that is processed to form an interfering dsRNA.
  • Art-recognized techniques for introducing foreign nucleic acids (e.g., DNA and RNA) into a host cell include calcium phosphate or calcium chloride co-precipitation, DEAE- dextran-mediated transfection, lipofection, electroporation, microinjection, DNA-loaded liposomes, lipofectamine-DNA complexes, cell sonication, gene bombardment using high velocity microprojectiles, biolistics, and viral-mediated transfection.
  • compositions comprising the nucleic acids may also comprise transfection facilitating agents, which include surface active agents, quinone analogs, vesicles such as squalene and squalene, hyaluronic acid, lipids, liposomes, lecithin liposomes, calcium ions, viral proteins, polyanions, polycations, including poly-L-glutamate, or nanoparticles, gold particles, or other known agents.
  • Delivery vehicles include a liposome, lipid-containing complex, nanoparticle, gold particle, or polymer complex.
  • Lipid materials have been used to create lipid nanoparticles (LNPs) based on ionizable cationic lipids, which exhibit a cationic charge in the lowered pH of late endosomes to induce endosomal escape, because of the tertiary amines in their structure.
  • LNPs have been used, for example, to deliver RNA interference (RNAi) components, as well as genetic constructs or CRISPR-Cas systems.
  • RNAi RNA interference
  • CRISPR-Cas systems See, such as, Wilbie et al., Acc Chem Res.;52(6): 1555-1564, 2019.
  • Wang et al., Proc Natl Acad Sci U S A.;113(11 ):2868-2873, 2016 describe use of biodegradable cationic LNPs.
  • Chang et al., Acc. Chem. Res., 52, 665-675, 2019 describe use of ionizable lipid along with cholesterol, DSPC
  • Polymer based particles can be used for genetic construct delivery in a similar manner as lipids.
  • Numerous materials have been used for delivery of nucleic acids.
  • cationic polymers such as polyethylenimine (PEI) can be complexed to nucleic acids and can induce endosomal uptake and release, similarly to cationic lipids.
  • Dendrimeric structures of poly(amido-amine) (PAMAM) can also be used for transfection. These particles consist of a core from which the polymer branches. They exhibit cationic primary amines on their surface, which can complex to nucleic acids.
  • Networks based on zinc to aid cross-linking of imidazole have been used as delivery methods, relying on the low pH of late endosomes which, upon uptake, results in cationic charges due to dissolution of the zeolitic imidazole frameworks (ZIF), after which the components are released into the cytosol.
  • ZIF zeolitic imidazole frameworks
  • Colloidal gold nanoparticles have also been used. See Wilbie et al., supra.
  • the present invention relates to the use of an inhibitor of H3K9 lysine methyl transferase (KMT), notably an inhibitor of Suv39h1 to improve the immune response, in particular the cell mediated immune response to one or more antigens.
  • KMT H3K9 lysine methyl transferase
  • An inhibitor of H3K9 lysine methyl transferase (KMT), notably an inhibitor of Suv39h1 can thus typically be used in combination with a pharmaceutical composition, typically an immunogenic composition that elicits an immune response in an individual for the treatment and/or the prevention of a disease or a condition associated with the elevated expression of an antigen, typically an infectious disease or a tumor.
  • the immune response includes a B-cell response and/or a T-cell response.
  • the immune response is a cell-mediated immune response.
  • the present invention encompasses a medical preparation comprising:
  • first and second components can be administered to the individual sequentially in any order, or simultaneously.
  • KMT H3K9 lysine methyl transferase
  • the medical preparation is for treating and/or preventing a disease, disorder or condition associated with the expression or the elevated expression of an antigen, typically wherein the disease is an infectious disease or a tumor.
  • the medical preparation prevents recall infections or tumor relapses, in more particular embodiments, the medical preparation prevents, reduces or delays tumor metastasis growth or secondary tumors.
  • the present invention also encompasses a method of treating and/or preventing an infectious disease or a tumor in an individual, said method comprising the administration to the individual of a medical preparation comprising:
  • first and second components can be administered sequentially in any order or simultaneously.
  • the present invention further encompasses a method of treating and/or preventing a disease, disorder or condition associated with the expression or the elevated expression of an antigen in an individual, optionally wherein the disease is an infectious disease or a neoplastic disease (tumor), said method comprising the administration to the individual of:
  • first and second components can be administered sequentially in any order or simultaneously.
  • the pharmaceutical composition or first component that elicits an immune response can be an immunogenic composition and/or a cell composition.
  • the immunogenic composition typically include one or more antigens that are able to elicit an immune response, notably a cell-mediated response such as a T cell response in a patient, wherein the one or more antigens can be in a nucleic acid (DNA and/or RNA molecule), a peptidic or a cellular format (such as antigen presenting cells loaded with the one or more antigens or T cells able to recognize the one or more antigens).
  • an immune response notably a cell-mediated response such as a T cell response in a patient
  • the one or more antigens can be in a nucleic acid (DNA and/or RNA molecule), a peptidic or a cellular format (such as antigen presenting cells loaded with the one or more antigens or T cells able to recognize the one or more antigens).
  • Immunogenic or vaccine composition or preparation according to the present invention are described below in relation to the various type and format of antigens.
  • Such composition notably include composition comprising antigen presenting cells.
  • the pharmaceutical composition or first component, as previously described that elicits an immune response comprises one or more immune cells.
  • An immune cell according to the present invention can be typically an NK cell, a B cell, a monocyte, a macrophage, a dendritic cell, a T cell or a progenitor thereof.
  • T cells typically include CD4+ T cells, CD8+ T cells (including alpha/beta T cells and gamma/delta T cells), CD4+ and CD8+ T cells, T regulatory cells (Treg), Naive T cells (TN cells), effector T cells, memory stem T cells (TSCMs), memory T cells (TCMs), effector memory T cells (TEM cells), resident memory T cells (TCRMs), mucosa- associated invariant T (MAIT) cells, and NK T cells (NKT cells).
  • T cell progenitors include T cell progenitors, lymphoid progenitors, myeloid progenitors, a pluripotent stem cells, and induced pluripotent stem cells (iPSCs) as well as hematopoietic stem cells (HSCs), adipose derived stem cells (ADSCs), or pluripotent stem cells of myeloid or lymphoid lineage.
  • the composition comprises a mixed population of T cells (such as a mixed population of CD4+ T cells and CD8+ T cells).
  • T cells can be obtained from a patient in need of a treatment or a healthy donor.
  • Cells can be typically isolated from PBMC or tissue samples, such as resident T cells.
  • T cells notably tumor infiltrating cells (TILs) can be obtained from tumor tissue samples.
  • T cell can be derived from induced pluripotent stem cells.
  • the T cell is an activated T cell (typically induced by stimulation with cognate antigen for example in the context of an antigen-presenting cell preferably with co-stimulatory signals). T cells can be activated and/or expanded in vitro.
  • activated T cell typically induced by stimulation with cognate antigen for example in the context of an antigen-presenting cell preferably with co-stimulatory signals.
  • T cells can be activated and/or expanded in vitro.
  • Non-limitative examples of T cell isolation and/or preparation, well-suited to the present invention include: Corgnac, Stephanie et al. “Isolation of tumor-resident CD8+ T cells from human lung tumors.” STAR protocols vol. 2, 1 100267. 12 Jan. 2021. Wang, Haiying et al. “A simple and effective method to purify and activate T cells for successful generation of chimeric antigen receptor T (CAR-T) cells from patients with high monocyte count.” Journal of translational medicine vol. 20, 1 608. 19 Dec. 2022 ; Iriguchi, S., Yasui, Y., Kawai, Y. et al.
  • the immune cell is a T cell.
  • the immune cell typically a T cell (such as a tissue resident notably a TIL) can be selected or isolated to express a specific antigen receptor (notably a specific TCR) against an identified antigen.
  • a T cell such as a tissue resident notably a TIL
  • a specific antigen receptor notably a specific TCR
  • the modified immune cell can also be engineered to express at it surface one or more antigen receptors.
  • the immune cells express one or more antigen-specific receptors on the surface.
  • the cells thus may comprise one or more nucleic acids that encode one or more antigen-specific receptors, optionally operably linked to a heterologous regulatory control sequence.
  • antigen-specific receptors bind the target antigen with a Kd binding affinity of 10’ 6 M or less, 10’ 7 M or less, 10’ 8 M or less, 10’ 9 M or less, 10’ 10 M or less, or 10’ 11 M or less (lower numbers indicating greater binding affinity).
  • the antigen-binding domain binds a target antigen with a KD affinity of about 1 x 10’ 7 or less, about 5 x 10’ 8 or less, about 1 x 10’ 8 or less, about 5 x 10’ 9 or less, about 1 x 10’ 9 or less, about 5 x 1 O’ 10 or less, about 1 x 1 O’ 10 or less, about 5 x 10’ 11 or less, about 1 x 10’ 11 or less, about 5 x 10’ 12 or less, or about 1 x 10’ 12 or less.
  • the nucleic acids are exogenous (e.g.
  • the nucleic acids are not naturally occurring, including chimeric combinations of nucleic acids encoding various domains from multiple different cell types.
  • the nucleic acids and their regulatory control sequences are typically heterologous.
  • the nucleic acid encoding the antigen-specific receptor may be heterologous to the immune cell and operatively linked to an endogenous promoter of the T-cell receptor such that its expression is under control of the endogenous promoter.
  • the nucleic acid encoding a modified TCR or CAR is operatively linked to an endogenous TRAC promoter.
  • antigen-specific receptors as per the disclosure are recombinant modified T cell receptors (TCRs) and components thereof, as well as functional non-TCR antigen- specific receptors, such as chimeric antigen receptors (CAR).
  • TCRs modified T cell receptors
  • CAR chimeric antigen receptors
  • Engineered immune cells and engineered antigen receptors suited to the present invention have been for example described in EP3359563B1 , in international patent application publication numbers W0200014257, WO2013126726, WO2012/129514, WO2014031687, WO201 3/166321 , WO2013/071154, WO2013/123061 , WO2023126458A1 , W02021013950A1 , U.S.
  • the antigen-specific receptors include a CAR as described in U.S. Patent No.: 7,446,190, and those described in International Patent Application Publication No.: WO/2014055668 A1 .
  • the present invention also encompasses a method of stimulating an immune response against an infectious disease or a tumor in an individual, more particularly against one or more antigens expressed in the context of an infectious disease or a tumor (such as antigens expressed by infected cells or tumor cells), said method comprising administering a vaccination regimen and an immune stimulation regimen to the individual; wherein the immune stimulation regimen comprises administration of an inhibitor of a H3K9 KMT inhibitor, preferably a Suv39H1 inhibitor; wherein the immune stimulation regimen and the vaccination regimen are administered sequentially in any order or simultaneously.
  • the present invention also encompasses a method of raising, stimulating or enhancing an immune response to one or more antigen(s) in an individual, comprising administering to the individual an effective amount of an inhibitor of a H3K9 KMT, notably an inhibitor of Suv39h1 .
  • the immune response is B cell or a cell-mediated immune response, notably a T cell mediated immune response, more particularly the immune response comprises the generation, activation or expansion of antigen-specific T cells and/or the induction or cytolotic event or activity mediated by immune cell and in particular T cell such as CD8 T cells.
  • the immune response also encompasses a response to a vaccination regimen (e.g., the administration of a vaccine or immunogenic composition).
  • KMT inhibitor Inhibitors of H3K9 KMT (KMT inhibitor), in particular inhibitors of Suv39h1 suitable with the present invention have been described above.
  • KMT inhibitor usable according to the present invention significantly increases the sensitivity and initial response of naive T cells, in particular at low antigen load and/or at low antigen affinity.
  • such effect can be assessed as illustrated in the examples of the present application (e.g. incubating naive antigen specific normal CD8+ T cells (such as OTI CD8+ T cells) or deficient for a H3K9 KMT (such as Suv39h1 ) expressing a TCR against a given antigen (e.g., from wild-type and Suv39h1 KO OTI mice, e.g.
  • T cell expressing a specific TCR recognizing an OVA antigen in combination with CMH I) typically around 1x104
  • antigen presenting cells typically around 2.5x104
  • antigenic peptides having variable affinity for the said TCR such as the exemplified peptide
  • a KMT inhibitor increases expansion and/or recall response of central memory T cells (e.g., CD44+CD62L+ T cells) (typically in the absence of inflammation as illustrated in figure 3), notably in lymphoid organs (e.g., spleen and/or lymph nodes).
  • central memory T cells e.g., CD44+CD62L+ T cells
  • lymphoid organs e.g., spleen and/or lymph nodes
  • a KMT inhibitor increases the number of effector memory T cells (e.g., CD44+CD62L-) (typically in the absence of inflammation as illustrated in figure 3), notably in tissues (e.g., liver).
  • an immune response is a protective immune response, e.g., reducing partially or completely the severity of one or more symptoms and/or time over which one or more symptoms are experienced by a subject, reducing the likelihood of developing an established infection after challenge, preventing tumor relapses, metastasis, secondary infections, and/or slowing progression of an associated illness (e.g. extending survival).
  • Immune response may include a humoral immune response and/or a cell-mediated immune response.
  • the immune response according to the present invention comprises a cell- mediated immune response, notably a T cell mediated immune response.
  • the generation of a T cell mediated immune response includes the generation of antigen-specific T cells, in other words T lymphocytes comprising a T cell receptor (TCR) that is directed against an antigen.
  • TCR T cell receptor
  • the said antigen is typically responsible for the induction of the immune response, once presented as the surface of antigen presenting cells in combination with an HLA molecule.
  • Said antigen can typically be included in an immunogenic or vaccine composition.
  • an immunogen refers to a molecule that is capable of eliciting an immune response by an organism's immune system
  • an antigen refers to a molecule that is capable of binding to the product of that immune response. So, an immunogen is necessarily an antigen, but an antigen may not necessarily be an immunogen. Typically, according to the invention, an antigen is an immunogen.
  • the antigen may be a whole-organism, a protein/polypeptide, a polysaccharide, a peptide, a protein-polysaccharide conjugate, or a hapten capable of raising an immune response in a human or an animal, each of these types of antigen, or any combination of two or more thereof, being specifically contemplated as a possible antigen in specific embodiments of the composition.
  • the terms "protein” and "polypeptide” are herein synonymous and interchangeable.
  • epitopes typically refers to the part of an antigen which is recognized by the adaptive immune system.
  • An “antigen” is a substance, which is capable of being recognized (typically via its epitope(s)) by the immune system, preferably by the adaptive immune system, and which is capable of eliciting an antigen-specific immune response, e.g. by formation of antibodies and/or antigenspecific T cells as part of an adaptive immune response.
  • Such a fragment comprising or consisting of an epitope can typically comprise from about 5 to about 20 amino acids.
  • Epitopes can be distinguished in T cell epitopes and B cell epitopes, that can be respectively recognized by T cell receptors (TCRs) on T cells (T lymphocytes) and B cell receptors expressed by B cells (B lymphocytes).
  • an antigen is, or comprises, a peptide or epitope, which can be presented to (antigen-specific) T-cells by antigen-presenting cells in comnbination with MHC surface molecules.
  • an antigen is the product of translation of a provided nucleic acid molecule, preferably an epitope-encoding RNA. Fragments or variants of an antigen (such as a peptide or a protein) comprising at least one epitope are understood as antigens.
  • T cell epitopes or parts of the (antigenic) proteins in the context of the present invention can comprise fragments preferably having a length of about 6 to about 20 or even more amino acids, e.g. fragments as processed and presented by MHC class I molecules, preferably having a length of about 8 to about 10 amino acids, e.g. 8, 9, or 10, (or even 11 , or 12 amino acids), or fragments as processed and presented by MHC class II molecules, preferably having a length of about 13 or more amino acids, e.g. 13, 14, 15, 16, 17, 18, 19, 20 or even more amino acids, wherein these fragments may be selected from any part of the amino acid sequence.
  • These fragments are typically recognized by T cells in form of a complex consisting of the peptide fragment and an MHC surface molecule, i.e. the fragments are typically not recognized in their native form.
  • B cell epitopes are typically fragments located on the outer surface of protein or peptide antigens as defined herein, preferably having 5 to 15 amino acids, more preferably having 5 to 12 amino acids, even more preferably having 6 to 9 amino acids, which may be recognized by antibodies, i.e. in their native form.
  • epitope includes “conformational” (or “discontinuous”) epitopes, which are composed of discontinuous sequences of the amino acids of the antigen but are brought together in the three-dimensional structure, and “linear” epitopes, which are formed by a continuous sequence of amino acids from the antigen.
  • the immune response may be raised against a pathogen, such as for example, viruses, bacteria, parasites or fungus. That is, in one embodiment, the antigen is derived from a human pathogen. In some embodiments, the antigen is derived from a human pathogen selected from the group consisting of bacteria, virus, fungi, parasitic microorganisms and multicellular parasites. In some embodiments, the antigen is derived from a combination of two or more bacteria, virus, fungi, parasitic microorganisms and multicellular parasites. Alternatively, the antigen may be derived from a tumor cell (e.g., the antigen may be a tumor- associated antigen or a tumor specific antigen), and the vaccine composition may be useful for the treatment or the prevention of cancers.
  • a pathogen such as for example, viruses, bacteria, parasites or fungus. That is, in one embodiment, the antigen is derived from a human pathogen. In some embodiments, the antigen is derived from a human pathogen
  • an antigen derived from an organism encompasses, in particular, the organism as a whole (whole-organisms, such as for example a whole-virus or a whole-bacterium), or one or more molecules only from the organism.
  • the antigen may be the naturally occurring whole-organism, and the one or more molecules for instance one or more polypeptides, from the organism may be isolated and purified from such naturally occurring whole-organism.
  • the antigen may be artificially produced, for example, using recombinant technology or using chemical synthesis.
  • Such recombinant antigens may be in a wildtype form, i.e. their nucleotide sequence, or amino acid sequence, is identical to the sequence of the corresponding antigens derived from the naturally occurring wholeorganism.
  • said recombinant antigens may advantageously comprise one or more mutations, i.e. their nucleotide sequence, or amino acid sequence, comprises one or more mutations, as compared with the sequence of the corresponding wild type antigens.
  • Whole-organisms may be live attenuated or killed/inactivated. Inactivation processes using physical and/or chemical means are known to the skilled person.
  • Such recombinant/modified/designed antigens are considered to be within the definition of "derived from" an organism within the context of the present disclosure.
  • the antigen comprises at least one B or T cell epitope, an antigen comprises B and T cell epitopes.
  • the elicited immune response may be an antigen specific B cell response which produces neutralizing antibodies.
  • the elicited immune response may be an antigen specific T cell response, which may be a systemic and/or a local response.
  • the antigen specific T cell response may comprise a CD4+ T cell response, such as a response involving CD4+ T cells expressing a plurality of cytokines, e.g. IFN gamma, TNF alpha and/or IL2.
  • the antigen specific T cell response comprises a CD8+ T cell response, such as a response involving CD8+ T cells expressing a plurality of cytokines, e.g., IFN gamma, TNF alpha and/or IL2.
  • cytokines e.g., IFN gamma, TNF alpha and/or IL2.
  • the encoded antigen contains 3000 residues or fewer, especially 2000 residues or fewer, in particular 1500 residues or fewer.
  • the encoded antigen may contain 1000 residues or fewer, 800 residues or fewer, 600 residues or fewer, 400 residues or fewer or 200 residues or fewer.
  • the antigen contains 50 residues or more, especially 100 residues or more, in particular 150 residues or more.
  • the antigen contains 50 to 3000 residues, especially 100 to 1500 residues, in particular 200 to 1000 residues.
  • An antigen according to the present invention is typically associated with a disease or disorder such as an infection or a tumor.
  • a disease or disorder such as an infection or a tumor.
  • the expression level of the said antigen is increased in cells from a subject suffering from said disease or disorder.
  • the expression of the said antigen in an individual may be cell specific, typically in case of a tumor, where the expression of a tumor antigen is usually tumor tissue specific.
  • an antigen according to the present invention may derive from a virus.
  • the antigen derives from a virus.
  • the antigen may be a whole-virus.
  • the whole virus may be live attenuated or killed/inactivated.
  • the antigen may be a polypeptide derived from a virus.
  • Suitable viruses are from the families Orthomyxoviridae, such as for instance influenza viruses, Paramyxoviridae, such as for instance respiratory syncytial viruses (RSV), mumps virus or measles, Togaviridae, such as for instance rubella virus, Papovaviridae, such as for instance human papillomaviruses (HPV), Herpesviridae, such as for instance herpes simplex viruses (HSV), human cytomegaloviruses (HCMV), Epstein-Barr viruses (EBV), or varicella-zoster viruses (VZV), Picornaviridae, such as for instance enteroviruses, rhinoviruses, polioviruses, Fiaviviridae, such as for instance Dengue viruses or hepatitis C virus (HCV), Hepadnaviridae, such as for instance hepatitis B virus (HBV), Retroviridae, such as for instance human immunodeficiency viruses (HIV), Re
  • the antigen used either in or with the adjuvant composition derives from a virus selected from the group consisting of influenza virus, RSV, HPV, measles, rubella virus, mumps virus, HCMV, VZV, Dengue virus, poliovirus, HIV, HBV, Ebola virus and rotavirus, or any combination of two or more thereof.
  • a virus selected from the group consisting of influenza virus, RSV, HPV, measles, rubella virus, mumps virus, HCMV, VZV, Dengue virus, poliovirus, HIV, HBV, Ebola virus and rotavirus, or any combination of two or more thereof.
  • the antigen derives from HCMV.
  • the HCMV antigen is the glycoprotein gB, which may lack the transmembrane domain (as disclosed in EP0802979), optionally in combination with one or more of the HCMV proteins pp65, IE1 , pUL131 , gL, gH, pUL128, and pUL130.
  • the HCMV antigen is a combination of gB, gL, gH, pUL131 , pUL128 and pUL130.
  • the HCMV antigen is a combination of gL, gH, pUL131 , pUL128 and pUL130.
  • the antigen is a varicella-zoster viruses (VZV) antigen.
  • VZV antigen is a gE antigen.
  • the VZV antigen is the glycoprotein gE, which may be deleted from its transmembrane domain, as disclosed in EP0405867 Bl.
  • the VZV antigen is a protein derived Varicella Zoster Virus which is one of gpl, gpll or g pill as defined on pages 5-7 of EP 0 405 867 Bl and is missing from 4-20 percent of the total amino acid residues of the full length glycoprotein at the carboxy terminal end.
  • the antigen derives from RSV.
  • the RSV antigen is a polypeptide selected from the group consisting of the fusion protein (F), the attachment protein (G), the matrix protein (M2) and the nucleoprotein (N).
  • Particularly suitable as an RSV polypeptide antigen to be included in or administered with the adjuvant composition are conformationally constrained F polypeptides.
  • Conformationally constrained F polypeptides have previously been described in both the prefusion (PreF) and postfusion (PostF) conformations.
  • Exemplary F protein antigens conformationally constrained in the prefusion conformation have been described in the art and are disclosed in detail in e.g.
  • the adjuvant composition comprises an antigen polypeptide derived from RSV selected from the group consisting of: F protein, preF protein, N protein and M2 protein.
  • the antigen derives from HBV.
  • the antigen is the Hepatitis B surface antigen (HBS)
  • the antigen is derived from an RNA virus. In one embodiment, the antigen is derived from a coronavirus, particularly from SARS-CoV-2.
  • a plurality of antigens maybe encoded. Consequently, in some embodiments the antigen is derived from at least one coronavirus, for example from SARS-CoV-2. In some embodiments the antigen is derived from more than one coronavirus (such as 2, 3, 4 or 5), for example from SARS- CoV-2 (such as a plurality of SARS-CoV-2 variant antigens).
  • SARS-CoV-2 makes use of a densely glycosylated spike (S) protein to gain entry into host cells.
  • the S protein is a trimeric class I fusion protein which exists in a metastable prefusion conformation that undergoes a substantial structural rearrangement to fuse the viral membrane with the host cell membrane (Li F. Structure, Function, and Evolution of Coronavirus Spike Proteins. Annu Rev Virol. 2016 Sep 29;3(1 ):237-261 ; Bosch BJ, van der Zee R, de Haan CA, Rottier P
  • the coronavirus spike protein is a class I virus fusion protein: structural and functional characterization of the fusion core complex. J Virol. 2003 Aug;77(16):8801 -II.).
  • a coronavirus protein of use is a fragment or variant of a native coronavirus protein which is capable of eliciting neutralising antibodies and/or a T cell response (such as a CD4 or CD8 T cell response) to a coronavirus, suitably a protective immune response.
  • a T cell response such as a CD4 or CD8 T cell response
  • a SARS-CoV-2 S protein of use comprises, such as consists of, a fragment or variant of a native SARS-CoV-2 S protein which is capable of eliciting neutralising antibodies and/or a T cell response (such as a CD4 or CD8 T cell response) to SARS-CoV-2, suitably a protective immune response.
  • the antigen is a human cytomegalovirus (CMV) antigen.
  • CMV human cytomegalovirus
  • the antigen is a Zika virus antigen.
  • the antigen is a human parainfluenza virus (PIV) antigen, such as a human PIV type 3 antigen.
  • PIV parainfluenza virus
  • the antigen is a human metapneumovirus (hMPV) antigen. In one embodiment the antigen is a respiratory syncytial virus (RSV) antigen.
  • hMPV human metapneumovirus
  • RSV respiratory syncytial virus
  • the antigen is an influenza virus antigen, such as a hemagglutinin or a neuraminidase.
  • the antigen is an Epstein-Barr virus (EBV) antigen.
  • EBV Epstein-Barr virus
  • the antigen is an Herpes simplex virus (HSV) antigen, such as a gE and/or a gl antigen.
  • HSV Herpes simplex virus
  • the antigen may also derive from a bacterium. Accordingly, in particular embodiments, the antigen derives from a bacterium. In one embodiment, the antigen is from a bacterium selected from the group consisting of: B. pertussis, S. Pneumoniae, and N. meningitidis, or any combination of two or more thereof.
  • the antigen may be a whole-bacterium and may be killed/inactivated or live attenuated.
  • Particular whole-bacterium antigens for use in the present invention are Bordetella pertussis.
  • the B. pertussis antigen is the wholebacterium (Pw antigen), optionally in combination with tetanus toxoid (T) and/or diphtheria toxoid (D).
  • the antigen may also derive from a parasite.
  • the antigen may derive from parasites causing Malaria.
  • the antigen is derived from parasites that cause Malaria, such as for example, Plasmodium falciparum or Plasmodium vivax.
  • the Plasmodium falciparum-derived antigen is RTS,S.
  • the antigen is a tumor antigen (also named cancer or neoplastic antigens).
  • Tumor antigens recognized by T lymphocytes are central to the efficacy of cancer vaccines.
  • the ideal antigen for a cancer vaccine should be highly immunogenic, explicitly expressed in all cancer cells (not in normal cells or at low level, i.e. can be a TS or a TAA with tissue differentiation) and optionally necessary for the survival of cancer cells.
  • the cancer may be a solid cancer or a “liquid tumor” such as cancers affecting the blood, bone marrow and lymphoid system, also known as tumors of the hematopoietic and lymphoid tissues, which notably include leukemia and lymphoma.
  • Liquid tumors include for example acute myelogenous leukemia (AML), chronic myelogenous leukemia (CML), acute lymphocytic leukemia (ALL), and chronic lymphocytic leukemia (CLL), (including various lymphomas such as mantle cell lymphoma, non-Hodgkins lymphoma (NHL), adenoma, squamous cell carcinoma, laryngeal carcinoma, gallbladder and bile duct cancers, cancers of the retina such as retinoblastoma).
  • AML acute myelogenous leukemia
  • CML chronic myelogenous leukemia
  • ALL acute lymphocytic leukemia
  • CLL chronic lymphocytic leukemia
  • various lymphomas such as mantle cell lymphoma, non-Hodgkins lymphoma (NHL), adenoma, squamous cell carcinoma, laryngeal carcinoma, gallbladder and bile duct
  • Solid cancers notably include cancers affecting one of the organs selected from the group consisting of colon, rectum, skin, endometrium, lung (including non-small cell lung carcinoma), uterus, bones (such as Osteosarcoma, Chondrosarcomas, Ewing's sarcoma, Fibrosarcomas, Giant cell tumors, Adamantinomas, and Chordomas), liver, kidney, esophagus, stomach, bladder, pancreas, cervix, brain (such as Meningiomas, Glioblastomas, Lower-Grade Astrocytomas, Oligodendrocytomas, Pituitary Tumors, Schwannomas, and Metastatic brain cancers), ovary, breast, head and neck region, testis, prostate and the thyroid gland.
  • bones such as Osteosarcoma, Chondrosarcomas, Ewing's sarcoma, Fibrosarcomas, Giant cell tumors, Adamantinomas, and
  • the tumor antigen is a tumor associated antigen (TAA), a tumor specific antigen (TSA) or a cancer testis antigen (CTA).
  • TAA tumor associated antigen
  • TSA tumor specific antigen
  • CTA cancer testis antigen
  • TAAs are typically shared tumor-shared antigens (archetypal examples are HER2 and human telomerase transcriptase cancer mutants) and include self-antigens” such as differentiated antigens, overexpressed antigens, cancer-testicular antigens and viral- original “non-self’ antigens.
  • TAAs typically include tissue differentiated antigens are expressed by tumor cells and normal cells of the same tissue origin as tumor cells, such as prostate-specific antigen (PSA) expressed in the prostate gland and prostate cancer, and melanoma antigens tyrosinase expressed by normal melanocytes, and melanoma cells.
  • PSA prostate-specific antigen
  • CTAs Cancer-testis antigens
  • MAGE melanoma- associated antigen family
  • SAGE1 sarcoma antigen 1
  • WT1 cancer-testis antigen 1
  • CAG1A cancer-testis antigen 1
  • TSAs are a class of proteins or peptides specifically expressed in tumor cells. TSAs are often referred to as neoantigens. In some embodiments TSAs drive oncogenesis. TSAs viral antigens, such the Epstein-Barr virus encoded antigens (including latent membrane proteins (LMP1 and LMP2), which are expressed in various tumors or HPV E6 and E7 antigens. In some embodiments TSA further include overexpressed mutant self proteins , such as EGFRvlll which is a constitutively active, somatically mutated EGFR variant
  • the antigen is a universal tumor antigen.
  • the term "universal tumor antigen” refers to an immunogenic molecule, such as a protein, that is, generally, expressed at a higher level in tumor cells than in non-tumor cells and also is expressed in tumors of different origins. In some embodiments, the universal tumor antigen is expressed in more than 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90% or more of human cancers. In some embodiments, the universal tumor antigen is expressed in at least three, at least four, at least five, at least six, at least seven, at least eight or more different types of tumors.
  • the universal tumor antigen may be expressed in non-tumor cells, such as normal cells, but at lower levels than it is expressed in tumor cells. In some cases, the universal tumor antigen is not expressed at all in non-tumor cells, such as not expressed in normal cells.
  • Exemplary universal tumor antigens include, for example, human telomerase reverse transcriptase (hTERT), survivin, mouse double minute 2 homolog (MDM2), cytochrome P450 1 B1 (CYP1 B), HER2/neu, p95HER2, Wilms' tumor gene 1 (WT1 ), livin, alphafetoprotein (AFP), carcinoembryonic antigen (CEA), mucin 16 (MLIC16), MLIC1 , prostate-specific membrane antigen (PSMA), p53 or cyclin (DI).
  • the antigen is expressed on multiple myeloma, such as CD38, CD138, and/or CS-1 .
  • exemplary multiple myeloma antigens include CD56, TIM-3, CD33, CD123, and/or CD44.
  • Typical antigen examples include include orphan tyrosine kinase receptor ROR1 , tEGFR, Her2, p95HER2, LI-CAM, CD19, CD20, CD22, mesothelin, CEA, and hepatitis B surface antigen, anti-folate receptor, CD23, CD24, CD30, CD33, CD38, CD44, EGFR, EGP-2, EGP-4, EPHa2, ErbB2, 3, or 4, FBP, fetal acethycholine e receptor, GD2, GD3, HMW-MAA, IL-22R-alpha, IL-13R-alpha2, kdr, kappa light chain, Lewis Y, Ll-cell adhesion molecule, MAGE-A1 , mesothelin, MUC1 , MUC16, PSCA, NKG2D Liga
  • one or more antigens can be selected from the following list (Gene Name (Protein Accession No. Of UniProt, RefSeq or Genbank)): 1A01_HLA- A/m (P30443); 1A02 (P01892); 5T4 (Q13641 ); ACRBP (Q8NEB7); AFP (P02771 ); AKAP4 (Q5JQC9); alpha-actinin-_4/m (B4DSX0); alpha-actinin-_4/m (B4E337); alpha-actinin-_4/m (043707); alpha-methylacyl-coenzyme_A_racemase (A0A024RE16); alpha-methylacyl-coenzyme_A_racemase (A8KAC3); ANDR (P10275); ART-4 (Q9ULX3); ARTC1/m (P52961 ); AURKB (Q96GD4); B2MG (P6176
  • B4DTK1 fibronectin (B4DU16); fibronectin (B7Z3W5); fibronectin (B7Z939); fibronectin (G5E9X3); fibronectin (Q9H382); FOS (P01100); FOXP3 (Q9BZS1 ); FUT1 (P19526); G250 (Q16790); GAGE-1 (AAA82744); GAGE-2 (Q6NT46); GAGE-3 (Q13067); GAGE-4 (Q13068); GAGE-5 (Q13069); GAGE-6 (Q13070); GAGE7b (Q76087); GAGE-8 GAGE-2D (Q9UEU5); GASR (P32239); GnT-V (Q09328); GPC3 (I6QTG3); GPC3 (P51654); GPC3 (Q8IYG2); GPNMB/m (A0A024RA55); GPNMB/m (Q14956); GPNMB/m (Q8IX
  • V9Q8N1 MC1_R (V9Q977); MC1_R (V9Q9P5); MC1_R (V9Q9R8); MC1_R
  • V9QAE0 MC1_R (V9QAR2); MC1_R (V9QAW3); MC1_R (V9QB02); MC1_R
  • V9QB58 MC1_R (V9QBY6); MC1_R (V9QC17); MC1_R (V9QC66); MC1_R
  • V9QCQ4 MC1_R (V9QDF4); MC1_R (V9QDN7); MC1_R (V9QDQ6); M-CSF
  • the antigen is a personalized antigen used to design personalized antigen vaccines that includes variations of DNA and RNA extraction from tumor and germline tissue for exome and RNA sequencing as well as HLA typing. Somatic mutations are often selected that are present in the tumor and absent in the germline, because they have low ‘false discovery rate’ and cause non-synonymous protein changes. Potentially immunogenic neo-epitopes (or neoantigens) are selected from among somatic mutations by in silico prediction of their binding to that patients’ HLA alleles using approaches similar to the NetMHC algorithm.
  • Highly expressed neoepitopes are prioritized by assessment of tumoral RNA-sequencing data, from which generally up to 20 neo-epitopes are selected and good manufacturing practice (GMP)- grade neo-epitope peptides, RNA or viral vectors are produced.
  • GMP manufacturing practice
  • the antigen is an “ignored neoantigen”, characterized by a moderate level of neoepitope presentation that is below the threshold for priming of naive T cells but above the level for recognition by memory T cells.
  • Ignored neoantigens typically require a vaccination to generate neoantigen presentation levels in the lymph node that allow priming.
  • Said neoantigen should typically exhibit low expression and/or high-affinity MHC binding or high expression and/or low-affinity MHC binding such that T cells can be activated for effector functions in the tumour.
  • the antigen may be a peptide derived from non-canonical open reading frame (ORFs) also referred to as antigens arising from the dark genome or as neoantigens.
  • ORFs are termed “non-canonical” to distinguish them from CDSs included in reference gene annotation - i.e. Ensembl-GENCODE - even though their translation occurs through mechanisms of ribosome activity similar to that of CDSs.
  • non-canonical open reading frame is therefore defined as any open reading frame that is not an annotated CDS, an in-frame extension or truncation (either N-terminal or C-terminal), or an in-frame intron retention of an annotated CDS.
  • the antigen is from the grey or dark genome.
  • Typical dark or grey antigen can be derived from non-canonical ORFs induced by frameshit and/or spliced variants as well as from ORFs from transcripts annotated as IncRNAs, pseudogenes, TE, or retroviral elements in the genome.
  • the extracellular antigen binding domain binds to any of the tumor neoantigenic peptides disclosed in Int’l Pat. Pub. No. WO 2021/043804, incorporated by reference herein in its entirety.
  • the antigen-binding domain binds to any of the peptides of SEQ ID NO: 1-117 or to a neoantigenic peptide comprising at least 8, 9, 10, 11 or 12 amino acids that is encoded by a part of an open reading frame (ORF) of any of the fusion transcript sequences of any one of SEQ ID NO: 118-17492 of WO 2021/043804 or described in any of WO 2018/234367, WO 2022/189620, WO 2022/189626, and WO-2022/189639.
  • ORF open reading frame
  • Noncanonical cancer or tumor polypeptides include for example peptides derived from TE (transposable elements) such as in Bonte PE, Arribas YA, Merlotti A, et al. Single-cell RNA-seq-based proteogenomics identifies glioblastoma-specific transposable elements encoding HLA-l-presented peptides. Cell Rep. 2022;39(10): 110916 ; LTR elements as in Attig J, Young GR, Hosie L, et al. LTR retroelement expansion of the human cancer transcriptome and immunopeptidome revealed by de novo transcript assembly. Genome Res.
  • TE transposable elements
  • the tumor antigen is selected from an intracellular peptide as described in WO 2022/189626 or WO 2022/189639.
  • the antigen binding domain of the antigen receptor as herein described is typically a pMHC restricted antibody (e.g. a monoclonal antibody or mAbs) or a fragment thereof.
  • the tumor antigen is a surface antigen and notably a non-canonical surface polypeptide as defined for example in WO 2022/189620.
  • the tumor antigen is a predefined antigen.
  • Predefined antigens can be further classified by the frequency of expression across patient cohorts.
  • Shared antigens are those expressed in a sufficient proportion of patients such that vaccinologists can target these patient groups (frequently within patient subsets of tumor types) using standard testing.
  • Shared antigen vaccines can thus target TSAs, CTAs,TAAs or any type of non-canonical antigens.
  • the antigen derived from cancer mutations that can be shared or not.
  • Shared cancer antigens include nucleotide cancer variants or KRAS, IDH1 , TP53, H3-3A, JAK2, PIK3A, BRAF, CDK4, CDK12, NRAS, CTNNBA, GAS7. It may also include cancer indel variants of genes such as NPM1 , CALR, TGFBR2 as well as cancer fusion genes such as BCR-ABL, DEK-CAN, SYT- SSX, PML-RARA, PAX-FKHR or ETV6-AML1 or cancer spliced variants.
  • Shared antigen vaccines are distinguished from personalized antigen vaccines in that the former can be assessed with standard testing such as cytology, immunohistochemistry and flow cytometry. Personalized antigens are unique to the vaccinated patient.
  • the tumor antigen is a variant of a tumor antigen, wherein the tumor antigen wherein the antigen can be selected from one of the above-mentioned tumor antigens.
  • a “variant” of said tumor antigen may typically comprise an amino acid sequence having a sequence identity of at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, preferably of at least 70%, more preferably of at least 80%, even more preferably at least 85%, even more preferably of at least 90% and most preferably of at least 95% or even 97%, with an amino acid sequence of the respective naturally occurring (wild type) full-length tumor antigen, wherein the tumor antigen is an antigen selected from the antigens listed above.
  • the antigen comprises a fragment of an antigen (notably a tumor antigen) as described above (or a variant thereof) preferably comprising at least one epitope of said antigen (or variant thereof), wherein the tumor antigen is an antigen selected from above listed antigens notably tumor antigens, or a variant thereof.
  • an antigen notably a tumor antigen
  • the tumor antigen is an antigen selected from above listed antigens notably tumor antigens, or a variant thereof.
  • a fragment of said tumor antigen may typically comprise or consist of an amino acid sequence having a sequence identity of at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, preferably of at least 70%, more preferably of at least 80%, even more preferably at least 85%, even more preferably of at least 90% and most preferably of at least 95% or even 97%, with an amino acid sequence of the respective full-length tumor antigen (or variant thereof.
  • the tumor antigens are anonymous antigens. Instead of being classified by their antigen identity, anonymous antigens can be classified by their method and location of APC loading.
  • Anonymous antigen ex vivo vaccines are derived from excised tumor cells that are lysed and delivered to autologous APCs. Ex vivo antigen isolation may require extraction of tumor cells (excisional biopsy), processing raw tissue into a more antigenic form and colocalization with APCs. Injected tumor cells may be taken up and their antigens may be presented by APCs, or the tumor cells themselves may present their antigens to T cells.
  • Anonymous antigen in situ vaccines are conceptually similar to ex vivo vaccines and bypass developing custom, GMP- compliant therapies for each patient.
  • the antigen is expressed at low density, e.g., less than about 6,000 molecules of the target antigen per cell. In some embodiments, the antigen is expressed at an expression level of less than about 5,000 molecules, less than about 4,000 molecules, less than about 3,000 molecules, less than about 2,000 molecules, less than about 1 ,000 molecules, or less than about 500 molecules of the target antigen per cell.
  • the antigen is expressed at a density of less than about 2,000 molecules, such as e.g., less than about 1 ,800 molecules, less than about 1 ,600 molecules, less than about 1 ,400 molecules, less than about 1 ,200 molecules, less than about 1 ,000 molecules, less than about 800 molecules, less than about 600 molecules, less than about 400 molecules, less than about 200 molecules, or less than about 100 molecules of the target antigen per cell.
  • the antigen is expressed at a density of less than about 1 ,000 molecules, such as e.g., less than about 900 molecules, less than about 800 molecules, less than about 700 molecules, less than about 600 molecules, less than about 500 molecules, less than about 400 molecules, less than about 300 molecules, less than about 200 molecules, or less than about 100 molecules of the target antigen per cell.
  • the antigen is expressed at a density ranging from about 5,000 to about 100 molecules of the target antigen per cell, such as e.g., from about 5,000 to about 1 ,000 molecules, from about 4,000 to about 2,000 molecules, from about 3,000 to about 2,000 molecules, from about 4,000 to about 3,000 molecules, from about 3,000 to about 1 ,000 molecules, from about 2,000 to about 1 ,000 molecules, from about 1 ,000 to about 500 molecules, from about 500 to about 100 molecules of the target antigen per cell.
  • the antigen is a peptide predicted to bind to MHC I molecules, thereby inducing T cell responses to the CD8 + T cell subset. In some embodiments, the antigen is a peptide predicted to bind to MHC II molecules, thereby inducing T cell responses to the CD4 + T cell subset. In some embodiments one or more antigens predicted to bind to MHC I molecules and one or more antigens predicted to bind to MHC II molecules can be used in combination.
  • antigen as described above can be combined in a vaccine composition to achieve the ideal immune response.
  • antigens can be produced either in vitro or in vivo.
  • peptides or polypeptides may be produced in vitro as peptides or polypeptides, which may then be formulated into a vaccine or immunogenic composition and administered to a subject.
  • in vitro production may occur by a variety of methods known to one of skill in the art such as, for example, peptide synthesis or expression of a peptide/polypeptide from a DNA or RNA molecule in any of a variety of bacterial, eukaryotic, or viral recombinant expression systems, followed by purification of the expressed peptide/polypeptide.
  • antigens may be produced in vivo by introducing molecules (e.g., DNA, RNA, viral expression systems, and the like) encoding antigens into a subject, whereupon the encoded antigens are expressed.
  • molecules e.g., DNA, RNA, viral expression systems, and the like
  • a “vaccine” or immunogenic composition is typically understood to be a prophylactic or therapeutic material providing at least one antigen, typically at least one epitope of an antigen, preferably an immunogen.
  • Providing at least on epitope means, for example, that the vaccine comprises the epitope or that the vaccine comprises a molecule that, e.g., codes for the epitope or a molecule comprising the epitope.
  • a vaccine composition can comprise at least one epitope-encoding nucleic acid (such as an RNA molecule) comprising at least one coding sequence encoding an epitope (or an antigen or variant or fragment thereof comprising said epitope).
  • Said epitope (or antigen or variant or fragment thereof comprising said epitope) can be derived from an infectious pathogen or from a tumor or cancer cell, and triggers an adaptive immune response which preferably eliminates said infectious pathogen or tumor (or cancer) cell.
  • Vaccine or immunogenic compositions of the present disclosure include nucleic acidbased compositions, peptide-based composition as well as cell-based compositions.
  • the first component that elicits an immune response notably a cell- mediated immune response, notably a composition comprising one or more antigens as previously defined is provided as a pharmaceutical composition or as a vaccine also named herein immunogenic composition.
  • composition or vaccine provided herein may further comprise at least one pharmaceutically acceptable excipient, adjuvant or further component (e.g. additives, auxiliary substances, and the like).
  • pharmaceutically acceptable excipient e.g. additives, auxiliary substances, and the like.
  • the vaccine or immunogenic composition comprises T helper (Th) cell epitopes such as the vaccine composition is able to trigger a Th response in the recipient subject.
  • Th T helper
  • Emulsifiers include, for example, potassium, sodium and ammonium salts of lauric and oleic acid, calcium, magnesium and aluminum salts of fatty acids, organic sulfonates such as sodium lauryl sulfate, cetyltrhethylammonlum bromide, glycerylesters, polyoxyethylene glycol esters and ethers, and sorbitan fatty acid esters and their polyoxyethylene, acacia, gelatin, lecithin and/or cholesterol.
  • organic sulfonates such as sodium lauryl sulfate, cetyltrhethylammonlum bromide, glycerylesters, polyoxyethylene glycol esters and ethers, and sorbitan fatty acid esters and their polyoxyethylene, acacia, gelatin, lecithin and/or cholesterol.
  • Adjuvants that comprise an oil component include mineral oil, a vegetable oil, or an animal oil.
  • FCA Freund's Complete Adjuvant
  • FIA Freund's Incomplete Adjuvant
  • Cytokines useful as additional immunostimulatory agents include interferon alpha, interleukin-2 (IL-2), and granulocyte macrophage-colony stimulating factor (GM-CSF), or combinations thereof.
  • effectively activating a cellular immune response for a vaccine or immunogenic composition can be achieved by expressing the relevant one or more antigens in a vaccine or immunogenic composition in a non-pathogenic microorganism.
  • a non-pathogenic microorganism such microorganisms are Mycobacterium bovis BCG, Salmonella and Pseudomona (See, U.S. Patent No. 6,991 ,797, hereby incorporated by reference in its entirety).
  • the (pharmaceutical) composition or the vaccine according to the invention comprises the combination of the present invention, wherein the at least one coding sequence of the at least one epitope-encoding nucleic acid encodes at least one epitope of an antigen (e.g., at least one epitope of a tumor antigen or a fragment or variant of any one of the previously defined antigens).
  • the (pharmaceutical) composition or vaccine according to the invention may thus comprise at least one antigen together with a KMT inhibitor as previously defined.
  • a combination with a nucleic acid KMT inhibitor as previously defined can be of interest for delivery reason.
  • the one or more nucleic acids encoding the one or more antigens can be delivered into separate delivery vehicles (typically an expression vector) or in the one single vehicle (such as a multi-cistronic expression cassette included in a vector).
  • the (pharmaceutical) composition or vaccine of the present invention comprises, a KMT inhibitor (notably the Suv39h1 inhibitor), and at least one antigen, notably at least one epitope encoding nucleic acid, in particular at least one epitope-encoding nucleic acid (typically an RNA molecule) as defined herein, wherein said at least one epitope-encoding nucleic acid encodes at least two, three, four, five, six, seven, eight, nine, ten, eleven or twelve distinct epitopes (or antigens or variants or fragments thereof comprising said epitopes) as defined herein.
  • a KMT inhibitor notably the Suv39h1 inhibitor
  • at least one antigen notably at least one epitope encoding nucleic acid
  • at least one epitope-encoding nucleic acid typically an RNA molecule
  • the (pharmaceutical) composition or vaccine preferably comprises several classes of the epitope-encoding nucleic acid (notably encoding RNA) as previously defined in combination with the KMT inhibitor, notably the Suv39h1 inhibitor, wherein each epitope-encoding nucleic acid species, notably RNA species encodes a distinct epitope (or an antigen or a variant or fragment thereof comprising said epitope) as defined herein.
  • the epitope-encoding nucleic acid notably encoding RNA
  • the KMT inhibitor notably the Suv39h1 inhibitor
  • the epitope-encoding nucleic acid comprised in the (pharmaceutical) composition or vaccine is a bi- or multicistronic nucleic acid molecule (e.g., RNA), which encodes the at least two, three, four, five, six, seven, eight, nine, ten, eleven or twelve distinct epitopes (or antigens or variants or fragments thereof comprising said epitopes).
  • RNA bi- or multicistronic nucleic acid molecule
  • Nucleic acid transport includes notably viral and non-viral vectors (including mRNA, plasmid, lipid nanoparticules (LNPs) or nanocarriers).
  • viral and non-viral vectors including mRNA, plasmid, lipid nanoparticules (LNPs) or nanocarriers.
  • a therapeutic or pharmaceutical composition as per the present invention comprise one or more LVs, AAVs, LNPs, NCs, and/or NPs.
  • LVs having a particular cell tropism, in particular a particular a T cell or NK cell tropism are used.
  • LVs targeting surface marker of NK or T cells such as CD3, CD4 or CD8 can be used.
  • an implantable scaffold for example made of biodegradable polymer carrying viral or non-viral particles comprising at least one nucleic acid of the invention can be used.
  • a Poxvirus is used in the vaccine or immunogenic composition.
  • These include orthopoxvirus, avipox, vaccinia, MV A, NYVAC, canarypox, ALVAC, fowlpox, TROVAC, etc. (See e.g., Verardiet ah, Hum Vaccin Immunother. 2012 Jul;8 (7):96l-70; and Moss, Vaccine. 2013: 31 (39): 4220-4222).
  • Poxvirus expression vectors were described in 1982 and quickly became widely used for vaccine development as well as research in numerous fields. Advantages of the vectors include simple construction, ability to accommodate large amounts of foreign DNA and high expression levels.
  • Vaccines or immunogenic compositions according to the present invention include inactivated vaccines, live-attenuated vaccines, messenger RNA (mRNA) vaccines, subunit, recombinant, polysaccharide, and conjugate vaccines, toxoid vaccines and viral vector vaccines.
  • mRNA messenger RNA
  • Live-attenuated vaccines contain live pathogens from either a bacteria or a virus that have been "attenuated,” or weakened (e.g., Measles, mumps, and rubella (MMR) vaccine, varicella (chickenpox) vaccine).
  • Inactivated vaccines take a live pathogen and inactivate or kill it. When the vaccine is then introduced to a human through a shot, for example, the inactivated pathogen is strong enough to create an immune response, however, is incapable of causing disease. Multiple doses are often needed in order to build up immunity and offer full protection (e.g., polio vaccine and influenza vaccine).
  • Subunit/antigen, recombinant, polysaccharide, and conjugate vaccine compositions are made from a piece of a pathogen, not the whole organism, so they do not contain any live pathogens.
  • Some important subunit vaccines are polysaccharide vaccines, conjugate vaccines, and protein-based vaccines (can be recombinant or not) (e.g., Haemophilus influenzae type B (Hib) vaccine (conjugate), pneumococcal vaccine (polysaccharide or conjugate), shingles vaccine (recombinant protein), hepatitis B (recombinant protein), acellular pertussis, MenACWY (conjugate)).
  • Hib Haemophilus influenzae type B
  • pneumococcal vaccine polysaccharide or conjugate
  • shingles vaccine recombinant protein
  • hepatitis B recombinant protein
  • acellular pertussis MenACWY (conjugate)
  • Several approaches have been described to enhance the immunogenicity and stability of subunit vaccines, such as virus-like particle (VLP) vaccines and nanoparticle (NP) vaccines.
  • VLP vaccines use platforms capable of producing particles that mimic the structure
  • VLP vaccines can be produced by expressing antigenic proteins in a eukaryotic or prokaryotic system, resulting in the formation of particles with an inherent ability of the antigenic proteins to self-assemble.
  • VLP vaccines can also be made by producing blank VLP templates and then chemically linking antigenic peptides onto the pre-formed particles.
  • Toxoid vaccines use inactivated toxins to target the toxic activity created by the bacteria, rather than targeting the bacteria itself (e.g., tetanus vaccine and diphteria vaccine).
  • Viral vector vaccines rely on antigen delivered on an unrelated, non-pathogenic viral backbone (rVSV-ZEBOV Ebola vaccine, AstraZeneca Covid-19 vaccine).
  • viruses have been developed as vectors for vaccine development, including poxviruses, adenoviruses, herpesviruses, arenaviruses, retroviruses, paramyxoviruses, and flaviviruses, among others (see Draper SJ, Heeney JL. Viruses as vaccine vectors for infectious diseases and cancer. Nat Rev Microbiol (2010) 8:62- 73).
  • Replication-defective and single-cycle viral vectors are particularly relevant as they have an increased safety profile and, in some cases, are still able to elicit a strong immune response (see for example the following reviews: Dudek T, Knipe DM. Replication-defective viruses as vaccines and vaccine vectors. Virology (2006) 344:230-9Barry M. Single-cycle adenovirus vectors in the current vaccine landscape. Expert Rev Vaccines (2016)).
  • Nucleic acid-based vaccine such as DNA or mRNA vaccines use genetic materials that code for the one or more antigens (e.g., the coronavirus’s spike protein or a tumor antigen) to trigger an immune response.
  • the one or more antigens e.g., the coronavirus’s spike protein or a tumor antigen
  • Recently approved COVID-19 mRNA vaccines include the Moderna's Spikevax and Pfizer's BNT 162b2. Then, the expressed tumor antigens could induce immune killing effects against cancer cells.
  • the nucleic acid vaccine usually induces strong MHC I mediated CD8 + T cell responses.
  • Nucleic acid vaccines can simultaneously deliver multiple antigens to trigger humoral and cellular immunity. Additionally, nucleic acid vaccines can encode full-length tumor antigens, allowing APC to cross-present various epitopes or present several antigens simultaneously.
  • DNA vaccines use small DNA molecules (e.g., plasmids), while mRNA vaccines use the mRNA encoding the antigen.
  • DNA vaccines need to enter the nucleus to synthesize the antigen, however, once plasmid DNA enters the nucleus, a single plasmid DNA can produce multiple mRNA copies.
  • mRNA vaccines require a shorter route as mRNA just need to reach the cytoplasm for the synthesis of the antigen and mRNA have low risk of insertion and integration into the genome.
  • mRNA vaccines are mainly divided into non-replicating mRNA and self-amplifying RNA (SAM).
  • Non-replacing mRNA is composed of 7-methylguanosine (m7G) 5' cap, 5'- untranslated region (5'-UTR), open reading frame (OFR), 3'-untranslated region (3'- UTR), and 3'poly(A) tail (see notably Pollard C, De Koker S, Saelens X, Vanham G, Grooten J. Challenges and advances towards the rational design of mRNA vaccines. Trends Mol Med. 2013; 19(12):705- 13).
  • SAM S elf-amplifying RNA
  • SAM comprises 2 ORFs. One encodes the antigen, and te second encodes viral replication component, enabling long-lasting RNA amplification in cells.
  • SAM is originated from alphavirus, and it replicates and magnifies in vivo to induce a persistent and efficient immune response. SAM may allow low doses of vaccination to produce large amounts of the antigen over a certain period.
  • Cancer vaccines can be described according to the type of antigen being introduced: whole tumor, tumor cells, protein, peptides (long or short), RNA or DNA (directly or virally); and the adjuvants with which antigen is introduced: carrier protein, cells (for example, dendritic cells (DCs)), proteins (for example, CD40 ligand (CD40L)) or chemicals (for example, oil-water emulsions and Toll-like receptor (TLR) agonists).
  • cancer vaccines have also been described as belonging to at least four categories: cell-based vaccines, peptide-based vaccines, viral-based vaccines, and nucleic acidbased vaccines.
  • These categories typically include whole tumor cells, tumor lysates, gene-modified tumor cells, purified or recombinant peptide or protein TAA-based vaccines, nucleic acid-based vaccines, and genetically modified cancer cells expressing immunostimulatory cytokines.
  • the cell-based vaccine compositions can be divided into (tumor) cell-based vaccine composition and immune cell vaccine composition.
  • Cancer vaccine technologies have been recently reviewed in Liu, J., Fu, M., Wang, M. et al. Cancer vaccines as promising immuno-therapeutics: platforms and current progress. J Hematol Oncol 15, 28 (2022). These technologies are summarized below.
  • Immune cell-based cancer vaccines are often prepared from whole cells or cell fragments, containing almost tumor antigens, inducing a broader antigen immune response (see Le DT, Pardoll DM, Jaffee EM. Cellular vaccine approaches. Cancer J. 2010;16(4):304-10 fr review).
  • Immune cell-based is typically represented by antigen presenting cell (APC) vaccine and more particularly dendritic cell (DC) vaccine.
  • APC antigen presenting cell
  • DC dendritic cell
  • Sipuleucel-T (Provenge®) is an autologous active cellular immunotherapy with unknown precise mechanism of action; however, it is believed to induce T-cell responses through antigen presenting cells (APCs) to specifically target prostatic acid phosphatase (PAP).
  • APCs antigen presenting cells
  • PAP prostatic acid phosphatase
  • the active component of Sipuleucel-T is achieved by cultivation of patient-derived APCs with PA2024 protein containing a granulocyte-macrophage colony-stimulating factor (GM- CSF). PA2024-activated APCs are shown with elevated level of co-stimulatory molecules, which are then infused back to the patients
  • DC-based vaccines Six different approaches have been developed for the production of DC-based vaccines, which differ in the method used for antigen delivery or DC modifications (see Najafi S, Mortezaee K. Advances in dendritic cell vaccination therapy of cancer. Biomed Pharmacother. 2023; 164:114954 summarized below): (1 ) DCs are not exposed to tumor antigens and instead used to form iDCs or in vitro DC maturation. This process is conducted via treatment with activating stimuli like interleukins. (2) Ex vivo pulsing of DCs either with tumor lysate, tumor antigens or tumor-derived mRNA, in which induced extracted DCs are treated with sources of antigens and then infused back to the recipient.
  • DC-derived exosomes as a source of antigens for immunization.
  • This approach is considered as an alternative to DC adoptive therapy in which antigen-presenting exosomes are treated with antigens and then used to eradicate cancer cells in treated recipients.
  • pulsing DCs with tumor antigens or lysate and maturation using standard maturation cocktails is the approach that is commonly used.
  • neoantigens in the tumor predicted to bind the major histocompatibility complex protein HLA-A*02:01 are identified for individual patients with a cancer.
  • Dendritic cells from the patient are matured ex vivo, then incubated with neoantigens. The activated dendritic cells are then administered to the patient.
  • robust T-cell immunity against the neoantigen is detectable.
  • Dendritic cells are a diverse population of antigen presenting cells found in a variety of lymphoid and non-lymphoid tissues. (See Liu, Cell 106:259-62 (2001 ); Steinman, Ann. Rev. Immunol. 9:271-96 (1991 )) and include lymphoid dendritic cells of the spleen, Langerhans cells of the epidermis, and veiled cells in the blood circulation. Collectively, dendritic cells are classified as a group based on their morphology, high levels of surface MHC-class II expression, and absence of certain other surface markers expressed on T cells, B cells, monocytes, and natural killer cells. In particular, monocyte-derived dendritic cells (also referred to as monocytic dendritic cells) usually express CD 11 c, CD80, CD86, and are HLA-DR+, but are CD 14".
  • Monocytic dendritic cell precursors are usually CD14+.
  • Monocytic dendritic cell precursors can be obtained from any tissue where they reside, particularly lymphoid tissues such as the spleen, bone marrow, lymph nodes and thymus.
  • Monocytic dendritic cell precursors can also be isolated from the peripheral blood , typically from peripheral blood mononuclear cells (PBMCs) (isolated from peripheral blood and identified as any blood cell with a round nucleus (i.e. lymphocytes, monocytes, natural killer cells (NK cells) or dendritic cells)).
  • PBMCs peripheral blood mononuclear cells
  • Umbilical cord blood is another source of monocytic dendritic cell precursors.
  • thenmonocytic dendritic cell precursors and/or immature dendritic cells can be isolated from a healthy subject or from a subject in need of immunostimulation, such as, for example, a cancer subject or other subject for whom cellular immunostimulation can be beneficial or desired (i.e., a subject having a bacterial or viral infection, and the like).
  • Dendritic cell precursors and/or immature dendritic cells also can be obtained from an HLA-matched healthy individual for partial activation and administration to an HLA-matched subject in need of immunostimulation. Methods of isolating and modifying dendritic cell precursors can be found in U.S. Pat. Pub. No. 20060057120 which is herein incorporated by reference.
  • Dendritic cells can be administered directly into a tumor, into the tumor bed subsequent to surgical removal or resection of the tumor, peri-tumorily, into a draining lymph node in direct contact with the tumor, into a blood vessel or lymph duct leading into, or feeding a tumor or organ afflicted by the tumor, e.g., the portal vein or a pulmonary vein or artery, and the like.
  • the administration of partially mature dendritic cells can be either simultaneous with or subsequent to other treatments for the tumor, such as chemotherapy or radiation therapy.
  • partially mature dendritic cells can be co - administered with another agent, which agent acts as an adjuvant to the maturation of the dendritic cell and/or the processing of antigen within the tumor or region near or adjacent to the tumor.
  • the dendritic cells can also be formulated or compounded into a slow release matrix for implantation into a region in or around the tumor or tumor bed such that cells are slowly released into the tumor, or tumor bed, for contact with the tumor antigens
  • Partially mature dendritic cells can also be administered by any means appropriate for the formulation and mode of administration.
  • the cells can be combined with a pharmaceutically acceptable carrier and administered with a syringe, a catheter, a cannula, and the like.
  • the cells can be formulated in a slow release matrix.
  • the formulation can be administered by a means appropriate for the matrix used.
  • Other methods and modes of administration applicable to the present invention are well known to the skilled artisan.
  • Dendritic cell compositions can be used by themselves in the treatment of an individual.
  • the compositions can be used in combination with any other method to treat a tumor.
  • the methods of the present invention can be used in combination with surgical resection of a tumor, chemotherapy (cytotoxic drugs, apoptotic agents, antibodies, and the like), radiation therapy, cryotherapy, brachytherapy, immune therapy (administration of antigen specific mature activated dendritic cells, NK cells, antibodies specific for tumor antigens, etc.), and the like. Any and all of these methods can also be used in any combination.
  • Combination treatments can be concurrent or sequential and can be administered in any order as determined by the treating physician.
  • the subject's immune cells are obtained through a blood draw.
  • the monocytes are differentiated into dendritic cells, matured, activated and loaded with biomarkers from the subject's own tumor tissue.
  • the loading of biomarkers into the dendritic cells "educates" the cells about what the immune system needs to attack.
  • the activated, educated dendritic cells are then isolated with very high purity and are administered to the subject through a simple intradermal injection in the upper arm.
  • the dendritic cells then convey the tumor biomarker information to the rest of the immune system agents (T cells, B cells and others) which then target cells with these biomarkers.
  • the monocytes are differentiated into dendritic cells and partially matured.
  • the cells are then administered by injection directly into the tumors.
  • dendritic cells pick up the tumor biomarkers in situ and convey the tumor biomarker information to the rest of the immune system agents (T cells, B cells and others) which then target cells with these biomarkers.
  • dendritic cell compositions can be used as a first treatment, or a primer, for a second immunotherapy treatment (such as immune checkpoint inhibitor).
  • a second immunotherapy treatment such as immune checkpoint inhibitor.
  • the immune system specifically T-cells
  • Suv39h1 inhibition has also been shown to enhance immune checkpoint effect (in particular anti- PD1 effect).
  • Dendritic cell therapy provokes anti-tumor responses by causing dendritic cells to present tumor antigens to lymphocytes, which activates them, priming them to kill other cells that present the antigen.
  • Dendritic cells are antigen presenting cells (APCs) in the mammalian immune system. In cancer treatment they aid cancer antigen targeting.
  • APCs antigen presenting cells
  • One example of cellular cancer therapy based on dendritic cells is sipuleucel-T.
  • Virus-based cancer vaccines The virus-based vaccine can be divided into three forms: inactivated, live attenuated, or subunit vaccines against the virus that can cause the tumor; the oncolytic virus vaccine and the virus vector vaccine.
  • Epstein-Barr virus, HBV, Hepatitis C virus, and HPV are the most common cancer-related viruses.
  • Viruses are naturally immunogenic and their genetic material can be engineered to contain sequences encoding tumor antigens.
  • Oncolytic virus contain herpes simplex virus, adenovirus, measles, vaccinia, reovirus, vesicular stomatitis virus
  • the engineered virus vaccines can present tumor antigens in large quantities in the immune system and produce anti-tumor immunity.
  • the oncolytic virus can be used as a vector as well. Except for providing tumor antigens, the virus itself can also lyse the tumor, release tumor antigens, further increase the vaccine's effectiveness, and produce long-term immune memory.
  • the adenovirus is a frequently used oncolytic virus, used as delivery vectors for specific genes as well. Adenovirus is easy to manipulate, has a very broad spectrum of host cell tropism and can be rapidly prepared in large quantities.
  • Other vectors include vaccinia virus, lentivirus and adeno-associated virus. Lentivirus and adeno-associated virus have the unique ability to stably and long-termly express the transgene in non-dividing cells the same as adenovirus.
  • Peptide-based subunit vaccines employ targeting distinct tumor antigens, which may be delivered as peptides/proteins typically composed of known or predicted tumor antigen epitopes or as genetically-engineered DNA vectors, viruses, bacteria, or the like
  • Peptide-based subunit vaccines include chemical and biosynthetic preparations of predicted or known specific tumor antigens. Due to the limitation of MHC polymorphism and the small size of antigen epitopes themselves, the immunogenicity of peptide- based vaccines can be weak weak. It is often difficult to cause a robust immune response, which also leads to immune tolerance. Adjuvants are combined with peptide-based vaccines to enhance the immune response generally. The present invention that enhance immune response associated to vaccination fulfill an important therapeutic need.
  • peptide-based cancer vaccines comprise both CD8+ T epitopes and CD4+ T cell epitopes. CD8+ T cell epitopes activate CTLs tumor immunity through the antigens cross-presentation pathway, while CD4+ T cells activate helper T cells to maintain the function of CTLs.
  • Proteins or peptides may be made by any technique known to those of skill in the art, including the expression of proteins, polypeptides or peptides through standard molecular biological techniques, the isolation of proteins or peptides from natural sources, in vitro translation, or the chemical synthesis of proteins or peptides.
  • Peptides can be readily synthesized chemically utilizing reagents that are free of contaminating bacterial or animal substances (Merrifield RB: Solid phase peptide synthesis. I. The synthesis of a tetrapeptide. J. Am. Chem. Soc. 85:2149-54, 1963).
  • polypeptides provided herein, or portions thereof, under in vivo conditions may require their chemical modification since the polypeptides themselves may not have a sufficiently long serum and/or tissue half-life. It may also be advantageous to modify the polypeptides in order to impose a conformational restraint upon them. This might be useful, for example, to mimic a naturally-occurring conformation of the polypeptide in the context of the native protein in order to optimize the effector immune responses that are elicited. Modified polypeptides are referred to herein as "analog" polypeptides.
  • analog extends to any functional and/or structural equivalent of a peptide characterized by its increased stability and/or efficacy in- vivo or in- vitro in respect of the practice of the invention.
  • analog also is used herein to extend to any amino acid derivative of the polypeptides as described herein.
  • Analogs of the polypeptides or peptides contemplated herein include, but are not limited to, modifications to side chains, and incorporation of unnatural amino acids and/or their derivatives, non-amino acid monomers and cross-linkers. Other methods which impose conformational constraint on the polypeptides or their analogs are also contemplated. It will be apparent that the polypeptides of the invention can be modified in a variety of different ways without significantly affecting the functionally important immunogenic behavior thereof. Possible modifications to the polypeptide sequence may include the following: The said polypeptides of the invention or analogs thereof may occur as single length or as multiple tandem or non-tandem repeats. A single type of polypeptide or analog may form the repeats or the repeats may be composed of different molecules including suitable carrier molecules.
  • the immunogenicity of the polypeptides of the present invention may also be modulated by coupling to fatty acid moieties to produce lipidated polypeptides.
  • the polypeptides may also be conjugated to a lipidated amino acid.
  • peptide vaccines there are a number of strategies for amplifying an immunogen's effectiveness, particularly as related to the art of vaccines. For example, cyclization or circularization of a peptide can increase the peptide's antigenic and immunogenic potency.
  • a small peptide antigen can also be conjugated to a suitable carrier, usually a protein molecule. It can thus allow multiple copies of an antigen, such as a peptide, to be conjugated to a single larger carrier molecule.
  • the carrier may possess properties which facilitate transport, binding, absorption or transfer of the antigen.
  • Suitable carriers include, e.g., keyhole limpet hemocyanin (KLH), serum albumin, purified protein derivative of tuberculin (PPD), ovalbumin, non-protein carriers and many others.
  • KLH keyhole limpet hemocyanin
  • PPD purified protein derivative of tuberculin
  • ovalbumin non-protein carriers and many others.
  • the conjugation between a peptide and a carrier can be accomplished using one of the methods known in the art. Specifically, the conjugation can use bifunctional cross-linkers as binding agents as detailed, for example, by Means and Feeney, "A recent review of protein modification techniques" Bioconjugate Chem. 1 :2- 12 (1990
  • a nucleic acid e.g., a polynucleotide
  • an antigenic peptide may be used to produce the antigenic peptide in vitro.
  • the polynucleotide may be, e.g., DNA, cDNA, PNA, CNA, RNA, either single-and/or double-stranded, or native or stabilized forms of polynucleotides.
  • an expression vector capable of expressing a polypeptide can also be prepared.
  • Expression vectors for different cell types are well known in the art and can be selected without undue experimentation.
  • the DNA is inserted into an expression vector, such as a plasmid, in proper orientation and correct reading frame for expression, if necessary, the DNA may be linked to the appropriate transcriptional and translational regulatory control nucleotide sequences recognized by the desired host (e.g., bacteria), although such controls are generally available in the expression vector.
  • the vector is then introduced into the host bacteria for cloning using standard techniques (see, e.g., Sambrook et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.).
  • Expression vectors comprising the isolated polynucleotides, as well as host cells containing the expression vectors, are also contemplated.
  • the antigenic peptides may be provided in the form of RNA or cDNA molecules encoding the desired antigenic peptides.
  • One or more antigenic peptides may also be encoded by a single expression vector.
  • polynucleotide encoding a polypeptide encompasses a polynucleotide which includes only coding sequences for the polypeptide as well as a polynucleotide which includes additional coding and/or non-coding sequences.
  • Polynucleotides can be in the form of RNA or in the form of DNA.
  • DNA includes cDNA, genomic DNA, and synthetic DNA; and can be double- stranded or single-stranded, and if single stranded can be the coding strand or non-coding (anti- sense) strand.
  • the polynucleotides may comprise the coding sequence for antigenic peptide fused in the same reading frame to a polynucleotide which aids, for example, in expression and/or secretion of a polypeptide from a host cell (e.g., a leader sequence which functions as a secretory sequence for controlling transport of a polypeptide from the cell ).
  • the polynucleotides can comprise the coding sequence for the antigenic peptide fused in the same reading frame to a marker sequence that allows, for example, for purification of the encoded polypeptide, which may then be incorporated into the vaccine or immunogenic composition.
  • the polynucleotides may comprise the coding sequence for one or more of the antigenic peptides fused in the same reading frame to create a single concatamerized neoantigenic peptide construct capable of producing multiple antigenic peptides.
  • the polynucleotide sequences encoding a particular isolated polypeptide of interest can be inserted into an expression vector and optionally operatively linked to an expression control sequence appropriate for expression of the protein in a desired host. Proper assembly can be confirmed by nucleotide sequencing, restriction mapping, and expression of a biologically active polypeptide in a suitable host. As well known in the art, in order to obtain high expression levels of a transfected gene in a host, the gene can be operatively linked to transcriptional and translational expression control sequences that are functional in the chosen expression host.
  • Recombinant expression vectors may be used to amplify and express DNA encoding antigenic peptides.
  • Recombinant expression vectors are typically replicable DNA constructs which have synthetic or cDNA-derived DNA fragments encoding a tumor specific antigenic peptide or a bioequivalent analog operatively linked to suitable transcriptional or translational regulatory elements derived from mammalian, microbial, viral or insect genes.
  • a transcriptional unit generally comprises an assembly of (1 ) a genetic element or elements having a regulatory role in gene expression, for example, transcriptional promoters or enhancers, (2) a structural or coding sequence which is transcribed into mRNA and translated into protein, and (3) appropriate transcription and translation initiation and termination sequences.
  • Such regulatory elements can include an operator sequence to control transcription.
  • DNA regions are operatively linked when they are functionally related to each other.
  • DNA for a signal peptide secretory leader
  • DNA for a polypeptide is operatively linked to DNA for a polypeptide if it is expressed as a precursor which participates in the secretion of the polypeptide
  • a promoter is operatively linked to a coding sequence if it controls the transcription of the sequence
  • a ribosome binding site is operatively linked to a coding sequence if it is positioned so as to permit translation.
  • operatively linked means contiguous, and in the case of secretory leaders, operatively linked means contiguous and in the reading frame.
  • Structural elements intended for use in yeast expression systems include a leader sequence enabling extracellular secretion of translated protein by a host cell.
  • recombinant protein is expressed without a leader or transport sequence, it can include an N-terminal methionine residue. This residue can optionally be subsequently cleaved from the expressed recombinant protein to provide a final product.
  • Useful expression vectors for eukaryotic hosts, especially mammals or humans include, for example, vectors comprising expression control sequences from SV40, bovine papilloma virus, adenovirus and cytomegalovirus.
  • Useful expression vectors for bacterial hosts include known bacterial plasmids, such as plasmids from Escherichia coli, including pCR 1 , pBR322, pMB9 and their derivatives, wider host range plasmids, such as Ml 3 and filamentous single- stranded DNA phages.
  • Suitable host cells for expression of a polypeptide include prokaryotes, yeast, insect or higher eukaryotic cells under the control of appropriate promoters.
  • Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli.
  • Higher eukaryotic cells include established cell lines of mammalian origin. Cell-free translation systems could also be employed.
  • Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are well known in the art (see Pouwels et al, Cloning Vectors: A Laboratory Manual, Elsevier,. Y., 1985).
  • mammalian or insect cell culture systems are also advantageously employed to express recombinant protein.
  • suitable mammalian host cell lines include the COS -7 lines of monkey kidney cells, described by Gluzman (Cell 23: 175, 1981 ), and other cell lines capable of expressing an appropriate vector including, for example, L cells, C127, 3T3, Chinese hamster ovary (CHO), 293, HeLa and BHK cell lines.
  • Mammalian expression vectors can comprise nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5 ' or 3' flanking nontranscribed sequences, and 5' or 3' nontranslated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
  • nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5 ' or 3' flanking nontranscribed sequences, and 5' or 3' nontranslated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
  • the proteins produced by a transformed host can be purified according to any suitable method.
  • standard methods include chromatography (e.g., ion exchange, affinity and sizing column chromatography, and the like), centrifugation, differential solubility, or by any other standard technique for protein purification.
  • Affinity tags such as hexahistidine, maltose binding domain, influenza coat sequence, glutathione-S- transferase, and the like can be attached to the protein to allow easy purification by passage over an appropriate affinity column.
  • Isolated proteins can also be physically characterized using such techniques as proteolysis, nuclear magnetic resonance and x-ray crystallography.
  • DNA vaccines are based on bacterial plasmids that encode one or several oncology antigens inducing innate immunity activation and adaptive immune responses.
  • DNA plasmids are directly transfected into APCs, mainly through intradermal delivery.
  • a KMT inhibitor which is the subject of the present invention
  • other adjuvants can be used to enhance the immunogenicity of DNA vaccines, such as CpG motifs, polymer, nanoparticle, liposome, and small molecule agonists.
  • nucleic acid-based vaccines include multiple antigens.
  • nucleic acid-based vaccines include a plurality or more than one, preferably 2 to 20, more preferably 2 to 20, most preferably 2 to 6 of antigen or epitope-encoding nucleic acid.
  • Said combinations typically comprise more than one antigen or epitope-encoding nucleic acid, preferably encoding different peptides or proteins which comprise or provide preferably different epitopes, particularly of different tumor antigens, or pathogenic antigens.
  • antigens can be administered to an individual in need thereof by use of a plasmid.
  • plasmids typically comprises a strong viral promoter to drive the in vivo transcription and translation of the nucleic acid of interest (see e.g., Mor, et al ,(1995). The Journal of Immunology 155 (4): 2039-2046). Intron may also be included to improve mRNA stability and increase protein expression (Leitner et al, (1997). The Journal of Immunology 159 (12): 6112-61 19). Plasmids also typically include a strong polyadenylation/transcriptional termination signal, (Alarcon et alvor (1999). Adv. Parasitol.
  • Multi cistronic vectors can be constructed to express more than one immunogen, or to express an immunogen and an immunostimulatory molecule (Lewis et al., (1999). Advances in Virus Research (Academic Press) 54: 129-88). It is to be noted that advantageously in some embodiments, a multi cistronic vector can be constructed to include one or more immunogens as above defined and an inhibitor of a SUV KMT as previously defined herein.
  • a vaccine or immunogenic composition may include separate DNA plasmids encoding, for example, one or more antigenic peptides/polypeptides and/or encoding an inhibitor of a SUV39 KMT as previously defined.
  • the choice of expression vectors typically depends upon the peptide/polypeptides to be expressed, and is well within the skill of the ordinary artisan.
  • Plasmids can be introduced in vivo by a number of different methods.
  • the two most popular approaches are injection of DNA in saline, using a standard hypodermic needle, and gene gun delivery.
  • a schematic outline of the construction of a DNA vaccine plasmid and its subsequent delivery by these two methods into a host is illustrated at Scientific American (Weiner et al., (1999) Scientific American 281 (I): 34- 41 ).
  • Alternative delivery methods may include aerosol instillation of naked DNA on mucosal surfaces, such as the nasal and lung mucosa, (Lewis et al., (1999).
  • one or more antigenic peptides may be encoded and expressed in vivo using a viral-based system (e.g., an adenovirus system, an adeno associated virus (AAV) vector, a poxvirus, or a lentivirus).
  • a viral-based system e.g., an adenovirus system, an adeno associated virus (AAV) vector, a poxvirus, or a lentivirus.
  • the vaccine or immunogenic composition may include a viral based vector for use in a human individual in need thereof, such as, for example, an adenovirus. Plasmids that can be used for adeno associated virus, adenovirus, and lentivirus delivery are well known in the field. Typically, AAV and lentivirus delivery are widely used and comply well with the present invention.
  • a nucleic acid construct is a mammalian expression cassette, preferably human expression cassette, wherein the one or more coding sequences of the one or more antigens are operably linked to appropriate regulatory sequence(s) for their expression in an individual’s target cells or tissue(s).
  • the target cell(s) or tissue(s) is epithelial cell(s) or tissue(s).
  • sequences which are well-known in the art include in particular a promoter, and further regulatory sequences capable of further controlling the expression of a transgene, such as without limitation, enhancer, terminator and intron.
  • the expression cassette comprises a promoter; preferably further comprises one or more of an enhancer, terminator or intron.
  • the expression cassette may include a sequence coding for a KMT inhibitor, said coding sequence may be operably linked to the sequences coding for the one or more antigens or may include regulatory sequences.
  • the KMT inhibitor can be provided as a separate expression cassette.
  • the promoter may be a tissue-specific, ubiquitous, constitutive or inducible promoter that is functional in the individual’s target cells or tissue, in particular epithelial cell(s) or tissue(s).
  • constitutive promoters which can be used in the present invention include without limitation: phosphogly cerate kinase promoter (PGK), elongation factor- 1 alpha (EF-1 alpha) promoter including the short form of said promoter (EFS), viral promoters such as cytomegalovirus (CMV) immediate early enhancer and promoter (optionally with the CMV enhancer), cytomegalovirus enhancer/chicken beta actin (CAG) promoter, SV40 early promoter and retroviral 5’ and 3’ LTR promoters including hybrid LTR promoters.
  • PGK phosphogly cerate kinase promoter
  • EF-1 alpha elongation factor- 1 alpha
  • EFS short form of said promoter
  • viral promoters such as cytomegalovirus
  • CMV promoter Preferred ubiquitous promoter
  • inducible promoters which can be used in the present invention include Tetracycline-regulated promoters.
  • the promoters are advantageously human promoters, i.e., promoters from human cells or human viruses. Such promoters are well-known in the art and their sequences are available in public sequence data bases.
  • the nucleic acid construct is DNA, wherein the coding sequence of the antigen is operably linked to appropriate regulatory sequence(s) for their expression in an individual’s target cells or tissue(s) as disclosed above.
  • the DNA construct advantageously comprises a mammalian expression cassette as disclosed above.
  • the nucleic acid construct is RNA, preferably mRNA, wherein the coding sequence the antigen is operably linked to appropriate regulatory sequence(s) for their expression in an individual’s target cells or tissue(s).
  • mRNA vaccines are well-known in the art (reviewed in Jackson et ah, Vaccines, 2020, 5, 11 , doi.10.1038). mRNA is delivered into the host cell cytoplasm where expression generates the antigen of interest.
  • mRNA construct comprises a cap structure, 5’ and 3 ’untranslated regions (UTRs), and open reading frame (ORF), and a 3’poly(A) tail.
  • mRNA construct may be non-replicating mRNA (MRM) or self-amplifying mRNA (SAM).
  • SAM comprises the inclusion of genetic replication machinery derived from positive- strand mRNA viruses, most commonly alphavimses such as Sindbis and Semliki- Forest viruses.
  • the ORF encoding viral structural protein is replaced by the transcript encoding the vaccine antigen of interest, and the viral RNA-dependent RNA polymerase is retained to direct cytoplasmic amplification of the replicon construct.
  • Trans- replicating RNA are disclosed for example in WO 2017/162461 .
  • RNA replicon from alphavims suitable for gene expression are disclosed in WO 2017/162460.
  • mRNA manufacturing process uses plasmid DNA (pDNA) containing a DNA-dependent RNA polymerase promoter, such as T7, and the corresponding sequence for the mRNA construct.
  • pDNA plasmid DNA
  • the pDNA is linearized to serve as a template for the DNA-dependent RNA polymerase to transcribe the mRNA, and subsequently degraded by a DNase process step.
  • the addition of the 5 ’cap and the 3 ’poly (A) tail can be achieved during the in vitro transcription step or enzymatically after transcription.
  • Enzymatic addition of the cap can be accomplished by using guanylyl transferase and 2’-0-methyltransferase to yield a CapO(N7MeGpppN) or Capl (NTMeQpppN2 oMe) structure, respectively, while the poly-A tail can be achieved through enzymatic addition via poly-A polymerase. mRNA is then purified using standard methods
  • the antigen or epitope-encoding RNA is mono-, bi-, or multicistronic, preferably as defined herein.
  • Bi- or multicistronic RNAs typically comprise two (bicistronic) or more (multicistronic) open reading frames (ORF).
  • An open reading frame in this context is a sequence of codons that is translatable into a peptide or protein.
  • the coding sequences in a bi- or multicistronic epitope-encoding RNA preferably encode distinct epitopes (or antigens or variants or fragments thereof comprising said epitopes) as defined herein.
  • Bi- or even multicistronic epitope-encoding RNAs may encode, for example, at least two, three, four, five, six or more (preferably different) epitopes (or antigens or variants or fragments thereof comprising said epitopes) as defined herein.
  • the term “encoding two or more epitopes/pathway inhibitors” may mean, without being limited thereto, that the bi- or even multicistronic epitope-encoding RNA, may encode e.g. at least two, three, four, five, six or more (preferably different) epitopes (or antigens or variants or fragments thereof comprising said epitopes).
  • the coding sequences encoding two or more epitopes may be separated in the bi- or multicistronic RNA by at least one IRES (internal ribosomal entry site) sequence.
  • IRES internal ribosomal entry site
  • IRES internal ribosomal entry site
  • An IRES can function as a sole ribosome binding site, but it can also serve to provide a bi- or even multicistronic epitope-encoding RNA as defined above, which encodes several epitopes (or antigens or variants or fragments thereof comprising said epitopes), which are to be translated by the ribosomes independently of one another.
  • IRES sequences which can be used according to the invention, are those from picornaviruses (e.g.
  • FMDV pestiviruses
  • CFFV pestiviruses
  • PV polioviruses
  • ECMV encephalomyocarditis viruses
  • FMDV foot and mouth disease viruses
  • HCV hepatitis C viruses
  • CSFV classical swine fever viruses
  • MLV mouse leukoma virus
  • SIV simian immunodeficiency viruses
  • CrPV cricket paralysis viruses
  • the at least one coding sequence of the epitopeencoding RNA of the inventive combination may encode at least two, three, four, five, six, seven, eight and more epitopes (or antigens or variants or fragments thereof comprising said epitopes) as defined herein linked with or without an amino acid linker sequence, wherein said linker sequence can comprise rigid linkers, flexible linkers, cleavable linkers (e.g., self-cleaving peptides) or a combination thereof.
  • epitopes or antigens or variants or fragments thereof comprising said epitopes
  • epitopes may be identical or different or a combination thereof.
  • the epitope-encoding RNA comprises a length of about 50 to about 20000, or 100 to about 20000 nucleotides, preferably of about 250 to about 20000 nucleotides, more preferably of about 500 to about 10000, even more preferably of about 500 to about 5000.
  • the epitope-encoding RNA of the inventive combination may further be single stranded or double stranded.
  • the epitope-encoding RNA of the inventive combination preferably comprises a sense and a corresponding antisense strand.
  • the epitope-encoding RNA of the inventive combination is an mRNA, a viral RNA or a replicon RNA, preferably a mRNA.
  • the one or more nucleic acid of a vaccine composition may thus be provided as a “stabilized” nucleic acids, i.e. which is essentially resistant to in vivo degradation (e.g. by an exo- or endonuclease).
  • Such stabilization can be effected, for example, by a modified phosphate backbone of the epitope-encoding RNA (or any other nucleic acid, in particular RNA, as defined herein).
  • a backbone modification in connection with the present invention is a modification in which phosphates of the backbone of the nucleotides contained in said RNA (or any other nucleic acid, in particular RNA, as defined herein) are chemically modified.
  • Nucleotides that may be preferably used in this connection contain e.g. a phosphorothioate-modified phosphate backbone, preferably at least one of the phosphate oxygens contained in the phosphate backbone being replaced by a sulfur atom.
  • Stabilized epitope-encoding RNAs may further include, for example: non-ionic phosphate analogues, such as, for example, alkyl and aryl phosphonates, in which the charged phosphonate oxygen is replaced by an alkyl or aryl group, or phosphodiesters and alkylphosphotriesters, in which the charged oxygen residue is present in alkylated form.
  • non-ionic phosphate analogues such as, for example, alkyl and aryl phosphonates, in which the charged phosphonate oxygen is replaced by an alkyl or aryl group, or phosphodiesters and alkylphosphotriesters, in which the charged oxygen residue is present in alkylated form.
  • Such backbone modifications typically include, without implying any limitation, modifications from the group consisting of methylphosphonates, phosphoramidates and phosphorothioates (e.g. cytidine-5'-O-(1 -thiophosphate)). Specific modifications are described, which
  • the nucleic acid construct as above defined may comprise at least one open frame encoding for an antigenic peptide and an open frame encoding for a KMT inhibitor (typically a suv39h1 inhibitor) as previously defined.
  • LNPs are the most widely used delivery system
  • Delivery methods for RNA vaccines suitable for the present invention in particular related to LNPs have been recently review in Liu, J., Fu, M., Wang, M. et al. Cancer vaccines as promising immuno-therapeutics: platforms and current progress. J Hematol Oncol 15, 28 (2022), the content of which is summarized after).
  • LNPs are mainly composed of ionizable amino lipid-like molecules, phospholipids, cholesterol, as well as lipid-anchored PEG.
  • ionizable lipids focuses on regulating head groups, connectors, and alkyl chains to regulate acid dissociation constant (pKa), fusion properties and metabolic behavior.
  • Representative ionizable lipids include dilinoleylmethyl-4-dimethylaminobutyrate (DLin-MC3-DMA), 1 ,2-dioleoyl-sn-glycerol-3-phosphoethanolamine (DOPE).
  • DLin-MC3-DMA dilinoleylmethyl-4-dimethylaminobutyrate
  • DOPE 1 ,2-dioleoyl-sn-glycerol-3-phosphoethanolamine
  • the ideal lipid material should be metabolized and cleared quickly after mRNA delivery, thus reducing the toxic side effects caused by the carrier and allowing multiple administrations.
  • the uptake pathways of LNPs mainly contain apolipoprotein or albumin receptor-mediated endocytosis and non-specific pinocytosis.
  • LNPs have been modified to achieve targeted delivery.
  • LNPs modified with mannose could target DCs through the mannose receptor CD206 (see Beissert T, Perkovic M, Vogel A, Erbar S, Walzer KC, Hempel T, et al. A trans-amplifying RNA vaccine strategy for induction of potent protective immunity. Mol Ther. 2020;28(1 ): 119— 28).
  • LNPs prepared by chip-based microfluidic devices have the advantages of high stability and repeatability, which is beneficial to GMP production of LNPs.
  • the at least one RNA of (pharmaceutical) composition or vaccine is thus provided in a complexed form, i.e. complexed or associated with one or more (poly- )cationic compounds, preferably with (poly-)cationic polymers, (poly-)cationic peptides or proteins, e.g. protamine, (poly-)cationic polysaccharides and/or (poly-)cationic lipids.
  • the terms “complexed” or “associated” refer to the essentially stable combination of the at least one RNA (or said other nucleic acid, in particular RNA) with one or more of the aforementioned compounds into larger complexes or assemblies without covalent binding.
  • RNA (or any other nucleic acid, in particular RNA, as defined herein) is complexed or associated with lipids (in particular cationic and/or neutral lipids) to form one or more liposomes, lipoplexes, lipid nanoparticles, or nanoliposomes.
  • lipids in particular cationic and/or neutral lipids
  • RNA composition or vaccine (or any other nucleic acid, in particular RNA, as defined herein) is provided in the form of a lipid-based formulation, in particular in the form of liposomes, lipoplexes, and/or lipid nanoparticles comprising said RNA (or said other nucleic acid, in particular RNA).
  • KMT inhibitor notably the scuv39h1 inhibitor
  • the KMT inhibitor notably the scuv39h1 inhibitor
  • RNAs of the (pharmaceutical) composition or vaccine are formulated as lipoplexes, i.e. cationic lipid bilayers sandwiched between nucleic acid (e.g. (epitope-encoding) RNA or DNA) layers.
  • RNAs of the (pharmaceutical) composition or vaccine are formulated as emulsions.
  • said RNAs (and optionally inhibitor of KMT) are formulated in a cationic oil-in-water emulsion where the emulsion particle comprises an oil core and a cationic lipid which can interact with the nucleic acid(s) anchoring the molecule to the emulsion particle.
  • said RNA is formulated in a water-in- oil emulsion comprising a continuous hydrophobic phase in which the hydrophilic phase is dispersed.
  • the RNA of the vaccine composition (or any other nucleic acid, in particular RNA, as defined herein) is is complexed or associated with a cationic or polycationic compound (“(poly-)cationic compound”) and/or a polymeric carrier.
  • a cationic or polycationic compound typically refers to a charged molecule, which is positively charged (cation) at a pH value typically from 1 to 9, preferably at a pH value of or below 9 (e.g. from 5 to 9), of or below 8 (e.g. from 5 to 8), of or below 7 (e.g. from 5 to 7), most preferably at a physiological pH, e.g. from 7.3 to 7.4.
  • Poly-)cationic compounds being particularly preferred agents for complexation or association of RNA of the (pharmaceutical) composition or vaccine (or any other nucleic acid, in particular RNA, as defined herein) include protamine, nucleoline, spermine or spermidine, or other cationic peptides or proteins, such as poly-L-lysine (PLL), poly-arginine, basic polypeptides, cell penetrating peptides (CPPs), including HIV-binding peptides, HIV-1 Tat (HIV), Tat-derived peptides, Penetratin, VP22 derived or analog peptides, HSV VP22 (Herpes simplex), MAP, KALA or protein transduction domains (PTDs), PpT620, prolin-rich peptides, arginine-rich peptides, lysine-rich peptides, MPG-peptide(s), Pep-1 , L-oligomers, Calcitonin peptide(s
  • the RNA of the (pharmaceutical) composition or vaccine is complexed or associated with a polymeric carrier.
  • a “polymeric carrier” suitable to the present ivention might be a polymeric carrier formed by disulfide-crosslinked cationic components. The disulfide- crosslinked cationic components may be the same or different from each other.
  • the polymeric carrier can also contain further components.
  • compositions and methods of administration are provided.
  • compositions of the present invention are pharmaceutical compositions and formulations for administration, preferably sterile compositions and formulations.
  • a pharmaceutical composition of the disclosure generally comprises a vaccine composition and/or a KMT inhibitor in association with pharmaceutically acceptable carriers.
  • Main pharmaceutically acceptable carriers include saline, solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration.
  • Supplementary active compounds can further be incorporated into the compositions.
  • a pharmaceutical composition is formulated to be compatible with its intended route of administration.
  • the present invention therefore encompasses pharmaceutical compositions comprising an effective amount of one or more compounds according to the present invention (including a pharmaceutically acceptable salt, thereof), optionally in combination with a pharmaceutically acceptable carrier, excipient or additive.
  • the (therapeutic) agents or components i.e. the vaccine or immunogenic composition and the KMT inhibitor notably the Suv39h1
  • the two (therapeutic) components can be given as a single composition.
  • compositions may be administered once daily, twice daily, once every two days, once every three days, once every four days, once every five days, once every six days, once every seven days, once every two weeks, once every three weeks, once every four weeks, once every two months, once every six months, or once per year.
  • the dosing interval can be adjusted according to the needs of individual patients. For longer intervals of administration, extended release or depot formulations can be used.
  • compositions of the invention can be used to treat diseases and disease conditions that are acute, and may also be used for treatment of chronic conditions.
  • the compositions of the invention are used in methods to treat or prevent a neoplasia or an infectious disease.
  • the compounds of the invention are administered for time periods exceeding two weeks, three weeks, one month, two months, three months, four months, five months, six months, one year, two years, three years, four years, or five years, ten years, or fifteen years; or for example, any time period range in days, months or years in which the low end of the range is any time period between 14 days and 15 years and the upper end of the range is between 15 days and 20 years (e.g., 4 weeks and 15 years, 6 months and 20 years).
  • the patient is monitored to check the progression of the disease or disorder, and the dose is adjusted accordingly.
  • treatment according to the invention is effective for at least two weeks, three weeks, one month, two months, three months, four months, five months, six months, one year, two years, three years, four years, or five years, ten years, fifteen years, twenty years, or for the remainder of the subject's life.
  • administration of the KMT inhibitor is initiated before initiation of administration of the vaccine or immunogenic composition.
  • administration of the inhibitor is initiated after initiation of administration of the vaccine or immunogenic composition.
  • administration of the KMT inhibitor is initiated simultaneously with the initiation of administration of the vaccine or immunogenic composition.
  • Administration of KMT the inhibitor may continue every 2, 3, 4, 5, 6, 7, 8 or more weeks after the first administration of the said KMT inhibitor.
  • one or more KMT inhibitors such as a Suv39h1 inhibitor, may be administered to the patient throughout the treatment regimen.
  • administration of the KMT inhibitor such as a Suv39h1 inhibitor
  • administration of the KMT inhibitor is withheld during the week prior to administration of the vaccine or immunogenic composition.
  • administration of the KMT inhibitor is withheld during administration of the vaccine or immunogenic composition.
  • Surgical resection uses surgery to remove abnormal tissue in cancer, such as mediastinal, neurogenic, or germ cell tumors, or thymoma.
  • administration of the KMT inhibitor is initiated following tumor resection.
  • administration of a cancer vaccine or immunogenic composition is initiated 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15 or more weeks after tumor resection.
  • administration of the cancer vaccine or immunogenic composition is initiated 4, 5, 6, 7, 8, 9, 10, 11 or 12 weeks after tumor resection.
  • Prime/boost regimens refer to the successive administrations of a vaccine or immunogenic or immunological compositions.
  • administration of the vaccine or immunogenic composition is in a prime/ boost dosing regimen, for example administration of the neoplasia vaccine or immunogenic composition at weeks 1 , 2, 3 or 4 as a prime and administration of the vaccine or immunogenic composition is at months 2, 3 or 4 as a boost.
  • heterologous prime -boost strategies are used to elicit a greater cytotoxic T-cell response (see Schneider et ah, Induction of CD8+ T cells using heterologous prime-boost immunization strategies, Immunological Reviews Volume 170, Issue 1 , pages 29-38, August 1999).
  • DNA encoding antigens is used to prime followed by a protein boost.
  • protein is used to prime followed by boosting with a virus encoding the antigen.
  • virus encoding the antigen is used to prime and another virus is used to boost.
  • protein is used to prime and DNA is used to boost.
  • a DNA vaccine or immunogenic composition is used to prime a T-cell response and a recombinant viral vaccine or immunogenic composition is used to boost the response.
  • a viral vaccine or immunogenic composition is co-administered with a protein or DNA vaccine or immunogenic composition to act as an adjuvant for the protein or DNA vaccine or immunogenic composition.
  • the patient can then be boosted with either the viral vaccine or immunogenic composition, protein, or DNA vaccine or immunogenic composition (see Hutchings et al., Combination of protein and viral vaccines induces potent cellular and humoral immune responses and enhanced protection from murine malaria challenge. Infect Immun, 2007 Dec;75(l2):5SI9-26. Epub 2007 Oct 1 ))
  • fixed intermittent dosing regimen refers to repeating cycles of preplanned drug administration in which the drug is administered on one or more consecutive days (“days on”) followed by one or more consecutive days of rest on which the drug is not administered (“days off).
  • compositions can be processed in accordance with conventional methods of pharmacy to produce medicinal agents for administration to patients in need thereof, including humans and other mammals.
  • a therapeutically effective amount of one of more compounds according to the present invention may vary with the condition to be treated, its severity, the treatment regimen to be employed, the pharmacokinetics of the agent used, as well as the patient (animal or human) treated.
  • a therapeutically effective amount of one or more of the compounds according to the present invention can be intimately admixed with a pharmaceutically acceptable carrier according to conventional pharmaceutical compounding techniques to produce a dose.
  • a carrier may take a wide variety of forms depending on the form of preparation desired for administration, e.g., ocular, oral, topical or parenteral, including gels, creams ointments, lotions and time released implantable preparations, among numerous others.
  • any of the usual pharmaceutical media may be used.
  • suitable carriers and additives including water, glycols, oils, alcohols, flavoring agents, preservatives, coloring agents and the like may be used.
  • suitable carriers and additives including starches, sugar carriers, such as dextrose, mannitol, lactose and related carriers, diluents, granulating agents, lubricants, binders, disintegrating agents and the like may be used. If desired, the tablets or capsules may be enteric- coated or sustained release by standard techniques.
  • the active compound is included in the pharmaceutically acceptable earner or diluent in an amount sufficient to deliver to a patient a therapeutically effective amount for the desired indication, without causing serious toxic effects in the patient treated,
  • the vaccine or immunogenic composition and the KMT inhibitor, such as suv39h1 inhibitor, and any additional agents may be administered by injection, orally, parenterally, by inhalation spray, rectally, vaginally, or topically in dosage unit formulations containing conventional pharmaceutically acceptable carriers, adjuvants, and vehicles.
  • parenteral as used herein includes, into a lymph node or nodes, subcutaneous, intravenous, intramuscular, intrasternal, infusion techniques, intraperitoneally, eye or ocular, intravitreal, intrabuccal, transdermal, intranasal, into the brain, including intracranial and intradural, into the joints, including ankles, knees, hips, shoulders, elbows, wrists, directly into tumors, and the like, and in suppository form.
  • the vaccine or immunogenic composition and/or the KMT inhibitor are administered intravenously or subcutaneously.
  • the subject therapeutics may be local, so as to be administered at the site of interest.
  • the KMT inhibitor such as suv39h1 inhibitor
  • the KMT inhibitor is administered subcutaneously near the site of administration of the vaccine or immunogenic composition. It is to be understood by one skilled in the art administering the compositions that the concentration of the KMT inhibitor, administered to the subject may be changed based on the nature of the inhibitor, its specificity and the location of administration.
  • the combination therapy according to the present invention may be utilized in combination with at least one known other therapeutic agent, or a pharmaceutically acceptable salt of said agent.
  • a combined cancer treatment can include but is not limited to cancer chemotherapeutic agents, cytotoxic agents, hormones, anti- angiogens, radiolabelled compounds, immunotherapy, surgery, cryotherapy, and/or radiotherapy.
  • cancer chemotherapeutic agents include alkylating agents, antimetabolites, anthracyclines, topoisomerase inhibitors, microtubule inhibitors and B-raf enzyme inhibitors.
  • Alkylating agents include the nitrogen mustards (such as mechlorethamine, cyclophosphamide, ifosfamide, melphalan and chlorambucil), ethylenamine and methylenamine derivatives (such as altretamine, thiotepa), alkyl sulfonates (such as busulfan), nitrosoureas (such as carmustine, lomustine, estramustine), triazenes (such as dacarbazine, procarbazine, temozolomide), and platinum-containing antineoplastic agents (such as cisplatin, carboplatin, oxaliplatin).
  • nitrogen mustards such as mechlorethamine, cyclophosphamide, ifosfamide, melphalan and chlorambucil
  • ethylenamine and methylenamine derivatives such as altretamine, thiotepa
  • alkyl sulfonates
  • Antimetabolites include 5-fluorouracil (5-Fll), 6-mercaptopurine (6-MP), Capecitabine (Xeloda®), Cytarabine (Ara-C®), Floxuridine, Fludarabine, Gemcitabine (Gemzar®), Hydroxyurea, Methotrexate, Pemetrexed (Alimta®).
  • Anthracyclines include Daunorubicin, Doxorubicin (Adriamycin®), Epirubicin. Idarubicin.
  • Other anti-tumor antibiotics include Actinomycin-D, Bleomycin, Mitomycin- C, Mitoxantrone.
  • Topoisomerase inhibitors include Topotecan, Irinotecan (CPT-11 ), Etoposide (VP-16), Teniposide or Mitoxantrone
  • Microtubule inhibitors include Estramustine, Ixabepilone, the taxanes (such as Paclitaxel, Docetaxel and Cabazitaxel), and the vinca alkaloids (such as Vinblastine, Vincristine, Vinorelbine, Vindesine and Vinflunine)
  • B-raf enzyme inhibitors include vemurafenib (Zelboraf), dabrafenib (Tafinlar), and encorafenib (Braftovi)
  • Immunotherapy includes but is not limited to immune checkpoint modulators (i.e. inhibitors and/or agonists), cytokines, immunomodulating monoclonal antibodies, cancer vaccines.
  • immunotherapy includes administration immune checkpoint modulators. Examples include inhibitors of (e.g. antibodies that bind specifically to and inhibit activity of) PD-1 , CTLA4, LAG3, BTLA, OX2R, TIM-3, TIGIT, LAIR-1 , PGE2 receptors, and/or EP2/4 Adenosine receptors including A2AR.
  • the immune checkpoint modulators comprise anti-PD-1 and/or anti-PDL-1 inhibitors (e.g., anti-PD-1 and/or anti-PDL-1 antibodies).
  • the combined cancer treatment is cell therapy an comprise administration of immune cell engineered to express one or more antigen receptors against one or more antigens.
  • the said one or more antigens are also included in the vaccine composition.
  • Well-suited cell therapy are typically described in WO2018234370A1 , W02021013950A1 or WO2023126458A1 , the content of which is included herein by reference in their entirety.
  • compositions of the invention are administered in combination with a KMT inhibitor to a patient in an amount sufficient to elicit an immune response, typically a cell mediated immune response, more particularly a T cell mediated response and notably an effective CTL response to the pathogen or tumor antigen and to cure or at least partially arrest symptoms and/or complications.
  • An amount adequate to accomplish this is defined as “therapeutically effective dose.” Amounts effective for this use can depend on, e.g., the vaccine composition the KMT inhibitor, the manner of administration, the stage and severity of the disease being treated, the weight and general state of health of the patient, and the judgment of the prescribing physician.
  • the patient's response and condition can be monitored by measuring specific CTL activity in the patient's blood to adapt doses and administration regimen.
  • the present invention provides methods of stimulating, enhancing or raising an immune response against an infectious disease or a tumor in an individual, said method comprising administering a vaccination regimen and an immune stimulation regimen to the individual; wherein the immune stimulation regimen comprises administration of KMT inhibitor, preferably wherein the KMT inhibitor is a Suv39H1 inhibitor; wherein the immune stimulation regimen and the vaccination regimen are administered sequentially in any order or simultaneously,
  • the vaccination regimen comprises the administration of a vaccine composition as previously defined.
  • the invention also provides a method of raising an immune response to an antigen or enhancing or augmenting an immune response to an antigen in an individual, comprising administering to the individual an effective amount of KMT inhibitor; typically, wherein an immune function or immune health of the individual is improved;
  • the invention also pertains to a method of treating and/or preventing an infectious disease or a tumor in an individual, said method comprising the administration to the individual of a medical preparation comprising:
  • first and second components can be administered sequentially in any order or simultaneously.
  • the invention also encompasses a method of treating and/or preventing a disease, disorder or condition associated with the expression or the elevated expression of an antigen in an individual, optionally wherein the disease is an infectious disease or a neoplastic disease (tumor), said method comprising the administration to the individual of:
  • first and second components can be administered sequentially in any order or simultaneously.
  • the immune response is a response again one or more pathogen or tumor antigens as herein described.
  • the immune response typically includes a cell-mediated immune response, notably a T cell response, notably a T cell response, notably a CTL response.
  • the methods of the invention lead to an increased neoplasia/tumor specific immune response in a subject, and are aimed at treating and or alleviating a symptom of cancer in a subject.
  • compositions may be used for a patient that has been diagnosed as having cancer, or at risk of developing cancer.
  • the described combination of the invention is administered in an amount sufficient to induce a CTL response.
  • Administration of a KMT inhibitor may allow to reduce vaccination regimen and/or to increase and or extend immune response notably the immune response associated with particular type of antigen, such as antigen that have a low affinity and/or are expressed at low expression levels. This might be of high relevance for tumor specific antigen derived from dark or grey genome.
  • the composition, medical preparation and methods of the invention prevent and or limit recall infection or tumor relapse.
  • Patients may be screened before administration and after the administration of the compositions described herein.
  • Patients may undergo screening assessments that document historical health status as well as their current and future health status in general and as related to their underlying disease.
  • the screening assessments may include tests like vital signs (including diastolic and systolic blood pressure, heart rate, temperature, weight, and height), electrocardiograms, symptom directed physical exam, hematology (including hematocrit, hemoglobin, RBC count, WBC count with differential, and platelet count), chemistry (including tests for glucose, urea nitrogen, creatinine, sodium, potassium, calcium, total and direct bilirubin, AST, ALT, alkaline phosphatase, lactate dehydrogenase (LDH), and adrenocorticotropic hormone), liver function tests (such as detecting levels of AST, ALT, total and direct bilirubin), pregnancy testing, CT or MRI, surgical or core needle biopsy of a primary or metastatic tumor site for DNA and RNA
  • Biopsies may be used to evaluate the presence of T-cell infiltrates in the tumor and their localization with respect to tumor margins by tests like immunohistochemistry, western blot analysis, RNA and DNA analysis. The presence of tumor-associated macrophages and DCs within the tumor micro-environment may also be evaluated.
  • the list of markers for analysis may include, but not be limited to, the following: CD3, CD4, CD8, CD45RO, PD-L1 , PD-I, FoxP3, Granzyme B, Perforin, CD68, CD163, MHC Class I, MHC Class II, CD83 AND CD1 lb.
  • Immune response parameters may be analyzed for changes over time from baseline levels before the administration of the treatments and may include summaries of characterization of nucleic acids (e.g., DNA mutations, transcript abundance), histopathology, and immune cell analyses in tissues obtained at the Pretreatment, Prevaccination Treatment, and Vaccination Treatment phases as well as at the time of preliminary assessment. Reporting the test results may include tables depicting shifts from earlier time points in order to compare changes in immune parameters. Descriptive statistics and frequency distributions may be used as appropriate. Immunological analyses may include summaries for CD8+ and CD4+ T-cell response measured by ex vivo IFN-g ELISpot and assessed through spot counts. Analyses can be used to assess changes from pretreatment to pre-vaccination treatment to vaccination treatment to preliminary assessment.
  • Reporting may include medians and inter-quartile ranges, as well as tables depicting shifts from earlier time points for each patient. Additionally, nonparametric tests (e.g., Wilcoxon signed-rank test) may be used to determine differences in the ELISpot data between time points as appropriate. Fold changes in biomarkers measured on a continuous scale may be summarized and compared across response categories using the Wilcoxon rank-sum test between treatment arms for every cohort. For multi-gene assays, genes may be grouped into analysis sets to characterize biological functions of the cells as appropriate.
  • Tests and results may include a detailed characterization of the phenotype and abundance of antigen-specific T cells, both in the periphery and in the tumor microenvironment.
  • the abundance of regulatory cells such as regulatory T cells or myeloid-derived suppressor cells, and T-cell recognition, activation, and cytotoxicity may also be evaluated with PBMCs and tumor cells.
  • ex vivo induction of neoantigen T-cell responses may also be performed on peripheral blood and leukopheresis samples. Presence of circulating tumor DNA (ctDNA) and vaccinespecific antibody responses may be evaluated after treatment with the compositions described herein.
  • compositions and methods may be used on patients in need thereof with any cancer according to the general flow process comprising subject identification, collecting informed consent and pre-screening the patients. Patients can then undergo an assessment of the specific type of cancer and the mutations causing the cancer.
  • the nucleic acid material collected from a patient may be used for exome sequencing (tumor and normal tissue), RNA sequencing for the preparation of specific personalized vaccine.
  • Patients in need thereof may receive a series of priming vaccinations with a mixture of personalized tumor-specific peptides. Additionally, over a 4 week period the priming may be followed by two boosts during a maintenance phase. All vaccinations are subcutaneously delivered.
  • the vaccine or immunogenic composition is evaluated for safety, tolerability, immune response and clinical effect in patients and for feasibility of producing vaccine or immunogenic composition and successfully initiating vaccination within an appropriate time frame.
  • the first cohort can consist of 5 patients, and after safety is adequately demonstrated, an additional cohort of 10 patients may be enrolled. Peripheral blood is extensively monitored for peptidespecific T-cell responses and patients are followed for up to two years to assess disease recurrence.
  • the subject receiving the inventive combination, (pharmaceutical) composition or vaccine according to the invention may be a patient with cancer, preferably as defined herein, or a related condition, receiving chemotherapy (e.g. first- line or second-line chemotherapy), radiotherapy, chemoradiation (combination of chemotherapy and radiotherapy), tyrosine kinase inhibitors (e.g. EGFR tyrosine kinase inhibitors), antibody therapy and/or inhibitory and/or stimulatory checkpoint molecules (e.g. CTLA4 inhibitors), or a patient, who has achieved partial response or stable disease after having received one or more of the treatments specified above.
  • the subject receiving the inventive combination, (pharmaceutical) composition or vaccine according to the invention may be a patient with an infectious disease, preferably as defined herein, receiving antibiotic, antifungal or antiviral therapy.
  • the present invention thus also relates to the use of the inventive combination, for supporting another therapy of cancer or an infectious disease.
  • Support of the treatment or prophylaxis of cancer may be any combination of a conventional cancer therapy method of such as surgery, radiation therapy, chemotherapy (e.g. first-line or second-line chemotherapy), chemoradiation, treatment with tyrosine kinase inhibitors, treatment with inhibitory and/or stimulatory checkpoint molecules, preferably CTLA4 inhibitors, antibody therapy or any combination of these, and a therapy using the inventive combination, (pharmaceutical) composition or vaccine as defined herein.
  • inventive combination, (pharmaceutical) composition or vaccine according to the invention may be accomplished prior to, simultaneously and/or subsequently to administering another therapeutic or subjecting the patient to another therapy that is useful for treatment of the particular disease or condition to be treated.
  • the inventive combination is used for treatment or prophylaxis of cancer.
  • cancer refers to a neoplasm characterized by the uncontrolled and usually rapid proliferation of cells that tend to invade surrounding tissue and to metastasize to distant body sites.
  • the term encompasses benign and malignant neoplasms. Malignancy in cancers is typically characterized by anaplasia, invasiveness, and metastasis; whereas benign malignancies typically have none of those properties.
  • the terms includes neoplasms characterized by tumor growth as well as cancers of blood and lymphatic system.
  • cancers that can be treated with the inventive combination, (pharmaceutical) composition or vaccine include Acute Lymphoblastic Leukemia, Adult; Acute Lymphoblastic Leukemia, Childhood; Acute Myeloid Leukemia, Adult; Adrenocortical Carcinoma; Adrenocortical Carcinoma, Childhood; AIDS-Related Lymphoma; AIDS-Related Malignancies; Anal Cancer; Astrocytoma, Childhood Cerebellar; Astrocytoma, Childhood Cerebral; Bile Duct Cancer, Extrahepatic; Bladder Cancer; Bladder Cancer, Childhood; Bone Cancer, Osteosarcoma/Malignant Fibrous Histiocytoma; Brain Stem Glioma, Childhood; Brain Tumor, Adult; Brain Tumor, Brain Stem Glioma, Childhood; Brain Tumor, Cerebellar Astrocytoma, Childhood; Brain Tumor, Cerebral Astrocytoma/Malignant Glioma, Childhood; Brain
  • Vulvar Cancer Waldenstrom's Macro globulinemia; and Wilms' Tumor.
  • the inventive combination, pharmaceutical composition or kit may also be used for treating infectious diseases.
  • infectious diseases or “infectious disease” relates to the invasion and multiplication of microorganisms such as bacteria, viruses, and parasites that are not normally present within the body.
  • An infection may cause no symptoms and be subclinical, or it may cause symptoms and be clinically apparent.
  • An infection may remain localized, or it may spread through the blood or lymphatic system to become systemic.
  • Infectious diseases in this context preferably include viral, bacterial, fungal or protozoological infectious diseases.
  • infectious diseases that can be treated with the inventive combination, (pharmaceutical) composition or vaccine include Acinetobacter infections, African sleeping sickness (African trypanosomiasis), AIDS (Acquired immunodeficiency syndrome), Amoebiasis, Anaplasmosis, Anthrax, Appendicitis, Arcanobacterium haemolyticum infections, Argentine hemorrhagic fever, Ascariasis, Aspergillosis, Astrovirus infections, Athlete's foot, Babesiosis, Bacillus cereus infections, Bacterial meningitis, Bacterial pneumonia, Bacterial vaginosis (BV), Bacteroides infections, Balantidiasis, Baylisascaris infections, Bilharziosis, BK virus infections, Black piedra, Blastocystis hominis infections, Blastomycosis, Venezuelan hemorrhagic fever, Borrelia infectionss (Borreliosis), Botulism (Acine
  • kits containing any one or more of the elements discussed herein to allow administration of the combination therapy Elements may be provided individually or in combinations, and may be provided in any suitable container, such as a vial, a bottle, or a tube.
  • the kit includes instructions in one or more languages, for example in more than one language.
  • a kit comprises one or more reagents for use in a process utilizing one or more of the elements described herein.
  • Reagents may be provided in any suitable container.
  • a kit may provide one or more delivery or storage buffers.
  • Reagents may be provided in a form that is usable in a particular process, or in a form that requires addition of one or more other components before use (e.g.
  • a buffer can be any buffer, including but not limited to a sodium carbonate buffer, a sodium bicarbonate buffer, a borate buffer, a Tris buffer, a MOPS buffer, a HEPES buffer, and combinations thereof.
  • the buffer is alkaline.
  • the buffer has a pH from about 7 to about 10.
  • the kit comprises one or more of the vectors, proteins and/or one or more of the polynucleotides described herein. The kit may advantageously al low the provision of all elements of the systems of the invention.
  • Kits can involve vector(s) and/or particle(s) and/or nanoparticle(s) containing or encoding nucleic acids (typically RNAs)(s) for 1 -50 or more antigens to be administered to an animal, mammal, primate, rodent, etc., with such a kit including instructions for administering to such a eukaryote; and such a kit can optionally include any of the anti-cancer agents described herein.
  • the kit may include any of the components above (as well as instructions for use with any of the methods of the present invention.
  • kits may comprise ready to use components that are mixed and ready to administer.
  • a kit contains a ready to use immunogenic or vaccine composition and a ready to use KMT inhibitor.
  • the ready to use immunogenic or vaccine composition may comprise separate vials containing different pools of immunogenic compositions.
  • the immunogenic compositions may comprise one vial containing a viral vector or DNA plasmid and the other vial may comprise immunogenic protein.
  • the ready to use KMT inhibitor may comprise a cocktail of KMT inhibitors or a single KMT inhibitor agent or component.
  • a kit may contain a ready to use KMT inhibitor and an immunogenic composition or vaccine in a ready to be reconstituted form.
  • the immunogenic or vaccine composition may be freeze dried or lyophilized.
  • the kit may comprise a separate vial with a reconstitution buffer that can be added to the lyophilized composition so that it is ready to be administered.
  • the buffer may advantageously comprise an adjuvant or emulsion according to the present invention.
  • the kit may comprise a ready to reconstitute KMT inhibitor and a ready to reconstitute immunogenic composition or vaccine. In this aspect both may be lyophilized.
  • separate reconstitution buffers for each may be included in the kit.
  • the buffer may advantageously comprise an adjuvant or emulsion according to the present invention.
  • the kit may comprise single vials containing a dose of immunogenic composition and KMT inhibitor agent that are administered together.
  • multiple vials are included so that one vial is administered according to a treatment timeline.
  • One vial may only contain the KMT inhibitor agent or component for one dose of treatment, another may contain both the KMT inhibitor agent or component and immunogenic composition for another dose of treatment and one vial may only contain the immunogenic composition for yet another dose.
  • the vials are labeled for their proper administration to a patient in need thereof.
  • the immunogen or KMT inhibitor agent or component of any embodiment may be in a lyophilized form, a dried form or in aqueous solution as described herein.
  • the immunogen may be a live attenuated virus, protein, or nucleic acid as described herein.
  • inventive combination may also be used in combination therapy. Any other therapy useful for treating or preventing the diseases and disorders defined herein may be combined with the uses and methods disclosed herein.
  • Immunological memory is based on the capacity of immune cells to adapt to previously encountered pathogens.
  • Three basic features of T cells are key for this adaptation: 1 ) antigen mediated clonal expansion, which biases the T cell repertoire to pathogens encountered previously, 2) epigenetic landscape remodeling that accelerates acquisition of effector functions, and 3) T cell redistribution to peripheral tissues, that maximizes the chances of early pathogen re-encounter.
  • Central memory (TCM) cells are predominantly found in blood and secondary lymphoid organs, express lymphoid homing molecules such as CCR7 and CD62L, and are characterized by multipotency and a high proliferative capacity upon antigen reencounter.
  • TRM cells Effector memory (TEM) cells, patrol the blood and are characterized by high cytotoxic capacity upon renewed TCR signaling.
  • TRM cells reside in non-lymphoid tissues, and do not recirculate through blood.
  • TRM cells downregulate tissue egress markers such as S1 PR1 and CCR7 and, very often but not always, constitutively express tissue retention molecules such as CD69. They provide local protection upon reinfection 456 constitute a large proportion of the CD8 + T-cell memory population 7 and are among the first to respond during secondary antigen encounters 5 .
  • TRM differentiation Both activation signals during priming and tissue-derived signals are important for TRM differentiation, maturation, and persistence 8 .
  • Fate decisions in the TRM linage occur in tissues (model of local divergence), or at the priming sites (systemic divergent model 1 ), leading to a pool of TRM-poised T cells in the lymphoid compartment.
  • TRM precursors are already present in tissues during the effector phase of immune responses.
  • the precise nature of the TRM precursors and their relationship to TCM is still a matter of debate 1 .
  • the differentiation of all T cell memory subtypes is accompanied by profound changes in the epigenetic landscape that maintain memory gene expression programs 1415 .
  • Studies on epigenetic changes during TRM formation revealed both shared and tissue-specific epigenetic signatures 16 . Some of these changes occur early during immune responses, supporting the existence of poised T RM precursors among tissue homing effector cells 17 .
  • the role of specific epigenetic regulators or chromatin modifiers in TRM formation is still
  • SUV39H1 Through its KMT activity, SUV39H1 has essential roles in heterochromatin formation and spreading 2425 26 and is one of the most conserved epigenetic silencing systems, even more than DNA methylation 25 .
  • H3K9me3 is important for silencing lineage-inappropriate genes 27 and for establishing linage cell identity during embryogenesis 28 , as well as an impediment to differentiated cells reprograming 29 .
  • Previous work from the inventors showed that H3K9me3 and SUV39H1 silence Th1- related genes during CD4 + T cell commitment to Th2 cells 22 .
  • mice virus strains and cell lines C57BL/6J male mice were obtained from Charles River and used at 6-10 weeks of age.
  • Suv39h1tm1 Jnw C57BL/6J (Suv39h1-KO) mice were kindly provided by T. Jenuwein and previously described (Peters, A. H. et al. Loss of the Suv39h histone methyltransferases impairs mammalian heterochromatin and genome stability. Cell 107, 323-337 (2001 ).), were backcrossed with C57BI6/J mice for at least nine generations.
  • mice were housed in Curie Institute SPF animal facilities. Live animal experiments were performed in accordance with the guidelines of the Ministere de I’ complicat superieur, de la terme et de innovation (Project authorization: APAFIS #34372- 2021121522311823 v1 ).
  • Influenza A/HKX31 (H3N2) and A/PR8 (H1 N1 ) virus were purchased from Charles River. Influenza A/HKX31 (H3N2) and A/PR8 (H1 N1 ) virus expressing the OVA peptide SIINFEKL, (X31-OVA and PR8-OVA, respectively) were kindly provided by Dr. Stephen Turner and Dr. Richard Webby (Jenkins MR, Webby R, Doherty PC, Turner SJ. Addition of a Prominent Epitope Affects Influenza A Virus-Specific CD8 + T Cell Immunodominance Hierarchies When Antigen Is Limiting. J Immunol. 1 sept 2006;177(5):2917-25).
  • B16F10-expressing OVA B16F10-OVA
  • Luciferase B16F10-OVA- Luc
  • Tissue homing and circulating cells were distinguished by intravascular staining as previously described 32 . Briefly, 15 ug of CD45.1-PE, CD45.1-APC, CD45.2-PE, CD45.2-APC, CD8a-PE or CD8a-APC in 100 ul of PBS were injected intravenously in the retroorbital sinus between 3’ and 5’ before killing the mice.
  • lungs were digested using GentleMACS® tissue dissociator (Milteny) in CO2 independent medium (Gibco 18045-054) with DNAse I 0,1 mg/ml (Roche 11-284-932-001 ) and Liberase® 0,1 mg/ml (Roche 05-401- 020-001 ).
  • lELs small intestinal epithelium
  • small gut was dissected from the caecum to the stomach, Peyer’s patches were removed, and the tissue was cut longitudinally and washed of luminal contents.
  • the tissue was then cut into 0.5-cm pieces that were incubated while shaking in Hanks’ balanced salt solution (HBSS) without Ca2+ and Mg2+ (Gibco 14185-052) with EDTA 5 mM (Invitrogen 15575-038), FBS (Eurobio) 10% and DTT 1 mM (Euromedex 0006-b) at 37°C 3 times for 20’ and 1 time in HBSS without Ca2+ and Mg2+ for 20’. Cells within the supernatant were collected.
  • HBSS Hanks’ balanced salt solution
  • FBS Eurobio
  • DTT 1 mM Euromedex 0006-b
  • Liver was scratched using a 100 pM cell strainer (Falcon 352360) and a syringe plunge in PBS (Eurobio CS1 PBS01-01 ) supplemented with EDTA 2 mM (Invitrogen 15575- 038) and BSA 0.5% (Sigma-Aldrich A7906) -FACS buffer-.
  • PBS Eurobio CS1 PBS01-01
  • EDTA 2 mM Invitrogen 15575- 038
  • BSA 0.5% Sigma-Aldrich A7906
  • Lymphocytes from digested lung, lELs, LP, skin and liver samples were enriched by 40%/80% Percoll® (Sigma-Aldrich) gradient 63 .
  • Mediastinal, inguinal, and mesenteric lymph nodes and spleen were scratched using a 40 pM cell strainer (Falcon 352340) and a syringe plunge in CO2 independent medium (Gibco 18045-054) supplemented with 10% FBS (Eurobio).
  • cells were fixed in 2% PFA (Electron Microscopy Sciences) during 20’ at room temperature.
  • Cell suspensions were analyzed in a BD FacsVerse or a BD LSRFortessa cytometer. Data was analyzed by Flowjo 10 software version: 10.8.0.
  • naive CD8+ T cells were enriched using the naive CD8+ T-cell isolation kit (Miltenyi Biotec, 130-096-543) according to manufacturer’s instructions.
  • 1 x 106 or 5x104 cells of a 1 :1 mix of Suv39H1 KO and WT naive CD8+ T cells were adoptively transferred into Rag-KO or C57BL/6J male mice respectively. Cells were transferred intravenously by retroorbital injection. 24 h later, C57BL/6J mice were infected with the influenza virus strain X31- OVA.
  • TRM precursors Adoptive transfer of TRM precursors was made from lung tissue. Mice were injected with PE CD8 a Monoclonal Antibody (53-6.7, Ficher Scientific) as described before euthanasia. Lungs were digested as previously described and pooled enriched lymphocytes were stained with Acqua LIVE/DEADTM Fixable Cell Stain Kit (Fisher Scientific L34957), eFluor 450 CD45.1 (A20, Fisher Scientific), PerCP-Cy5.5 CD8 a (53-6.7, BD), FITC anti-mouse Ly-6C (HK1.4, Biolegend), PE-CF594 TCR p Chain (H57-597, BD), PE/Cyanine7 anti-mouse CD49d Antibody (R1-2, Biolegend), APC Mouse anti-Mouse CD45.2 (104, BD), APC-R700 Rat Anti-Mouse CD44 (IM7, BD), APC/Cyanine7 anti-mouse CD62L Anti
  • WT or SUV39H1 KO Total iv-, CD49d+/Ly6c- or CD49d+/Ly6c+ populations were FACS sorted from pooled lungs. Between 2x10 ⁇ 4 and 4x1 ⁇ ⁇ 4 cells of each population of a 1 :1 mix of Suv39H1 KO and WT cells were adoptively transferred. Cells were transferred intravenously by retroorbital injection
  • mice were infected by intranasal instillation with a sublethal dose of Influenza PR8 (5x10 5 EID50), X31 (2x10 5 EID50) or X31-OVA (2x10 5 TCID50) in 20 or 40 ul of PBS in the left nostril. Control group mice were instilled intranasally with PBS. In some experiments, 28 days after the first infection, mice were infected with a lethal dose of PR8 (2x10 6 -200-EID50). All infections were performed on anesthetized mice with ketamine (100mg/kg, Merial) and xylazine (7,5mg/kg, Bayer) in PBS administered intraperitoneally. The humane endpoint was defined by a maximum of 30% weight loss and additional clinical signs of distress.
  • Specific T aqMan probe for PA protein was designed using the AllelelD software (Premier Biosoft) using default parameters. Custom TaqMan probe (CCAAGTCATGAAGGAGAATACCGCT) was ordered from Fisher Scientific, and primers (Forward Primer: CGGTCCAAATTCCTGCTGA; Reverse primer: CATTGGGTTCCTTCCATCCA) were from Eurogentec.
  • TaqMan assays (20*) were prepared by mixing 5pl of TaqMan probe, 18 ⁇ l of each primer, and 59 ⁇ l of ddH 20.
  • Glyceraldehyde-3-phospha tedehydrogenase (GAPDH) and hypoxanthine-guanine phsphoribosyl-transferase (HPRT1 ) TaqMan assays (Fisher Scientific) were used as housekeeping gene controls.
  • qRT-PCR was performed in 384-well plates, using dTTP MasterMix (Eurogentec), according to the manufacturer ’s instructions (for each well, 0.5 pl of TaqMan assay, 5 ⁇ l of Mastermix , and 4.5 pl of cDNA). Amplification was performed as recommended by the manufacturer, on Roche LightCycler 480, and the relative quantification tool from the analysis software was applied. Data were analyzed using Microsoft Excel to calculate AC t and further analyzed in GraphPadPrism.
  • cells were diluted at 10x10 6 cells par ml of a solution of 5 pM of Cell Trace Violet in PBS during 15min 37C and then washed with complete medium [RPMI, 100 mM Hepes, 2 mM Glutamax, 50 uM 2-mercaptoethanol, 100 U/100 ug/ml Penicillin/Streptomycin, 1x MEM Non-essential amino acids, 1 mM Sodium Pyruvate (all Gibco, Thermo Fisher), 10% SBF (Eurobio).
  • complete medium [RPMI, 100 mM Hepes, 2 mM Glutamax, 50 uM 2-mercaptoethanol, 100 U/100 ug/ml Penicillin/Streptomycin, 1x MEM Non-essential amino acids, 1 mM Sodium Pyruvate (all Gibco, Thermo Fisher), 10% SBF (Eurobio).
  • 1x10 4 or 1x10 5 CTV-stained naive OTI CD8+ T cells were incubated for different time points with 2.5x10 4 or 2.5x10 5 splenocytes from CD3-KO mice preloaded with the indicated concentration of peptides (SIINFEKL, SIITFEKL or SIIVFEKL, GeneCust) in complete medium for the indicated periods of time. Then cells were stained for surface antibodies and analysed by FACS.
  • SUV39H1 KO (CD45.1/1 ) and WT (CD45.1/2) OTI cells were adoptively transferred into Rag KO mice and 34 days after transfer mice were stained with CD45.1-PE antibody intravenously and euthanized 5’ after injection as indicated above.
  • Enriched lung leucocytes were stained with the following antibodies: CD8a-PerCP, TCRb- PECy7, CD4-FITC, CD45.2-APC, B220-eF450, MHCII-eF450, Nkp46-V450 and DAPI.
  • the following cell populations were sorted in a FACSAria FACS sorter: WT iv+ (CD45.1 +/CD45.2+), WT iv- (CD45.1-/CD45.2+), KO iv+ (CD45.1 +, CD45.2-), KO iv- (CD45.1-, CD45.2-) from 6 mice and pooled by population.
  • RNA samples from each population were pooled and then subjected to 10X single cell RNA seq library preparation targeting 1x10 4 total cells.
  • the single-cell library method used was the Chromium Single Cell v3 with single-indexing.
  • the RNA samples and antibody derived tag (ADT/HTO) samples were pooled separately. RNA samples were sequenced to a depth of 100,000 reads/cell on a NovaSeq S4.
  • RNA and TCRb sequencing from ex-vivo naive, memory and Trm populations secondary lymphoid organs (mesenteric, axillary, inguinal, brachial, cervical and lumbar lymph nodes and spleen) from Suv39H1-KO or WT male mice were collected, pooled, homogenized into single cell suspensions and stained with CD4-V500, CD44- PerCPCy5.5, TCRb-FITC, CD122-PE, CD8a-APC-Cy7 and DAPL Liver leucocytes were enriched as described before and stained with CD4-V500 CD69-PerCPCy5.5, Ly6c-AF488, TCRb-PECy7, CD8-APCCy7 and DAPL Naive (DAPI- /CD8a+/TCRb+/CD4-/CD44-/CD122-), and memory (DAPI-/CD8a+/TCRb+/CD4- /CD44+/CD122+) CD8 +
  • RNA sequencing cDNA library was prepared using a SMART-Seq v4 Ultra Low Input RNA kit (Takara) according to manufacturer’s instructions. Libraries were quantified by Qubit fluorometric quantification (Invitrogen) with dsDNA HS (High Sensitivity) Assay Kit and size distribution was determined by Agilent High Sensitivity DNA Kit. 100bp paired-end sequencing was performed on an Illumina NovaSeq - S1 . For TCRb sequencing, libraries were prepared from purified total RNA using iRepertoire kit for TCRb mouse sequencing according to manufacturer’s instructions. 150bp paired-end sequencing was performed on an Illumina MiSeq - nanoV2-300 with 10% PhiX.
  • RNA sequencing from in vitro activated cells cells were stained with DAPI, CD8a-PE and TCRb5 APC and DAPI-/CD8a+/TCRb+ cells were FACS sorted in a FACSAria Fusion directly into buffer RLT (Qiagen) supplemented with 2- mercaptoethanol (Sigma-Aldrich) and frozen at -80 C.
  • Total RNA was isolated using RNeasy Plus Micro kit (Qiagen 74004) according to the manufacturer’s instructions.
  • RNA was quantified by NanoDrop (Thermo-Fisher) and size distribution was analyzed by using Agilent RNA 6000 Nano kit (Agilent).
  • mRNA sequencing libraries were prepared from 100ng of total RNA using the Stranded mRNA Prep Ligation library preparation kit (Illumina), which allows to perform a strand specific sequencing.
  • This protocol includes a first step of polyA selection using magnetic beads to focus sequencing on polyadenylated transcripts. After RNA fragmentation, cDNA synthesis was then performed and resulting fragments were used for dA-tailing followed by ligation of RNA Index Anchors. PCR amplification with indexed primers (IDT for Illumina RNA UD Indexes) was finally achieved, with 15 cycles, to generate the final cDNA libraries.
  • IDT Illumina RNA UD Indexes
  • RNA-seq fastq reads were mapped to reference mouse genome mm10 using STAR (v2.7.1.a). Gene expression was quantified using featurecounts from Subread (v1.6.4) with Gencode mouse genes annotations (gtf file release M22, GRCm38.p6) and default parameters. Genes raw counts matrices were imported to R (v4.2.1 ). TPM and FPKM normalized expression values were calculated using calculateFPKM and calculateTPM functions from scuttle R package (version 1 .8.4). Low expressed genes were filtered out using a threshold of 0.5 FPKM. Only genes expressed above this threshold in all samples from at least 1 condition were retained. Count normalization and differential expression analyses were performed using DESeq2 R package (version 1.36.0).
  • GSEA Gene Set Enrichment Analyses
  • RNA-seq fastq reads for gene expression were processed using the Cell Ranger Single Cell Software Suite (v3.1 .0) to perform quality control, barcode and UMI processing, and single cell 3' gene counting. Reads were mapped to mm10 transcriptome (v3.0.0). HTO (hashtag oligos) sequencing reads defining sample of origin and ADT (antibody-derived tags) sequencing reads assessing cell surface protein expression were processed using CITE-seq count (v1 .4.5). Single cell gene expression data were imported within R (v4.2.1 ) and downstream analyses were performed using Seurat R package (v4.3.0.1 ). Cells with less than 200 features expressed and/or more than 10% of mitochondrial content were filtered out.
  • ADT and HTO processed data from CITE-seq count were then imported in the Seurat object in two new assays.
  • HTO data were demultiplexed with Seurat function HTODemux to assess sample of origin of each cell (blood-KO, blood-WT, tissue-KO, tissue-WT). Only singlet cells were kept for downstream analysis while cells positive for two or more hashtag oligos (doublets) and cells negative for all hashtag oligos were removed.
  • counts from the ADT assay were normalized using the CLR method and used in downstream analyses to support annotation of the clusters defined by gene expression.
  • the 5000 most variable genes were scaled and used to compute Principal Component Analysis (PCA).
  • Trajectory analysis was performed using R tools suite dynverse (dyno vO.1.2, dynmethods v1.0.5, dynwrap 1.2.4, dynguidelines v1.0.1 , dynfeature 1.0.1 , dynplot 1.1.2, dynutils 1.0.11 , dynparam 1.0.2, dyndimred 1.0.4).
  • Differentially expressed genes excluding genes from the cell cycle cluster were used for the input matrix in the trajectory analysis.
  • slingshot slingshot (ti_slingshot) was used as the trajectory inference method within infer_trajectory function from dynwrap.
  • ps c is the proportion of sample s in cluster c
  • pc s is the proportion of cluster c in sample s
  • ps is the proportion of sample s among the whole lung
  • po is the proportion of cluster c in sample i.
  • Heatmaps, barplots, violin plots, dotplots, scatter plots, LIMAP representations and volcano plots of single cell and bulk sequencing data were computed within R (v4.2.1 ) using R packages ggplot2 (v3.4.4), Seurat (v4.3.0.1 ), ComplexHeatmap (v2.14.0), scvelo (vO.2.5) and dynplot (v1 .1 .2).
  • Statistical analysis and other plots were made by GraphPad Prism version 10.11. Plots were exported into Affinity Designer version 1 .10.8 to build the figures.
  • Total CD3+ T cells were purified from peripheral blood mononuclear cells (PBMCs), isolated from anonymous healthy donor leukapheresis rings (provided by EFS-Etablatorium Francais du Sang), by density gradient centrifugation using Lymphoprep.
  • PBMCs peripheral blood mononuclear cells
  • Naive CD45RA+CCR7+CD27+
  • Central Memory CD45RA-CCR7+CD27+
  • Effector Memory CD45RO-CCR7-
  • SUV39H1 inactivation by Crispr/Cas9 was performed in the sorted and bulk populations as follows: T cells were plated at a concentration 106 cells /ml using X- VIVO 15 media supplemented with 5 % human serum (Sigma Aldrich) and 0.5 pM p- mercaptoethanol, and stimulated with Dynabeads human T-Activator CD3/CD28 in a ratio of 1 bead per cell. Cells were recovered from the cultures 48 hours after and then subjected to magnetic removal of activation beads. We used a duplex (crRNA:tracrRNA) guide RNA format, which was generated by annealing at equimolar concentrations to form the duplex at 95 °C for 5 min.
  • crRNA:tracrRNA duplex guide RNA format
  • RNPs were then formed by combining precomplexed duplex (crRNA:tracrRNA) with Hifi Cas9 Nuclease V3 (IDT) at a molar ratio of 3:1 and incubating them 10 min at room temperature. Nucleofection was done with P3 Primary Cell 4D-Nuleofector® X kit S adding between 2 x 106 cells with 10 pg of Cas9 in 5 pl of RNP and 20 pl of nucleofection solution. After electroporation using the EO-115 program (4D-Nucleofector Core Unit, Lonza), 200 pl of complete X-VIVO 15 with 500 lU/ml rhlL-2 was added to each reaction and cells were cultured at 32°C.
  • crRNA:tracrRNA Hifi Cas9 Nuclease V3
  • IDT Hifi Cas9 Nuclease V3
  • SUV39H1 inactivation efficiency was tested indirectly by looking into the levels of H3K9me3, which were reduced in SUV39H1-KO T cells produced from all 3 sorted populations.
  • FIG 1 the results show that naive T cells from SUV39H1 -deficient mice show increased initial response, more particularly figure 1 D illustrates that naive T cells deficient for Suv39h1 exhibit and increased response at lower antigen load or at lower antigen affinity as compared to naive wild type T cells.
  • FIG. 3 shows that Suv39h1 deficient mice have increased memory population at homeostatic state, in particular the results shows that the numbers of central memory T cells (CD44+CD62L+) is increased in lymphoid organs (e.g., spleen, lymph nodes) while Effector Memory T cells (CD44+CD62L-) are more elevated in tissues (e.g., liver). Moreoever the results show an increased numbers of CD69+ tissues resident T cells in Suv39h1 KO mice.
  • CD44+CD62L+ central memory T cells
  • lymphoid organs e.g., spleen, lymph nodes
  • Effector Memory T cells CD44+CD62L-
  • FIG. 4 provides in vivo evidence that Suv39h1 provides better protection in flu recall infections.
  • SUV39H1-KO CD8+ T cells expand faster and CD69+/CD103+ resident memory cells are increased following vaccination.
  • the inventors have further noted that decreased viral titer is decreased after vaccination upon Suv39h1 inhibition (data not shown).
  • FIGS. 5-9 Activation of CD8 + T cells leads to the differentiation of short-lived terminal effectors and long-lived memory precursors. Some of these memory precursors remain in lymphoid organs and become central memory T cells (TCM), while others home to non-lymphoid peripheral tissues early after antigen recognition and give rise to tissue resident memory T cells (TRM). The early stages of memory precursor differentiation into TCM and TRM remain poorly understood. The results included herein provide evidence that at steady state, during space-induced “homeostatic” expansion and after infection, deletion of SUV39H1 in CD8 + T cells leads to the accumulation of both TCM and TRM, in lymphoid and non-lymphoid tissues, respectively.
  • TCM central memory T cells
  • TRM tissue resident memory T cells
  • TCM (CD62L + CD44 + ) in lymphoid organs, including spleen and inguinal lymph nodes (iLN) accumulated among SUV39H1 -deficient CD8 + T cells.
  • SUV39H1 KO mice did not show any defect in thymic T cell development (data not shown) and the number of naive CD8 + T cells in lymphoid organs were like those in WT mice, suggesting normal T cell development. Accumulation of CD62L’ CD44 + cells in the liver was not dependent on the age of the animals (data not shown), excluding any possible effect of early aging on the accumulation of CD8+ T cells in tissues of SUV39H1-defficient mice 7 .
  • naive WT and SUV39H1 -deficient OT-I CD8 + T cells at a 1 :1 ratio into lymphopenic RAG-KO mice (Fig 6 A).
  • Transferring naive CD8 + T cells into lymphopenic hosts induces their expansion and promotes differentiation of TRM cells in the gut after 27 days 33 .
  • SUV39H1-defficient cells accumulate up to 10 times more than WT cells in non-lymphoid organs.
  • the KO:WT ratio was slightly over 1 in lymphoid organs, indicating a clear bias of SUV39H1 -defective T cells for homing to non-lymphoid tissues, compared to lymphoid organs.
  • SUV39H1 -deficient OT-I cells accumulated more than WT cells in the iv- compartment of the lung upon space- induced “homeostatic” proliferation (Fig 6 B). Both percentages and numbers of CD49d + Ly6c _ cells were higher among SUV39H1 -deficient OT-I cells in all tested organs.
  • CD49d + Ly6c _ cells in iv- lung compartments expressed high levels of CD69 both in WT and KO cells, further suggesting that this population is enriched in TRM cells (Fig 6 D).
  • the inventors next investigated the role of SUV39H1 in CD8 + TRM formation after flu infection, a well-stablished model of TRM differentiation in vivo 34 35 36 .
  • the extravascular (iv-) proportion of CD8 + T cells was increased as compared to uninfected mice (not shown).
  • No differences were observed between SUV39H1 -deficient and sufficient T cells.
  • these flu-induced lung-homing cells however, they observed an accumulation of CD69 + CD103’ TRM CD8 + T cells in SUV39H1 -deficient mice, 35 days after PR8 flu infection.
  • CD8 + T cells Three days after the secondary infection with PR8 flu, an overall accumulation of CD8 + T cells was observed in the lung tissue (iv-), and an increase in the numbers of CD49d + Ly6c _ and CD69 + CD103’ CD8 + T cells among CD44 + iv- cells (Fig 7 C).
  • the inventors used CITE-seq analysis of sorted cells from lungs of RAG-KO mice that had received WT and SUV39H1-KO OT-I cells (as in Fig 6.). To obtain sufficient cells for the analysis of all populations, they mixed equal numbers of cells from WT and KO genotypes (expressing distinct congenic markers CD45.1 and 2), coming from the iv+ or iv- fractions.
  • Clusters were named after their class and most differentially expressed gene. They identified one cluster of cycling cells (Cycling Mki67), four clusters of central memory cells (TCM CCR7 a-c and TCM Jun), three clusters of effector cells (TEW Lgals3, CTL GzmA and TEW CD49d), and one cluster of resident memory cells (TRM Rbpj) (Fig 4 A). TCM cells were separated from TEW and TRM cells on the Uniform Manifold Approximation and Projection (UMAP) dimensional reduction plot.
  • UMAP Uniform Manifold Approximation and Projection
  • TCM CCR7 a-c and TCM Jun The top 5 upregulated genes in TCM clusters (TCM CCR7 a-c and TCM Jun) include Foxpl , Sell, CCR7 and Ly6c2 -encoding Ly6c, except for TCM CCR7 a-.
  • Cluster TCM Jun also expresses Fos and CD69, probably reflecting recent activation.
  • This cluster also upregulated Klf2, a transcription factor expressed in recirculating cells 37 .
  • the cytotoxic CTL GzmA cluster expresses markers of cytotoxic effectors, like granzyme A and B (Gzma, Gzmb), CX3CR1 and interferon gamma (Ifng).
  • effector cluster TEW Lgals3 expresses effector (Ifng) and terminal effector markers such as Klrcl and Klrkl , encoding NKG2D. In addition, they found Itga4 (encoding CD49d) among the top 5 upregulated genes in effector cluster TEW CD49d. This cluster also expresses high levels of effector and memory markers such as Ccl5, Eomes and Tox as well as Gzmk and Nr4a2. Among these genes, some are also implicated in TRM differentiation, such as Nr4a2 11 , or TRM maintenance, such as Eomes 38 . Additionally, some of these genes are also upregulated upon TCR-dependent cell activation, like Tox and Eomes 39 40 .
  • TRM Rbpj Among the top 5 upregulated genes in TRM Rbpj cells are Rbpj 36 , Cxcr6 12 and Pdcdl (encoding PD1 16 ), all markers of bona fide TRM cells, and RGS1 , a G protein regulator that is involved in inhibition of T cell trafficking to lymph nodes 41 ). Additionally, cluster TRM Rbpj expresses high levels of TRM signatures from the literature. Other typic markers of TRM cells like Hobbit (Zfp683), Blimp-1 (Prdml ) or CD103 (Itgae) were not detected at the RNA level in our dataset.
  • TF activity using Single-Cell rEgulatory Network Inference and Clustering (SCENIC 42 ).
  • SCENIC 42 Single-Cell rEgulatory Network Inference and Clustering
  • regulons Srebp2, recently involved in the metabolic adaptation of TRM cells 43 ; the AP-1 family members Fosb, Fos, Jund and Jun, highly expressed in TRM cells 361644 ; and Prmdl 12 -encoding for BLIMP1- Runx3 13 , Tbx21 45 -encoding for Tbet-, and Irf4 46 all having roles in TRM formation and maintenance.
  • TRM Rbpj, TEA CD49d, as well as TEW Lgals3, and Cycling Mki67 clusters all express high levels of CD49d and low levels of Ly6c proteins, as detected by hashtag-coupled antibodies.
  • Cd69, encoding CD69 was expressed at low RNA levels in cluster TRM Rbpj (Fig 4 B), it was highly expressed at the protein level (not shown).
  • cluster TRM Rbpj is specific of lung extravascular compartments (iv-)(Fig 7 C and D). Consistent with previous results, both TRM Rbpj and TEW CD49d clusters were among the most overrepresented in KO cells (together with the minor cytotoxic cluster CTL GzmA), compared to WT cells.
  • TEW CD49d Some of these genes (CD3g, Itga4, GzmK and Tox) are shared by TEW CD49d and TRM Rbpj, but not by the other effector clusters. Altogether, these results suggest that TEW CD49d cells are enriched in TRM precursors. This hypothesis is consistent with most cycling cells being related to TEW CD49d cluster, as suggested by label transfer of cycling cells into other clusters (using Seurat label transfer method).
  • the inventors used the Cytotrace score, a proxy for sternness as a function of gene expression diversity per cell 49 .
  • the Cytotrace score for cluster TEW CD49d showed bimodal distribution, suggesting the presence of a high sternness subcluster among TEW CD49d cells.
  • they computed the Silhouette score for each cell, a parameter that indicates how well assigned to its cluster each cell is. This score can be used to estimate if a cluster represents a defined stable cluster (high Silhouette score), or a transitional state between two stable clusters (low Silhouette score). At 0.8 resolution, all clusters have high Silhouette scores.
  • TEW CD49d resolved into 2 clusters, one of which has lower Silhouette score than all other clusters, suggesting that these cells are transitional (i.e. in transition between two stable states).
  • This transitional cluster share genes with TEW CD49d cells, including Itga4, Eomes and Nr4a2.
  • Some of the upregulated genes in the TEW transitional cluster, including Eomes and Slamf6, are also upregulated in TRM precursors 11 .
  • TEW transitional cluster differentiates into TRM (TRM Rbpj or TRM CD103) and circulatory effector clusters (TEW Lgals3 and CTL GzmA).
  • Cytotrace analysis at 1 .2 resolution showed that the TEW transitional cluster has higher sternness score than all other effector and TRM clusters.
  • the TEW CD49 cluster includes transitional cells with features of TRM precursors. Even though cluster TEA transitional was not overrepresented in SUV39H1 -deficient samples, computation of the original proportions of cells in lungs before sorting (see Methods) showed that the majority of TEW transitional cells in lungs were deficient for SUV39H1. Altogether these results suggest that CD49d-expressing TRM precursors accumulate in the absence of SUV39H1 expression.
  • TRM precursors differentiation is increased in the absence of SUV39H1
  • the inventors transferred WT and SUV39H1- defficeint naive OT-I cells in a 1 :1 ratio into B6 mice and then infected the mice with the flu strain X31 expressing the SIINFEKL peptide (X31-0VA, Fig 5 A). 30 days after infection, CD69 + CD103’ TRM cells accumulated among SUV39H1-KO OT-I cells in lungs (Fig 8 B), reminiscent of what we have seen ex-vivo at steady state (Fig 1 ) and after flu infection.
  • the inventors transferred naive OT-I CD8 + T cells from SUV39H1-KO mice or WT littermates into RAG-KO mice. Between 33 and 35 days later, the inventors challenged the mice with an intravenous injection of B16-0VA cells expressing Luciferase (B16-OVA-Luc, Fig 9 A).
  • mice that received WT or SUV39H1 -KO OT-I cells Fig 9 B
  • SUV39H1-KO iv- cells were enriched in CD49d + Ly6c _ cells, reminiscent of what was found in co-transfer experiments.
  • Mice adoptively transferred with either WT or SUV39H1-KO OT-1 cells showed delayed B16-OVA-Luc growth as compared to mice that did not receive any OTI cells (Fig 9 C).
  • tumor growth delay was significantly stronger compared to mice bearing WT OT-I cells (Fig 9 C and D).
  • TRM numbers and proportions are increased in non-lymphoid tissues in absence of SUV39H1 expression.
  • Increased presence of TRM occurs in different tissues, including lungs, liver, and small gut. It occurs at steady state, and after spaced-induced “homeostatic” expansion or Flu infection.
  • the effect of the SUV39H1 -defect was particularly strong in a model of competition between WT and KO T cells, in which SUV39H1 KO TRM surpassed WT TRM by 10- folds in small gut or liver colonization.
  • scRNAseq analyses showed increased proportions of a population of TRM precursors in SUV39H1 KO cells homing to lungs compared to WT cells.
  • Adoptive transfer of purified SUV39H1-defficient lung homing effectors to flu infected mice shows increased TRM colonization, indicating increased TRM precursor capacity in absence of SUV39H1 expression.
  • TRM populations in tissues are heterogenous.
  • CD103 + CD8 + TRM cells locate to epithelial structures, while CD103’ TRM cells home to the stroma 2 .
  • CD103- TRM cells can replenish the CD103+ TRM pool upon re-infection.
  • the TRM accumulation observed in absence of SUV39H1 expression mostly concerns CD103’ TRM, suggesting that SUV39H1 KO can promote the differentiation of CD69 + CD103’ or reduce the transition to CD103 + TRM cells.
  • over representation of CD49d + Ly6c _ TRM in SUV39H1-KO is consistent with increased tissue homing (due to increased CD49d expression) and reduced lymphoid homing (due to reduced Ly6c expression).
  • Niborski, L. L. et al. CD8+T cell responsiveness to anti-PD-1 is epigenetically regulated by Suv39h1 in melanomas. Nat Commun 13, 3739 (2022).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Epidemiology (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Immunology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Virology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

The present invention relates to the use of KMT inhibitors and in particular of Suv39h1 inhibitors to increase immune response, and in particular immune cell mediated response, notably elicited by a vaccine or immunogenic composition.

Description

METHODS AND COMPOSITIONS FOR IMPROVING IMMUNE RESPONSE
FIELD OF THE DISCLOSURE
The present invention relates to the use of KMT (lysine methyl transferase) inhibitors and in particular of HKMT (histone lysine methyl transferase) inhibitors, notably to the use of Suv39h1 inhibitors to increase immune response, and in particular immune cell mediated response, notably elicited by a vaccine or an immunogenic composition.
BACKGROUND
The advent of vaccines has introduced new opportunities to prevent and treat infectious diseases. As the vaccine developed, it was later introduced to treat more diseases, such as cancers. The initial cancer vaccine based on tumor cells and tumor lysates has been developed in 1980, but the outbreak of COVID-19 has urged the development of vaccine technology. Cancer vaccines mainly use tumor-associated antigens (TAAs) and tumor-specific antigens (TSAs) to activate the patient's immune system and induce both specific cellular immunity and humoral immune response to prevent tumor growth and ultimately eradicate tumor cells. Currently however, most cancer vaccines are still in the stage of preclinical and clinical research and more specific antigens and vaccine development platforms need to be developed. Indeed, unlike traditional vaccines with antigens from foreign pathogens, tumor antigens are endogenous with low immunogenicity such that tumor antigens are often difficult to elicit an effective immune response. The present application therefore fulfills an important need that may expand the use of broader types of cancer antigen in cancer vaccination platforms.
Infections also represent another major clinical burden and are often characterized by resistances of the infectious pathogens to available antibiotic or antiviral therapeutics. In (chronic) infections, T cells are exposed to persistent antigen and/or inflammatory signals. Vaccination therefore remains a major strategy to prevent developments of infectious diseases.
There is thus an urgent need in the art to provide novel therapeutics that would support or enhance immune response and in particular cell mediated immune response associated with vaccination. It is an object of the present invention to comply with these needs and to provide improved therapeutic approaches for treatment of cancers, infectious diseases and other diseases and conditions defined herein. The object underlying the present invention is solved by the claimed subject matter.
SUMMARY OF THE INVENTION
The present invention is resumed in the claims of the present application.
It has been previously shown by the inventors that OVA-specific T cells from Suv39h1- deficient mice stimulated upon Listeria m. infection express a stem-like mRNA signature and that inhibition of Suv39h1 in T cell increases T cell expansion and persistence after adoptive transfer. It was further shown that Suv39h1 KO CAR T cells are more resistant to terminal differentiation than Mock CAR T cells and maintain sternness and memory characteristics. These results strongly supported the high therapeutic interest of developing Suv39h1 -deficient T cells for cellular therapy (e.g., CAR T cell therapy).
The inventors have now further discovered that the inhibition of Suv39h1 has a broader scope effect on T cells and notably, that Suv39h1 inhibition increases the antigen sensitivity and reactivity of naive T cells, which thus demonstrate increased activation at both low antigen affinity and low antigen density upon Suv39h1 inhibition. The inventors also provide further results showing that Suv39h1 primarily contributes to heterochromatin formation at stem/memory loci in differentiating naive T cells, as compared to lineage-committed central memory T cells. These new and exciting results now support a broader therapeutic use of Suv39h1 inhibition, to promote or enhance immune response, notably cellular immune response. This finds a major application in vaccination, where Suv39h1 can be used in combination with vaccine composition to enhance cellular immunity. The inventors thus provide results that elegantly demonstrate that in a model of Heterosubtypic flu infection, CD8+ T cells show stronger expansion following vaccination when Suv39h1 is inhibited and generate increased numbers of resident memory cells in the lung tissue. This results in better protection in recall infections (such as the flu archetypical infection), suggesting that Suv39h1 inhibition is beneficial for the enhancement of cellular immunity following vaccination strategies. DESCRIPTION OF THE FIGURES
Figure 1. Naive OTI cells (Naive (CD44-) CD8+ T cells) from Suv39h1-KO mice or WT littermates were incubated for the indicated timepoints with antigen presenting cells loaded with the indicated peptides or with anti-CD3 anti-CD28 beads at the indicated bead:cell ratios. A. Scheme of the experiment. B. Representative dot plots of the expression of CD69 and CD44 in OTI cells incubated with antigen presenting cells loaded with the T4 peptide (10-7 M) during the indicated time points. C. Median Fluorescence Intensity (MFI) of CD44 as a percentage of maximum value in OTI cells incubated for 48h at the indicated bead:cell ratios. D. MFI of CD44 (% of the maximum value) in OTI cells incubated for 48h with the indicated peptides and concentrations. * p<0.05, **p<0.01 , ***p<0.001 , ****p<0.0001 by two-way ANOVA followed by Sidak’s multiple comparison test.
Figure 2. Effect of SUV39H1 inactivation in human naive T cells. A. Sorting strategy for naive (N, CD45RA+CCR7+CD27+), Central Memory (CM, CD45RA- CCR7+CD27+), and Effector Memory (EM, CD45RA-CCR7-) cells from PBMC-purified total CD3+ T cells. B. MFI of H3K9me3 levels measured by flow cytometry and relativized to the equivalent Mock after Crispr inactivation of SUV39H1. Experiment was performed in two independent donors. C-E. Phenotype of mock and SUV39H1- deficient cells derived from different subsets analyzed by flow cytometry. Experiment was performed in two independent donors (shown as circle and square). C. Percentage of CD45RO+CD27+ cells after SUV39H1 inactivation. D. Representative dot-plot of CD62L expression (left) and percentage of CD62L+ cells (right) in mock and SUV39H1 -deficient naive-, CM-, or total CD3- derived cells after week-long stimulation. E. Percentage of TIM-3+PD-1 + cells in mock and SUV39H1 -deficient naive-, CM-, or total CD3-derived cells after week-long stimulation.
Figure 3. Analysis of the proportions and numbers of central memory (CM, CD62L+CD44+), effector memory (EM, CD62L-CD44+), and tissue resident memory (TRM, CD44+CD69+Ly6c- and CD44+CD69+CD103-) cells at steady state in mice deficient for Suv39h1. A and B. Representative dot plots (A) and quantification (B) of CD44 and CD62L expression in CD8+ T cells from the indicated organs of Suv39h1 KO and WT littermates at steady state, i LN : inguinal Lymph Node. C-F. Representative dot plots (C and E) and quantification (D and F) of the expression of the indicated markers in CD44+ CD8+ T cells from liver of conditional Suv39h1 KO mice (Cre+) or WT littermates (Cre-) at steady state.* p<0.05 ; ** p<0.01 ; *** p< 0.001 ; **** p<0.0001 ; ns: not significant by multiple unpaired t test with Holm-Sidak correction (B) or Mann Whitney test (D and F).
Figure 4. Naive OTI CD8+ T cells from Suv39h1-KO or WT littermate mice were adoptively transferred into B6 mice and 1 day later mice were infected with the flu strain X31 expressing OVA (X31-OVA). A. Scheme of the experiment. B and C. Representative dot plots (B) and quantification (C) of the ratio of OTI cells in the indicated organs 9 days post X31-OVA infection (Acute phase of the infection). D-F. Representative dot plot of CD69 and CD103 expression (D) and cell numbers of CD69+CD103- and CD69+CD103+ cells (E) in WT littermate (D) or Suv39h1-KO cells (E) 28 days post infection in OTI cells in lungs (Memory phase). * p<0.05 ; ** p<0.01 ; *** p< 0.001 ; **** p<0.0001 ; ns: not significant multiple ratio paired t test with Holm- Sidak correction (C) or Mann Whitney test (E).
Figure 5: SUV39H1 -deficiency leads to the accumulation of CD8+ tissue resident memory T cells (TRM) at steady state
A. Quantification of CD44 and CD62L expression in CD8+ T cells from the indicated non lymphoid organs in conditional SUV39H1 KO (Cre+) or WT (Cre-) littermates. B. Quantification of CD69+ CD103’ and CD49d+ Ly6c_ populations in CD44+ CD8+ T cells from liver of conditional SUV39H1 KO mice (Cre+) or WT littermates (Cre-) at steady state. C. Quantification of intravascular staining negative (iv-) cells among lung CD8+ T cells and CD69+ CD103’ or CD49d+ Ly6c_ populations in iv- CD44+ CD8+ T cells from conditional SUV39H1 KO mice (Cre+) or WT littermates (Cre-) at steady state. Each dot represents a mouse, different shapes represent different experiments. * p<0.05 ; ** p<0.01 ; *** p< 0.001 ; **** p<0.0001 ; ns: not significant by multiple unpaired t test with Holm-Sidak correction (A) or Mann Whitney test (B and C).
Figure 6: Lack of SUV39H1 promotes tissue homing and CD8+ TRM cells differentiation from naive cells
A. Scheme of the experiment. B. Quantification of the ratio between SUV39H1 KO and WT OTI cells within each organ. C. Quantification of the percentage and absolute numbers of CD49d+ Ly6c_ cells among SUV39H1 KO or WT OTI cells in the indicated organs from Exp 1 in C. Numbers represent the fold increase between KO and WT condition for each organ. D. Histogram of CD69 expression in iv- CD49d+ Ly6c_ CD8+ T cells and proportions of CD69+ cells among iv+ and iv- CD49d+ Ly6c_ CD8+ T cells in lungs from Exp. 4 in B. Numbers represent p values. Each dot represents a mouse, different shapes represent different experiments. * p<0.05 ; ** p<0.01 ; *** p< 0.001 ; **** p<0.0001 ; ns: not significant by one sample t test compared to 1 (B), multiple ratio paired t test with Holm-Sidak correction (C) and multiple paired t test (D).
Figure 7: CD8+ TRM differentiation upon flu infection is enhanced in the absence of SUV39H1
A. Scheme of the experiment. B. Quantification of the normalized numbers of iv- CD44+ CD8+ T cells and the normalized percentages of CD49d+ Ly6c_ cells among iv- CD44+ CD8+ T cells in lungs 28 days post X31 infection (Memory). Values were normalized to the mean of X31 -infected WT group for each experiment and then pooled. C. Quantification of the number of iv- CD44+ CD8+ T cells in lungs 3 days post PR8 infection (Recall). D. Quantification of the number of CD49d+ Ly6c_ and CD69+ CD103’ iv- CD44+ CD8+ T cells in lungs 3 days post PR8 infection (Recall). * p<0.05 ; ** p<0.01 ; *** p< 0.001 ; ns: not significant by ANOVA test with Sidak’s multiple comparisons test.
Figure 8: TRM precursors differentiation is increased in the absence of SUV39H1 A. Scheme of the experiment. B. Quantification of the expression of CD69 and CD103 in SUV39H1 -deficient and WT OTI cells 30 days post X31-OVA infection in lungs (Memory). C. Quantification of the percentage of CD49d+ Ly6c_ cells among SUV39H1 -deficient and WT OTI cells in the indicated organs and the percentage of CD69+ KLRGT or CD49a+ CX3CRT cells among CD49d+ Ly6c_ iv- CD44+ OTI cells in lungs 9 days post X31-OVA infection (Acute). D. Scheme of the experiment. E. Quantification of the percentage and numbers of WT and SUV39H1 KO OTI cells among CD69+ CD103’ and CD69+ CD103+ iv- CD44+ OTI cells in lungs 28 days post X31-OVA infection (Memory) and 27 days post adoptive transfer.p<0.05 ; ** p<0.01 ; *** p< 0.001 ; **** p<0.0001 ; ns: not significant by multiple ratio paired t test (B), (C) top and (E) and ratio pared t test (C) bottom. B, C and E: Representative data from 2 independent experiments.
Figure 9. SUV39H1 controls the formation of functional TRM CD8+ T cells able to delay lung tumor metastases A. Scheme of the experiment. B. iv staining (top) and CD49d and Ly6c expression in SUV39H1 KO and WT iv- OTI cells (bottom) in the lungs of mice at 33 days post transfer. C. Individual tumor growth curves in each experimental group. Inset ratios show the number of mice that developed tumors at the end of the experiment over the total number of mice in each experimental group (cut off average radiance = 2x103 p/s/cm2/sr). Pooled of 2 independent experiments. D. Median tumor growth curves of SUV39H1 KO and WT OTI recipient mice in G. Each dot represents a mouse. * p<0.05; ns: not significant by unpaired t test (B) and mixed-effects model (D).
DETAILED DESCRIPTION
Definitions
The terminology used herein is for the purpose of describing particular cases only and is not intended to be limiting. In this application, the use of the singular includes the plural unless specifically stated otherwise. As used herein, the singular forms “a”, “an” and “the” are intended to include the plural forms as well, unless the context clearly indicates otherwise.
In this application, the use of “or” means “and/or” unless stated otherwise. The terms “and/or” and “any combination thereof’ and their grammatical equivalents as used herein, can be used interchangeably. These terms can convey that any combination is specifically contemplated.
The term “about” or “around” can mean within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, up to 10%, up to 5%, or up to 1 % of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, within 5-fold, or within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated the term “about” meaning within an acceptable error range for the particular value should be assumed.
As used in this specification and claim(s), the words “comprising”, “having”, “including”, or “containing” are inclusive or open-ended and do not exclude additional, unrecited elements or method steps. It is contemplated that any embodiment discussed in this specification can be implemented with respect to any method or composition of the present disclosure, and vice versa. Furthermore, compositions of the present disclosure can be used to achieve methods of the present disclosure.
Reference in the specification to “some embodiments,” “an embodiment,” “one embodiment” or “other embodiments” means that a particular feature, structure, or characteristic described in connection with the embodiments is included in at least some embodiments, but not necessarily all embodiments, of the present disclosures.
To facilitate an understanding of the present disclosure, a number of terms and phrases are defined below.
Immune response: An immune response may typically be a specific reaction of the adaptive immune system to a particular antigen (so called specific or adaptive immune response) or an unspecific reaction of the innate immune system (so called unspecific or innate immune response), or a combination thereof.
Immune system: The immune system may protect organisms from infection. If a pathogen succeeds in passing a physical barrier of an organism and enters this organism, the innate immune system provides an immediate, but non-specific response. If pathogens evade this innate response, vertebrates possess a second layer of protection, the adaptive immune system. Here, the immune system adapts its response during an infection to improve its recognition of the pathogen. This improved response is then retained after the pathogen has been eliminated, in the form of an immunological memory, and allows the adaptive immune system to mount faster and stronger attacks each time this pathogen is encountered. According to this, the immune system comprises the innate and the adaptive immune system. Each of these two parts typically contains so called humoral and cellular components.
Adaptive immune response: The adaptive immune response is typically understood to be an antigen-specific response of the immune system. Antigen specificity allows for the generation of responses that are tailored, for example, to specific pathogens or pathogen-infected cells. The ability to mount these tailored responses is usually maintained in the body by “memory cells”. Should a pathogen infect the body more than once, these specific memory cells are used to quickly eliminate it. In this context, the first step of an adaptive immune response is the activation of naive antigen-specific T cells or different immune cells able to induce an antigen-specific immune response by antigen-presenting cells. This occurs in the lymphoid tissues and organs through which naive T cells are constantly passing. The three cell types that may serve as antigen-presenting cells are dendritic cells, macrophages, and B cells. Each of these cells has a distinct function in eliciting immune responses. Dendritic cells may take up antigens by phagocytosis and macropinocytosis and may become stimulated by contact with e.g. a foreign antigen to migrate to the local lymphoid tissue, where they differentiate into mature dendritic cells. Macrophages ingest particulate antigens such as bacteria and are induced by infectious agents or other appropriate stimuli to express MHC molecules. The unique ability of B cells to bind and internalize soluble protein antigens via their receptors may also be important to induce T cells. MHC-molecules are, typically, responsible for presentation of an antigen to T-cells. Therein, presenting the antigen on MHC molecules leads to activation of T cells, which induces their proliferation and differentiation into armed effector T cells. The most important function of effector T cells is the killing of infected cells by CD8+ cytotoxic T cells and the activation of macrophages by Th1 cells, which together make up cell-mediated immunity, and the activation of B cells by both Th2 and Th1 cells to produce different classes of antibody, thus driving the humoral immune response. T cells recognize an antigen by their T cell receptors which do not recognize and bind the antigen directly, but instead recognize short peptide fragments e.g. of pathogen-derived protein antigens, e.g. so-called epitopes, which are bound to MHC molecules on the surfaces of other cells.
Cellular immunity/cell-mediated immune response (CMI): Cellular immunity relates typically to the activation of macrophages, natural killer cells (NK), antigen-specific cytotoxic T-lymphocytes, and the release of various cytokines in response to an antigen. In more general terms, cellular immunity is not based on antibodies, but on the activation of cells of the immune system. Typically, a cellular immune response may be characterized e.g. by activating antigen-specific cytotoxic T-lymphocytes that are able to induce apoptosis in cells, e.g. specific immune cells like dendritic cells or other cells, displaying epitopes of foreign antigens on their surface. Such cells may be virus-infected or infected with intracellular bacteria, or cancer cells displaying tumor antigens. Further characteristics may be activation of macrophages and natural killer cells, enabling them to destroy pathogens and stimulation of cells to secrete a variety of cytokines that influence the function of other cells involved in adaptive immune responses and innate immune responses.
An “immunogenic” peptide or an “immunogenic” epitope or “peptide epitope” is a peptide that comprises an allele-specific motif such that the peptide will bind an HLA molecule and induce a cell-mediated or humoral response, for example, cytotoxic T lymphocyte (CTL ( e.g ., CD8+ )), helper T lymphocyte (Th (e.g, CD4+ )) and/or B lymphocyte response. Thus, immunogenic peptides described herein are capable of binding to an appropriate HLA molecule and thereafter inducing a CTL (cytotoxic) response, or a HTL (and humoral) response, to the peptide.
« Major Histocompatibility Complex” or “MHC” is a cluster of genes that plays a role in control of the cellular interactions responsible for physiologic immune responses. In humans, the MHC complex is also known as the human leukocyte antigen (HLA) complex. For a detailed description of the MHC and HLA complexes, see, Paul, Fundamental Immunology, 3rd Ed., Raven Press, New York (1993). “Proteins or molecules of the major histocompatibility complex (MHC)”, “MHC molecules”, “MHC proteins” or “HLA proteins” are to be understood as meaning proteins capable of binding peptides resulting from the proteolytic cleavage of protein antigens and representing potential lymphocyte epitopes, ( e.g ., T cell epitope and B cell epitope) transporting them to the cell surface and presenting them there to specific cells, in particular cytotoxic T-lymphocytes, T-helper cells, or B cells. The major histocompatibility complex in the genome comprises the genetic region whose gene products expressed on the cell surface are important for binding and presenting endogenous and/or foreign antigens and thus for regulating immunological processes. The major histocompatibility complex is classified into two gene groups coding for different proteins, namely molecules of MHC class I and molecules of MHC class IL The cellular biology and the expression patterns of the two MHC classes are adapted to these different roles.
« Human Leukocyte Antigen” or “HLA” is a human class I or class II Major Histocompatibility Complex (MHC) protein (see, e.g., Stites, et al., Immunology, 8th Ed., Lange Publishing, Los Altos, Calif. (1994).
Immunogen: In the context of the present invention, an immunogen may be typically understood to be a compound or antigen that is able to stimulate an immune response. Preferably, an immunogen is a peptide, polypeptide, or protein. In some preferred embodiments, an immunogen in the sense of the present invention is the product of translation of a provided nucleic acid molecule, preferably an artificial nucleic acid molecule as defined herein. Typically, an immunogen elicits at least an adaptive immune response.
Immunostimulatory composition or immunogenic composition: In the context of the invention, an immunostimulatory composition may be typically understood to be a composition containing at least one component which is able to induce an immune response or from which a component, which is able to induce an immune response, is derivable. Such immune response may be preferably an innate immune response or a combination of an adaptive and an innate immune response. For example, an immunostimulatory composition in the context of the invention contains at least a peptide or a nucleic acid molecule encoding thereof, notably at least one artificial nucleic acid molecule, more preferably an RNA, for example an mRNA molecule. The immunostimulatory component, such as the mRNA may be complexed with a suitable carrier. Thus, the immunostimulatory composition may comprise an mRNA/carrier- complex. Furthermore, the immunostimulatory composition may comprise an adjuvant and/or a suitable vehicle for the immunostimulatory component, such as the mRNA.
“Polypeptide”, “peptide” and their grammatical equivalents as used herein refer to a polymer of amino acid residues linked by peptide bonds. A “mature protein” is a protein which is full-length and which, optionally, includes glycosylation or other modifications typical for the protein in a given cellular environment. Polypeptides and proteins disclosed herein (including functional portions and functional variants thereof) can comprise synthetic amino acids in place of one or more naturally-occurring amino acids. Peptides typically contains less than 50 monomer units. Nevertheless, the term peptide is not a disclaimer for molecules having more than 50 monomer units. Long peptides are also called polypeptides, typically having between 50 and 600 monomeric units. A peptide or polypeptide as used herein can comprise at least one flanking sequence. The term “flanking sequence” as used herein refers to a fragment or region of the neoantigen peptide that is not a part of the neoepitope. The term “residue” refers to an amino acid residue or amino acid mimetic residue incorporated into a peptide or protein by an amide bond or amide bond mimetic, or nucleic acid (DNA or RNA) that encodes the amino acid or amino acid mimetic.
A “protein” typically comprises one or more peptides or polypeptides. A protein is typically folded into 3-dimensional form, which may be required for the protein to exert its biological function.
Nucleic acid molecule: A nucleic acid molecule is a molecule comprising, preferably consisting of nucleic acid components. The term nucleic acid molecule preferably refers to DNA or RNA molecules. It is preferably used synonymous with the term “polynucleotide”. Preferably, a nucleic acid molecule is a polymer comprising or consisting of nucleotide monomers, which are covalently linked to each other by phosphodiester-bonds of a sugar/phosphate-backbone. The term “nucleic acid molecule” also encompasses modified nucleic acid molecules, such as base-modified, sugar-modified or backbone-modified etc. DNA or RNA molecules. According to various embodiments of the present disclosure, a nucleic acid such as RNA encoding a peptide or polypeptide is taken up by or introduced, i.e. transfected or transduced, into a cell which cell may be present in vitro or in a subject, resulting in expression of said peptide or polypeptide. The cell may, e.g., express the encoded peptide or polypeptide intracellularly (e.g. in the cytoplasm and/or in the nucleus), may secrete the encoded peptide or polypeptide, and/or may express it on the surface.
The term "endogenous" refers to any material from or produced inside an organism, cell, tissue or system.
The term "exogenous" refers to any material introduced from or produced outside an organism, cell, tissue or system.
Heterologous sequences: two sequences are typically understood to be “heterologous” if they are not derivable from the same gene; i.e., although heterologous sequences may be derivable from the same organism, they naturally (in nature) do not occur in the same nucleic acid molecule, such as in the same mRNA. Heterologous sequences can be exogenous.
Artificial nucleic acid molecule: An artificial nucleic acid molecule may typically be understood to be a nucleic acid molecule, e.g. a DNA or an RNA, that does not occur naturally. In other words, an artificial nucleic acid molecule may be understood as a non-natural nucleic acid molecule. Such nucleic acid molecule may be non-natural due to its individual sequence (which does not occur naturally) and/or due to other modifications, e.g. structural modifications of nucleotides, which do not occur naturally. An artificial nucleic acid molecule may be a DNA molecule, an RNA molecule or a hybrid-molecule comprising DNA and RNA portions. Typically, artificial nucleic acid molecules may be designed and/or generated by genetic engineering methods to correspond to a desired artificial sequence of nucleotides (heterologous sequence). In this context an artificial sequence is usually a sequence that may not occur naturally, i.e. it differs from the wild type sequence by at least one nucleotide. The term “wild type” may be understood as a sequence occurring in nature. Further, the term “artificial nucleic acid molecule” is not restricted to mean “one single molecule” but is, typically, understood to comprise an ensemble of identical molecules. Accordingly, it may relate to a plurality of identical molecules contained in an aliquot.
Open reading frame: An open reading frame (ORF) in the context of the invention may typically be a sequence of several nucleotide triplets, which may be translated into a peptide or protein. An open reading frame preferably contains a start codon, i.e. a combination of three subsequent nucleotides coding usually for the amino acid methionine (ATG), at its 5'-end and a subsequent region, which usually exhibits a length which is a multiple of 3 nucleotides. An ORF is preferably terminated by a stopcodon (e.g., TAA, TAG, TGA). Typically, this is the only stop-codon of the open reading frame. Thus, an open reading frame in the context of the present invention is preferably a nucleotide sequence, consisting of a number of nucleotides that may be divided by three, which starts with a start codon (e.g. ATG) and which preferably terminates with a stop codon (e.g., TAA, TGA, or TAG). The open reading frame may be isolated or it may be incorporated in a longer nucleic acid sequence, for example in a vector or an mRNA. An open reading frame may also be termed “(protein) coding sequence” or, preferably, “coding sequence”.
RNA, mRNA: RNA is the usual abbreviation for ribonucleic-acid. It is a nucleic acid molecule, i.e. a polymer consisting of nucleotides. These nucleotides are usually adenosine-monophosphate, uridine-monophosphate, guanosine-monophosphate and cytidine-monophosphate monomers which are connected to each other along a so- called backbone. The backbone is formed by phosphodiester bonds between the sugar, i.e. ribose, of a first and a phosphate moiety of a second, adjacent monomer. The specific succession of the monomers is called the RNA-sequence. Usually RNA may be obtainable by transcription of a DNA-sequence, e.g., inside a cell. In eukaryotic cells, transcription is typically performed inside the nucleus or the mitochondria. In vivo, transcription of DNA usually results in the so-called premature RNA which has to be processed into so-called messenger-RNA, usually abbreviated as mRNA. Processing of the premature RNA, e.g. in eukaryotic organisms, comprises a variety of different posttranscriptional-modifications such as splicing, 5'-capping, polyadenylation, export from the nucleus or the mitochondria and the like. The sum of these processes is also called maturation of RNA. The mature messenger RNA usually provides the nucleotide sequence that may be translated into an amino-acid sequence of a particular peptide or protein. Typically, a mature mRNA comprises a 5'-cap, a 5 -UTR, an open reading frame, a 3 -UTR and a poly(A) sequence. Aside from messenger RNA, several noncoding types of RNA exist which may be involved in regulation of transcription and/or translation.
The term "expression cassette" is used in the context of the present invention to refer to a nucleic acid molecule which comprises at least one nucleic acid sequence that is to be expressed, e.g. a nucleic acid encoding an antigen or a part thereof, operably linked to transcription and translation control sequences. Preferably, an expression cassette includes cis-regulating elements for efficient expression of a given gene, such as promoter, initiation-site and/or polyadenylation-site. Preferably, an expression cassette contains all the additional elements required for the expression of the nucleic acid in the cell of a patient. A typical expression cassette thus contains a promoter operatively linked to the nucleic acid sequence to be expressed and signals required for efficient polyadenylation of the transcript, ribosome binding sites, and translation termination. Additional elements of the cassette may include, for example enhancers. An expression cassette preferably also contains a transcription termination region downstream of the structural gene to provide for efficient termination. The termination region may be obtained from the same gene as the promoter sequence or may be obtained from a different gene.
The term "operably linked" as used in the context of the present invention refers to an arrangement of elements, wherein the components so described are configured so as to perform their usual function. A nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence. For example, a promoter is operably linked to one or more transgenes, if it affects the transcription of the one or more transgenes. Further, control elements operably linked to a coding sequence are capable of effecting the expression of the coding sequence. The control elements need not be contiguous with the coding sequence, so long as they function to direct the expression thereof. Thus, for example, intervening untranslated yet transcribed sequences can be present between a promoter sequence and the coding sequence and the promoter sequence can still be considered "operably linked" to the coding sequence.
The term "expression vector" refers to a polynucleotide or a mixture of a polynucleotide and proteins capable of being introduced or of introducing the collection of nucleic acids of the present invention or one nucleic acid that is part of the collection of nucleic acids of the invention into a cell, preferably a mammalian cell. Examples of vectors include but are not limited to plasmids, cosmids, phages, viruses or artificial chromosomes. In particular, a vector is used to transport the promoter and the collection of the nucleic acids or one nucleic acid that is part of the collection of nucleic acids of the invention into a suitable host cell. Expression vectors may contain "replicon" polynucleotide sequences that facilitate the autonomous replication of the expression vector in a host cell. Once in the host cell, the expression vector may replicate independently of or coincidental with the host chromosomal DNA, and several copies of the vector and its inserted DNA can be generated. In case that replication incompetent expression vectors are used - which is often the case for safety reasons - the vector may not replicate but merely direct expression of the nucleic acid. Depending on the type of expression vector the expression vector may be lost from the cell, i.e only transiently expresses the CVP encoded by the nucleic acid or may be stable in the cell. Expression vectors typically contain expression cassettes, i.e. the necessary elements that permit transcription of the nucleic acid into an mRNA molecule.
A “fragment of a sequence” is typically a shorter portion of a full-length sequence of e.g. a nucleic acid molecule or an amino acid sequence. Accordingly, a fragment, typically, consists of a sequence that is identical to the corresponding stretch within the full-length sequence. A preferred fragment of a sequence in the context of the present invention, consists of a continuous stretch of entities, such as nucleotides or amino acids corresponding to a continuous stretch of entities in the molecule the fragment is derived from, which represents at least 20%, preferably at least 30%, more preferably at least 40%, more preferably at least 50%, even more preferably at least 60%, even more preferably at least 70%, and most preferably at least 80% of the total (i.e. full- length) molecule from which the fragment is derived.
Sequence identity: Two or more sequences are identical if they exhibit the same length and order of nucleotides or amino acids. The percentage of identity typically describes the extent to which two sequences are identical, i.e. it typically describes the percentage of nucleotides that correspond in their sequence position with identical nucleotides of a reference-sequence. For determination of the degree of identity, the sequences to be compared are considered to exhibit the same length, i.e. the length of the longest sequence of the sequences to be compared. This means that a first sequence consisting of 8 nucleotides is 80% identical to a second sequence consisting of 10 nucleotides comprising the first sequence. In other words, in the context of the present invention, identity of sequences preferably relates to the percentage of nucleotides of a sequence which have the same position in two or more sequences having the same length. Gaps are usually regarded as non-identical positions, irrespective of their actual position in an alignment.
The term “neoantigen” means a class of tumor antigens that arises from a tumorspecific mutation(s) which alters the amino acid sequence of genome encoded proteins. Neoantigens encompass, but are not limited to, tumor antigens which arise from, for example, substitution in the protein sequence, frame shift mutation, fusion polypeptide, in-frame deletion, insertion, expression of endogenous retroviral polypeptides, and tumor-specific overexpression of polypeptides. The terms “(neo)antigen peptide” and “(neo)antigenic peptide”, or mutant peptides can be used interchangeably with “peptide” in the present specification. The polypeptides or peptides can be a variety of lengths, either in their neutral (uncharged) forms or in forms which are salts, and either free of modifications such as glycosylation, side chain oxidation, or phosphorylation or containing these modifications, subject to the condition that the modification does not destroy the biological activity of the polypeptides as herein described.
By “neoplasia”, “neoplastic disease”, “cancer” or “tumor” it is meant any disease that is caused by or results in inappropriately high levels of cell division, inappropriately low levels of apoptosis, or both. Examples of cancers include, without limitation, leukemia (e.g., acute leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, acute myeloblastic leukemia, acute promyelocytic leukemia, acute myelomonocytic leukemia, acute monocytic leukemia, acute erythroleukemia, chronic leukemia, chronic myelocytic leukemia, chronic lymphocytic leukemia), polycythemia vera, lymphoma (e.g., Hodgkin's disease, non-Hodgkin's disease), Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors such as sarcomas and carcinomas (e.g., fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, uterine cancer, testicular cancer, lung carcinoma, small cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, schwannoma, meningioma, melanoma, neuroblastoma, and retinoblastoma). Lymphoproliferative disorders are also considered to be proliferative diseases.
The term “neoplasia vaccine” or “tumor vaccine”, or “cancer vaccine” is typically meant to refer to a pooled sample of neoplasia/tumor antigens, for example at least two, at least three, at least four, at least five, or more antigenic peptides. A “vaccine” is to be understood as meaning a composition for generating immunity for the prophylaxis and/or treatment of diseases (e.g., neoplasia/tumor or infectious disease). Accordingly, vaccines are medicaments which comprise antigens and are intended to be used in humans or animals for generating specific defense and protective substance by vaccination. A “vaccine composition” or a “neoplasia vaccine composition” can include a pharmaceutically acceptable excipient, earner or diluent.
The term “combination” embraces the administration of an KMT inhibitor, notably a suv39h1 inhibitor and one or additional component that elicits an immune response, typically a vaccine or immunogenic composition (e.g. a pooled sample of neoplasia/tumor specific antigens or infectious disease-associated antigens), as part of a treatment regimen intended to provide a beneficial (additive or synergistic) effect from the co-action of one or more of these therapeutic agents. The combination may also include one or more additional agents, for example, but not limited to, such as a checkpoint inhibitor, immune cell therapy, chemotherapeutic agents, anti-angiogenesis agents and agents that reduce immune-suppression. The beneficial effect of the combination includes, but is not limited to, an improved or enhanced immunogenic response resulting from the combination of therapeutic agents. Administration of these therapeutic agents or components in combination typically is carried out over a defined time period (for example, minutes, hours, days, or weeks depending upon the combination selected).
“Combination therapy” is intended to embrace administration of these therapeutic agents or components in a sequential manner, that is, wherein each therapeutic agent is administered at a different time, as well as administration of these therapeutic agents, or at least two of the therapeutic agents, in a substantially simultaneous manner. As another example, a combination of the present invention may be formulated as separate pharmaceutical compositions that can be administered at the same or different time. As used herein, the term “simultaneously” is meant to refer to administration of one or more agents at the same time. Simultaneously includes administration contemporaneously, that is during the same period of time. In certain embodiments, the one or more agents or components are administered simultaneously in the same hour, or simultaneously in the same day. Sequential or substantially simultaneous administration of each therapeutic agent can be effected by any appropriate route including, but not limited to, oral routes, intravenous routes, subcutaneous routes, intramuscular routes, direct absorption through mucous membrane tissues (e.g., nasal, mouth, vaginal, and rectal), and ocular routes (e.g., intravitreal, intraocular, etc.). The therapeutic agents can be administered by the same route or by different routes. For example, one component of a particular combination may be administered by intravenous injection while the other components ) of the combination may be administered orally. The components may be administered in any
5 therapeutically effective sequence. The expression “combination” embraces groups of compounds or non -drug therapies useful as part of a combination therapy.
The term “pharmaceutically acceptable” refers to approved or approvable by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals,
10 including humans. A “pharmaceutically acceptable excipient, carrier or diluent” refers to an excipient, carrier or diluent that can be administered to a subject, together with an agent, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the agent.
15 The terms “treat,” “treated,” “treating,” “treatment,” and the like are meant to refer to reducing or ameliorating a disorder and/or symptoms associated therewith (e.g., a neoplasia or tumor). “Treating” may refer to administration of the combination therapy to a subject after the onset, or suspected onset, of a cancer. “Treating” includes the concepts of “alleviating”, which refers to lessening the frequency of occurrence or
20 recurrence, or the severity, of any symptoms or other ill effects related to a cancer and/or the side effects associated with cancer therapy. The term “treating” also encompasses the concept of “managing” which refers to reducing the severity of a particular disease or disorder in a patient or delaying its recurrence, e.g., lengthening the period of remission in a patient who had suffered from the disease. It is appreciated
25 that, although not precluded, treating a disorder or condition does not require that the disorder, condition, or symptoms associated therewith be completely eliminated.
The term “therapeutic effect” refers to some extent of relief of one or more of the symptoms of a disorder (e.g., a neoplasia or tumor) or its associated pathology. “Therapeutically effective amount” as used herein refers to an amount of an agent
30 which is effective, upon single or multiple dose administration to the cell or subject, in prolonging the survivability of the patient with such a disorder, reducing one or more signs or symptoms of the disorder, preventing or delaying, and the like beyond that
18 expected in the absence of such treatment. 'Therapeutically effective amount” is intended to qualify the amount required to achieve a therapeutic effect. A physician or veterinarian having ordinary skill in the art can readily determine and prescribe the “therapeutically effective amount” (e.g., ED50) of the pharmaceutical composition required. For example, the physician or veterinarian could start doses of the compounds of the invention employed in a pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
As used herein, the terms “prevent,” “preventing,” “prevention,” “prophylactic treatment,” and the like, refer to reducing the probability of developing a disease or condition in a subject, who does not have, but is at risk of or susceptible to developing a disease or condition.
The term “prime/ boost” or “prime/ boost dosing regimen” is meant to refer to the successive administrations of a vaccine or immunogenic or immunological compositions. The priming administration (priming) is the administration of a first vaccine or immunogenic or immunological composition type and may comprise one, two or more administrations. The boost administration is the second administration of a vaccine or immunogenic or immunological composition type and may comprise one, two or more administrations, and, for instance, may comprise or consist essentially of annual administrations. In certain embodiments, administration of the neoplasia vaccine or immunogenic composition is in a prime/ boost dosing regimen.
The term "subject” or “individual” refers to an animal which is the object of treatment, observation, or experiment. By way of example only, a subject includes, but is not limited to, a mammal, including, but not limited to, a human or a non-human mammal, such as a non-human primate, bovine, equine, canine, ovine, or feline.
The immune cells according to the disclosure are typically mammalian cells, e.g., human cells. More particularly, the cells of the disclosure are derived from the blood, bone marrow, lymph, or lymphoid organs (notably the thymus) and are cells of the immune system (i.e., immune cells), such as cells of the innate or adaptive immunity, e.g., myeloid or lymphoid cells, including lymphocytes, typically T cells and/or NK cells. Preferably according to the disclosure, cells are notably lymphocytes including T cells, B cells, NK cells and progenitors thereof. In some embodiments T cells are generated from induced pluripotent stems cells.
Cells according to the disclosure may also be immune cell progenitors, such as lymphoid progenitors and more preferably T cell progenitors. Examples of T-cell progenitors include pluripotent stem cells (PSCs), induced pluripotent stem cells (iPSCs), hematopoietic stem cells (HSCs), human embryonic stem cells (ESCs), adipocyte-derived stem cells (ADSCs), multipotent progenitor (MPP); lymphoid-primed multipotent progenitor (LMPP); common lymphoid progenitor (CLP); lymphoid progenitor (LP); thymus settling progenitor (TSP); or early thymic progenitor (ETP). Hematopoietic stem and progenitor cells can be obtained, for example, from cord blood, or from peripheral blood, e.g. peripheral blood-derived CD34+ cells after mobilization treatment with granulocyte-colony stimulating factor (G-CSF).
T cell progenitors typically express a set of consensus markers including CD44, CD117, CD135, and/or Sca-1 but see also Petrie HT, Kincade PW. Many roads, one destination for T cell progenitors. The Journal of Experimental Medicine. 2005;202(1 ):11-13. The cells typically are primary cells, such as those isolated directly from a subject and/or isolated from a subject and frozen. With reference to the subject to be treated, the cells of the disclosure may be allogeneic and/or autologous.
Histone lysine methyltransferase (KMT) and inhibitor’s thereof
Heterochromatin Protein 1 (HP1 ) is a transcriptional repressor that directly binds to the methylated lysine 9 residue of histone H3 (H3K9me), which is a hallmark histone modification for transcriptionally silenced heterochromatin. The accumulation of histone H3 lysine 9 methylation (H3K9me) is thus an important mark of the heterochromatin state. HP1 proteins are characterized by two conserved domains: the chromodomain (CD) at the N-terminus, and the chromo shadow domain (CSD) at the C-terminus.The CD was shown to directly bind to H3K9me, while the CSD is implicated in various proteimprotein interactions and dimerization. H3K9me3-mediated heterochromatin formation thus involves HP1 that contains a chromodomain that recognizes and binds to di- and tri-methylated H3K9. The SUV39 PKMTs and their function in heterochromatin formation are evolutionarily conserved and orthologous proteins can be detected in most organisms from fission yeast to humans including plants (see Zeng W, Ball AR Jr, Yokomori K. HP1 : heterochromatin binding proteins working the genome. Epigenetics. 2010;5(4):287-292).
H3K9me in mammals is effected by multiple histone methyltransferases, which have distinct targeting specificities and degrees of methylation (e.g., mono-, di- or trimethylation). A common feature HKMTs is the fact that they all interact with both maintenance and de novo DNA methyltrans- ferases or DNMTs.
Many H3K9-specific histone methyltransferases (HKMTs) have been characterized, all of which contain a conserved SET domain (Kouzarides, 2007) and are thus members of the SET family of histone methyltransferases (HMTs) (Cheng, X.; Collins, R.E.; Zhang, X. Structural and Sequence Motifs of Protein (Histone) Methylation Enzymes. Annu. Rev. Biophys. Biomol. Struct. 2005, 34, 267-294 ; Dillon, S.C.; Zhang, X.; Trievel, R.C.; Cheng, X. The SET-domain protein superfamily: Protein lysine methyltransferases. Genome Biol. 2005, 6, 227).
Examples of reviews and relevant articles include Weirich S, Khella MS, Jeltsch A. Structure, Activity and Function of the Suv39h1 and Suv39h2 Protein Lysine Methyltransferases. Life (Basel). 2021 ; 11 (7):703 ; Fritsch L, Robin P, Mathieu JR, et al. A subset of the histone H3 lysine 9 methyltransferases Suv39h1 , G9a, GLP, and SETDB1 participate in a multimeric complex. Mol Cell. 2010;37(1 ):46-56 ; Shinkai Y, Tachibana M. H3K9 methyltransferase G9a and the related molecule GLP. Genes Dev. 2011 ;25(8):781 -788. Padeken J, Methot SP, Gasser SM. Establishment of H3K9- methylated heterochromatin and its functions in tissue differentiation and maintenance. Nat Rev Mol Cell Biol. 2022;23(9):623-640).
Suv39h1 and Suv39h2 consist of two-conserved domains, one SET- and one chromodomain. The amino acid sequences of Suv39h1 and Suv39h2 are highly conserved, with 56% amino acid identity over the entire protein alignment. The SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain is the catalytic domain of one large group of PKMTs, called SET-domain PKMTs. The structure of the Suv39h2 SET domain shows a high similarity to the known SET domain structures of other H3K9 PKMTs such as Dim-5 or G9a. This domain binds the methyl group donor S-adenosyl- L-methionine (AdoMet) and brings it in close contact to the target lysine residue in its active site pocket. Chromodomains are methylated lysine binding modules (Taverna, S.D.; Li, H.; Ruthenburg, A.; Allis, C.D.; Patel, D.J. How chromatin-binding modules interpret histone modifications: Lessons from professional pocket pickers. Nat. Struct. Mol. Biol. 2007, 14, 1025-1040 ; Patel, D.J.; Wang, Z. Readout of Epigenetic Modifications. Annu. Rev. Biochem. 2013, 82, 81-118). The Suv39h1 chromodomain was shown to recognize H3K9me2/3 (Wang, T.; Xu, C.; Liu, Y.; Fan, K.; Li, Z.; Sun, X.; Ouyang, H.; Zhang, X.; Zhang, J.; Li, Y.; et al. Crystal Structure of the Human Suv39h1 Chromodomain and Its Recognition of Histone H3K9me2/3. PLoS ONE 2012, 7, e52977).
The trimethylases Suv39h1 and 2/KMT1A and -1 B, which contribute mainly to the establishment of pericentric heterochromatin (Peters et al., 2003; Rea et al., 2000). At the enzymatic level, Suv39h prefers mono- or dimethylated H3K9 as a primary substrate In agreement with a role in gene silencing, Suv39h1 has also been found to interact with the de novo DNA methyltransferase DNMT3B.
Another important family of H3K9 HKMTs comprises G9a/ Eu-HMTase2/KMT1 C and GLP/Eu-HMTase1/KMT1 D. G9a catalyzes the initial mono-methylation of H3K9. Human G9A is referenced as Q96KQ7 in UNIPROT and is encoded by the EHMT2gene located on chromosome 6 (p21.33) (gene ID: 10919 in NCBI). Human KMT1 D is referenced as Q9H9B1 in UNIPROT and is encoded by the EHMT12 gene located on chromosome 9 (q34.3) (gene ID: 79813, in NCBI).
H3K9 HKMT family also includes SETDB1/ESET/KMT1 E. SETDB1 alone dimethylates H3K9 but trimethylates this residue when associated with its cofactor hAM. Human Setdbl is referenced as Q15047 in UNIPROT and is encoded by the Suv39h2 gene located on chromosome 1 (q21 .3) (gene ID: 9869 in NCBI).
In some embodiments of the present invention, a H3K9me histone methyltransferase (also shortly named herein H3K9me HKMT) inhibitor can be selected among inhibitors of Suv39h1 (KMT1A), Suv39h2 (KMT1 B), G9a (EHMT2/KMT1C), G9a-like protein 1 ; GLP (EHMT1/KMT1 D), Setdbl (KMT1 E), and Setdb2 (KMT1 F).
In some embodiments, the selected inhibitor is selective for one or more HKMTs as above mentioned. By "selective" it is meant that the affinity of the inhibitor is at least 10-fold, preferably 25-fold, more preferably 100-fold, and still preferably 500-fold higher than the affinity for other histone methyltransferases and in some cases for one or more of the H3K9me HKMTs. Typically, the selected inhibitor has an IC50 of less than 20 pM, preferably less than 10 pM, more preferably less than 5 pM, even more preferably less than 1 pM or less than 0.5 pM. In some embodiments, the HKMT inhibitor has an IC50 for the other HKMTs, in some cases for H3K9me HKMT, such as for example EZH2, G9A and/or Setbdl , of more than 10 pM, preferably more than 20 pM, more preferably more than 50 pM. In some embodiments, the selected inhibitor is selective for Suv39h1 and/or Suv39h1. In some embodiments, the selected inhibitor does not inhibit Setdbl .
In some embodiments, a selected HKMT inhibitor alternatively targets one or more heterochromatin protein 1 (HP1 ) proteins (see for review Zeng W, Ball AR Jr, Yokomori K. HP1 : heterochromatin binding proteins working the genome. Epigenetics. 2010;5(4):287-292). Typically, HP1 proteins include HP1 a, encoded by Chromobox homolog 5 (CBX5); HP1 p, encoded by CBX1, and HP1y, encoded by CBX3.
Human CBX1 is referenced as P83916 in UNIPROT and is encoded by the CBX1 gene located on chromosome 17q (21.32) (gene ID: 10951 in NCBI). This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadowdomain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins.
Human CBX3 (also named HP1y) is referenced as Q13185 in UNIPROT and is encoded by the CBX1 gene located on chromosome 7 (p15.2) (gene ID: 11335 in NCBI).
Human CBX5 (also named HP1 a) is referenced as P5973 in UNIPROT and is encoded by the CBX5 gene located on chromosome 12 (q13.13) (gene ID: 23468 in NCBI).
Inhibitors of HP1 proteins may prevent binding of the protein to histone H3 trimethylated and or inhibit the gene expression (at the genomic and/or transcriptomic level as detailed below).
Inhibitors of Suv39h1 will be described in detail below, but it is clearly intended that the definitions below can be applied by the skilled person to any the H3K9 HKMT inhibitors (including inhibitors targeting HP1 protein) as previously described and more particularly to Suv39h2. In some embodiments, the selective inhibitors inhibits both Suv39h1 and Suv39h2.
Inhibitors of Suv39h1
Human Suv39h1 methyltransferase is referenced as 043463 in UNIPROT and is encoded by the Suv39h1 gene located on chromosome X (gene ID: 6839 in NCBI). One exemplary human gene sequence is SEQ ID NO: 1
GCTCTTCTCGCGAGGCCGGCTAGGCCCGAATGTCGTTAGCCGTGGGGAAAGATGGCGGAAAATTTAAAAG GTGAAGCAGTGGAGGCAGAGGCGCGGGCCCGCTGGCCGGGCCGGGTGGGCTGGAGGGGTGGCGTTGCCGG CTCGGGGCCCCGGCGTCCGAGGCCCCGGCGCCGGGAGCCGGAAGCTCGGCGCGGAAAGGATGAGGCTCGG GGAGCGCGGGCCTGGTGCGCGGGGCTGGGCGGGGCTCAGGGGAGGGGGCGCGCGCCTCGGAACGCAGCGG GCCTGGGGCTAAGTGGGGACGCAGGAGGGGGGCGCGCGCTGCAGATCGCGGCCGGACCGGCGCGCGCACG CGCGGGGGCTTGTCGAGGAGGCCGCGCCCGCGCGCGGGAAAATCGGCCCCTGGTGACCGTTACCCATTCG GTGTCCACGCGAGACGCCGGAAGGGGAGGGAAGATAAGGGGGACAGACCCCCCCTTCAGAGTGCGGGGAC TGAGAACTCTTCTGGGGGAAAGTATCGCCTCTCGGCGTGATGGGGGAAGGGTTTGGAATAGAGGATCTCC CAGAAGAGAGAAATGGGGCCTTCCTAATAGGACAGCTGGACTCCCCCATGTGCAGGGAAAGAGGGGTGAC TCAGTTATGTTGGGGGGCCCCTCTATGTGACGAAAGCCGCAGGGAGGATGGGTTCCACAAGTGGGAGGAC CTCTGAGGGGTTCAGGAGAGTCCACCTGTGGCCAGTTCCGGAGCCAGCAGCTGGAGGGTGTTAATTGGGA CCACTTAAGTGGGGTTTCAAATGCAAGTGAAGGAAGGGGTTTGCGAGGACAGGCTGTAGGGAGAGGAAAG CGTGGGCACAGGCGGGCTCAGTCTCCACTTGGTCTTGCCTAAGTAGGGGGGGTAGGGCTTGCACACGAAA TAATTTTGAAAAGCTCTTGTACGTTTTTAGGTTGACATCTAAAGTTTAGGTGTGATTTTTGCAATGGGAG GCAGAAAATATTAAACATTTTAAAAAGATGATATAGGATGAGGACTGACTGCCCTTGGAATGTTTTGAGA CATGATTTGATAAAATGGCTTCTAAAGTACTTTGATTAAGAATGTGCCTTGAATCAGAAAGAAATCTGTT TTTTAAAATCCGTGTGTCTTACAAAATTTTGGCAGTCCCAGAAATATACCAGGTATATTTAAAAGAATCA GTGTCACTAATCTGTACCGCTTTGCGTATAAATTCAGAGCATAACCCTTTGGATGAGCTTTACTCTTCAC AGAAAGATGGATGAGACAGAAAGTCAAAATGCAGTGTGAAAAAATATACCTTGTGGATTTAAGGCACCCA GATTGATCATTTAAGGAGCCTTCCTGTAATGTAGTATCATTCCACAATCTCTTGCTCATAATTCCGAAAT CTAAAAAGCCCTGAAAACTGAAATCCTTTTCTTAAATTTGGCACCATTTATGGCAAAAGTAGATTATAAA GTGGAACTCTTCTGTGAGGCTATTTTATATCTCTATTTCTCCTATTTAATGTGGGAAATTCATACTTTTG CTGCAGGACGGTTAATGCATTTGATTATAGCTTGATGTCCCCTGGCCACGCTGGGGGTGTTAGGTGATGT ATGGGATATCCTAGAACTAGTCTTGTAAAATCCAAAAAATTTTGAATTCCAAAACACATCTGGCCCAGGA GTTTGAGATAAGGGATTAAAGACCAGTCTTTCCAGTTACGCCTTTGTTTGGTGCCCTGGAGGTTTTAATC TTGTCCTCCCATCCGCCCCACCTCGGGGCACTGCATCCTACTGAGATGGGGGGTTGTTCTCTTTCTTTTG CAAAGTGGAGAGAGGGGTGATCAGGTCCTGAACCCAAAGCAGGTTTGCAGGCAGTTTTAGGAATGACATG GAGTTTGAAGCTCTGGAAATAGATTCCTTTAGGACAATTCATGTTGCAAACCCCGCTTAGAGGTCTGCTG CTCCAGGGGCAGCTTTGGGCAGTGAGTATTGGGGTTCAAAGCACATTTCTGTTGTAGAACAGTCTCAGCA CTGGGGAAGGCCTGTGGATTAAATTTCCCTGACTCTTAGTCAGTCTTTGGGATGTCCCAGGGAGGATTTG GGGTCCCCTTTGACTCCTGGCCTAGTCAGGCTGCCCAGTAATAGTTCTTTCTGCCCCGCTTGATCCAGGC TGCAGCGTGTGTTGCAAGTCTTCTTGGAATCAGCTGCAGGACCTGTGCCGCCTGGCCAAGCTCTCCTGCC CTGCCCTCGGTATCTCTAAGAGGAACCTCTATGACTTTGAAGTCGAGTACCTGTGCGATTACAAGAAGAT CCGCGTGAGTCTGGGGTGACCATGCTCTGGGAGGGGACAGGTCACAAGGAAGTTAGTGTCCTGCCCTCTT GTCCCCAACTGCCCACATCTGTTTCCAAAGGGAATTTTCTCCTTTGACCCTGAAAACACAGGATGAATAG ACCCTTTTATCCCTATGTTACAGATAGGGAAACTAAGTAGCTTTCTGGGCAGGAGCCGGAATGAATTCCC AAATAAATCTCTTCCCATCTCCCTAGGAATACAAAGTAATTGCAGAGATTGAGATGCTGAACCCTGGAGT GGAAATGTCAATAGCTAATGGCTATTGAGCACTTTCAGTGTGCCAGGCGTTTCCTCTCGGAAACTCATTT AATCCCCTAACAACTGAAATGGGGATAGTTATTGCCAGAAGGGGGAGTGGCAGGATGGTTAGGAGAACAA ACTGGAGTCAGCATGCTTGGGTTCCAGTCCTGGTTGTGTTACCCCAGGCTACCTACCCAAACCTTCAGTA CTTCATTTTCCTTGTCGTAAAAGAGGGATAACTAGGAGCATCTACCTCATGTGGGGTTGTGAGGATTAAG TTAGTTAATAATACATGTAAGCTGCCTAGAACAGGCAAGGACTTGTCAGGGTCCAGGTGAGCCAGGGTGG TGGCAGTGATGATGGTTTGTCACTGGACGTATTTTGAAGGTGGGGCCAACGGGATGTGCAGAGGGTGGGT GTCGGAAGTGTGAACAAAAGAGAAGTCAAGGATGACTCCAGGAGTTCCGGTCTGAACAGCTAGAAGGGAG GGAGCTGATGATGGGGAAGACCAAGGAGAGGAGTGGGTTTGGGAGATTAATTAAAAGTTGGAACAGTTTG GACAGACAGTAAGGGGGAGAGGAGGATTTGAACCTAGTAATCCTCACTCTAGAGCCCATGCTTTTTAATC ACCGCATGAAGTCATTCCAGAAAAGGGGTGGGGTGGGGTAGGTGTTATCCATCAGCTTTGGGATGGAAGC CCCATGAAGGCTGGCCCAAAGATCTCACTACTTACGGTACCCCCGTCCCCCTACCCACCCCCAACAGGAA CAGGAATATTACCTGGTGAAATGGCGTGGATATCCAGACTCAGAGAGCACCTGGGAGCCACGGCAGAATC
TCAAGTGTGTGCGTATCCTCAAGCAGTTCCACAAGGACTTAGAAAGGGAGCTGCTCCGGCGGCACCACCG
GTCAAAGACCCCCCGGCACCTGGACCCAAGCTTGGCCAACTACCTGGTGCAGAAGGCCAAGCAGAGGCGG
GCGCTCCGTCGCTGGGAGCAGGAGCTCAATGCCAAGCGCAGCCATCTGGGACGCATCACTGTAGAGAATG
AGGTGGACCTGGACGGCCCTCCGCGGGCCTTCGTGTACATCAATGAGTACCGTGTTGGTGAGGGCATCAC
CCTCAACCAGGTGGCTGTGGGCTGCGAGTGCCAGGACTGTCTGTGGGCACCCACTGGAGGCTGCTGCCCG
GGGGCGTCACTGCACAAGTTTGCCTACAATGACCAGGGCCAGGTGCGGCTTCGAGCCGGGCTGCCCATCT
ACGAGTGCAACTCCCGCTGCCGCTGCGGCTATGACTGCCCAAATCGTGTGGTACAGAAGGGTATCCGATA
TGACCTCTGCATCTTCCGCACGGATGATGGGCGTGGCTGGGGCGTCCGCACCCTGGAGAAGATTCGCAAG
AACAGCTTCGTCATGGAGTACGTGGGAGAGGTAGGGAGATGGGACCCGGTGTGTGTGTGCAGCTCTTCCC
ACCCTGTGTTCACAGTGTGCACCCGGCTCTCCTCACTGTGTGTCTGAAACTCCCTGCTTTCCCTATGGGA
AAGGCCTGGGAGACTGATCTGAGTGTCACAGGGACATTGGGCAGGGGCTAGTATTCCAAGCTGGTACACA
CCAGCATGGCCATGCTGGTGGTTACAGGAACACCAAAATACTTCTGCACTGGGTTGACTTTATCAGGGTA
CTTAGCAAAGAAGAAAAGTGGGAGCTGAGATCCAGGCAGCCTTAGCATTCCTTGTAACAGGCCATGTGGT
CTGGCATAGGGCTGCATCAGCTGGAAAGGCACTTCCTCTTCTCATTTCACAAGGGCCCATCTTATCACCA
AGCAGTATCTGCCTGAGGAGCATTGTTTTACCAGTCTGCACAGAAGGAACGCAGTCTGGAGTAGGATGAG
ACATGCCTTGGACAAAGGTTGGCTAACTCCTTTAGACTTTCAGGACACTGGGGAAGGCCGAGTGTATTAG
GCAAGCCAGCCATTGTAAAAACAACCCCCTCATCTTAGTGACTTTGCACATTACAAGTTTGCTTGCTCAT
GGAACAGTCCATTGTGGGGGTTTGAGTGGGTATCCTTTCACACAGCAACTGGGACACCTAGGCTCTTTCC
CTCCTGTGCCTTTGCTGTGCCTTGAAGCCTTGGAGTCACTACCAGATCCTCAGCATTGCCTGGCAGGCGG
GCCAAGTGGGGGATAGAAGGGGCCCATCCTAGTGGGCCAGGCCTAGATGCAGCACCCATCACTTCTGCCC
ATGCTCCACTGGCTGGAACTGAGTCACTGGCCTTACCTCCATGCAAGAGAGGCAACAGGATGTGCTTTAG
CCATGTGCCCAGCTGCACAAGGCTAAAGCACAGCCATAACTAGCAACTAGATAACTAGCAAGTATCTACA
ACAGAAAAATGTCGCATTCTAAGATGGGATGCAGTTAGCATTTGGGATGAGATGATTTTTCGTTATGTAG
AACTGTCTCATGCATTGGGGGACATTTAGCATCCCTGGACCTTGACCATTTAAATCCATGAGTGTGCCCT
GTCATAGTGACAACCCCAGATACCTCTATATATAGCCATAGGTCCCTTAGGGGTGTGATATAGTTGGAAA
GTGACAGAAACTGGCCTGAGGAACACTCACATGAGGGTGTCCACACTGTAGCACTGATACTGATGACAAG
GAGAGGCTCCTACTCTGAGAAACTGTACAGAGGGTCACATCTGACAGGGACAGAGACAATCTTGGGTAGA
ACAATCTACACCACAGAGGACCCTGACAGTCTGGGCAAGGAGACAGCCACACCCTGTCCAGATAACCCTG
CTGGCCTGCTGGAGGAGATGTCTACATGCCACAGGACCTGGCCATCTGGAAGGAGGAGGTGGGGAGGTGT
CCACACCCTGAGGGCTCCTGACAGTGGGCGGGGGAAGGAGTCCTGATAATCTGCAGGAAGTCCATGTCCC
ACAGTGACCCCAGTGACCTGGAGGAAGAGCTTGTGCTCTCCACACTCTAGAGGACCTGGTGGTCTGACTT
AGGAAGTGTTCACACCCATGTTGTCATGACAGGAAAAAGAAGTGTCCTCACCCCAGAGGGATCCGGACAG
CCTGGAGATCTAGTCTACACCCAAGGGCACCCTGACAGTATCGGGGGAAGTGTCCATGCCCTCAATGTCC
TGACGCTCTGGAGGAAGTGTCCAGAGGTTGAAGGAACCCAAACTCTCTGGAGGAGATGTCCAGACCCCAT
AGGACCCAGACAGTCCACCGTCCTAGGGGCTGCACAGAGCAGGAAGTATCTCAGCCTCACTGTACTGGCA
TCTGGAGGAAACACTGTCTACCACACAGGGTCCTGACAGTCGAGGAGGAAGACTACACCCCAAGGGCAGC
CTCAGACCCTCCTGGGCCTGAGACTTTTCTGGCTGCTCTTCCTTAGTGTCAGTGTCTTTAATCCTCCCAG
GGATCCTCTCAGCCCTGTCCTCACCCTTCCTGCTCTCCACACATTCTTGCTGCACTATTTCCTGACCGCC
CTCCAGCACCCTCAGACCCATGGGTCCTCCTGATGGTGCCACAGGCCTCCGGAAAGAGCCAAACTCATCT
TCCCGCATTCCCCTCTGAAGAGACAGTATAGCAAATGGTTAGGAGGGTGGACTCTGGATCCTGACTGCCC
GAGGCTGAATCCCAGCTCCACTACTCATCAGCAATCACTAACCTCTGTGCCTGCATTTACTATGTAAAAT
GGGAACAATAATAGCACTCACCTCACAGGCTTGTTACAAAAATTAAATGAGTTACTATGTATCAAGCACT
TGGAAAAAGCACTTGAACAGTGTTCAGTACACAGTAAGTTTGATACAAATGTTATCAGCATAGTTCAAAC
TTCAGCAAATCCAAAATGTCTGGAAGACCAAGTTTTTTTGTAACCCATCTGGCTACAGGACCCAGCCTGA
CCGGATAGGGTCCTATTTGTAGTTTTTATTTATCCTACTTGGGGTAATAGTCATACATTTCGTTGCAGCA
GTTCTAATTTACTTGATTCTGTAGTGCCGTCCCAGATGCTGCCAGGGTGTTACGGAATCAAGGGCCTATC
TGCACACCATGCTATCTACTGTCCTTCTTCAGCTGGGACATGTACTGACAGTCTGTACCAAGAGCTCCCT
CCACGGGAGCTGCCCTTCCCTCCTTTGCAGCCTCCCACATTGGGTCAGAACTTTCACGTTCCTGCAGAAC
ATTCCCATCCTCACCCAAGAGACAATGCCAGCCTATTTTATCCATTCTAAAACATGCATTTTCTTCCTAT
TTTAACATCTCGGAAATGAAGATGTCTTAATTAAATCATGGTGTATCATTTATAATTAACAGCAGTTTTT
CCTTTCTTGGTAAAGGGCACATAAAATTAAGGGTGTGCCTTACATTTATAACTGGTCCTCATAACCACTC
CTAACATTGCTCACTCTCCTATCAGAAACAGGAACACCTTTCACGTCCATGATCTTGTATGGATCTTTAC
AACAGCCCCTGTCAGGTTGGGATTTTGTCACTGTCATTCCCATTCTGCAGATGAGAAAACTGAGGCCCAG
AGAGGTAGAATAACTTGATTAAAATCACAAAAGTAGTACAATGGATAAAAAAATAAAGGCCCAAATAATA
TCTAAAACTGGTACCCTGCCAGGCTGTAGCTTTTTTTTTTTTTTTTTAGCTGAGGAAACAGGCACAGAGA
GAACATTCAGGATCCCATATCCAGGAGGGGGCAGAGCAGCAGCTGACTCCAAGTCTTCTAGTTCCCATTC
ACGTCAGCACCCTCTCGGAACTGCCAGCTTACAGCCTGTCTTTTCCATTCATTCTGGAGAGCTGTTAGGG
AGCAGAGACAGGCCCATCTGTTCCCAAGCTTTCAGGGTTGACCAATCATTAGAGAATGGGACTGAAAAGA
AGATGAGAAGGAACCAAGAAGTGTTTGTGCCCTGGAGGGCCTGCAGTATGACTCACTCCTGGTGAGACTG GGAGAGCAGGTAGTGGCAGAATAGGCATGAAGATGGAGACTAGGAAGGATGTGGGCACTCCTCCTGGCTC
AAGGAGGGCCTACGGTGAAAAAGATGGCTCATACCCCACCCACTAGGCCTGTGAGCCTGGGAGAGGCTGC
CCTTTGATCCCAGGACTTGATCAGACAAGTGGCCAGCTTCTGAGGTAGGGGAGGAACGGGAAGCTTGGAA
GGCTGCCTAGAGAGGTCCCATCTGTTTGAGCTGATGCCACAAGGAAGACTGTTCTCCAGGAGGTGAAGGG
AGACTGATCTTGACATATTCCACCCTCATGTTGTGGCCCTTAGGAGAGAGTCCCCACTCTTCCACCAGGT
GGTAAAGCCCTTTTATGATCTGCAACTCGTTTTAGAGAATCCGTCTCTTCTCCATTCCCCCTCAAGCCCT
AAGCACTGTTTCCTGATCACAGTCTTACACTGTGGGTGTGTGAATCTGTCTCTCTGTGACCAGACTTTGA
CCCCTTGAGGGCAGGGACCAATCCTGGTTCCTGTGTATCCCCTACCCACCTGTGACCCCTGAGAGTGGAC
CGGGCCTGGTCCCTGTGTCTCCCTGATCAGACCGTGAGCCCTGCATGCTGGGACTGGGCACAAGGAAGGC
CTCAATAAAAACCCTGGCAAGGGAGCCAGGTTCCTCAAGGAACAGAACTGGAGCACGGGGCAGTGGGTAG
TGTGGCCCGAGGCAGGGTAAATCTTGGTTTCCTCAAGGCATTGTTAGTCAGCCTTTGGCATGGAACACAG
CCTTGAGGGGACAGCCAGGGAGAACACCAGTGTGGCCATCCTAGCTAAGGAGATGGATTCCCAAGTCAGA
AGGGCATGGTCACCGGCCCACATGAGGGTGAGCAAGGAAGGAAGCCCGAGAGGGGTCTCTGGAGAAGGGA
GGGGAAGGAAGAAGTGTGGCGGGGGAGTACTGGAGCTACCTGGAGGGCCGCCACTTGGACAGAGGACAGG
CTGCTAAGCCAGGAAGCAGAATCAAAGTAAACAGCAGTCCCCATGTGTCTCCTGTGTGCTGTGCACTGTT
CTTGGCTGAGGTACAGTGGGACCCCTACCCAGGGAAGGGCCTGGTCAGCTACGCTTGGGGATTGGCAGGA
GGCTGCCGTTGCTGGCCTCAGGGAAGAGGGGCCATGGGGCCGGAGATTTGTTGGCGTGGATTGGGAGGCA
AGGACAGGCTGGGGCTAGGATGGCAGCAAAGCTTCCCATTTCCTAGGACAGGTAGGGAACCAGCTGGGGA
GGAGGCACCCACTGCCGTCTGAAGCACCAGTTGGCACTGCGCAGCCCTGGGCCGAGGGAGAGCTTCTCTC
ACTGTGCTCTCCCTTCATCTTTCCTCCTCCTCTGCTGCTGTCTCTGAAGTGTGTGGCCTCAGCCTCTTTC
TGGCTCTCTGAACCTGGGCCTCCCTCTGCCTCTGCCTCCACCTCTCTTGTCTTGAGGCCCTTGCCCCCTT
TCCCCATGGCCTGGGTCTCTTCTTCCCCTCTCTCCACGCCCTCCCTGCTGGGTCCTGCATGGGCTCAGGC
TCCCTTGCCTGGATCAGTAAGTATCTCTCCCTGTGGCACCCTGGGTCACTTTCTTTCTTGCCCTTGCTTT
GGTCTCTCCTGATCACCTTCCTGCTCCGTCCCAAGGCACTGGAGGCTCCAGGGGTTCTTGGGCAGCTCTT
GCTGGGTGGCGGCAGGAGGTGCTCGCGTGGCCCCAGTTGGGCCCTGCAGCCAGGCCAGCCTGCACTCACC
GCCAGGGACTCCTCCTGCTAGCCAGAGGCCTGAGGCGGGCCAGGCAGTTGCCAGCTGAGGCCCAGCTCCT
CAGGAAGGGCCGACAGACTCTCTGCGTCACTGCCCATGTGTGTCCACGGGCAGGGGTGCCTCCTGCTCCC
TGTCCTTCAGAAGTCAGGAGCAGTGCCGGCTTTCCTGAGACTTCGCGGCCAATCTCCCCTTACCCATGGC
CCTTTCCCTAGATCATTACCTCAGAGGAGGCAGAGCGGCGGGGCCAGATCTACGACCGTCAGGGCGCCAC
CTACCTCTTTGACCTGGACTACGTGGAGGACGTGTACACCGTGGATGCCGCCTACTATGGCAACATCTCC
CACTTTGTCAACCACAGTGTGGGTACCCCCGGCAGGCGGGCAAGGGGTCGAGAGGGGCAGGCTGGAGCCC
CTCCTCACTCTCCCAACTGTTCTTTCTCGCCCAGTGTGACCCCAACCTGCAGGTGTACAACGTCTTCATA
GACAACCTTGACGAGCGGCTGCCCCGCATCGCTTTCTTTGCCACAAGAACCATCCGGGCAGGCGAGGAGC
TCACCTTTGATTACAACATGCAAGGTGGGGGTGGCAAGGGACTGGGGGCAGGGGCGCACTGTGACTTGGG
ACACAAGGACCCCTCCCAAAGGCACACCAGTCACTCAGAGAACCAAGGAAAATTCTTTAGCGGGAGCTTT
AAGATGCTCTTCCTGACTCCCAGTCCCCCATTCGGACTACTAGACCCCTGCCTACCCCTCGAGTCCCCTC
ATTCCCAGCCCCTGAACCCTAACCCTGAGGCATTCATACCAACTTCTCCCAAGATTCCTGGAGAGTTAAG
AAACTCCTGACTCCAGTCTTGACTGAGTTTCCCTCATCCCCCAGCCCCTCCCCACTCCTAGCTCCCTTTG
GCCTTCTTCATCCCAAGCCTCTGGACACCCTTGTGGCCTCCAGCCAGTCCCCTCCTTGATAAGCTAGCCA
CCTCTGAGACCCTCAAGGGCAGGTCTTTGGCAGGAGAGTTCAGATGTACCTCTGGATGCCCAGGTGGCCC
TCTATTCCTGCCCCTGCCCCCCCCCACACACCTAAAACGACCCTCCTGGTTCCTTGACGGCTCCCTGCCT
CCCCCAGCATTCTTCAACCCCTGGCCTGAACAACCTCCAGTGCTGAGCCCTGGCCCTAGCCCCAAACCAC
CAACCCTAAGATCTCCCAACTCAAATCCCAGAGTTGCTCCCAGCCCCAAAGATCCTTGGTCTCATGGTAT
AAAGGGTAGTGGGACCCTTCATCCAGGCCTTCTAACAAGTCCCCTGCCTCCTTCCCTACCTTCCTCCCTC
CCTCCTTCTCCCCCTCCCTCCCTGCCTCCTTCCCTCCTCTCCTCCCTGGCTGTGACTCCACAGTGGACCC
CGTGGACATGGAGAGCACCCGCATGGACTCCAACTTTGGCCTGGCTGGGCTCCCTGGCTCCCCTAAGAAG
CGGGTCCGTATTGAATGCAAGTGTGGGACTGAGTCCTGCCGCAAATACCTCTTCTAGCCCTTAGAAGTCT
GAGGCCAGACTGACTGAGGGGGCCTGAAGCTACATGCACCTCCCCCACTGCTGCCCTCCTGTCGAGAATG
ACTGCCAGGGCCTCGCCTGCCTCCACCTGCCCCCACCTGCTCCTACCTGCTCTACGTTCAGGGCTGTGGC
CGTGGTGAGGACCGACTCCAGGAGTCCCCTTTCCCTGTCCCAGCCCCATCTGTGGGTTGCACTTACAAAC
CCCCACCCACCTTCAGAAATAGTTTTTCAACATCAAGACTCTCTGTCGTTGGGATTCATGGCCTATTAAG
GAGGTCCAAGGGGTGAGTCCCAACCCAGCCCCAGAATATATTTGTTTTTGCACCTGCTTCTGCCTGGAGA
TTGAGGGGTCTGCTGCAGGCCTCCTCCCTGCTGCCCCAAAGGTATGGGGAAGCAACCCCAGAGCAGGCAG
ACATCAGAGGCCAGAGTGCCTAGCCCGACATGAAGCTGGTTCCCCAACCACAGAAACTTTGTACTAGTGA
AAGAAAGGGGGTCCCTGGGCTACGGGCTGAGGCTGGTTTCTGCTCGTGCTTACAGTGCTGGGTAGTGTTG
GCCCTAAGAGCTGTAGGGTCTCTTCTTCAGGGCTGCATATCTGAGAAGTGGATGCCCACATGCCACTGGA
AGGGAAGTGGGTGTCCATGGGCCACTGAGCAGTGAGAGGAAGGCAGTGCAGAGCTGGCCAGCCCTGGAGG
TAGGCTGGGACCAAGCTCTGCCTTCACAGTGCAGTGAAGGTACCTAGGGCTCTTGGGAGCTCTGCGGTTG
CTAGGGGCCCTGACCTGGGGTGTCATGACCGCTGACACCACTCAGAGCTGGAACCAAGATCTAGATAGTC
CGTAGATAGCACTTAGGACAAGAATGTGCATTGATGGGGTGGTGATGAGGTGCCAGGCACTGGGTAGAGC ACCTGGTCCACGTGGATTGTCTCAGGGAAGCCTTGAAAACCACGGAGGTGGATGCCAGGAAAGGGCCCAT
GTGGCAGAAGGCAAAGTACAGGCCAAGAATTGGGGGTGGGGGAGATGGCTTCCCCACTATGGGATGACGA
GGCGAGAGGGAAGCCCTTGCTGCCTGCCATTCCCAGACCCCAGCCCTTTGTGCTCACCCTGGTTCCACTG
GTCTCAAAAGTCACCTGCCTACAAATGTACAAAAGGCGAAGGTTCTGATGGCTGCCTTGCTCCTTGCTCC
CCCACCCCCTGTGAGGACTTCTCTAGGAAGTCCTTCCTGACTACCTGTGCCCAGAGTGCCCCTACATGAG
ACTGTATGCCCTGCTATCAGATGCCAGATCTATGTGTCTGTCTGTGTGTCCATCCCGCCGGCCCCCCAGA
CTAACCTCCAGGCATGGACTGAATCTGGTTCTCCTCTTGTACACCCCTCAACCCTATGCAGCCTGGAGTG GGC AT CAATAAAAT GAAC T GT C GAG T GAACAAA
One exemplary human protein sequence is SEQ ID NO: 2
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRWQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEI ITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
It is understood that polymorphisms or variants with different sequences exist in various subject’s genomes. The term Suv39h1 according to the invention thus encompasses all mammalian variants of Suv39h1 , and genes that encode a protein at least 75%, 80%, or typically 85%, 90%, or 95% identical to SEQ ID NO: 2 and that has Suv39h1 activity (i.e., the methylation of Lys-9 of histone H3 by H3K9-histone methyltransferase).
Human Suv39h2 methyltransferase is referenced as G5E9A8 in UNIPROT and is encoded by the Suv39h2 gene located on chromosome 10 (p13) (gene ID: 79723 in NCBI).
Inhibition of Suv39h1 refers to a decrease of at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% or more of Suv39h1 protein activity, and/or protein level, Suv39h1 gene expression, and/or Suv39h1 transcript level in a cell or in an organism as compared to normal level (e.g., normal level typically refers to the expression level in a corresponding normal cell or organism, wherein the expression has not been modified). It is of course intended that reduced or decrease activity of Suv39h1 can indeed be achieved by reduced gene expression (at the genomic or transcript level) and/or by the expression of a non-functional Suv39h1 protein.
Inhibition of Suv39h1 activity according to the present invention can thus be achieved at the genomic, transcriptomic, and/or at the protein level. As per the invention, an inhibitor of Suv39h1 can thus be selected among any natural compound or not having the ability to inhibit Suv39h1 methyltransferase activity and/or gene expression (transcription and/or translation). The inhibiting activity of a compound may be determined using various methods as described in Greiner D. Et al. Nat Chem Biol. 2005 Aug;l(3): 143-5 or Eskeland, R. et al. Biochemistry 43, 3740-3749 (2004).
"Inhibition of Suv39h1 activity" as used herein refers to a decrease of Suv39h1 activity of at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% or more as compared to the activity or level of the Suv39h1 protein which is not inhibited (e.g., as compared to a corresponding cell, tissue, or organism without inhibition). Preferentially, the inhibition of Suv39h1 activity leads to the absence in the cell, tissue, or organism of substantial detectable activity of Suv39h1. The inhibition level of Suv39h1 activity (i.e., Suv39h1 inactivation efficiency) can be assessed typically by assessing the levels of H3K9me3 (see as a matter of illustration HMT activity assessment in Nishioka, Kenichi et al. “Set9, a novel histone H3 methyltransferase that facilitates transcription by precluding histone tail modifications required for heterochromatin formation.” Genes & development vol. 16,4 (2002): 479-89; but see also Allan, Rhys S et al. “An epigenetic silencing pathway controlling T helper 2 cell lineage commitment.” Nature vol. 487,7406 (2012): 249-53 using chromatin immunoprecipitation (ChIP) with antibodies specific for H3K9me3 and H3K9ac).
“Reduced expression of Suv39h1” as per the invention refers to a decrease of Suv39h1 protein and or/transcript expression of at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% or more as compared to normal level (e.g., normal level typically refers to the expression level in a corresponding normal cell or organism, wherein the expression has not been modified).
By “non-functional” Suv39h1 protein it is herein intended a protein with a reduced activity, or a lack of detectable activity as described above. Thus, inhibitors of Suv39h1 activity in a cell according to the invention can be selected among any compound or agent natural or not having the ability of inhibiting the methylation of Lys-9 of histone H3 by H3K9-histone methyltransferase or inhibiting the H3K9-histone methyltransferase Suv39h1 gene expression.
As detailed below, a Suv39h1 inhibitor can be selected from a nucleic acid, a peptide, a ribonucleic complex, a ribonucleoprotein (RNP) complex, a small molecule, as well derivatives and combinations thereof. In the context of the present invention, an inhibitor Suv39h1 according to the present invention is preferably selective for Suv39h1 , as compared with other histone methyltransferases such EZH2, G9A or Setdbl . In some embodiments, an inhibitor according to the present invention inhibits both Suv39h1 and Suv39h2, preferably said inhibitor is selective for Suv39h1 and Suv39h2. The inhibitor of Suv39h1 can also be selective for Suv39h1 as compared with the histone methyltransferase Suv39h2. By "selective" it is meant that the affinity of the inhibitor is at least 10-fold, preferably 25- fold, more preferably 100-fold, and still preferably 500-fold higher than the affinity for other histone methyltransferases.
Typically, the inhibitor of Suv39h1 of the invention has an IC50 of less than 20 pM, preferably less than 10 pM, more preferably less than 5 pM, even more preferably less than 1 pM or less than 0.5 pM. Typically also the inhibitor of SUV39H1 has an IC50 for the other methyltransferase such as for example EZH2, G9A or Setbdl of more than 10 pM, preferably more than 20 pM, more preferably more than 50 pM.
In some embodiments, the Suv39h1 inhibitor specifically inhibits Suv39h1 activity (e.g. relative to other histone methyltransferases (HMTs) such as one or more of G9a, DOT1 , EZH1 , EZH2, GLP, MLL1 , MLL2, MLL3, MLL4, NSD2, SETIb, SET7/9, SET8, SETMAR, SMYD2, Suv39h2). The inhibition may be at least about 2, 3, 4, 5, 10, 100, or 1000 fold greater inhibition relative to inhibition of other histone methyltransferases such as one or more of G9a, DOT1 , EZH1 , EZH2, GLP, MLL1 , MLL2, MLL3, MLL4, NSD2, Setlb, SET7/9, SET8, SETMAR, SMYD2, Suv39h2. In embodiments, the inhibition of Suv39h1 may be at least 2; 3; 4; 5; 6; 7; 8; 9 or 10 fold greater than the inhibition of other HMTs described herein.
In some embodiments, the inhibition of Suv39h1 may be at least 10; 20, 30, 40; 50; 60, 70; 80; 90 or 100-fold greater than the inhibition of other HMTs described herein.
In some embodiments, Suv39h1 inhibition is achieved using a Suv39h1 inhibitor selected among natural compounds or not, having the ability to inhibit the methylation of Lys-9 of histone H3 by H3K9-histone methyltransferase, for example by using a small molecule inhibitor (i.e., a small organic molecule). In some embodiments, the inhibitor of Suv39h1 according to the present invention is not triptolide and/or is not chaetocin.
Small molecules: The term "small organic molecule" refers to a molecule of a size comparable to those organic molecules generally used in pharmaceuticals. The term excludes biological macro molecules (e. g., proteins, nucleic acids, etc.). Preferred small organic molecules range in size up to about 5000 Da, more preferably up to 2000 Da, and most preferably up to about 1000 Da.
In a particular embodiment, the inhibitor of H3K9 -histone methyltransferase Suv39h1 is chaetocin (CAS 28097-03-2) as described by Greiner D, Bonaldi T, Eskeland R, Roemer E, Imhof A. “Identification of a specific inhibitor of the histone methyltransferase SU(VAR)3-9”. Nat Chem Biol. 2005 Aug;l(3): 143-5.; Weber, H. P., et al, “The molecular structure and absolute configuration of chaetocin”, Acta Cryst, B28, 2945-2951 (1972) ; Udagawa, S., et al, “The production of chaetoglobosins, sterigmatocystin, O-methylsterigmatocystin, and chaetocin by Chaetomium spp. and related fungi”, Can. J. microbiol, 25, 170-177 (1979); and Gardiner, D. M., et al, “The epipolythiodioxopiperazine (ETP) class of fungal toxins: distribution, mode of action, functions and biosynthesis”, Microbiol, 151 , 1021-1032 (2005). For example, chaetocin is commercially available from Sigma Aldrich.
An inhibitor of Suv39h1 can also be ETP69 (Rac-(3S,6S,7S,8aS)-6- (benzo[d][1 ,3]dioxol-5-yl)-2,3,7-trimethyl-1 ,4-dioxohexahydro-6H-3,8a- epidithiopyrrolo[1 ,2-a]pyrazine-7-carbonitrile), a racemic analog of the epidithiodiketopiperazine alkaloid chaetocin A (see WO2014066435 but see also Baumann M, Dieskau AP, Loertscher BM, et al. Tricyclic Analogues of Epidithiodioxopiperazine Alkaloids with Promising In Vitro and In Vivo Antitumor Activity. Chemical science (Royal Society of Chemistry : 2010). 2015;6:4451-4457, and Snigdha S, Prieto GA, Petrosyan A, et al. H3K9me3 Inhibition Improves Memory, Promotes Spine Formation, and Increases BDNF Levels in the Aged Hippocampus. The Journal of Neuroscience. 2016;36(12):3611-3622).
Identification of new small molecule inhibitors can be achieved according to classical techniques in the field. The current prevailing approach to identify hit compounds is with a high throughput screen (HTS).
Aptamers, intrabodies and affibodies:
In another embodiments, the inhibitor Suv39h1 is an aptamer. Aptamers are a class of molecules that represents an alternative to antibodies in term of molecular recognition. Aptamers are oligonucleotide or oligopeptide sequences with the capacity to recognize virtually any class of target molecules with high affinity and specificity. Such ligands may be isolated through Systematic Evolution of Ligands by Exponential enrichment (SELEX) of a random sequence library, as described in Tuerk C. and Gold L., 1990. The random sequence library is obtainable by combinatorial chemical synthesis of DNA. In this library, each member is a linear oligomer of a unique sequence that is optionally chemically modified. Possible modifications, uses and advantages of this class of molecules have been reviewed in Jayasena S.D., 1999. Peptide aptamers consists of a conformationally constrained antibody variable region displayed by a platform protein, such as E. coli Thioredoxin A that are selected from combinatorial libraries by two hybrid methods (Colas P, Cohen B, Jessen T, Grishina I, McCoy J, Brent R. “Genetic selection of peptide aptamers that recognize and inhibit cyclin- dependent kinase 2”. Nature. 1996 Apr 11 ;380(6574):548-50).
Inhibition of Suv39h1 in a cell according to the invention may also be achieved with intrabodies. Intrabodies are antibodies that bind intracellularly to their antigen after being produced in the same cell (for a review se for example, Marschall AL, Dubel S and Boldicke T “Specific in vivo knockdown of protein function by intrabodies”, MAbs. 2015;7(6): 1010-35. but see also Van Impe K, Bethuyne J, Cool S, Impens F, Ruano- Gallego D, De Wever O, Vanloo B, Van Troys M, Lambein K, Boucherie C, et al. “A nanobody targeting the F-actin capping protein CapG restrains breast cancer metastasis”. Breast Cancer Res 2013; 15:R116; Hyland S, Beerli RR, Barbas CF, Hynes NE, Weis W.. “Generation and functional characterization of intracellular antibodies interacting with the kinase domain of human EGF receptor. Oncogene 2003; 22:1557-67”; Lobato MN, Rabbitts TH. “Intracellular antibodies and challenges facing their use as therapeutic agents”. Trends Mol Med 2003; 9:390-6, and Donini M, Morea V, Desiderio A, Pashkoulov D, Villani ME, Tramontane A, Benvenuto E. “Engineering stable cytoplasmic intrabodies with designed specificity”. J Mol Biol. 2003 Jul 4;330(2):323-32.). Intrabodies can be generated by cloning the respective cDNA from an existing hybridoma clone or more conveniently, new scFvs/Fabs can be selected from in vitro display techniques such as phage display which provide the necessary gene encoding the antibody from the onset and allow a more detailed predesign of antibody fine specificity. In addition, bacterial-, yeast-, mammalian cell surface display and ribosome display can be employed. However, the most commonly used in vitro display system, for selection of specific antibodies, is phage display. In a procedure called panning (affinity selection), recombinant antibody phages are selected by incubation of the antibody phage repertoire with the antigen. This process is repeated several times leading to enriched antibody repertoires comprising specific antigen binders to almost any possible target. To date, in vitro assembled recombinant human antibody libraries have already yielded thousands of novel recombinant antibody fragments. It is to be noted that the prerequisite for a specific protein knockdown by a cytoplasmic intrabody is that the antigen is neutralized/inactivated through the antibody binding. Five different approaches to generate suitable antibodies have emerged : 1 ) In vivo selection of functional intrabodies in eukaryotes such as yeast and in prokaryotes such as E.coli (antigen-dependent and independent); 2) generation of antibody fusion proteins for improving cytosolic stability; 3) use of special frameworks for improving cytosolic stability (e.g., by grafting CDRs or introduction of synthetic CDRs in stable antibody frameworks); 4) use of single domain antibodies for improved cytosolic stability; and 5) selection of disulfide bond free stable intrabodies. Those approaches are notably detailed in Marschall, A. L et al., mAbs 2015, as mentioned above.
The most frequent format for intrabodies is the scFv, which consists of the H- and L- chain variable antibody domain (VH and VL) held together by a short, flexible linker sequence (frequently (Gly4Ser)3), to avoid the need for separate expression and assembly of the 2 antibody chains of a full IgG or Fab molecule. Alternatively, the Fab format comprising additionally the C1 domain of the heavy chain, and the constant region of the light chain has been used. Recently, a new possible format for intrabodies, the scFab, has been described. The scFab format promises easier subcloning of available Fab genes into the intracellular expression vector, but it remains to be seen whether this provides any advantage over the well-established scFv format. In addition to scFv and Fab, bispecific formats have been used as intrabodies. A bispecific Tie-2 x VEGFR-2 antibody targeted to the ER demonstrated an extended half-life compared to the monospecific antibody counterparts. A bispecific transmembrane intrabody has been developed as a special format to simultaneously recognize intra- and extracellular epitopes of the epidermal growth factor, combining the distinct features of the related monospecific antibodies, i.e., inhibition of autophosphorylation and ligand binding. Another intrabody format particularly suitable for cytoplasmic expression are single domain antibodies (also called nanobodies) derived from camels or consisting of one human VH domain or human VL domain. These single domain antibodies often have advantageous properties, e.g., high stability; good solubility; ease of library cloning and selection; high expression yield in E. coli and yeasts.
The intrabody gene can be expressed inside the target cell after transfection with an expression plasmid or viral transduction with a recombinant virus. Typically, the choice is aimed at providing optimal intrabody transfection and production levels. Successful transfection and subsequent intrabody production can be analyzed by immunoblot detection of the produced antibody, but, for the evaluation of correct intrabody/antigen- interaction, co-immunoprecipitation from HEK293 cell extracts transiently cotransfected with the corresponding antigen and intrabody expression plasmids may be used.
In other embodiments, inhibition of Suv39h1 in a cell may also be achieved with affibody molecules. Affibody are small proteins engineered to bind to a large number of target proteins or peptides with high affinity, imitating monoclonal antibodies, which are therefore a member of the family of antibody mimetics (see for review Lofblom J, Feldwisch J, Tolmachev V, Carlsson J, Stahl S, Frejd FY. Affibody molecules: engineered proteins for therapeutic, diagnostic and biotechnological applications. FEBS Lett. 2010 Jun 18;584(12):2670-80). Affibody molecules are based on an engineered variant (the Z domain) of the B-domain in the immunoglobulin-binding regions of staphylococcal protein A, with specific binding for theoretically any given target. Affibody molecule libraries are generally constructed by combinatorial randomization of 13 amino acid positions in helices one and two that comprise the original Fc-binding surface of the Z-domain. The libraries have typically been displayed on phages, followed by bio-panning against desired targets. Should the affinity of the primary be increased, affinity maturation generally results in improved binders and may be achieved by either helix shuffling or sequence alignment combined with directed combinatorial mutagenesis. The newly identified molecules with their altered binding surface generally keep the original helical structure as well as the high stability, although unique exceptions with interesting properties have been reported. Due to their small size and rapid folding properties, affibody molecules can be produced by chemical peptide synthesis.
Repression of Suv39h1 nene expression:
In some embodiments, Suv39h1 inhibition is achieved through repression of the Suv39h1 gene expression, through inactivation of the Suv39h1 gene of the cell, or through expression of exogenous inhibitors. For example, Suv39h1 repression (at the genomic and/or transcriptomic level) may reduce expression of Suv39h1 in the cell by at least 50, 60, 70, 80, 90, or 95% as to the same cell produced by the method in the absence of the repression. Gene disruption may a lead to a reduced expression of the Suv39h1 protein or to the expression of a non-functional Suv39h1 protein. Inhibition or repression of Suv39h1 activity, notably including inhibition or repression of Suv39h1 expression, in one or more cell, or in an individual, according to the present invention can be permanent and irreversible or transient or reversible. In some embodiments, Suv39h1 inhibition, disruption or repression is permanent and irreversible.
Antagonistic nucleic acids
In some embodiments, a Suv39h1 inhibitor reduces the expression of a Suv39h1 protein, for example by gene repression/suppression through gene knockdown using antagonistic nucleic acids which are typically capable of inhibiting or reducing the expression of a gene or a transcript thereof and/or translation into a protein. Antagonistic nucleic acids (also named herein nucleic acis inhibitors or inhibitor polynucleotides) typically include short interfering RNAs (siRNAs) short hairpin RNAs (shRNAs), anti-sense oligonucleotides (ASOs), non-coding RNAs, such as long noncoding RNAs (IncRNAs), aptamers or ribozymes. Suitable Suv39h1 inhibitors include, for example, agents that hybridize or bind to the Suv39h1 gene or its regulatory elements, such as aptamers that block or inhibit Suv39h1 expression or activity as well as nucleic acid molecules that block transcription or translation, such as antisense molecules complementary to Suv39h1 (e.g. anti-sense RNAs) such as RNA interfering agents (such as a small interfering RNAs (siRNAs), small hairpin RNAs (shRNAs), microRNAs (miRNAs), piwiRNAs (piRNAs)); long non-coding RNAs (IncRNAs), antisense oligonucleotides (ASOs), ribozymes and combinations thereof. The mechanism of RNAi is based on the sequence-specific degradation of host mRNA through the cytoplasmic delivery of double-stranded RNA (dsRNA) identical to the target sequence. RNAi can be transfected as plasmid vectors encoding thereof, transcribed by heterologous promoters, or can be delivered into mammalian cells through infection of the cell with virally produced vectors.
An "RNA interfering agent" as used herein, is defined as any agent, which interferes with or inhibits expression of a target biomarker gene by RNA interference (RNAi). Such RNA interfering agents include, but are not limited to, nucleic acid molecules including RNA molecules, which are homologous to the target gene of the invention (e.g., Suv39h1 ), or a fragment thereof, short interfering RNA (siRNA), and small molecules which interfere with or inhibit expression of the target nucleic acid by RNA interference (RNAi). siRNAs are small (~12-35 nucleotide) non-coding RNA molecules capable of inducing RNAi. siRNAs comprise an RNA duplex (double-stranded region) formed by complement base pairing with phosphorylated 5'-ends and hydroxylated 3'-ends, optionally with one or two single-stranded overhanging nucleotides. The duplex portion typically comprises between 17 and 29 nucleotides. siRNA may de generated from two RNA molecules that hybridize together or may alternatively be generated from a single RNA molecule that includes a self-hybridizing portion (shRNA). The duplex portion of an siRNA may, but typically does not, include one or more bulges containing one or more unpaired and/or mismatched nucleotides in one or both strands of the duplex or may contain one or more non-complementary nucleotide pairs. One strand of a siRNA (referred to as the antisense strand) includes a portion that hybridizes with a target transcript (e.g. a target mRNA). The antisense strand may be precisely complementary with a complementary region of the target transcript (i.e. the siRNA antisense strand may hybridize to the target sequence without a single mismatch, wobble base pairing or nucleotide bulge) or one or more mismatches, wobble (G:ll) base pairings and/or nucleotide bulges between the siRNA antisense strand and the complementary region of the target transcript may exist.
Small inhibitory RNAs (siRNAs) can function as inhibitors of expression for use in the present invention. H3K9-histone methyltransferase Suv39h1 gene expression can be reduced by contacting a subject or cell with a small double stranded RNA (dsRNA), or a vector or construct causing the production of a small double stranded RNA, such that H3K9-histone methyltransferase Suv39h1 expression is specifically inhibited (i.e., RNA interference or RNAi). Methods for selecting an appropriate dsRNA or dsRNA- encoding vector are well known in the art for genes whose sequence are well known by persons skilled in the art (see for example Tuschl, T. et al. (1999); Elbashir, S. M. et al. (2001 ); Hannon, GJ. (2002); McManus, MT. et al. (2002); Brummelkamp, TR. et al. (2002); U.S. Pat. Nos. 6,573,099 and 6,506,559; and International Patent Publication Nos. WO 01/36646, WO 99/32619, and WO 01/68836). All or part of the phosphodiester bonds of the siRNAs of the invention are advantageously protected. This protection is generally implemented via the chemical route using methods that are currently used in the field. The phosphodiester bonds can be protected, for example, by a thiol or amine functional group or by a phenyl group. The 5'- and/or 3'- ends of the siRNAs of the invention are also advantageously protected, for example, using the technique described above for protecting the phosphodiester bonds. The siRNAs sequences advantageously comprise at least twelve contiguous dinucleotides or derivatives thereof.
Anti-sense oligonucleotides (ASOs), including anti-sense RNA molecules and antisense DNA molecules, can act to directly block the translation of H3K9-histone methyltransferase Suv39h1 and thus preventing protein translation and/or increasing mRNA degradation, thus decreasing the level of H3K9-histone methyltransferase SUV39H1 and thus its activity in a cell. For example, antisense oligonucleotides of at least about 15 bases and complementary to unique regions of the mRNA transcript sequence encoding H3K9-histone methyltransferase SUV39H1 can be synthesized, e.g., by conventional phosphodiester techniques and administered by e.g., intravenous injection or infusion. Methods for using antisense techniques for specifically inhibiting gene expression of genes whose sequence is known are well known in the art (see for example U.S. Pat. Nos. 6,566,135; 6,566, 131 ; 6,365,354; 6,410,323; 6,107,091 ; 6,046,321 ; and 5,981 ,732).
Antisense RNAs or asRNAs are typically single or double-stranded RNA molecules exhibiting preferably at least 90%, more preferably 95% and especially 100% (of the nucleotides of a dsRNA) sequence identity to a section of a naturally occurring mRNA sequence, such as herein a portion of a SUV39H1 mRNA.
“MicroRNAs” or “miRNAs” are small (~20-24 nucleotide) non-coding double-stranded RNAs (dsRNAs) capable of recruiting the AGO-2 RISC complex to a complementary target transcript, thereby preferably inducing the miRNA-mediated RNAi pathway. MicroRNAs are typically processed from pri-microRNA to short stem-loop structures called pre-microRNA and finally to mature miRNA. Both strands of the stem of the pre- microRNA may be processed to a mature microRNA. After processing, the mature single-stranded microRNAs, associated with Argonaute 2 (AG02) in the RNA-induced silencing complex (RISC), typically bind to the 3' UTRs of their cytosolic mRNA targets, resulting in either reduced translation or deadenylation and degradation of the mRNA transcript. The predominant function of microRNAs is thus to (negatively) regulate protein translation by binding to complementary sequences of target mRNAs. The term “microRNA” includes miRNAs, mature single stranded miRNAs, precursor miRNAs (pre-miRNA), primary miRNA transcripts (pri-miRNA), duplex miRNAs and variants thereof. MicroRNAs are particularly envisaged to be capable of binding to a target site within a 3" untranslated region of a target nucleic acid. shRNAs (short hairpin RNA) can also function as inhibitors of expression for use in the present invention. shRNAs are typically composed of a short (e.g., 19-25 nucleotide) antisense strand, followed by a 5-9 nucleotide loop, and the analogous sense strand. Alternatively, the sense strand may precede the nucleotide loop structure and the antisense strand may follow. Principles and design of shRNA is for example described in Moore CB, Guthrie EH, Huang MT, Taxman DJ. Short hairpin RNA (shRNA): design, delivery, and assessment of gene knockdown. Methods Mol Biol. 2010;629:141-58, but see also Taxman DJ. siRNA and shRNA design. In: Helliwell TDC, editor. RNA Interference Methods for Plants and Animals. Vol. 10. CABI; Oxfordshire, UK: 2009. pp. 228-253. shRNAs are capable of DNA integration and typically consist of two complementary 19-22 bp RNA sequences linked by a short loop of 4-11 nt similar to the hairpin found in naturally occurring miRNA. Examples loop sequences are also described herein but any variation thereof based on the classical knowledge of the skilled person can be used.
ShRNA specific for Suv39h1 inhibition have been described in WO/2023/139269 and are included herein by reference. In some embodiments, one or more of the following shRNA sequences can be used:
SEQ ID NO : 7 shRNA #1 : GTTGCAAGTCTTCTTGGAATCAGCTG -TTGATATCCG - CAGCTGATTCCAAGAAGACTTGCAAC SEQ ID NO : 8 shRNA #2 : AGTCGAGTACCTGTGCGATTA - CTCGAG - TAATCGCACAGGTACTCGACT
SEQ ID NO : 9 shRNA #3 : AGATCCGCGAACAGGAATATT - CTCGAG - AATATTCCTGTTCGCGGATCT
SEQ ID NO : 10 shRNA #4 : GATCCGCGAACAGGAATATTA - CTCGAG - TAATATTCCTGTTCGCGGATC
SEQ ID NO : 11 shRNA #5 : GCAGTTCCACAAGGACTTAGA - TCAAGAG - TCTAAGTCCTTGTGGAACTGC
Examples loop sequences are provided herein (see sequences in italic in the above SEQ ID 4-8) but any variation thereof based on the classical knowledge of the skilled person can be used.
Ribozymes can also function as inhibitors of expression for use in the present invention. Ribozymes are enzymatic RNA molecules capable of catalyzing the specific cleavage of RNA. The mechanism of ribozyme action involves sequence specific hybridization of the ribozyme molecule to complementary target RNA, followed by endonucleolytic cleavage. Engineered hairpin or hammerhead motif ribozyme molecules that specifically and efficiently catalyze endonucleolytic cleavage of H3K9- histone methyltransferase SUV39H1 mRNA sequences are thereby useful within the scope of the present invention. Specific ribozyme cleavage sites within any potential RNA target are initially identified by scanning the target molecule for ribozyme cleavage sites, which typically include the following sequences, GUA, GUU, and GUC. Once identified, short RNA sequences of between about 15 and 20 ribonucleotides corresponding to the region of the target gene containing the cleavage site can be evaluated for predicted structural features, such as secondary structure, that can render the oligonucleotide sequence unsuitable.
In some embodiments, the Suv39h1 inhibitor is a IncRNA. It has indeed been shown that antisense IncRNA, AF196970.3 has silencing function against SUV39H1 in human cells, inhibiting SUV39H1 expression and thus lowering levels of SUV39H1 protein in the cell. AF196970.3 has an expression pattern very similar to the expression pattern of SUV39H1. It is detected in many different cell types, with endothelial cells, fibroblasts and myocytes showing the highest levels, similar to SUV39H1. The gene locus of SUV39H1 is on the X chromosome (position p11 .23, 48695554-48709016, in the GRCh38.p13 assembly). At the same locus, in anti-parallel orientation, the nonannotated gene ENSG00000232828 is located at positions 48698963-48737163. Both genes have annotated promoter regions. SEQ ID NO: 3: IncRNA AF196970.3 RNA sequence:
CGAGGCAGGGCUUUGGCUACUGGAGAUCGUAGGUUCGAAUCCCGUCUGGGA AGUUCAACUUGUGCACCUGUAAAAGAAGCUGGCAUUAUUGGCUUGUACUCAA GGGCUGGCACAGAGUGUGUCGGGGUGCGGACGCCCCAGCCACGCCCAUCAU CCGUGCGGAAGAUGCAGAGGUCAUAUCGGAUACCCUUCUGUACCACACGAUU UGGGCAGUCAUAGCCGCAGCGGCAGCGGGAGUUGCACUCGUAGAUGGGCAG CCCGGCUCGAAGCCGCACCUGGCCCUGGUCAUUGUAGGCAAACUUGUGCAG UGACGCCCCCGGGCAGCAGCCUCCAGUGGGUGCCCACAGACAGUCCUGGCA CUCGCAGCCCACAGCCACCUGGUUGAGGGUGAUGCCCUCACCAACACGGUAC UCAUUGAUGUACACGAAGGCCCGCGGAGGGCCGUCCAGGUCCACCUCAUUCU CUACAGUGAUGCGUCCCAGAUGGCUGCGCUUGGCAUUGAGCUCCUGCUCCC AGCGACGGAGCGCCCGCCUCUGCUUGGCCUUCUGCACCAGGUAGUUGGCCA AGCUUGGGUCCAGGUGCCGGGGGGUCUUUGACCGGUGGUGCCGCCGGAGC AGCUCCCUUUCUAAGUCCUUGUGGAACUGCUUGAGGAUACGCACACACUUGA GAUUCUGCCGUGGCUCCCAGGUGCUCUCUGAGUCUGGAUAUCCACGCCAUU UCACCAGGGUCAAAGGAGAAAAUUCCCUUUGGAAACAGAUGUGGGCAGUUGG GGACAAGAGGGCAGGACACUAACUUCCUUGUGACCUGUCCCCUCCCAGAGCA UGGUCACCCCAGACUCACGCGGAUCUUCUUGUAAUCGCACAGGUACUCGACU UCAAAGUCAUAGAGGUUCCUCUUAGAGAUACCGAGGGCAGGGCAGGAGAGC is the predicted RNA sequence expressed from ENSG00000232828, after transcription and splicing. SEQ ID NO: 3 is a 925 base sequence that includes three exons. AF196970.3 exon 1 (SEQ ID NO: 4) is 125 bases in length and does not have significant complementarity to the SUV39H1 gene. AF196970.3 exon 2 (SEQ ID NO: 5) is 600 bases in length and is anti-parallel to a substantial portion of exon 3 of the SUV39H1 gene with 100% similarity. AF196970.3 exon 3 (SEQ ID NO: 6) is 200 bases in length and is anti-parallel to a portion (42.5% similarity) of exon 2 of the SUV39H1 gene, as well as a portion of the adjacent intron. IncRNA sequences specific for Suv39h1 are also described in WO/2023/139269 included herein as reference. Inhibitory polynucleotides of the disclosure, for use in the cells and methods of the disclosure, include AF196970.3 (SEQ ID NO: 3) or fragments or variants thereof. Such fragments include fragments of any of SEQ ID NOs: 3-6, of about 12-50, 50-100, 100- 150, 150-200, 200-250, 250-300, 300-350, 350-400, 400-450, 450-500, 500-550, 550-
5 600, 600-650, 650-700, 700-750, 750-800, 800-850, 850-900, 250-750, 500-750 or more bases in length. Variants include polynucleotides, or chemically modified polynucleotides, in which SEQ ID NO: 3 or the foregoing fragments of SEQ ID NO: 3 have been mutated, including deletions, substitutions, modifications (including chemical modifications), or insertions. Such variants can have a nudeobase sequence
10 at least about 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to any of SEQ ID NOs: 3-6 or any fragments thereof, for example, fragments of SEQ ID NO: 3 of the aforementioned lengths. Variants include, for example, any of the foregoing fragments of SEQ ID NO:1 linked to additional nucleotides at either the 5’ end or 3’ end or both. Variants also include RNA produced by alternative splicing of
15 ENSG00000232828 (SEQ ID NO: 6) or RNA produced by allelic variants of ENSG00000232828 (SEQ ID NO: 6).
Both oligonucleotides and ribozymes useful as inhibitors of expression can be prepared by well-known methods in the field. These include techniques for chemical synthesis such as, e.g., by solid phase phosphoramadite chemical synthesis.
20 Alternatively, anti-sense RNA molecules can be generated by in vitro or in vivo transcription of exogenous DNA sequences encoding the RNA molecule(s). Such DNA sequences can be incorporated into a wide variety of vectors that incorporate suitable RNA polymerase promoters (such as the T7 or SPG polymerase promoters). Various modifications to the oligonucleotides of the invention can be introduced as a means of
25 increasing intracellular stability and half-life. Possible modifications include but are not limited to the addition of flanking sequences of ribonucleotides or deoxyribonucleotides to the 5' and/or 3' ends of the molecule, or the use of phosphorothioate or 2'-0-methyl rather than phosphodiesterase linkages within the oligonucleotide backbone.
In some embodiments, inactivation of Suv39h1 in a cell or in an organism, according
30 to the present invention, is achieved via repression or disruption of the Suv39h1 gene, such as by deletion (e.g., deletion of the entire gene, exon, or region, and/or replacement with an exogenous sequence), mutation (e.g., frameshift or missense mutation) within the gene typically within an exon of the gene. In some embodiments, the disruption results in a premature stop codon being incorporated into the gene, such that the Suv39h1 protein is not expressed or is non-functional. The disruption is generally carried out at the DNA level. The disruption generally is permanent, irreversible, or not transient.
Gene editing agents
Suitable Suv39h1 inhibitors can therefore include gene editing agent such as targeted nucleases, including e.g., Zinc finger, TALE and Cas nucleases. For example, a Suv39h1 inhibitor can include an exogenous nucleic acid comprising a) an engineered, non-naturally occurring Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) guide RNA (gRNA) that hybridizes with Suv39h1 genomic nucleic acid sequence and/or b) a CRISPR Cas protein (for example a Type-ll Cas9 protein) or a derivative thereof or a nucleotide sequence encoding thereof.
Suitable Suv39h1 inhibitors can also include non-functional Suv39h1. In some embodiments the inhibitor is a dominant negative Suv39h1 gene that expresses nonfunctional gene product at a level that inhibits activity of the wildtype Suv39h1. This may comprise overexpression of the dominant negative (typically recombinant) Suv39h1 gene.
In some embodiments, the gene inactivation is achieved using gene editing agents such as a DNA-targeting molecule, such as a DNA-binding protein or DNA-binding nucleic acid, or complex, compound, or composition, containing the same, which specifically binds to or hybridizes to the gene. In some embodiments, the DNA- targeting molecule comprises a DNA-binding domain, e.g., a zinc finger protein (ZFP) DNA-binding domain, a transcription activator-like protein (TAL) orTAL effector (TALE) DNA-binding domain, a clustered regularly interspaced short palindromic repeats (CRISPR) DNA-binding domain, or a DNA-binding domain from a meganuclease.
Zinc finger, TALE, and CRISPR system binding domains can be "engineered" to bind to a predetermined nucleotide sequence.
In some embodiments, the DNA-targeting molecule, complex, or combination contains a DNA-binding molecule and one or more additional domain, such as an effector domain to facilitate the repression or disruption of the gene. For example, in some embodiments, the gene disruption is carried out by fusion proteins that comprise DNA- binding proteins and a heterologous regulatory domain or functional fragment thereof.
Typically, the additional domain is a nuclease domain. Thus, in some embodiments, gene disruption is facilitated by gene or genome editing, using engineered proteins, such as nucleases and nuclease-containing complexes or fusion proteins, composed of sequence-specific DNA-binding domains fused to, or complexed with, non-specific DNA-cleavage molecules such as nucleases.
These targeted chimeric nucleases or nuclease-containing complexes carry out precise genetic modifications by inducing targeted double- stranded breaks or singlestranded breaks, stimulating the cellular DNA -repair mechanisms, including error- prone nonhomologous end joining (NHEJ) and homology-directed repair (HDR). In some embodiments the nuclease is an endonuclease, such as a zinc finger nuclease (ZFN), TALE nuclease (TALEN), an RNA-guided endonuclease (RGEN), such as a CRISPR-associated (Cas) protein, or a meganuclease. Such systems are well-known in the art (see, for example, U.S. Pat. No. 8,697,359; Sander and Joung (2014) Nat. Biotech. 32:347-355; Hale et al. (2009) Cell 139:945-956; Karginov and Hannon (2010) Mol. Cell 37:7; U.S. Pat. Publ. 2014/0087426 and 2012/0178169; Boch et al. (2011 ) Nat. Biotech. 29: 135-136; Boch et al. (2009) Science 326: 1509-1512; Moscou and Bogdanove (2009) Science 326: 1501 ; Weber et al. (2011 ) PLoS One 6:el9722; Li et al. (2011 ) Nucl. Acids Res. 39:6315-6325; Zhang et al. (2011 ) Nat. Biotech. 29: 149- 153; Miller et al. (2011 ) Nat. Biotech. 29: 143-148; Lin et al. (2014) Nucl. Acids Res. 42:e47). Such genetic strategies can use constitutive expression systems or inducible expression systems according to well-known methods in the art.
ZFPs and ZFNs; TALs, TALEs, and TALENs
In some embodiments, the DNA-targeting molecule includes a DNA-binding protein such as one or more zinc finger protein (ZFP) or transcription activator-like protein (TAL), fused to an effector protein such as an endonuclease. Examples include ZFNs, TALEs, and TALENs. See Lloyd et al., Frontiers in Immunology, 4(221 ), 1-7 (2013).
In some embodiments, the DNA-targeting molecule comprises one or more zinc-finger proteins (ZFPs) or domains thereof that bind to DNA in a sequence- specific manner. A ZFP or domain thereof is a protein or domain within a larger protein, that binds DNA in a sequence-specific manner through one or more zinc fingers regions of amino acid sequence within the binding domain whose structure is stabilized through coordination of a zinc ion. Generally, sequence-specificity of a ZFP may be altered by making amino acid substitutions at the four helix positions (-1 , 2, 3 and 6) on a zinc finger recognition helix. Thus, in some embodiments, the ZFP or ZFP-containing molecule is non- naturally occurring, e.g., is engineered to bind to the target site of choice. See, for example, Beerli et al. (2002) Nature Biotechnol. 20: 135-141 ; Pabo et al. (2001 ) Ann. Rev. Biochem. 70:313-340; Isalan et al. (2001 ) Nature Biotechnol. 19:656-660; Segal et al. (2001 ) Curr. Opin. Biotechnol. 12:632-637; Choo et al. (2000) Curr. Opin. Struct. Biol. 10:411-416.
In some embodiments, the DNA-targeting molecule is or comprises a zinc-finger DNA binding domain fused to a DNA cleavage domain to form a zinc-finger nuclease (ZFN). In some embodiments, fusion proteins comprise the cleavage domain (or cleavage half-domain) from at least one Type IIS restriction enzyme and one or more zinc finger binding domains, which may or may not be engineered. In some embodiments, the cleavage domain is from the Type IIS restriction endonuclease Fok I. See, for example, U.S. Pat. Nos. 5,356,802; 5,436,150 and 5,487,994; as well as Li et al. (1992) Proc. Natl. Acad. Sci. USA 89:4275-4279; Li et al. (1993) Proc. Natl. Acad. Sci. USA 90:2764-2768; Kim et al. (1994a) Proc. Natl. Acad. Sci. USA 91 :883-887; Kim et al. (1994b) J. Biol. Chem. 269:31 ,978-31 ,982.
In some aspects, the ZFNs efficiently generate a double strand break (DSB), for example at a predetermined site in the coding region of the targeted gene (i.e. SUV39H1 ). Typical targeted gene regions include exons, regions encoding N-terminal regions, first exon, second exon, and promoter or enhancer regions. In some embodiments, transient expression of the ZFNs promotes highly efficient and permanent disruption of the target gene in the engineered cells. In particular, in some embodiments, delivery of the ZFNs results in the permanent disruption of the gene with efficiencies surpassing 50%. Many gene-specific engineered zinc fingers are available commercially. For example, Sangamo Biosciences (Richmond, CA, USA) has developed a platform (CompoZr) for zinc-finger construction in partnership with Sigma- Aldrich (St. Louis, MO, USA), allowing investigators to bypass zinc-finger construction and validation altogether, and provides specifically targeted zinc fingers for thousands of proteins. Gaj et al., Trends in Biotechnology, 2013, 31 (7), 397-405. In some embodiments, commercially available zinc fingers are used or are custom designed. (See, for example, Sigma-Aldrich catalog numbers CSTZFND, CSTZFN, CTI1-1 KT, and PZD0020).
In some embodiments, the DNA-targeting molecule comprises a naturally occurring or engineered (non-naturally occurring) transcription activator-like protein (TAL) DNA binding domain, such as in a transcription activator-like protein effector (TALE) protein, See, e.g., U.S. Patent Publication No. 20110301073. In some embodiments, the molecule is a DNA binding endonuclease, such as a TALE-nuclease (TALEN). In some aspects the TALEN is a fusion protein comprising a DNA-binding domain derived from a TALE and a nuclease catalytic domain to cleave a nucleic acid target sequence. In some embodiments, the TALE DNA-binding domain has been engineered to bind a target sequence within genes that encode the target antigen and/or the immunosuppressive molecule. For example, in some aspects, the TALE DNA-binding domain may target CD38 and/or an adenosine receptor, such as A2AR.
In some embodiments, the TALEN recognizes and cleaves the target sequence in the gene. In some aspects, cleavage of the DNA results in double-stranded breaks. In some aspects, the breaks stimulate the rate of homologous recombination or non- homologous end joining (NHEJ). Generally, NHEJ is an imperfect repair process that often results in changes to the DNA sequence at the site of the cleavage. In some aspects, repair mechanisms involve rejoining of what remains of the two DNA ends through direct re-ligation (Critchlow and Jackson, Trends Biochem Sci. 1998 Oct;23(10):394-8) or via the so-called microhomology-mediated end joining. In some embodiments, repair via NHEJ results in small insertions or deletions and can be used to disrupt and thereby repress the gene. In some embodiments, the modification may be a substitution, deletion, or addition of at least one nucleotide. In some aspects, cells in which a cleavage-induced mutagenesis event, i.e. a mutagenesis event consecutive to an NHEJ event, has occurred can be identified and/or selected by well-known methods in the art.
TALE repeats can be assembled to specifically target Suv39h1. (Gaj et al., Trends in Biotechnology, 2013, 31 (7), 397-405). A library of TALENs targeting 18,740 human protein-coding genes has been constructed (Kim et al., Nature Biotechnology. 31 , 251- 258 (2013)). Custom-designed TALE arrays are commercially available through Cellectis Bioresearch (Paris, France), Transposagen Biopharmaceuticals (Lexington, KY, USA), and Life Technologies (Grand Island, NY, USA). Specifically, TALENs that target CD38 are commercially available (See Gencopoeia, catalog numbers HTN222870-1 , HTN222870-2, and HTN222870-3, available on the World Wide Web at www. genecopoeia.com/product/search/detail. php?prt=26&cid=&key=HTN222870). Exemplary molecules are described, e.g., in U.S. Patent Publication Nos. US 2014/0120622, and 2013/0315884.
In some embodiments the TALENs are introduced as transgenes encoded by one or more plasmid vectors. In some aspects, the plasmid vector can contain a selection marker which provides for identification and/or selection of cells which received said vector.
RGENs (CRISPR/Cas systems)
The gene repression or downregulation as per the present method can be carried out using one or more DNA -binding nucleic acids, such as disruption via an RNA-guided endonuclease (RGEN), or other form of repression by another RNA-guided effector molecule. For example, in some embodiments, the gene repression can be carried out using clustered regularly interspaced short palindromic repeats (CRISPR) and CRISPR-associated proteins (See Sander and Joung, Nature Biotechnology, 32(4): 347-355).
In general, "CRISPR system" refers collectively to transcripts and other elements involved in the expression of, or directing the activity of, CRISPR-associated ("Cas") genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g. tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a "direct repeat" and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a "spacer" in the context of an endogenous CRISPR system), and/or other sequences and transcripts from a CRISPR locus.
Typically, the CRISPR/Cas nuclease or CRISPR/Cas nuclease system includes a noncoding RNA molecule (guide) RNA, which sequence-specifically binds to DNA, and a CRISPR protein, with nuclease functionality (e.g., two nuclease domains). One or more elements of a CRISPR system can derive from a type I, type II, or type III CRISPR system, such as a Cas protein (e.g. a Cas nuclease). Cas proteins include Cas1 , Cas1 B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csn1 and Csx12), Cas10, Csy1 , Csy2, Csy3, Cse1 , Cse2, Csc1 , Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1 , Cmr3, Cmr4, Cmr5, Cmr6, Csb1 , Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1 , Csx15, Csf1 , Csf2, Csf3, Csf4, Cpf1 , or a variant thereof. In particular embodiments, the Cas protein is Cas9 nuclease. Preferably, the CRISPR protein is a Cas enzyme such as Cas9. Cas enzymes are well- known in the field; for example, the amino acid sequence of S. pyogenes Cas9 protein may be found in the SwissProt database under accession number Q99ZW2.
In some embodiments, a Cas nuclease and gRNA are introduced into the cell. In some embodiments, the CRISPR system induces DSBs at the target site, followed by disruptions as discussed herein. Common to all these Cas9 or Casg-like)-mediated editing strategies is the induction of double-strand breaks (DSBs) in DNA which are subsequently repaired by either non-homologous end joining (NHEJ) or homology- directed repair (HDR). Incomplete repair of these breakage points may give rise to indels leading to frameshift mutations and subsequent knock-out of one or more targeted genes. When combined with DNA donor template, the same toolkit allows the targeted integration of exogenous DNA inserts at defined genomic loci. Indeed, in general, a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of the target sequence. Typically, in the context of formation of a CRISPR complex, "target sequence" generally refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between the target sequence and a guide sequence promotes the formation of a CRISPR complex. Full complementarity is not necessarily required, provided there is sufficient complementarity to cause hybridization and promote formation of a CRISPR complex. The target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides. Generally, a sequence or template that may be used for recombination into the targeted locus comprising the target sequences is referred to as an "editing template" or "editing polynucleotide" or "editing sequence". In some aspects, an exogenous template polynucleotide may be referred to as an editing template. In some aspects, the recombination is homologous recombination. In some embodiments, Cas9 variants, deemed "nickases" can be used to nick a single strand at the target site. Paired nickases can also be used, e.g., to improve specificity, each directed by a pair of different gRNAs targeting sequences. In still other embodiments, catalytically inactive Cas9 can be fused to a heterologous effector domain, such as a transcriptional repressor, to affect gene expression.
In some embodiments, nuclease-inactive platforms including base and prime editors can be used as they offer a potentially safer route to rewriting genetic sequences and introducing large segments of transgenic DNA without inducing double-strand breaks (DSBs) (see notably Biederstadt A, Manzar GS, Daher M. Multiplexed engineering and precision gene editing in cellular immunotherapy. Front Immunol. 2022; 13: 1063303; and Liang, Y., Chen, F., Wang, K., & Lai, L. (2023). Base editors: development and applications in biomedicine. Frontiers of medicine, 10.1007/s11684-023-1013-y; see also Collantes JC, Tan VM, Xu H, et al. Development and Characterization of a Modular CRISPR and RNA Aptamer Mediated Base Editing System. CRISPR J. 2021 ;4(1 ):58-68, related to Pin-Point editing).
Base editing typically refers to the sgRNA-directed exchange of single nucleotides mediated by modified forms of Cas9 protein, Cas9 nickases (nCas9), which lack the capacity to cleave DNA, but instead are fused to bacterial deaminases to substitute single nucleotides, (see Komor AC, Kim YB, Packer MS, Zuris JA, Liu DR. Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage. Nature (2016) 533(7603):420-4) (see also for CAR-T cell engineering: Webber BR, Lonetree C-l, Kluesner MG, Johnson MJ, Pomeroy EJ, Diers MD, et al. Highly efficient multiplex human T cell engineering without double-strand breaks using Cas9 base editors. Nat Common (2019) 10(1 ):5222.)). It is an attractive strategy to knock out genes or correct pathogenic single nucleotide polymorphisms without the need for genomic double-strand breaks or co-delivering a homology-directed repair template (HDRT). For nCas9-mediated base editing, single-strand DNA point mutations are subsequently resolved in the process of replication and are used to deliberately alter the codon sequence including insertion of premature STOP codons. Base editing requires three elements. Broadly, a Cas nickase or Cas fused to a deaminase that makes the edit, a gRNA targeting Cas to a specific locus, and a target base for editing within the editing window specified by the Cas protein.
Recently CRISPR-free all-protein base editors have been described that are also suitable (Mok BY, Kotrys AV, Raguram A, Huang TP, Mootha VK, Liu DR. Crispr-free base editors with enhanced activity and expanded targeting scope in mitochondrial and nuclear DNA. Nat Biotechnol (2022) 40:1378-87).
Cytosine base editors (CBEs) that convert C G to T A base pairs (Komor A.C., Kim Y.B., Packer M.S., Zuris J.A., Liu D.R. Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage. Nature. 2016;533:420-424) and adenine base editors (ABEs) that convert A-T to G C base pairs (Gaudelli N.M., Komor A.C., Rees H.A., Packer M.S., Badran A.H., Bryson D.I., Liu D.R. Programmable base editing of A • T to G • C in genomic DNA without DNA cleavage. Nature. 2017;551 :464-471 ) are thus relevant tools to knock-out genes according to the present invention (see Knipping F, Newby GA, Eide CR, et al. Disruption of HIV-1 co-receptors CCR5 and CXCR4 in primary human T cells and hematopoietic stem and progenitor cells using base editing. Mol Ther. 2022;30(1 ):130-144)
Prime editing links nCas9 to a reverse transcriptase, both of which are guided to a desired genomic locus by a customizable prime editing guide RNA (pegRNA). It is a versatile and precise genome editing method that directly writes new genetic information into a specified DNA site using a catalytically impaired Cas9 fused to an engineered reverse transcriptase, programmed with a prime editing guide RNA (pegRNA) that both specifies the target site and encodes the desired edit. (Anzalone AV, Randolph PB, Davis JR, Sousa AA, Koblan LW, Levy JM, et al.. Search-and- Replace genome editing without double-strand breaks or donor DNA. Nature (2019) 576(7785):149-57; Nelson JW, Randolph PB, Shen SP, Everette KA, Chen PJ, Anzalone AV, et al.. Engineered pegrnas improve prime editing efficiency. Nat Biotechnol (2022) 40(3):402-10). After binding to the target region, prime editing allows for single base exchanges as well as insertions and deletions of synthetic DNA sequences of limited length. Prime editing notably allows to incorporate DNA sequences of up to 5kb length using a platform dubbed twin prime editing (TwinPE) (Anzalone AV, Gao XD, Podracky CJ, Nelson AT, Koblan LW, Raguram A, et al.. Programmable deletion, replacement, integration and inversion of Large DNA sequences with twin prime editing. Nat Biotechnol (2022) 40(5):731 -40). CRISPR-Cas systems comprising a) an engineered, non-naturally occurring Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) guide RNA that hybridizes with the Suv39h1 target genomic nucleic acid sequence and/or b) a CRISPR Cas protein (e.g., a Type-ll Cas9 protein or a Cpf1/Cas12 protein) have been described in WO/2023/222928. In some embodiment, the Cas protein can be administered as a protein or as a nucleic acid encoding thereof.
Production and administration of Suv39h1 nucleic acid inhibitors
Administration of a Suv39h1 inhibitor according to the present invention can be performed in vitro, ex vivo, or in vivo in an individual. Selection of the suitable inhibitor will of course depend on the type of administration. Suv39h1 gene inhibitors such as agents that hybridize or bind to the Suv39h1 gene or its regulatory elements can be favored. This typically includes aptamers that block or inhibit Suv39h1 expression or activity and nucleic acid molecules that block transcription or translation, such as antisense molecules complementary to Suv39h1 and various RNA interfering agents (such as a small interfering RNAs (siRNAs), small hairpin RNAs (shRNAs), microRNAs (miRNAs), piwiRNAs (piRNAs)); long non-coding RNAs (IncRNAs), ribozymes and combinations thereof). Suv39h1 nucleic acid inhibitors also include Suv39h1 gRNA as described in WO/2023/222928 and included herein by reference. Furthermore, selection a Suv39h1 inhibitor may also depends on the selected immunogenic composition (e.g. the vaccine composition). For example, nucleic acid inhibitors of Suv39h1 may be favored in combination with nucleic acid-based vaccine compositions.
Nucleic acid (i.e., polynucleotides) inhibitors can be delivered directly, such as heterologous RNA or as heterologous polynucleotides, e.g., chemically modified polynucleotides that have been modified to increase their serum half-life and/or affinity.
In some embodiments, nucleic acid inhibitors of Suv39h1 as previously described can be chemically modified. Chemical modifications include one or more of a modified backbone linkage, a modified sugar moiety, a modified phosphate moiety, a modified nucleobase, or a chemically conjugated moiety. Such chemical modifications can be present throughout the polynucleotide, or in alternating patterns. Chemical modifications can be present at the 5’ end or 3’ end or both, e.g. the 5-10 bases at the 5’ and/or 3’ end comprise one or more of a modified backbone linkage, a modified sugar moiety, a modified phosphate moiety, a modified nucleobase, or a chemically conjugated moiety. In vitro transcribed, chemically synthesized, or partially chemically synthesized RNAs can be delivered. For example, an RNA may be in vitro transcribed and chemically linked to chemically synthesized RNA at the 5’ end and/or 3’ end. Direct injection or transfection of in vitro-transcribed IncRNAs has been performed to demonstrate IncRNA function. Ulitsky et al. (2011 ) Cell, 147(7): 1537-1550.
Chemical modifications to oligonucleotides (also referred to as polynucleotides) can improve their resistance to degradation, thereby increasing half-life, and/or increase affinity for complementary polynucleotides. Modified oligonucleotides (e.g., RNA oligonucleotides) comprise chemical modifications including one or more of a modified backbone linkage, a modified phosphate moiety, a modified sugar moiety, a modified nucleobase, or a chemically conjugated moiety, or any combinations thereof. One, two, three, four, five, 10, 15, 20 or more of the same type of modification, optionally in combination with 1 , 2, 3, 4, 5, 10, 15, 20 or more of another type of modification, or patterns of modifications are contemplated. Patterns include alternating modifications throughout the oligonucleotide, such as 2’-fluoro and 2’-methoxy, or end modifications wherein, for example, 1 , 2, 3, 4, 5, or more of the bases, sugars, or linkages at the 5’ and/or 3’ end of the oligonucleotide are modified.
Examples of modified backbone linkages include phosphorothioate, phosphothioate (PhTx) group or phosphonoacetate, thiophosphonoacetate, methylphosphonate, boranophosphate, or phosphorodithioate. Other internucleotide bridging modified phosphates may be used, such as methyl phosphonothioates, phosphoromorpholidates, phosphoropiperazidates and phosphoramidates. For example, every one or every other one of the internucleotide bridging phosphate residues can be modified as described.
Examples of modified sugar moieties include deoxyribose, or replacement of the 2’ OH-group by another group. Although the majority of sugar analog alterations are localized to the 2’ position, other sites are amenable to modification, including the 4’ position. Example replacement groups include H, — OR, — R (wherein R can be, such as, alkyl, cycloalkyl, aryl, aralkyl, heteroaryl or sugar), lower alkyl moiety (e.g., C1-C4, linear or branched, saturated or unsaturated alkyl, such as methyl, ethyl, ethenyl, propyl, 1 -propenyl, 2-propenyl, and isopropyl), halo, -F, -Br, -Cl or -I, — SH, — SR (wherein R can be, such as, alkyl, cycloalkyl, aryl, aralkyl, heteroaryl or sugar), - arabino, F-arabino, amino (wherein amino can be, such as, NH2; alkylamino, dialkylamino, heterocyclyl, arylamino, diarylamino, heteroarylamino, diheteroarylamino, or amino acid); or cyano ( — CN). Specific examples include a 2’- fluoro sugar, 2’-O-methyl sugar, 2’-O-methoxyethyl sugar, or a locked nucleic acid (LNA) nucleotide. Specific examples of modified 2’-sugar include 2’-F or 2’-O-methyl, adenosine (A), 2’-F or 2’-O-methyl, cytidine (C), 2’-F or 2’-O-methyl, uridine (U), 2’-F or 2’-O-methyl, thymidine (T), 2’-F or 2’-O-methyl, guanosine (G), 2’-O-methoxyethyl- 5-methyluridine (Teo), 2’-O-methoxyethyladenosine (Aeo), 2’-O-methoxyethyl-5- methylcytidine (m5Ceo), and any combinations thereof. For example, every one or every other one of the nucleotides can be modified as described.
[0090] Examples of modified nucleobases include, but are not limited to, 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5- carboxymethylaminomet-hyluracil, di hydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2- methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7- methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta- D-mannosylqueosine, 5'-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio- N6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5- methyluracil, uracil-5-oxyacetic acid methylester, uracil-5-oxyacetic acid (v), 5-methyl- 2-thiouracil, 3-(3-amino-3-N-2-carboxypropyl) uracil, (acp3)w, and 2,6-diaminopurine.
Polynucleotides can also be stabilized by complexing to lipids or liposomes. In some embodiments, the liposome comprises 1 ,2-dioleoyl-sn-glycero-3-phosphatidylcholine (DOPC). In certain embodiments, the lipid particle comprises cholesterol, 1 ,2- distearoyl-sn-glycero-3-phosphocholine (DSPC), PEG-cDMA or PEG-cDSA, and 1 ,2- dilinoleyloxy-3-(N,N-dimethyl)aminopropane (DLinDMA).
Alternatively, such inhibitory polynucleotides can be expressed ectopically from DNA or vectors expressing such inhibitory polynucleotides. In yet another alternative, endogenous expression of such inhibitory polynucleotides (such as IncRNA inhibitors of Suv39h1 ) can be upregulated, e.g., by inserting expression control sequences, such as constitutive, inducible, strong or tissue-specific promoters.
Means and vectors for expressing polynucleotides such as RNA are well known in the art and commercially available. Known vectors include viral vectors and pseudotyped viral vectors, such as retroviral, lentivirus, adenoviral, adeno-associated (AAV), alphavirus, vaccinia virus, poxvirus, EBV, and herpes simplex virus papillomavirus, foamivirus, or Semliki Forest virus vectors, or transposase systems, such as Sleeping Beauty transposase vectors. Non-viral systems for delivery of naked plasmids to cells include lipids, cationic lipid complexes, liposomes, nanoparticle, gold particle, or polymer complex, poly-lysine conjugates, synthetic polyamino polymers and artificial viral envelopes.
For expressing short noncoding RNAs, such as shRNA, polymerase III promoters are commonly used. Examples include U6, H1 , or 7SK promoters.
For expressing long RNAs, such as mRNAs or long noncoding RNAs, polymerase II promoters are commonly used. Examples include CMV, EF-1 a, hPGK and RPBSA. CAG promoters have been used to overexpress IncRNA. Yin et al Cell Stem Cell. 2015 May 7; 16(5):504-16. Inducible promoters that are driven by signals from activated T cells include nuclear factor of activated T cells (NFAT) promoter. Other promoters for T cell expression of RNA include CIFT chimeric promoter (containing portions of cytomegalovirus (CMV) enhancer, core interferon gamma (IFN-y) promoter, and a T- lymphotropic virus long terminal repeat sequence (TLTR)), endogenous TRAC promoter or TRBC promoter. Inducible, constitutive, or tissue-specific promoters are contemplated.
Viral vectors have been used to overexpress IncRNAs, see Yang et al. (2013) Mol Cell 49: 1083-1096; Lu et al. (2018) Mol Ther Nucleic Acids 10: 387-397. In addition, IncRNA has been expressed from lentivectors and SB transposase systems. See, e.g., Zhang et al., Overexpression of IncRNAs with endogenous lengths and functions using a IncRNA delivery system based on transposon. J Nanobiotechnol 19, 303 (2021 ).
CRISPR-Cas9-based activation systems have also been used to upregulate endogenous expression of IncRNA. Rankin et al., Overexpressing Long Noncoding RNAs Using Gene-activating CRISPR. J Vis Exp. 2019;(145):10.3791/59233. In some embodiments, dsRNA such as RNAi is produced in the cell by a vector comprising an expression control sequence operatively linked to a nucleotide sequence that expresses (is a template for one or both strands of) the dsRNA. In further embodiments, a promoter can flank either end of the template nucleotide sequence, wherein the promoters drive expression of each individual DNA strand, thereby generating two complementary (or substantially complementary) RNAs that hybridize and form the dsRNA. In other embodiments, dsRNA is produced in the cell by a vector that expresses an shRNA that is processed to form an interfering dsRNA.
Art-recognized techniques for introducing foreign nucleic acids (e.g., DNA and RNA) into a host cell, include calcium phosphate or calcium chloride co-precipitation, DEAE- dextran-mediated transfection, lipofection, electroporation, microinjection, DNA-loaded liposomes, lipofectamine-DNA complexes, cell sonication, gene bombardment using high velocity microprojectiles, biolistics, and viral-mediated transfection. Compositions comprising the nucleic acids may also comprise transfection facilitating agents, which include surface active agents, quinone analogs, vesicles such as squalene and squalene, hyaluronic acid, lipids, liposomes, lecithin liposomes, calcium ions, viral proteins, polyanions, polycations, including poly-L-glutamate, or nanoparticles, gold particles, or other known agents. Delivery vehicles include a liposome, lipid-containing complex, nanoparticle, gold particle, or polymer complex.
Lipid materials have been used to create lipid nanoparticles (LNPs) based on ionizable cationic lipids, which exhibit a cationic charge in the lowered pH of late endosomes to induce endosomal escape, because of the tertiary amines in their structure. These LNPs have been used, for example, to deliver RNA interference (RNAi) components, as well as genetic constructs or CRISPR-Cas systems. See, such as, Wilbie et al., Acc Chem Res.;52(6): 1555-1564, 2019. Wang et al., Proc Natl Acad Sci U S A.;113(11 ):2868-2873, 2016 describe use of biodegradable cationic LNPs. Chang et al., Acc. Chem. Res., 52, 665-675, 2019 describe use of ionizable lipid along with cholesterol, DSPC, and a PEGylated lipid to create LNPs.
Polymer based particles can be used for genetic construct delivery in a similar manner as lipids. Numerous materials have been used for delivery of nucleic acids. For example, cationic polymers such as polyethylenimine (PEI) can be complexed to nucleic acids and can induce endosomal uptake and release, similarly to cationic lipids. Dendrimeric structures of poly(amido-amine) (PAMAM) can also be used for transfection. These particles consist of a core from which the polymer branches. They exhibit cationic primary amines on their surface, which can complex to nucleic acids. Networks based on zinc to aid cross-linking of imidazole have been used as delivery methods, relying on the low pH of late endosomes which, upon uptake, results in cationic charges due to dissolution of the zeolitic imidazole frameworks (ZIF), after which the components are released into the cytosol. Colloidal gold nanoparticles have also been used. See Wilbie et al., supra.
Stimulation of the immune response
The present invention relates to the use of an inhibitor of H3K9 lysine methyl transferase (KMT), notably an inhibitor of Suv39h1 to improve the immune response, in particular the cell mediated immune response to one or more antigens. An inhibitor of H3K9 lysine methyl transferase (KMT), notably an inhibitor of Suv39h1 can thus typically be used in combination with a pharmaceutical composition, typically an immunogenic composition that elicits an immune response in an individual for the treatment and/or the prevention of a disease or a condition associated with the elevated expression of an antigen, typically an infectious disease or a tumor. The immune response includes a B-cell response and/or a T-cell response.
Typically, the immune response is a cell-mediated immune response.
The present invention encompasses a medical preparation comprising:
- a first component that elicits an immune response in an individual
- a second component comprising an inhibitor of a H3K9 lysine methyl transferase (KMT); wherein the first and second components can be administered to the individual sequentially in any order, or simultaneously.
In some embodiments, the medical preparation is for treating and/or preventing a disease, disorder or condition associated with the expression or the elevated expression of an antigen, typically wherein the disease is an infectious disease or a tumor. In some embodiments, the medical preparation prevents recall infections or tumor relapses, in more particular embodiments, the medical preparation prevents, reduces or delays tumor metastasis growth or secondary tumors.
The present invention also encompasses a method of treating and/or preventing an infectious disease or a tumor in an individual, said method comprising the administration to the individual of a medical preparation comprising:
- a first component that elicits an immune response in the individual;
- a second component comprising an inhibitor of a H3K9 KMT ; wherein the first and second components can be administered sequentially in any order or simultaneously.
The present invention further encompasses a method of treating and/or preventing a disease, disorder or condition associated with the expression or the elevated expression of an antigen in an individual, optionally wherein the disease is an infectious disease or a neoplastic disease (tumor), said method comprising the administration to the individual of:
- a first component that elicits an immune response in the individual,
- a second component comprising an inhibitor of a H3K9 KMT ; wherein the first and second components can be administered sequentially in any order or simultaneously.
The pharmaceutical composition or first component that elicits an immune response can be an immunogenic composition and/or a cell composition.
The immunogenic composition typically include one or more antigens that are able to elicit an immune response, notably a cell-mediated response such as a T cell response in a patient, wherein the one or more antigens can be in a nucleic acid (DNA and/or RNA molecule), a peptidic or a cellular format (such as antigen presenting cells loaded with the one or more antigens or T cells able to recognize the one or more antigens).
Immunogenic or vaccine composition or preparation according to the present invention are described below in relation to the various type and format of antigens. Such composition notably include composition comprising antigen presenting cells. In some embodiments, the pharmaceutical composition or first component, as previously described that elicits an immune response, comprises one or more immune cells.
An immune cell according to the present invention can be typically an NK cell, a B cell, a monocyte, a macrophage, a dendritic cell, a T cell or a progenitor thereof. T cells typically include CD4+ T cells, CD8+ T cells (including alpha/beta T cells and gamma/delta T cells), CD4+ and CD8+ T cells, T regulatory cells (Treg), Naive T cells (TN cells), effector T cells, memory stem T cells (TSCMs), memory T cells (TCMs), effector memory T cells (TEM cells), resident memory T cells (TCRMs), mucosa- associated invariant T (MAIT) cells, and NK T cells (NKT cells). Progenitors, notably T cell progenitors, include T cell progenitors, lymphoid progenitors, myeloid progenitors, a pluripotent stem cells, and induced pluripotent stem cells (iPSCs) as well as hematopoietic stem cells (HSCs), adipose derived stem cells (ADSCs), or pluripotent stem cells of myeloid or lymphoid lineage. In some embodiments the composition comprises a mixed population of T cells (such as a mixed population of CD4+ T cells and CD8+ T cells).
T cells can be obtained from a patient in need of a treatment or a healthy donor. Cells can be typically isolated from PBMC or tissue samples, such as resident T cells. In some embodiment, T cells, notably tumor infiltrating cells (TILs) can be obtained from tumor tissue samples. In other embodiments, T cell can be derived from induced pluripotent stem cells.
In some embodiments, the T cell is an activated T cell (typically induced by stimulation with cognate antigen for example in the context of an antigen-presenting cell preferably with co-stimulatory signals). T cells can be activated and/or expanded in vitro.
Non-limitative examples of T cell isolation and/or preparation, well-suited to the present invention include: Corgnac, Stephanie et al. “Isolation of tumor-resident CD8+ T cells from human lung tumors.” STAR protocols vol. 2, 1 100267. 12 Jan. 2021. Wang, Haiying et al. “A simple and effective method to purify and activate T cells for successful generation of chimeric antigen receptor T (CAR-T) cells from patients with high monocyte count.” Journal of translational medicine vol. 20, 1 608. 19 Dec. 2022 ; Iriguchi, S., Yasui, Y., Kawai, Y. et al. A clinically applicable and scalable method to regenerate T-cells from iPSCs for off-the-shelf T-cell immunotherapy. Nat Commun 12, 430 (2021) or Sadeqi Nezhad, Muhammad et al. “Induced Pluripotent Stem Cells (IPSCs) Provide a Potentially Unlimited T Cell Source for CAR-T Cell Development and Off-the-Shelf Products.” Pharmaceutical research vol. 38,6 (2021): 931-945.
Typically, the immune cell is a T cell.
The immune cell, typically a T cell (such as a tissue resident notably a TIL) can be selected or isolated to express a specific antigen receptor (notably a specific TCR) against an identified antigen.
The modified immune cell can also be engineered to express at it surface one or more antigen receptors. In some embodiments, the immune cells express one or more antigen-specific receptors on the surface. The cells thus may comprise one or more nucleic acids that encode one or more antigen-specific receptors, optionally operably linked to a heterologous regulatory control sequence. Typically, such antigen-specific receptors bind the target antigen with a Kd binding affinity of 10’6M or less, 10’7 M or less, 10’8 M or less, 10’9 M or less, 10’10 M or less, or 10’11 M or less (lower numbers indicating greater binding affinity). In some embodiments, the antigen-binding domain binds a target antigen with a KD affinity of about 1 x 10’7 or less, about 5 x 10’8 or less, about 1 x 10’8 or less, about 5 x 10’9 or less, about 1 x 10’9 or less, about 5 x 1 O’10 or less, about 1 x 1 O’10 or less, about 5 x 10’11 or less, about 1 x 10’11 or less, about 5 x 10’12 or less, or about 1 x 10’12 or less. Typically, the nucleic acids are exogenous (e.g. heterologous), (i.e., for example which are not ordinarily found in the cell being engineered and/or in the organism from which such cell is derived). In some embodiments, the nucleic acids are not naturally occurring, including chimeric combinations of nucleic acids encoding various domains from multiple different cell types. The nucleic acids and their regulatory control sequences are typically heterologous. For example, the nucleic acid encoding the antigen-specific receptor may be heterologous to the immune cell and operatively linked to an endogenous promoter of the T-cell receptor such that its expression is under control of the endogenous promoter. In some embodiments, the nucleic acid encoding a modified TCR or CAR is operatively linked to an endogenous TRAC promoter. Among the antigen-specific receptors as per the disclosure are recombinant modified T cell receptors (TCRs) and components thereof, as well as functional non-TCR antigen- specific receptors, such as chimeric antigen receptors (CAR). Engineered immune cells and engineered antigen receptors suited to the present invention have been for example described in EP3359563B1 , in international patent application publication numbers W0200014257, WO2013126726, WO2012/129514, WO2014031687, WO201 3/166321 , WO2013/071154, WO2013/123061 , WO2023126458A1 , W02021013950A1 , U.S. patent application publication numbers US2002131960, US2013287748, US20130149337, U.S. Patent Nos.: 6,451 ,995, 7,446,190, 8,252,592, , 8,339,645, 8,398,282, 7,446,179, 6,410,319, 7,070,995, 7,265,209, 7,354,762, 7,446,191 , 8,324,353, and 8,479,118, and European patent application number EP2537416, and/or those described by Sadelain et al., Cancer Discov. 2013 April; 3(4): 388-398; Davila et al. (2013) PLoS ONE 8(4): e61338; Turtle et al., Curr. Opin. Immunol., 2012 October; 24(5): 633-39; Wu et al., Cancer, 2012 March 18(2): 160-75. In some aspects, the antigen-specific receptors include a CAR as described in U.S. Patent No.: 7,446,190, and those described in International Patent Application Publication No.: WO/2014055668 A1 .
The present invention also encompasses a method of stimulating an immune response against an infectious disease or a tumor in an individual, more particularly against one or more antigens expressed in the context of an infectious disease or a tumor (such as antigens expressed by infected cells or tumor cells), said method comprising administering a vaccination regimen and an immune stimulation regimen to the individual; wherein the immune stimulation regimen comprises administration of an inhibitor of a H3K9 KMT inhibitor, preferably a Suv39H1 inhibitor; wherein the immune stimulation regimen and the vaccination regimen are administered sequentially in any order or simultaneously.
The present invention also encompasses a method of raising, stimulating or enhancing an immune response to one or more antigen(s) in an individual, comprising administering to the individual an effective amount of an inhibitor of a H3K9 KMT, notably an inhibitor of Suv39h1 .
Typically, the immune response is B cell or a cell-mediated immune response, notably a T cell mediated immune response, more particularly the immune response comprises the generation, activation or expansion of antigen-specific T cells and/or the induction or cytolotic event or activity mediated by immune cell and in particular T cell such as CD8 T cells. The immune response also encompasses a response to a vaccination regimen (e.g., the administration of a vaccine or immunogenic composition).
Inhibitors of H3K9 KMT (KMT inhibitor), in particular inhibitors of Suv39h1 suitable with the present invention have been described above. Typically, a KMT inhibitor usable according to the present invention significantly increases the sensitivity and initial response of naive T cells, in particular at low antigen load and/or at low antigen affinity.
In some embodiments such effect can be assessed as illustrated in the examples of the present application (e.g. incubating naive antigen specific normal CD8+ T cells (such as OTI CD8+ T cells) or deficient for a H3K9 KMT (such as Suv39h1 ) expressing a TCR against a given antigen (e.g., from wild-type and Suv39h1 KO OTI mice, e.g. T cell expressing a specific TCR recognizing an OVA antigen in combination with CMH I) (typically around 1x104) for 4 to 48h with antigen presenting cells (typically around 2.5x104) (e.g., splenocytes from CD3-KO mice) preloaded with antigenic peptides having variable affinity for the said TCR (such as the exemplified peptide).
In some embodiments a KMT inhibitor increases expansion and/or recall response of central memory T cells (e.g., CD44+CD62L+ T cells) (typically in the absence of inflammation as illustrated in figure 3), notably in lymphoid organs (e.g., spleen and/or lymph nodes). In some embodiments a KMT inhibitor increases the number of effector memory T cells (e.g., CD44+CD62L-) (typically in the absence of inflammation as illustrated in figure 3), notably in tissues (e.g., liver).
As per the present invention, an immune response is a protective immune response, e.g., reducing partially or completely the severity of one or more symptoms and/or time over which one or more symptoms are experienced by a subject, reducing the likelihood of developing an established infection after challenge, preventing tumor relapses, metastasis, secondary infections, and/or slowing progression of an associated illness (e.g. extending survival). Immune response may include a humoral immune response and/or a cell-mediated immune response.
Typically, the immune response according to the present invention comprises a cell- mediated immune response, notably a T cell mediated immune response. Typically, the generation of a T cell mediated immune response includes the generation of antigen-specific T cells, in other words T lymphocytes comprising a T cell receptor (TCR) that is directed against an antigen. By recognized an antigen, it is intended that the TCR binds to the said antigen in combination with an HLA molecule. The said antigen is typically responsible for the induction of the immune response, once presented as the surface of antigen presenting cells in combination with an HLA molecule. Said antigen can typically be included in an immunogenic or vaccine composition.
Antigens or immunogens
An immunogen refers to a molecule that is capable of eliciting an immune response by an organism's immune system, whereas an antigen refers to a molecule that is capable of binding to the product of that immune response. So, an immunogen is necessarily an antigen, but an antigen may not necessarily be an immunogen. Typically, according to the invention, an antigen is an immunogen.
The antigen may be a whole-organism, a protein/polypeptide, a polysaccharide, a peptide, a protein-polysaccharide conjugate, or a hapten capable of raising an immune response in a human or an animal, each of these types of antigen, or any combination of two or more thereof, being specifically contemplated as a possible antigen in specific embodiments of the composition. The terms "protein" and "polypeptide" are herein synonymous and interchangeable.
The term “epitope” or “antigenic determinant” typically refers to the part of an antigen which is recognized by the adaptive immune system. An “antigen” is a substance, which is capable of being recognized (typically via its epitope(s)) by the immune system, preferably by the adaptive immune system, and which is capable of eliciting an antigen-specific immune response, e.g. by formation of antibodies and/or antigenspecific T cells as part of an adaptive immune response. Such a fragment comprising or consisting of an epitope can typically comprise from about 5 to about 20 amino acids. Epitopes can be distinguished in T cell epitopes and B cell epitopes, that can be respectively recognized by T cell receptors (TCRs) on T cells (T lymphocytes) and B cell receptors expressed by B cells (B lymphocytes).
Peptide epitopes In some embodiments, an antigen is, or comprises, a peptide or epitope, which can be presented to (antigen-specific) T-cells by antigen-presenting cells in comnbination with MHC surface molecules. In some embodiments, an antigen is the product of translation of a provided nucleic acid molecule, preferably an epitope-encoding RNA. Fragments or variants of an antigen (such as a peptide or a protein) comprising at least one epitope are understood as antigens.
T cell epitopes or parts of the (antigenic) proteins in the context of the present invention can comprise fragments preferably having a length of about 6 to about 20 or even more amino acids, e.g. fragments as processed and presented by MHC class I molecules, preferably having a length of about 8 to about 10 amino acids, e.g. 8, 9, or 10, (or even 11 , or 12 amino acids), or fragments as processed and presented by MHC class II molecules, preferably having a length of about 13 or more amino acids, e.g. 13, 14, 15, 16, 17, 18, 19, 20 or even more amino acids, wherein these fragments may be selected from any part of the amino acid sequence. These fragments are typically recognized by T cells in form of a complex consisting of the peptide fragment and an MHC surface molecule, i.e. the fragments are typically not recognized in their native form.
B cell epitopes are typically fragments located on the outer surface of protein or peptide antigens as defined herein, preferably having 5 to 15 amino acids, more preferably having 5 to 12 amino acids, even more preferably having 6 to 9 amino acids, which may be recognized by antibodies, i.e. in their native form.
The term “epitope” includes “conformational” (or “discontinuous”) epitopes, which are composed of discontinuous sequences of the amino acids of the antigen but are brought together in the three-dimensional structure, and “linear” epitopes, which are formed by a continuous sequence of amino acids from the antigen.
The immune response may be raised against a pathogen, such as for example, viruses, bacteria, parasites or fungus. That is, in one embodiment, the antigen is derived from a human pathogen. In some embodiments, the antigen is derived from a human pathogen selected from the group consisting of bacteria, virus, fungi, parasitic microorganisms and multicellular parasites. In some embodiments, the antigen is derived from a combination of two or more bacteria, virus, fungi, parasitic microorganisms and multicellular parasites. Alternatively, the antigen may be derived from a tumor cell (e.g., the antigen may be a tumor- associated antigen or a tumor specific antigen), and the vaccine composition may be useful for the treatment or the prevention of cancers.
The expression, "an antigen derived from an organism" encompasses, in particular, the organism as a whole (whole-organisms, such as for example a whole-virus or a whole-bacterium), or one or more molecules only from the organism. The antigen may be the naturally occurring whole-organism, and the one or more molecules for instance one or more polypeptides, from the organism may be isolated and purified from such naturally occurring whole-organism.
Alternatively, the antigen may be artificially produced, for example, using recombinant technology or using chemical synthesis. Such recombinant antigens may be in a wildtype form, i.e. their nucleotide sequence, or amino acid sequence, is identical to the sequence of the corresponding antigens derived from the naturally occurring wholeorganism. Alternatively, said recombinant antigens may advantageously comprise one or more mutations, i.e. their nucleotide sequence, or amino acid sequence, comprises one or more mutations, as compared with the sequence of the corresponding wild type antigens. Whole-organisms may be live attenuated or killed/inactivated. Inactivation processes using physical and/or chemical means are known to the skilled person. Such recombinant/modified/designed antigens are considered to be within the definition of "derived from" an organism within the context of the present disclosure.
In some embodiments, the antigen comprises at least one B or T cell epitope, an antigen comprises B and T cell epitopes. The elicited immune response may be an antigen specific B cell response which produces neutralizing antibodies. The elicited immune response may be an antigen specific T cell response, which may be a systemic and/or a local response. The antigen specific T cell response may comprise a CD4+ T cell response, such as a response involving CD4+ T cells expressing a plurality of cytokines, e.g. IFN gamma, TNF alpha and/or IL2. Alternatively, or additionally, the antigen specific T cell response comprises a CD8+ T cell response, such as a response involving CD8+ T cells expressing a plurality of cytokines, e.g., IFN gamma, TNF alpha and/or IL2.
Suitably the encoded antigen contains 3000 residues or fewer, especially 2000 residues or fewer, in particular 1500 residues or fewer. The encoded antigen may contain 1000 residues or fewer, 800 residues or fewer, 600 residues or fewer, 400 residues or fewer or 200 residues or fewer. Suitably the antigen contains 50 residues or more, especially 100 residues or more, in particular 150 residues or more. Suitably the antigen contains 50 to 3000 residues, especially 100 to 1500 residues, in particular 200 to 1000 residues.
An antigen according to the present invention is typically associated with a disease or disorder such as an infection or a tumor. By associated with a disease it is typically intended that the expression level of the said antigen is increased in cells from a subject suffering from said disease or disorder. In some cases, the expression of the said antigen in an individual may be cell specific, typically in case of a tumor, where the expression of a tumor antigen is usually tumor tissue specific.
Virus, bacterial and parasite antigens
An antigen according to the present invention, notably an antigen used in an immunogenic or vaccine composition may derive from a virus. Accordingly, in particular embodiments, the antigen derives from a virus. In particular, the antigen may be a whole-virus. The whole virus may be live attenuated or killed/inactivated. Alternatively, the antigen may be a polypeptide derived from a virus.
Suitable viruses are from the families Orthomyxoviridae, such as for instance influenza viruses, Paramyxoviridae, such as for instance respiratory syncytial viruses (RSV), mumps virus or measles, Togaviridae, such as for instance rubella virus, Papovaviridae, such as for instance human papillomaviruses (HPV), Herpesviridae, such as for instance herpes simplex viruses (HSV), human cytomegaloviruses (HCMV), Epstein-Barr viruses (EBV), or varicella-zoster viruses (VZV), Picornaviridae, such as for instance enteroviruses, rhinoviruses, polioviruses, Fiaviviridae, such as for instance Dengue viruses or hepatitis C virus (HCV), Hepadnaviridae, such as for instance hepatitis B virus (HBV), Retroviridae, such as for instance human immunodeficiency viruses (HIV), Reoviridae, such as for example rotaviruses, Rhabdoviridae, such as for instance rabies viruses, or Flloviridae, such as for example Ebola virus. In one embodiment, the antigen used either in or with the adjuvant composition derives from a virus selected from the group consisting of influenza virus, RSV, HPV, measles, rubella virus, mumps virus, HCMV, VZV, Dengue virus, poliovirus, HIV, HBV, Ebola virus and rotavirus, or any combination of two or more thereof.
In a particular embodiment, the antigen derives from HCMV. Suitably, the HCMV antigen is the glycoprotein gB, which may lack the transmembrane domain (as disclosed in EP0802979), optionally in combination with one or more of the HCMV proteins pp65, IE1 , pUL131 , gL, gH, pUL128, and pUL130. Suitably, the HCMV antigen is a combination of gB, gL, gH, pUL131 , pUL128 and pUL130. Alternatively, the HCMV antigen is a combination of gL, gH, pUL131 , pUL128 and pUL130.
In some embodiments, the antigen is a varicella-zoster viruses (VZV) antigen. In one embodiment, the VZV antigen is a gE antigen. Suitably, the VZV antigen is the glycoprotein gE, which may be deleted from its transmembrane domain, as disclosed in EP0405867 Bl. In one embodiment, the VZV antigen is a protein derived Varicella Zoster Virus which is one of gpl, gpll or g pill as defined on pages 5-7 of EP 0 405 867 Bl and is missing from 4-20 percent of the total amino acid residues of the full length glycoprotein at the carboxy terminal end.
In other embodiments, the antigen derives from RSV. Suitably, the RSV antigen is a polypeptide selected from the group consisting of the fusion protein (F), the attachment protein (G), the matrix protein (M2) and the nucleoprotein (N). Particularly suitable as an RSV polypeptide antigen to be included in or administered with the adjuvant composition are conformationally constrained F polypeptides. Conformationally constrained F polypeptides have previously been described in both the prefusion (PreF) and postfusion (PostF) conformations. Exemplary F protein antigens conformationally constrained in the prefusion conformation have been described in the art and are disclosed in detail in e.g. WO 09/079796, WO 10/149745, WO 11/008974 and WO 12/158613. Likewise, F protein antigens conformationally constrained in the postfusion conformation are also well known in the art and can be used in or administered with the adjuvant composition. Examples of postfusion conformationally constrained F protein polypeptides are disclosed in details in e.g. WO 11/008974, and Swanson et al. (PNAS, 2011 , Vol. 108: 9619-9624). In particular embodiments, the adjuvant composition comprises an antigen polypeptide derived from RSV selected from the group consisting of: F protein, preF protein, N protein and M2 protein. In a further embodiments, the antigen derives from HBV. Suitably, the antigen is the Hepatitis B surface antigen (HBS)
In some embodiments, the antigen is derived from an RNA virus. In one embodiment, the antigen is derived from a coronavirus, particularly from SARS-CoV-2.
A plurality of antigens maybe encoded. Consequently, in some embodiments the antigen is derived from at least one coronavirus, for example from SARS-CoV-2. In some embodiments the antigen is derived from more than one coronavirus (such as 2, 3, 4 or 5), for example from SARS- CoV-2 (such as a plurality of SARS-CoV-2 variant antigens).
SARS-CoV-2 makes use of a densely glycosylated spike (S) protein to gain entry into host cells. In coronaviruses, the S protein is a trimeric class I fusion protein which exists in a metastable prefusion conformation that undergoes a substantial structural rearrangement to fuse the viral membrane with the host cell membrane (Li F. Structure, Function, and Evolution of Coronavirus Spike Proteins. Annu Rev Virol. 2016 Sep 29;3(1 ):237-261 ; Bosch BJ, van der Zee R, de Haan CA, Rottier P The coronavirus spike protein is a class I virus fusion protein: structural and functional characterization of the fusion core complex. J Virol. 2003 Aug;77(16):8801 -II.).
A coronavirus protein of use is a fragment or variant of a native coronavirus protein which is capable of eliciting neutralising antibodies and/or a T cell response (such as a CD4 or CD8 T cell response) to a coronavirus, suitably a protective immune response.
A SARS-CoV-2 S protein of use comprises, such as consists of, a fragment or variant of a native SARS-CoV-2 S protein which is capable of eliciting neutralising antibodies and/or a T cell response (such as a CD4 or CD8 T cell response) to SARS-CoV-2, suitably a protective immune response.
In one embodiment, the antigen is a human cytomegalovirus (CMV) antigen.
In one embodiment, the antigen is a Zika virus antigen.
In one embodiment, the antigen is a human parainfluenza virus (PIV) antigen, such as a human PIV type 3 antigen.
In one embodiment the antigen is a human metapneumovirus (hMPV) antigen. In one embodiment the antigen is a respiratory syncytial virus (RSV) antigen.
In one embodiment the antigen is an influenza virus antigen, such as a hemagglutinin or a neuraminidase.
In one embodiment the antigen is an Epstein-Barr virus (EBV) antigen.
In one embodiment, the antigen is an Herpes simplex virus (HSV) antigen, such as a gE and/or a gl antigen. Suitable antigens are disclosed in WO 2021/013798.
The antigen may also derive from a bacterium. Accordingly, in particular embodiments, the antigen derives from a bacterium. In one embodiment, the antigen is from a bacterium selected from the group consisting of: B. pertussis, S. Pneumoniae, and N. meningitidis, or any combination of two or more thereof.
The antigen may be a whole-bacterium and may be killed/inactivated or live attenuated. Particular whole-bacterium antigens for use in the present invention are Bordetella pertussis. In one embodiment, the B. pertussis antigen is the wholebacterium (Pw antigen), optionally in combination with tetanus toxoid (T) and/or diphtheria toxoid (D).
The antigen may also derive from a parasite. In some embodiments, the antigen may derive from parasites causing Malaria. Accordingly, in some embodiments, the antigen is derived from parasites that cause Malaria, such as for example, Plasmodium falciparum or Plasmodium vivax. Suitably, the Plasmodium falciparum-derived antigen is RTS,S.
Tumor antigens
In some embodiments, the antigen is a tumor antigen (also named cancer or neoplastic antigens). Tumor antigens recognized by T lymphocytes are central to the efficacy of cancer vaccines. The ideal antigen for a cancer vaccine should be highly immunogenic, explicitly expressed in all cancer cells (not in normal cells or at low level, i.e. can be a TS or a TAA with tissue differentiation) and optionally necessary for the survival of cancer cells.
The cancer may be a solid cancer or a “liquid tumor” such as cancers affecting the blood, bone marrow and lymphoid system, also known as tumors of the hematopoietic and lymphoid tissues, which notably include leukemia and lymphoma. Liquid tumors include for example acute myelogenous leukemia (AML), chronic myelogenous leukemia (CML), acute lymphocytic leukemia (ALL), and chronic lymphocytic leukemia (CLL), (including various lymphomas such as mantle cell lymphoma, non-Hodgkins lymphoma (NHL), adenoma, squamous cell carcinoma, laryngeal carcinoma, gallbladder and bile duct cancers, cancers of the retina such as retinoblastoma).
Solid cancers notably include cancers affecting one of the organs selected from the group consisting of colon, rectum, skin, endometrium, lung (including non-small cell lung carcinoma), uterus, bones (such as Osteosarcoma, Chondrosarcomas, Ewing's sarcoma, Fibrosarcomas, Giant cell tumors, Adamantinomas, and Chordomas), liver, kidney, esophagus, stomach, bladder, pancreas, cervix, brain (such as Meningiomas, Glioblastomas, Lower-Grade Astrocytomas, Oligodendrocytomas, Pituitary Tumors, Schwannomas, and Metastatic brain cancers), ovary, breast, head and neck region, testis, prostate and the thyroid gland.
In some embodiments, the tumor antigen is a tumor associated antigen (TAA), a tumor specific antigen (TSA) or a cancer testis antigen (CTA).
TAAs are typically shared tumor-shared antigens (archetypal examples are HER2 and human telomerase transcriptase cancer mutants) and include self-antigens” such as differentiated antigens, overexpressed antigens, cancer-testicular antigens and viral- original “non-self’ antigens. TAAs typically include tissue differentiated antigens are expressed by tumor cells and normal cells of the same tissue origin as tumor cells, such as prostate-specific antigen (PSA) expressed in the prostate gland and prostate cancer, and melanoma antigens tyrosinase expressed by normal melanocytes, and melanoma cells.
Cancer-testis antigens (CTAs) are thought to provide high tumor specificity, as they are not expressed in normal adult tissues, except by germline and trophoblastic cells, but are highly expressed across cancers. Typical CTAs include the melanoma- associated antigen (MAGE) family (such as MAGE-A3), sarcoma antigen 1 (SAGE1 ), WT1 and cancer-testis antigen 1 (CTAG1A; commonly known as NY-ESO-1 ).
TSAs are a class of proteins or peptides specifically expressed in tumor cells. TSAs are often referred to as neoantigens. In some embodiments TSAs drive oncogenesis. TSAs viral antigens, such the Epstein-Barr virus encoded antigens (including latent membrane proteins (LMP1 and LMP2), which are expressed in various tumors or HPV E6 and E7 antigens. In some embodiments TSA further include overexpressed mutant self proteins , such as EGFRvlll which is a constitutively active, somatically mutated EGFR variant
In some embodiments, the antigen is a universal tumor antigen. The term "universal tumor antigen" refers to an immunogenic molecule, such as a protein, that is, generally, expressed at a higher level in tumor cells than in non-tumor cells and also is expressed in tumors of different origins. In some embodiments, the universal tumor antigen is expressed in more than 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90% or more of human cancers. In some embodiments, the universal tumor antigen is expressed in at least three, at least four, at least five, at least six, at least seven, at least eight or more different types of tumors. In some cases, the universal tumor antigen may be expressed in non-tumor cells, such as normal cells, but at lower levels than it is expressed in tumor cells. In some cases, the universal tumor antigen is not expressed at all in non-tumor cells, such as not expressed in normal cells. Exemplary universal tumor antigens include, for example, human telomerase reverse transcriptase (hTERT), survivin, mouse double minute 2 homolog (MDM2), cytochrome P450 1 B1 (CYP1 B), HER2/neu, p95HER2, Wilms' tumor gene 1 (WT1 ), livin, alphafetoprotein (AFP), carcinoembryonic antigen (CEA), mucin 16 (MLIC16), MLIC1 , prostate-specific membrane antigen (PSMA), p53 or cyclin (DI). In some aspects, the antigen is expressed on multiple myeloma, such as CD38, CD138, and/or CS-1 . Other exemplary multiple myeloma antigens include CD56, TIM-3, CD33, CD123, and/or CD44. Typical antigen examples include include orphan tyrosine kinase receptor ROR1 , tEGFR, Her2, p95HER2, LI-CAM, CD19, CD20, CD22, mesothelin, CEA, and hepatitis B surface antigen, anti-folate receptor, CD23, CD24, CD30, CD33, CD38, CD44, EGFR, EGP-2, EGP-4, EPHa2, ErbB2, 3, or 4, FBP, fetal acethycholine e receptor, GD2, GD3, HMW-MAA, IL-22R-alpha, IL-13R-alpha2, kdr, kappa light chain, Lewis Y, Ll-cell adhesion molecule, MAGE-A1 , mesothelin, MUC1 , MUC16, PSCA, NKG2D Ligands, NY-ESO-1 , MART-1 , gplOO, oncofetal antigen, ROR1 , TAG72, VEGF-R2, carcinoembryonic antigen (CEA), prostate specific antigen, PSMA, Her2/neu, p95HER2, estrogen receptor, progesterone receptor, ephrinB2, CD 123, CS-1 , c-Met, GD-2, and MAGE A3, CE7, Wilms Tumor 1 (WT-1 ), a cyclin, such as cyclin Al (CCNA1 ), CLDN6, gp100, melanl , p53, and/or biotinylated molecules, and/or molecules expressed by HIV, HCV, HBV or other pathogens.
In some embodiments one or more antigens can be selected from the following list (Gene Name (Protein Accession No. Of UniProt, RefSeq or Genbank)): 1A01_HLA- A/m (P30443); 1A02 (P01892); 5T4 (Q13641 ); ACRBP (Q8NEB7); AFP (P02771 ); AKAP4 (Q5JQC9); alpha-actinin-_4/m (B4DSX0); alpha-actinin-_4/m (B4E337); alpha-actinin-_4/m (043707); alpha-methylacyl-coenzyme_A_racemase (A0A024RE16); alpha-methylacyl-coenzyme_A_racemase (A8KAC3); ANDR (P10275); ART-4 (Q9ULX3); ARTC1/m (P52961 ); AURKB (Q96GD4); B2MG (P61769); B3GN5 (Q9BYG0); B4GN1 (Q00973); B7H4 (Q7Z7D3); BAGE-1 (Q13072); BASI (P35613); BCL-2 (A9QXG9); bcr/abl (A9UEZ4); bcr/abl (A9UEZ7); bcr/abl (A9UEZ8); bcr/abl (A9UEZ9); bcr/abl (A9UF00); bcr/abl (A9UF01 ); bcr/abl (A9UF03); bcr/abl (A9UF04); bcr/abl (A9UF05); bcr/abl (A9UF06); bcr/abl (A9UF08); beta- catenin/m (P35222); beta-catenin/m (Q8WYA6); BING-4 (015213); BIRC7 (Q96CA5); BRCA1/m (A0A024R1V0); BRCA1/m (A0A024R1V7); BRCA1/m (A0A024R1Z8); BRCA1/m (A0A068BFX7); BRCA1/m (C6YB45); BRCA1/m (C6YB47); BRCA1/m (G3XAC3); BY55 (095971 ); calreticulin (B4DHR1 ); calreticulin (B4E2Y9); calreticulin (P27797); calreticulin (Q96L12); CAMEL (095987); CASP-8/m (Q14790); CASPA (Q92851-4); cathepsin_B (A0A024R374); cathepsin_B (P07858); cathepsin_L (A0A024R276); cathepsin_L (P07711 ); cathepsin_L (Q9HBQ7); CD1A (P06126); CD1 B (P29016); CD1 C (P29017); CD1 D (P15813); CD1 E (P15812); CD20 (P11836); CD22 (060926); CD22 (P20273); CD22 (Q0EAF5); CD276 (Q5ZPR3); CD33 (B4DF51 ); CD33 (P20138); CD33 (Q546G0); CD3E (P07766); CD3Z (P20963); CD44_lsoform_1 (P16070); CD44_lsoform_6 (P16070-6); CD4 (P01730); CD52 (P31358); CD52 (Q6IBD0); CD52 (V9HWN9); CD55 (B1AP15); CD55 (D3DT85); CD55 (D3DT86); CD55 (P08174); CD56 (P13591 ); CD80 (A0N0P2); CD80 (P33681 ); CD86 (P42081 ); CD8A (P01732); CDC27/m (G5EA36); CDC27/m (P30260); CDE30 (P28908); CDK4/m (A0A024RBB6); CDK4/m (P11802); CDK4/m (Q6LC83); CDK4/m (Q96BE9); CDKN2A/m (D1 LYX3); CDKN2A/m (G3XAG3); CDKN2A/m (K7PML8); CDKN2A/m (L8E941 ); CDKN2A/m (Q8N726); CEA (NP_004354); CEAM6 (P40199); CH3L2 (Q15782); CLCA2 (Q9UQC9); CML28 (Q9NQT4); CML66 (Q96RS6); COA- 1/m (Q5T124); coactosin-like_protein (014019); collagen XXIII (L8EAS4); collagen XXIII (Q86Y22); COX-2 (Q6ZYK7); CP1 B1 (Q16678); CSAG2 (Q9Y5P2-2); CSAG2 (Q9Y5P2); CT45A1 (Q5HYN5); CT55 (Q8WUE5); CT-_9/BRD6 (Q58F21 ); CTAG2_lsoform_LAGE-1A (075638-2); CTAG2_lsoform_LAGE-1 B (075638); CTCFL (Q8NI51 ); Cten (Q8IZW8); cyclin_B1 (P14635); cyclin_D1 (P24385); cyp-B (P23284); DAM-10 (P43366); DEP1A (Q5TB30); E7 (P03129); E7 (P06788); E7 (P17387); E7 (P06429); E7 (P27230); E7 (P24837); E7 (P21736); E7 (P26558); E7 (P36831 ); E7 (P36833); E7 (Q9QCZ1 ); E7 (Q81965); E7 (Q80956); EF1A2 (Q05639); EFTUD2/m (Q15029); EGFR (A0A0B4J1Y5); EGFR (E7BSV0); EGFR (L0R6G1 ); EGFR (P00533-2); EGFR (P00533); EGFR (Q147T7); EGFR (Q504U8); EGFR (Q8NDU8); EGLN3 (Q9H6Z9); ELF2/m (B7Z720); EMMPRIN (Q54A51 ); EpCam (P16422); EphA2 (P29317); EphA3 (P29320); EphA3 (Q6P4R6); ErbB3 (B3KWG5); ErbB3 (B4DGQ7); ERBB4 (Q15303); ERG (P11308); ETV6 (P41212); EWS (Q01844); EZH2 (F2YMM1 ); EZH2 (G3XAL2); EZH2 (L0R855); EZH2 (Q15910); EZH2 (S4S3R8); FABP7 (015540); FCGR3A (P08637); FGF5 (P12034); FGF5 (Q60518); FGFR2 (P21802); fibronectin (A0A024R516); fibronectin (A0A024RB01 ); fibronectin (A0A024RDT9); fibronectin (A0A024RDV5); fibronectin (A6NH44); fibronectin (A8K6A5); fibronectin (B2R627); fibronectin (B3KXM5); fibronectin (B4DIC5); fibronectin (B4DN21 ); fibronectin (B4DS98); fibronectin (B4DTH2); fibronectin
(B4DTK1 ); fibronectin (B4DU16); fibronectin (B7Z3W5); fibronectin (B7Z939); fibronectin (G5E9X3); fibronectin (Q9H382); FOS (P01100); FOXP3 (Q9BZS1 ); FUT1 (P19526); G250 (Q16790); GAGE-1 (AAA82744); GAGE-2 (Q6NT46); GAGE-3 (Q13067); GAGE-4 (Q13068); GAGE-5 (Q13069); GAGE-6 (Q13070); GAGE7b (Q76087); GAGE-8 GAGE-2D (Q9UEU5); GASR (P32239); GnT-V (Q09328); GPC3 (I6QTG3); GPC3 (P51654); GPC3 (Q8IYG2); GPNMB/m (A0A024RA55); GPNMB/m (Q14956); GPNMB/m (Q8IXJ5); GPNMB/m (Q96F58); GRM3 (Q14832); HAGE (Q9NXZ2); hepsin (B2ZDQ2); hepsin (P05981 ); Her2/neu (B4DTR1 ); Her2/neu (L8E8G2); Her2/neu (P04626); Her2/neu (Q9UK79); HLA-A2/m (Q95387); HLA-A2/m (Q9MYF8); homeobox_NKX3.1 (Q99801 ); HOM-TES-85 (B2RBQ6); HOM-TES-85 (Q9P127); HPG1 Pubmed: 12543784); HS71A (P0DMV8); HS71 B (P0DMV9); HST- 2 (P10767); hTERT (094807); iCE (000748); IF2B3 (000425); IL10 (P22301 ); IL- 13Ra2 (014627); IL2-RA (P01589); IL2-RB (P14784); IL2-RG (P31785); IL-5 (P05113); IMP3 (Q9NV31 ); ITA5 (P08648); ITB1 (P05556); ITB6 (P18564); kallikrein- 2 (A0A024R4J4); kallikrein-2 (A0A024R4N3); kallikrein-2 (B0AZU9); kallikrein-2 (B4DU77); kallikrein-2 (P20151 ); kallikrein-2 (Q6T774); kallikrein-2 (Q6T775); kallikrein-4 (A0A0C4DFQ5); kallikrein-4 (Q5BQA0); kallikrein-4 (Q96PTO); kallikrein-4 (Q96PT1 ); kallikrein-4 (Q9Y5K2); KI20A (095235); KIAA0205 (092604); KIF2C (Q99661 ); KK-LC-1 (Q5H943); LDLR (P01130); LGMN (Q99538); LIRB2 (Q8N423); LY6K (Q17RY6); MAGA5 (P43359); MAGA8 (P43361 ); MAGAB (P43364); MAGE-A10 (A0A024RC14); MAGE-A12 (P43365); MAGE-A1 (P43355); MAGE-A2 (P43356); MAGE-A3 (P43357); MAGE-A4 (A0A024RC12); MAGE-A4 (P43358); MAGE-A4 (Q1 RN33); MAGE-A6 (A8K072); MAGE-A6 (P43360); MAGE-A6 (Q6FH15); MAGE- A9 (P43362); MAGE-B10 (Q96LZ2); MAGE-B16 (A2A368); MAGE-B17 (A8MXT2); MAGE-_B1 (Q96TG1 ); MAGE-B2 (015479); MAGE-B3 (015480); MAGE-B4 (015481 ); MAGE-B5 (Q9BZ81 ); MAGE-B6 (Q8N7X4); MAGE-C1 (060732); MAGE- 02 (Q9UBF1 ); MAGE-C3 (Q8TD91 ); MAGE-D1 (Q9Y5V3); MAGE-D2 (Q9UNF1 ); MAGE-D4 (Q96JG8); MAGE-_E1 (Q61AI7); MAGE-E1JMAGE1 ) (Q9HCI5); MAGE- E2 (Q8TD90); MAGE-F1 (Q9HAY2); MAGE-H1 (Q9H213); MAGEL2 (Q9UJ55); mammaglobin_A (Q13296); mammaglobin_A (Q6NX70); MART-1 /melan-A (Q16655); MART-2 (Q5VTY9); MC1_R (Q01726); MC1_R (Q1 JUL4); MC1_R (Q1 JUL6); MC1_R (Q1 JUL8); MC1_R (Q1JUL9); MC1_R (Q1 JUM0); MC1_R (Q1 JUM2); MC1_R (Q1 JUM3); MC1_R (Q1 JUM4); MC1_R (Q1 JUM5); MC1_R (Q6UR92); MC1_R
(Q6UR94); MC1_R (Q6UR95); MC1_R (Q6UR96); MC1_R (Q6UR97); MC1_R
(Q6UR98); MC1_R (Q6UR99); MC1_R (Q6URA0); MC1_R (Q86YW1 ); MC1_R
(V9Q5S2); MC1_R (V9Q671 ); MC1_R (V9Q783); MC1_R (V9Q7F1 ); MC1_R
(V9Q8N1 ); MC1_R (V9Q977); MC1_R (V9Q9P5); MC1_R (V9Q9R8); MC1_R
(V9QAE0); MC1_R (V9QAR2); MC1_R (V9QAW3); MC1_R (V9QB02); MC1_R
(V9QB58); MC1_R (V9QBY6); MC1_R (V9QC17); MC1_R (V9QC66); MC1_R
(V9QCQ4); MC1_R (V9QDF4); MC1_R (V9QDN7); MC1_R (V9QDQ6); M-CSF
(P09603); mesothelin (013421 ); MITF (075030-8); MITF (075030-9); MITF (075030); MMP1_1 (B3KQS8); MMP7 (P09237); MUC-1 (AAA60019); MUM-1/m (NP_116242); MUM-2/m (Q9Y5R8); MYCN (P04198); MYO1A (Q9UBC5); MYO1 B (043795); MYO1C (000159); MY01 D (094832); MYO1 E (Q12965); MY01 F (000160); MYO1 G (B0I1T2); MYO1 H (NP_001094891 ); NA17 (Q3V5L5); NA88-A Pubmed: 10790436); Neo-PAP (Q9BWT3); NFYC/m (Q13952); NGEP (Q61WH7); NPM (P06748); NRCAM (Q92823); NSE (P09104); NUF2 (Q9BZD4); NY-ESO-1 (P78358); OA1 (P51810); OGT (015294); OS-9 (B4DH11 ); OS-9 (B4E321 ); OS-9 (B7Z8E7); OS-9 (Q13438); osteocalcin (P02818); osteopontin (A0A024RDE2); osteopontin (A0A024RDE6); osteopontin (A0A024RDJ0); osteopontin (B7Z351 ); osteopontin (F2YQ21 ); osteopontin (P10451 ); p53 (P04637); PAGE-4 (060829); PAI-1 (P05121 ); PAI-2 (P05120); PAP (Q06141 ); PAP (Q53S56); PATE (Q8WXA2); PAX3 (P23760); PAX5 (002548); PD1 L1 (Q9NZQ7); PDCD1 (015116); PDEF (095238); PECA1 (P16284); PGCB (Q96GW7); PGFRB (P09619); Pim-1_-Kinase (A0A024RD25); Pin-1 (015428); Pin-1 (Q13526); Pin-1 (Q49AR7); PLAC1 (Q9HBJ0); PMEL (P40967); PML (P29590); POTEF (A5A3E0); POTE (Q86YR6); PRAME (A0A024R1 E6); PRAME (P78395); PRDX5/m (P30044); PRM2 (P04554); prostein (Q96JT2); proteinase-3 (D6CHE9); proteinase-3 (P24158); PSA (P55786); PSB9 (P28065); PSCA (D3DWI6); PSCA (043653); PSGR (Q9H255); PSM (Q04609); PTPRC (NP_002829); RAB8A (P61006); RAGE-1 (Q9UQ07); RARA (P10276); RASH (P01112); RASK (P01116); RASN (P01111 ); RGS5 (015539); RHAMM/CD168 (075330); RHOC (P08134); RSSA (P08865); RU1 (Q9UHJ3); RU2 (Q9UHG0); RUNX1 (Q01196); S-100 (V9HW39); SAGE (Q9NXZ1 ); SART-_1 (043290); SART-2 (Q9UL01 ); SART-3 (Q15020); SEPR (012884); SERPINB5 (P36952); SIA7F (Q969X2); SIA8A (Q92185); SIAT9 (Q9UNP4); SIRT2/m (A0A024R0G8); SIRT2/m (Q8IXJ6); SOX10 (P56693); SP17 (Q15506); SPNXA (Q9NS26); SPXN3 (Q5MJ09); SSX-1 (Q16384); SSX-2 (Q16385); SSX3 (Q99909); SSX-4 (060224); ST1A1 (P50225); STAG2 (Q8N3U4-2); STAMP-1 (Q8NFT2); STEAP-1 (A0A024RA63); STEAP-1 (Q9UHE8); Survivin-2B (015392-2); survivin (015392); SYCP1 (A0A024R012); SYCP1 (B7ZLS9); SYCP1 (015431 ); SYCP1 (Q3MHC4); SYT-SSX-1 (A4PIV7); SYT-SSX-1 (A4PIV8); SYT-SSX-2 (A4PIV9); SYT-SSX-2 (A4PIW0); TARP (Q0VGM3); TCRg (A2JGV3); TF2AA (P52655); TGFB1 (P01137); TGFR2 (P37173); TGM-4 (B2R7D1 ); TIE2 (Q02763); TKTL1 (P51854); TPI/m (P60174); TRGV11 (099601 ); TRGV9 (A4D1X2); TRGV9 (099603); TRGV9 (099604); TRPC1 (P48995); TRP-p8 (Q7Z2W7); TSG10 (Q9BZW7); TSPY1 (001534); TVC_TRGV3 (M13231.1 ); TX101 (Q9BY14-2); tyrosinase (A0A024DBG7); tyrosinase (L8B082); tyrosinase (L8B086); tyrosinase (L8B0B9); tyrosinase (075767); tyrosinase (P14679); tyrosinase (LI3M8NO); tyrosinase (U3M9D5); tyrosinase (U3M9J2); TYRP1 (P17643); TYRP2 (P40126); UPA (Q96NZ9); VEGFR1 (B5A924); WT1 (A0A0H5AUY0); WT1 (P19544); WT1 (Q06250) and XAGE1 (Q9HD64).
In some embodiments, the antigen is a personalized antigen used to design personalized antigen vaccines that includes variations of DNA and RNA extraction from tumor and germline tissue for exome and RNA sequencing as well as HLA typing. Somatic mutations are often selected that are present in the tumor and absent in the germline, because they have low ‘false discovery rate’ and cause non-synonymous protein changes. Potentially immunogenic neo-epitopes (or neoantigens) are selected from among somatic mutations by in silico prediction of their binding to that patients’ HLA alleles using approaches similar to the NetMHC algorithm. Highly expressed neoepitopes are prioritized by assessment of tumoral RNA-sequencing data, from which generally up to 20 neo-epitopes are selected and good manufacturing practice (GMP)- grade neo-epitope peptides, RNA or viral vectors are produced.
In some embodiments the antigen is an “ignored neoantigen”, characterized by a moderate level of neoepitope presentation that is below the threshold for priming of naive T cells but above the level for recognition by memory T cells. Ignored neoantigens typically require a vaccination to generate neoantigen presentation levels in the lymph node that allow priming. Said neoantigen should typically exhibit low expression and/or high-affinity MHC binding or high expression and/or low-affinity MHC binding such that T cells can be activated for effector functions in the tumour.
In some embodiments, the antigen may be a peptide derived from non-canonical open reading frame (ORFs) also referred to as antigens arising from the dark genome or as neoantigens. ORFs are termed “non-canonical” to distinguish them from CDSs included in reference gene annotation - i.e. Ensembl-GENCODE - even though their translation occurs through mechanisms of ribosome activity similar to that of CDSs. Throughout this text the term “non-canonical open reading frame” is therefore defined as any open reading frame that is not an annotated CDS, an in-frame extension or truncation (either N-terminal or C-terminal), or an in-frame intron retention of an annotated CDS. Thus, in some embodiments the antigen is from the grey or dark genome. Typical dark or grey antigen can be derived from non-canonical ORFs induced by frameshit and/or spliced variants as well as from ORFs from transcripts annotated as IncRNAs, pseudogenes, TE, or retroviral elements in the genome. In some embodiments, the extracellular antigen binding domain binds to any of the tumor neoantigenic peptides disclosed in Int’l Pat. Pub. No. WO 2021/043804, incorporated by reference herein in its entirety. For example, the antigen-binding domain binds to any of the peptides of SEQ ID NO: 1-117 or to a neoantigenic peptide comprising at least 8, 9, 10, 11 or 12 amino acids that is encoded by a part of an open reading frame (ORF) of any of the fusion transcript sequences of any one of SEQ ID NO: 118-17492 of WO 2021/043804 or described in any of WO 2018/234367, WO 2022/189620, WO 2022/189626, and WO-2022/189639. Noncanonical cancer or tumor polypeptides include for example peptides derived from TE (transposable elements) such as in Bonte PE, Arribas YA, Merlotti A, et al. Single-cell RNA-seq-based proteogenomics identifies glioblastoma-specific transposable elements encoding HLA-l-presented peptides. Cell Rep. 2022;39(10): 110916 ; LTR elements as in Attig J, Young GR, Hosie L, et al. LTR retroelement expansion of the human cancer transcriptome and immunopeptidome revealed by de novo transcript assembly. Genome Res. 2019;29(10):1578-1590 ; mid exon splicing such as in Kahles A, Lehmann KV, Toussaint NO, Huser M, Stark SG, Sachsenberg T, Stegle O, Kohlbacher O, Sander C; Cancer Genome Atlas Research Network, et al. 2018. Comprehensive analysis of alternative splicing across tumors from 8,705 patients. Cancer Cell 34: 211-224. e6 ; intron retention such as in Smart AC, Margolis CA, Pimentel H, He MX, Miao D, Adeegbe D, Fugmann T, Wong KK, Van Allen EM. 2018. Intron retention is a source of neoepitopes in cancer. Nat Biotechnol 36: 1056-1058. 10.1038/nbt.4239, noncanonical splicing junctions such as described in Merlotti A, Sadacca B, Arribas YA, et al. Noncanonical splicing junctions between exons and transposable elements represent a source of immunogenic recurrent neo-antigens in patients with lung cancer. Sci Immunol. 2023;8(80):eabm6359 or in Shah NM, Jang HJ, Liang Y, et al. Pan-cancer analysis identifies tumor-specific antigens derived from transposable elements. Nat Genet. 2023;55(4):631-639). In some embodiments, the tumor antigen is selected from an intracellular peptide as described in WO 2022/189626 or WO 2022/189639. In these embodiments the antigen binding domain of the antigen receptor as herein described is typically a pMHC restricted antibody (e.g. a monoclonal antibody or mAbs) or a fragment thereof. In other embodiment, the tumor antigen is a surface antigen and notably a non-canonical surface polypeptide as defined for example in WO 2022/189620.
In some embodiments, the tumor antigen is a predefined antigen. Predefined antigens can be further classified by the frequency of expression across patient cohorts. Shared antigens are those expressed in a sufficient proportion of patients such that vaccinologists can target these patient groups (frequently within patient subsets of tumor types) using standard testing. Shared antigen vaccines can thus target TSAs, CTAs,TAAs or any type of non-canonical antigens.
In some embodiment the antigen derived from cancer mutations (somatic cancer variants) that can be shared or not. Shared cancer antigens include nucleotide cancer variants or KRAS, IDH1 , TP53, H3-3A, JAK2, PIK3A, BRAF, CDK4, CDK12, NRAS, CTNNBA, GAS7. It may also include cancer indel variants of genes such as NPM1 , CALR, TGFBR2 as well as cancer fusion genes such as BCR-ABL, DEK-CAN, SYT- SSX, PML-RARA, PAX-FKHR or ETV6-AML1 or cancer spliced variants.
Shared antigen vaccines are distinguished from personalized antigen vaccines in that the former can be assessed with standard testing such as cytology, immunohistochemistry and flow cytometry. Personalized antigens are unique to the vaccinated patient.
In some embodiment, the tumor antigen is a variant of a tumor antigen, wherein the tumor antigen wherein the antigen can be selected from one of the above-mentioned tumor antigens. A “variant” of said tumor antigen may typically comprise an amino acid sequence having a sequence identity of at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, preferably of at least 70%, more preferably of at least 80%, even more preferably at least 85%, even more preferably of at least 90% and most preferably of at least 95% or even 97%, with an amino acid sequence of the respective naturally occurring (wild type) full-length tumor antigen, wherein the tumor antigen is an antigen selected from the antigens listed above.
In some embodiments, the antigen comprises a fragment of an antigen (notably a tumor antigen) as described above (or a variant thereof) preferably comprising at least one epitope of said antigen (or variant thereof), wherein the tumor antigen is an antigen selected from above listed antigens notably tumor antigens, or a variant thereof. A fragment of said tumor antigen (or variant thereof) may typically comprise or consist of an amino acid sequence having a sequence identity of at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, preferably of at least 70%, more preferably of at least 80%, even more preferably at least 85%, even more preferably of at least 90% and most preferably of at least 95% or even 97%, with an amino acid sequence of the respective full-length tumor antigen (or variant thereof.
In some embodiments, the tumor antigens are anonymous antigens. Instead of being classified by their antigen identity, anonymous antigens can be classified by their method and location of APC loading. Anonymous antigen ex vivo vaccines are derived from excised tumor cells that are lysed and delivered to autologous APCs. Ex vivo antigen isolation may require extraction of tumor cells (excisional biopsy), processing raw tissue into a more antigenic form and colocalization with APCs. Injected tumor cells may be taken up and their antigens may be presented by APCs, or the tumor cells themselves may present their antigens to T cells. Anonymous antigen in situ vaccines are conceptually similar to ex vivo vaccines and bypass developing custom, GMP- compliant therapies for each patient.
In some embodiments, the antigen is expressed at low density, e.g., less than about 6,000 molecules of the target antigen per cell. In some embodiments, the antigen is expressed at an expression level of less than about 5,000 molecules, less than about 4,000 molecules, less than about 3,000 molecules, less than about 2,000 molecules, less than about 1 ,000 molecules, or less than about 500 molecules of the target antigen per cell. In some embodiments, the antigen is expressed at a density of less than about 2,000 molecules, such as e.g., less than about 1 ,800 molecules, less than about 1 ,600 molecules, less than about 1 ,400 molecules, less than about 1 ,200 molecules, less than about 1 ,000 molecules, less than about 800 molecules, less than about 600 molecules, less than about 400 molecules, less than about 200 molecules, or less than about 100 molecules of the target antigen per cell. In some embodiments, the antigen is expressed at a density of less than about 1 ,000 molecules, such as e.g., less than about 900 molecules, less than about 800 molecules, less than about 700 molecules, less than about 600 molecules, less than about 500 molecules, less than about 400 molecules, less than about 300 molecules, less than about 200 molecules, or less than about 100 molecules of the target antigen per cell. In some embodiments, the antigen is expressed at a density ranging from about 5,000 to about 100 molecules of the target antigen per cell, such as e.g., from about 5,000 to about 1 ,000 molecules, from about 4,000 to about 2,000 molecules, from about 3,000 to about 2,000 molecules, from about 4,000 to about 3,000 molecules, from about 3,000 to about 1 ,000 molecules, from about 2,000 to about 1 ,000 molecules, from about 1 ,000 to about 500 molecules, from about 500 to about 100 molecules of the target antigen per cell.
In some embodiments, the antigen is a peptide predicted to bind to MHC I molecules, thereby inducing T cell responses to the CD8+ T cell subset. In some embodiments, the antigen is a peptide predicted to bind to MHC II molecules, thereby inducing T cell responses to the CD4+ T cell subset. In some embodiments one or more antigens predicted to bind to MHC I molecules and one or more antigens predicted to bind to MHC II molecules can be used in combination.
It is of course intended that more than one antigen as described above can be combined in a vaccine composition to achieve the ideal immune response. In some embodiments, a plurality or more than one, preferably 2 to 20, more preferably 2 to 20, most preferably 2 to 6 antigens. Said combinations typically comprise more than one different tumor antigens, or pathogenic antigens.
Production of antigens
One of skill in the art will appreciate that there are a variety of ways in which to produce antigens as above defined. Typically, antigens can be produced either in vitro or in vivo.
They may be produced in vitro as peptides or polypeptides, which may then be formulated into a vaccine or immunogenic composition and administered to a subject. Such in vitro production may occur by a variety of methods known to one of skill in the art such as, for example, peptide synthesis or expression of a peptide/polypeptide from a DNA or RNA molecule in any of a variety of bacterial, eukaryotic, or viral recombinant expression systems, followed by purification of the expressed peptide/polypeptide.
Alternatively, antigens may be produced in vivo by introducing molecules (e.g., DNA, RNA, viral expression systems, and the like) encoding antigens into a subject, whereupon the encoded antigens are expressed. Vaccine or immunogenic compositions
A “vaccine” or immunogenic composition is typically understood to be a prophylactic or therapeutic material providing at least one antigen, typically at least one epitope of an antigen, preferably an immunogen.
“Providing at least on epitope” means, for example, that the vaccine comprises the epitope or that the vaccine comprises a molecule that, e.g., codes for the epitope or a molecule comprising the epitope. For example, a vaccine composition can comprise at least one epitope-encoding nucleic acid (such as an RNA molecule) comprising at least one coding sequence encoding an epitope (or an antigen or variant or fragment thereof comprising said epitope). Said epitope (or antigen or variant or fragment thereof comprising said epitope) can be derived from an infectious pathogen or from a tumor or cancer cell, and triggers an adaptive immune response which preferably eliminates said infectious pathogen or tumor (or cancer) cell.
Vaccine or immunogenic compositions of the present disclosure include nucleic acidbased compositions, peptide-based composition as well as cell-based compositions.
Typically, as previously mentioned, in the medical preparation and treatment method as herein disclosed the first component that elicits an immune response, notably a cell- mediated immune response, notably a composition comprising one or more antigens as previously defined is provided as a pharmaceutical composition or as a vaccine also named herein immunogenic composition.
The (pharmaceutical) composition or vaccine provided herein may further comprise at least one pharmaceutically acceptable excipient, adjuvant or further component (e.g. additives, auxiliary substances, and the like).
In some embodiments the vaccine or immunogenic composition comprises T helper (Th) cell epitopes such as the vaccine composition is able to trigger a Th response in the recipient subject.
Further example of adjuvants that increase or expand the immune response of a host to an antigenic compound include emulsifiers, muramyl dipeptides, avridine, aqueous adjuvants such as aluminum hydroxide, chitosan-based adjuvants, saponins, oils, Amphigen, LPS, bacterial cell wall extracts, bacterial DNA, CpG sequences, synthetic oligonucleotides, cytokines and combinations thereof. Emulsifiers include, for example, potassium, sodium and ammonium salts of lauric and oleic acid, calcium, magnesium and aluminum salts of fatty acids, organic sulfonates such as sodium lauryl sulfate, cetyltrhethylammonlum bromide, glycerylesters, polyoxyethylene glycol esters and ethers, and sorbitan fatty acid esters and their polyoxyethylene, acacia, gelatin, lecithin and/or cholesterol.
Adjuvants that comprise an oil component include mineral oil, a vegetable oil, or an animal oil.
Other adjuvants include Freund's Complete Adjuvant (FCA) or Freund's Incomplete Adjuvant (FIA). Cytokines useful as additional immunostimulatory agents include interferon alpha, interleukin-2 (IL-2), and granulocyte macrophage-colony stimulating factor (GM-CSF), or combinations thereof.
In some embodiments effectively activating a cellular immune response for a vaccine or immunogenic composition can be achieved by expressing the relevant one or more antigens in a vaccine or immunogenic composition in a non-pathogenic microorganism. Well-known examples of such microorganisms are Mycobacterium bovis BCG, Salmonella and Pseudomona (See, U.S. Patent No. 6,991 ,797, hereby incorporated by reference in its entirety).
In some embodiments, the (pharmaceutical) composition or the vaccine according to the invention comprises the combination of the present invention, wherein the at least one coding sequence of the at least one epitope-encoding nucleic acid encodes at least one epitope of an antigen (e.g., at least one epitope of a tumor antigen or a fragment or variant of any one of the previously defined antigens). The (pharmaceutical) composition or vaccine according to the invention may thus comprise at least one antigen together with a KMT inhibitor as previously defined. When the antigen is under the form of a nucleic acid, a combination with a nucleic acid KMT inhibitor as previously defined can be of interest for delivery reason. In some of embodiments, the one or more nucleic acids encoding the one or more antigens can be delivered into separate delivery vehicles (typically an expression vector) or in the one single vehicle (such as a multi-cistronic expression cassette included in a vector).
In some embodiments, the (pharmaceutical) composition or vaccine of the present invention comprises, a KMT inhibitor (notably the Suv39h1 inhibitor), and at least one antigen, notably at least one epitope encoding nucleic acid, in particular at least one epitope-encoding nucleic acid (typically an RNA molecule) as defined herein, wherein said at least one epitope-encoding nucleic acid encodes at least two, three, four, five, six, seven, eight, nine, ten, eleven or twelve distinct epitopes (or antigens or variants or fragments thereof comprising said epitopes) as defined herein. In such embodiments, the (pharmaceutical) composition or vaccine preferably comprises several classes of the epitope-encoding nucleic acid (notably encoding RNA) as previously defined in combination with the KMT inhibitor, notably the Suv39h1 inhibitor, wherein each epitope-encoding nucleic acid species, notably RNA species encodes a distinct epitope (or an antigen or a variant or fragment thereof comprising said epitope) as defined herein.
In some embodiments, the epitope-encoding nucleic acid comprised in the (pharmaceutical) composition or vaccine is a bi- or multicistronic nucleic acid molecule (e.g., RNA), which encodes the at least two, three, four, five, six, seven, eight, nine, ten, eleven or twelve distinct epitopes (or antigens or variants or fragments thereof comprising said epitopes). Mixtures between these embodiments are also envisaged, such as compositions comprising more than one epitope-encoding RNA species, wherein at least one epitope-encoding RNA species may be monocistronic, while at least one other epitope-encoding RNA species may be bi- or multicistronic.
Methods for introducing nucleic acids into mammalian cells in vivo are well known. Nucleic acid transport includes notably viral and non-viral vectors (including mRNA, plasmid, lipid nanoparticules (LNPs) or nanocarriers).
In some embodiments a therapeutic or pharmaceutical composition as per the present invention comprise one or more LVs, AAVs, LNPs, NCs, and/or NPs. In some embodiments, LVs having a particular cell tropism, in particular a particular a T cell or NK cell tropism, are used. For example, LVs targeting surface marker of NK or T cells (such as CD3, CD4 or CD8) can be used. In some embodiments, an implantable scaffold for example made of biodegradable polymer carrying viral or non-viral particles comprising at least one nucleic acid of the invention can be used.
In some embodiments a Poxvirus is used in the vaccine or immunogenic composition. These include orthopoxvirus, avipox, vaccinia, MV A, NYVAC, canarypox, ALVAC, fowlpox, TROVAC, etc. (See e.g., Verardiet ah, Hum Vaccin Immunother. 2012 Jul;8 (7):96l-70; and Moss, Vaccine. 2013: 31 (39): 4220-4222). Poxvirus expression vectors were described in 1982 and quickly became widely used for vaccine development as well as research in numerous fields. Advantages of the vectors include simple construction, ability to accommodate large amounts of foreign DNA and high expression levels.
Vaccines or immunogenic compositions according to the present invention include inactivated vaccines, live-attenuated vaccines, messenger RNA (mRNA) vaccines, subunit, recombinant, polysaccharide, and conjugate vaccines, toxoid vaccines and viral vector vaccines.
Live-attenuated vaccines contain live pathogens from either a bacteria or a virus that have been "attenuated," or weakened (e.g., Measles, mumps, and rubella (MMR) vaccine, varicella (chickenpox) vaccine).
Inactivated vaccines take a live pathogen and inactivate or kill it. When the vaccine is then introduced to a human through a shot, for example, the inactivated pathogen is strong enough to create an immune response, however, is incapable of causing disease. Multiple doses are often needed in order to build up immunity and offer full protection (e.g., polio vaccine and influenza vaccine).
Subunit/antigen, recombinant, polysaccharide, and conjugate vaccine compositions are made from a piece of a pathogen, not the whole organism, so they do not contain any live pathogens.
Some important subunit vaccines are polysaccharide vaccines, conjugate vaccines, and protein-based vaccines (can be recombinant or not) (e.g., Haemophilus influenzae type B (Hib) vaccine (conjugate), pneumococcal vaccine (polysaccharide or conjugate), shingles vaccine (recombinant protein), hepatitis B (recombinant protein), acellular pertussis, MenACWY (conjugate)). Several approaches have been described to enhance the immunogenicity and stability of subunit vaccines, such as virus-like particle (VLP) vaccines and nanoparticle (NP) vaccines. VLP vaccines use platforms capable of producing particles that mimic the structure of authentic viruses. VLP vaccines can be produced by expressing antigenic proteins in a eukaryotic or prokaryotic system, resulting in the formation of particles with an inherent ability of the antigenic proteins to self-assemble. Alternatively, VLP vaccines can also be made by producing blank VLP templates and then chemically linking antigenic peptides onto the pre-formed particles.
Toxoid vaccines use inactivated toxins to target the toxic activity created by the bacteria, rather than targeting the bacteria itself (e.g., tetanus vaccine and diphteria vaccine).
Viral vector vaccines rely on antigen delivered on an unrelated, non-pathogenic viral backbone (rVSV-ZEBOV Ebola vaccine, AstraZeneca Covid-19 vaccine). A number of viruses have been developed as vectors for vaccine development, including poxviruses, adenoviruses, herpesviruses, arenaviruses, retroviruses, paramyxoviruses, and flaviviruses, among others (see Draper SJ, Heeney JL. Viruses as vaccine vectors for infectious diseases and cancer. Nat Rev Microbiol (2010) 8:62- 73). Replication-defective and single-cycle viral vectors (such as single cycle AAV vectors) are particularly relevant as they have an increased safety profile and, in some cases, are still able to elicit a strong immune response (see for example the following reviews: Dudek T, Knipe DM. Replication-defective viruses as vaccines and vaccine vectors. Virology (2006) 344:230-9Barry M. Single-cycle adenovirus vectors in the current vaccine landscape. Expert Rev Vaccines (2018)).
Nucleic acid-based vaccine such as DNA or mRNA vaccines use genetic materials that code for the one or more antigens (e.g., the coronavirus’s spike protein or a tumor antigen) to trigger an immune response. Recently approved COVID-19 mRNA vaccines include the Moderna's Spikevax and Pfizer's BNT 162b2. Then, the expressed tumor antigens could induce immune killing effects against cancer cells. The nucleic acid vaccine usually induces strong MHC I mediated CD8 + T cell responses. Nucleic acid vaccines can simultaneously deliver multiple antigens to trigger humoral and cellular immunity. Additionally, nucleic acid vaccines can encode full-length tumor antigens, allowing APC to cross-present various epitopes or present several antigens simultaneously. More particularly, DNA vaccines use small DNA molecules (e.g., plasmids), while mRNA vaccines use the mRNA encoding the antigen. Typically, DNA vaccines need to enter the nucleus to synthesize the antigen, however, once plasmid DNA enters the nucleus, a single plasmid DNA can produce multiple mRNA copies. mRNA vaccines require a shorter route as mRNA just need to reach the cytoplasm for the synthesis of the antigen and mRNA have low risk of insertion and integration into the genome. mRNA vaccines are mainly divided into non-replicating mRNA and self-amplifying RNA (SAM). Non-replacing mRNA is composed of 7-methylguanosine (m7G) 5' cap, 5'- untranslated region (5'-UTR), open reading frame (OFR), 3'-untranslated region (3'- UTR), and 3'poly(A) tail (see notably Pollard C, De Koker S, Saelens X, Vanham G, Grooten J. Challenges and advances towards the rational design of mRNA vaccines. Trends Mol Med. 2013; 19(12):705- 13). S elf-amplifying RNA (SAM) comprises 2 ORFs. One encodes the antigen, and te second encodes viral replication component, enabling long-lasting RNA amplification in cells. SAM is originated from alphavirus, and it replicates and magnifies in vivo to induce a persistent and efficient immune response. SAM may allow low doses of vaccination to produce large amounts of the antigen over a certain period.
Some of these vaccine compositions will be further detailed below in relation to cancer vaccines but it is to be understood that such vaccine can be applied to any other pathogen antigen as previously detailed.
Cancer vaccines can be described according to the type of antigen being introduced: whole tumor, tumor cells, protein, peptides (long or short), RNA or DNA (directly or virally); and the adjuvants with which antigen is introduced: carrier protein, cells (for example, dendritic cells (DCs)), proteins (for example, CD40 ligand (CD40L)) or chemicals (for example, oil-water emulsions and Toll-like receptor (TLR) agonists). Cancer vaccines have also been described as belonging to at least four categories: cell-based vaccines, peptide-based vaccines, viral-based vaccines, and nucleic acidbased vaccines. These categories typically include whole tumor cells, tumor lysates, gene-modified tumor cells, purified or recombinant peptide or protein TAA-based vaccines, nucleic acid-based vaccines, and genetically modified cancer cells expressing immunostimulatory cytokines.
Cell-based (cancer) vaccines
The cell-based vaccine compositions can be divided into (tumor) cell-based vaccine composition and immune cell vaccine composition. Cancer vaccine technologies have been recently reviewed in Liu, J., Fu, M., Wang, M. et al. Cancer vaccines as promising immuno-therapeutics: platforms and current progress. J Hematol Oncol 15, 28 (2022). These technologies are summarized below.
Cell-based cancer vaccines are often prepared from whole cells or cell fragments, containing almost tumor antigens, inducing a broader antigen immune response (see Le DT, Pardoll DM, Jaffee EM. Cellular vaccine approaches. Cancer J. 2010;16(4):304-10 fr review). Immune cell-based is typically represented by antigen presenting cell (APC) vaccine and more particularly dendritic cell (DC) vaccine.
Whole tumor cell vaccines can be autologous or allogenic. Sipuleucel-T (Provenge®) is an autologous active cellular immunotherapy with unknown precise mechanism of action; however, it is believed to induce T-cell responses through antigen presenting cells (APCs) to specifically target prostatic acid phosphatase (PAP). The active component of Sipuleucel-T is achieved by cultivation of patient-derived APCs with PA2024 protein containing a granulocyte-macrophage colony-stimulating factor (GM- CSF). PA2024-activated APCs are shown with elevated level of co-stimulatory molecules, which are then infused back to the patients
Six different approaches have been developed for the production of DC-based vaccines, which differ in the method used for antigen delivery or DC modifications (see Najafi S, Mortezaee K. Advances in dendritic cell vaccination therapy of cancer. Biomed Pharmacother. 2023; 164:114954 summarized below): (1 ) DCs are not exposed to tumor antigens and instead used to form iDCs or in vitro DC maturation. This process is conducted via treatment with activating stimuli like interleukins. (2) Ex vivo pulsing of DCs either with tumor lysate, tumor antigens or tumor-derived mRNA, in which induced extracted DCs are treated with sources of antigens and then infused back to the recipient. (3) In vivo treatment of DCs with antigens, which aims at targeting the antigens to DCs and development of anticancer vaccines within the host body. (4) In situ stimulation of DCs, which is conducted through intratumoral administration of immunomodulators to induce development of anticancer immunity (see L. Hammerich, N. Bhardwaj, H.E. Kohrt, J.D. Brody ; In situ vaccination for the treatment of cancer. Immunotherapy, 8 (3) (2016), pp. 315-330) (5) Transfection of DCs with antigenencoding vectors or tumor cells-extracted RNA. Transfected DCs express antigens and are active to stimulate T cells upon infusion to the recipient. (6) DC-derived exosomes as a source of antigens for immunization. This approach is considered as an alternative to DC adoptive therapy in which antigen-presenting exosomes are treated with antigens and then used to eradicate cancer cells in treated recipients. Among those approaches, pulsing DCs with tumor antigens or lysate and maturation using standard maturation cocktails is the approach that is commonly used. In typical personalized or semi-personnalized approaches, neoantigens in the tumor predicted to bind the major histocompatibility complex protein HLA-A*02:01 are identified for individual patients with a cancer. Dendritic cells from the patient are matured ex vivo, then incubated with neoantigens. The activated dendritic cells are then administered to the patient. In some embodiments, following administration of the cancer vaccine, robust T-cell immunity against the neoantigen is detectable.
Dendritic cells are a diverse population of antigen presenting cells found in a variety of lymphoid and non-lymphoid tissues. (See Liu, Cell 106:259-62 (2001 ); Steinman, Ann. Rev. Immunol. 9:271-96 (1991 )) and include lymphoid dendritic cells of the spleen, Langerhans cells of the epidermis, and veiled cells in the blood circulation. Collectively, dendritic cells are classified as a group based on their morphology, high levels of surface MHC-class II expression, and absence of certain other surface markers expressed on T cells, B cells, monocytes, and natural killer cells. In particular, monocyte-derived dendritic cells (also referred to as monocytic dendritic cells) usually express CD 11 c, CD80, CD86, and are HLA-DR+, but are CD 14".
Monocytic dendritic cell precursors (typically monocytes) are usually CD14+. Monocytic dendritic cell precursors can be obtained from any tissue where they reside, particularly lymphoid tissues such as the spleen, bone marrow, lymph nodes and thymus. Monocytic dendritic cell precursors can also be isolated from the peripheral blood , typically from peripheral blood mononuclear cells (PBMCs) (isolated from peripheral blood and identified as any blood cell with a round nucleus (i.e. lymphocytes, monocytes, natural killer cells (NK cells) or dendritic cells)). Umbilical cord blood is another source of monocytic dendritic cell precursors.
In certain embodiments, thenmonocytic dendritic cell precursors and/or immature dendritic cells can be isolated from a healthy subject or from a subject in need of immunostimulation, such as, for example, a cancer subject or other subject for whom cellular immunostimulation can be beneficial or desired (i.e., a subject having a bacterial or viral infection, and the like). Dendritic cell precursors and/or immature dendritic cells also can be obtained from an HLA-matched healthy individual for partial activation and administration to an HLA-matched subject in need of immunostimulation. Methods of isolating and modifying dendritic cell precursors can be found in U.S. Pat. Pub. No. 20060057120 which is herein incorporated by reference.
Dendritic cells can be administered directly into a tumor, into the tumor bed subsequent to surgical removal or resection of the tumor, peri-tumorily, into a draining lymph node in direct contact with the tumor, into a blood vessel or lymph duct leading into, or feeding a tumor or organ afflicted by the tumor, e.g., the portal vein or a pulmonary vein or artery, and the like. The administration of partially mature dendritic cells can be either simultaneous with or subsequent to other treatments for the tumor, such as chemotherapy or radiation therapy. Further, partially mature dendritic cells can be co - administered with another agent, which agent acts as an adjuvant to the maturation of the dendritic cell and/or the processing of antigen within the tumor or region near or adjacent to the tumor. In addition, the dendritic cells can also be formulated or compounded into a slow release matrix for implantation into a region in or around the tumor or tumor bed such that cells are slowly released into the tumor, or tumor bed, for contact with the tumor antigens.
Partially mature dendritic cells can also be administered by any means appropriate for the formulation and mode of administration. For example, the cells can be combined with a pharmaceutically acceptable carrier and administered with a syringe, a catheter, a cannula, and the like. As above, the cells can be formulated in a slow release matrix. When administered in this fashion, the formulation can be administered by a means appropriate for the matrix used. Other methods and modes of administration applicable to the present invention are well known to the skilled artisan.
Dendritic cell compositions can be used by themselves in the treatment of an individual. In addition, the compositions can be used in combination with any other method to treat a tumor. For example, the methods of the present invention can be used in combination with surgical resection of a tumor, chemotherapy (cytotoxic drugs, apoptotic agents, antibodies, and the like), radiation therapy, cryotherapy, brachytherapy, immune therapy (administration of antigen specific mature activated dendritic cells, NK cells, antibodies specific for tumor antigens, etc.), and the like. Any and all of these methods can also be used in any combination. Combination treatments can be concurrent or sequential and can be administered in any order as determined by the treating physician.
To make a dendritic cell vaccine for a subject, the subject's immune cells are obtained through a blood draw. For systemic administration, the monocytes are differentiated into dendritic cells, matured, activated and loaded with biomarkers from the subject's own tumor tissue. The loading of biomarkers into the dendritic cells "educates" the cells about what the immune system needs to attack. The activated, educated dendritic cells are then isolated with very high purity and are administered to the subject through a simple intradermal injection in the upper arm. The dendritic cells then convey the tumor biomarker information to the rest of the immune system agents (T cells, B cells and others) which then target cells with these biomarkers.
For intratumoral administration, the monocytes are differentiated into dendritic cells and partially matured. The cells are then administered by injection directly into the tumors. After injection into the tumors, dendritic cells pick up the tumor biomarkers in situ and convey the tumor biomarker information to the rest of the immune system agents (T cells, B cells and others) which then target cells with these biomarkers.
In some embodiments, dendritic cell compositions can be used as a first treatment, or a primer, for a second immunotherapy treatment (such as immune checkpoint inhibitor). By administering the dendritic cell compositions before the checkpoint inhibitor(s), the immune system (specifically T-cells) become activated which allows an enhanced response to checkpoint inhibitors. It is further reminded that Suv39h1 inhibition has also been shown to enhance immune checkpoint effect (in particular anti- PD1 effect).
Dendritic cell therapy provokes anti-tumor responses by causing dendritic cells to present tumor antigens to lymphocytes, which activates them, priming them to kill other cells that present the antigen. Dendritic cells are antigen presenting cells (APCs) in the mammalian immune system. In cancer treatment they aid cancer antigen targeting. One example of cellular cancer therapy based on dendritic cells is sipuleucel-T.
Virus-based cancer vaccines The virus-based vaccine can be divided into three forms: inactivated, live attenuated, or subunit vaccines against the virus that can cause the tumor; the oncolytic virus vaccine and the virus vector vaccine. Epstein-Barr virus, HBV, Hepatitis C virus, and HPV are the most common cancer-related viruses. Viruses are naturally immunogenic and their genetic material can be engineered to contain sequences encoding tumor antigens. Oncolytic virus contain herpes simplex virus, adenovirus, measles, vaccinia, reovirus, vesicular stomatitis virus The engineered virus vaccines can present tumor antigens in large quantities in the immune system and produce anti-tumor immunity. Furthermore, the oncolytic virus can be used as a vector as well. Except for providing tumor antigens, the virus itself can also lyse the tumor, release tumor antigens, further increase the vaccine's effectiveness, and produce long-term immune memory. In addition to the herpes simplex virus, the adenovirus is a frequently used oncolytic virus, used as delivery vectors for specific genes as well. Adenovirus is easy to manipulate, has a very broad spectrum of host cell tropism and can be rapidly prepared in large quantities. Other vectors include vaccinia virus, lentivirus and adeno-associated virus. Lentivirus and adeno-associated virus have the unique ability to stably and long-termly express the transgene in non-dividing cells the same as adenovirus.
Peptide-based subunit vaccines
Peptide-based subunit vaccines employ targeting distinct tumor antigens, which may be delivered as peptides/proteins typically composed of known or predicted tumor antigen epitopes or as genetically-engineered DNA vectors, viruses, bacteria, or the like
Peptide-based subunit vaccines, include chemical and biosynthetic preparations of predicted or known specific tumor antigens. Due to the limitation of MHC polymorphism and the small size of antigen epitopes themselves, the immunogenicity of peptide- based vaccines can be weak weak. It is often difficult to cause a robust immune response, which also leads to immune tolerance. Adjuvants are combined with peptide-based vaccines to enhance the immune response generally. The present invention that enhance immune response associated to vaccination fulfill an important therapeutic need. In some embodiments, peptide-based cancer vaccines comprise both CD8+ T epitopes and CD4+ T cell epitopes. CD8+ T cell epitopes activate CTLs tumor immunity through the antigens cross-presentation pathway, while CD4+ T cells activate helper T cells to maintain the function of CTLs.
Proteins or peptides may be made by any technique known to those of skill in the art, including the expression of proteins, polypeptides or peptides through standard molecular biological techniques, the isolation of proteins or peptides from natural sources, in vitro translation, or the chemical synthesis of proteins or peptides.
Peptides can be readily synthesized chemically utilizing reagents that are free of contaminating bacterial or animal substances (Merrifield RB: Solid phase peptide synthesis. I. The synthesis of a tetrapeptide. J. Am. Chem. Soc. 85:2149-54, 1963).
The use of the polypeptides provided herein, or portions thereof, under in vivo conditions may require their chemical modification since the polypeptides themselves may not have a sufficiently long serum and/or tissue half-life. It may also be advantageous to modify the polypeptides in order to impose a conformational restraint upon them. This might be useful, for example, to mimic a naturally-occurring conformation of the polypeptide in the context of the native protein in order to optimize the effector immune responses that are elicited. Modified polypeptides are referred to herein as "analog" polypeptides. The term "analog" extends to any functional and/or structural equivalent of a peptide characterized by its increased stability and/or efficacy in- vivo or in- vitro in respect of the practice of the invention. The term "analog" also is used herein to extend to any amino acid derivative of the polypeptides as described herein.
Analogs of the polypeptides or peptides contemplated herein include, but are not limited to, modifications to side chains, and incorporation of unnatural amino acids and/or their derivatives, non-amino acid monomers and cross-linkers. Other methods which impose conformational constraint on the polypeptides or their analogs are also contemplated. It will be apparent that the polypeptides of the invention can be modified in a variety of different ways without significantly affecting the functionally important immunogenic behavior thereof. Possible modifications to the polypeptide sequence may include the following: The said polypeptides of the invention or analogs thereof may occur as single length or as multiple tandem or non-tandem repeats. A single type of polypeptide or analog may form the repeats or the repeats may be composed of different molecules including suitable carrier molecules.
The immunogenicity of the polypeptides of the present invention may also be modulated by coupling to fatty acid moieties to produce lipidated polypeptides. The polypeptides may also be conjugated to a lipidated amino acid.
With regard to peptide vaccines, there are a number of strategies for amplifying an immunogen's effectiveness, particularly as related to the art of vaccines. For example, cyclization or circularization of a peptide can increase the peptide's antigenic and immunogenic potency.
A small peptide antigen can also be conjugated to a suitable carrier, usually a protein molecule. It can thus allow multiple copies of an antigen, such as a peptide, to be conjugated to a single larger carrier molecule. Additionally, the carrier may possess properties which facilitate transport, binding, absorption or transfer of the antigen. Suitable carriers include, e.g., keyhole limpet hemocyanin (KLH), serum albumin, purified protein derivative of tuberculin (PPD), ovalbumin, non-protein carriers and many others. The conjugation between a peptide and a carrier can be accomplished using one of the methods known in the art. Specifically, the conjugation can use bifunctional cross-linkers as binding agents as detailed, for example, by Means and Feeney, "A recent review of protein modification techniques" Bioconjugate Chem. 1 :2- 12 (1990).
Alternatively, a nucleic acid (e.g., a polynucleotide) encoding an antigenic peptide may be used to produce the antigenic peptide in vitro. The polynucleotide may be, e.g., DNA, cDNA, PNA, CNA, RNA, either single-and/or double-stranded, or native or stabilized forms of polynucleotides.
An expression vector capable of expressing a polypeptide can also be prepared. Expression vectors for different cell types are well known in the art and can be selected without undue experimentation. Generally, the DNA is inserted into an expression vector, such as a plasmid, in proper orientation and correct reading frame for expression, if necessary, the DNA may be linked to the appropriate transcriptional and translational regulatory control nucleotide sequences recognized by the desired host (e.g., bacteria), although such controls are generally available in the expression vector. The vector is then introduced into the host bacteria for cloning using standard techniques (see, e.g., Sambrook et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.).
Expression vectors comprising the isolated polynucleotides, as well as host cells containing the expression vectors, are also contemplated. The antigenic peptides may be provided in the form of RNA or cDNA molecules encoding the desired antigenic peptides. One or more antigenic peptides may also be encoded by a single expression vector.
The term "polynucleotide encoding a polypeptide” encompasses a polynucleotide which includes only coding sequences for the polypeptide as well as a polynucleotide which includes additional coding and/or non-coding sequences. Polynucleotides can be in the form of RNA or in the form of DNA. DNA includes cDNA, genomic DNA, and synthetic DNA; and can be double- stranded or single-stranded, and if single stranded can be the coding strand or non-coding (anti- sense) strand.
The polynucleotides may comprise the coding sequence for antigenic peptide fused in the same reading frame to a polynucleotide which aids, for example, in expression and/or secretion of a polypeptide from a host cell (e.g., a leader sequence which functions as a secretory sequence for controlling transport of a polypeptide from the cell ). In some embodiments, the polynucleotides can comprise the coding sequence for the antigenic peptide fused in the same reading frame to a marker sequence that allows, for example, for purification of the encoded polypeptide, which may then be incorporated into the vaccine or immunogenic composition. In some embodiments, the polynucleotides may comprise the coding sequence for one or more of the antigenic peptides fused in the same reading frame to create a single concatamerized neoantigenic peptide construct capable of producing multiple antigenic peptides.
Once assembled (e.g., by synthesis, site-directed mutagenesis, or another method), the polynucleotide sequences encoding a particular isolated polypeptide of interest can be inserted into an expression vector and optionally operatively linked to an expression control sequence appropriate for expression of the protein in a desired host. Proper assembly can be confirmed by nucleotide sequencing, restriction mapping, and expression of a biologically active polypeptide in a suitable host. As well known in the art, in order to obtain high expression levels of a transfected gene in a host, the gene can be operatively linked to transcriptional and translational expression control sequences that are functional in the chosen expression host.
Recombinant expression vectors may be used to amplify and express DNA encoding antigenic peptides. Recombinant expression vectors are typically replicable DNA constructs which have synthetic or cDNA-derived DNA fragments encoding a tumor specific antigenic peptide or a bioequivalent analog operatively linked to suitable transcriptional or translational regulatory elements derived from mammalian, microbial, viral or insect genes. A transcriptional unit generally comprises an assembly of (1 ) a genetic element or elements having a regulatory role in gene expression, for example, transcriptional promoters or enhancers, (2) a structural or coding sequence which is transcribed into mRNA and translated into protein, and (3) appropriate transcription and translation initiation and termination sequences. Such regulatory elements can include an operator sequence to control transcription. The ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants can additionally be incorporated. DNA regions are operatively linked when they are functionally related to each other. For example, DNA for a signal peptide (secretory leader) is operatively linked to DNA for a polypeptide if it is expressed as a precursor which participates in the secretion of the polypeptide; a promoter is operatively linked to a coding sequence if it controls the transcription of the sequence; or a ribosome binding site is operatively linked to a coding sequence if it is positioned so as to permit translation. Generally, operatively linked means contiguous, and in the case of secretory leaders, operatively linked means contiguous and in the reading frame. Structural elements intended for use in yeast expression systems include a leader sequence enabling extracellular secretion of translated protein by a host cell. Alternatively, where recombinant protein is expressed without a leader or transport sequence, it can include an N-terminal methionine residue. This residue can optionally be subsequently cleaved from the expressed recombinant protein to provide a final product. Useful expression vectors for eukaryotic hosts, especially mammals or humans include, for example, vectors comprising expression control sequences from SV40, bovine papilloma virus, adenovirus and cytomegalovirus. Useful expression vectors for bacterial hosts include known bacterial plasmids, such as plasmids from Escherichia coli, including pCR 1 , pBR322, pMB9 and their derivatives, wider host range plasmids, such as Ml 3 and filamentous single- stranded DNA phages.
Suitable host cells for expression of a polypeptide include prokaryotes, yeast, insect or higher eukaryotic cells under the control of appropriate promoters. Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli. Higher eukaryotic cells include established cell lines of mammalian origin. Cell-free translation systems could also be employed. Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are well known in the art (see Pouwels et al, Cloning Vectors: A Laboratory Manual, Elsevier,. Y., 1985).
Various mammalian or insect cell culture systems are also advantageously employed to express recombinant protein. Examples of suitable mammalian host cell lines include the COS -7 lines of monkey kidney cells, described by Gluzman (Cell 23: 175, 1981 ), and other cell lines capable of expressing an appropriate vector including, for example, L cells, C127, 3T3, Chinese hamster ovary (CHO), 293, HeLa and BHK cell lines. Mammalian expression vectors can comprise nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5 ' or 3' flanking nontranscribed sequences, and 5' or 3' nontranslated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
The proteins produced by a transformed host can be purified according to any suitable method. Such standard methods include chromatography (e.g., ion exchange, affinity and sizing column chromatography, and the like), centrifugation, differential solubility, or by any other standard technique for protein purification. Affinity tags such as hexahistidine, maltose binding domain, influenza coat sequence, glutathione-S- transferase, and the like can be attached to the protein to allow easy purification by passage over an appropriate affinity column. Isolated proteins can also be physically characterized using such techniques as proteolysis, nuclear magnetic resonance and x-ray crystallography.
Nucleic acid base cancer vaccine compositions
Cancer DNA vaccines are based on bacterial plasmids that encode one or several oncology antigens inducing innate immunity activation and adaptive immune responses. In some embodiments, DNA plasmids are directly transfected into APCs, mainly through intradermal delivery.
In some embodiments, in addition to the combined administration with a KMT inhibitor which is the subject of the present invention, other adjuvants can be used to enhance the immunogenicity of DNA vaccines, such as CpG motifs, polymer, nanoparticle, liposome, and small molecule agonists.
Typically, nucleic acid-based vaccines include multiple antigens. Typically, nucleic acid-based vaccines include a plurality or more than one, preferably 2 to 20, more preferably 2 to 20, most preferably 2 to 6 of antigen or epitope-encoding nucleic acid. Said combinations typically comprise more than one antigen or epitope-encoding nucleic acid, preferably encoding different peptides or proteins which comprise or provide preferably different epitopes, particularly of different tumor antigens, or pathogenic antigens.
In some embodiment antigens can be administered to an individual in need thereof by use of a plasmid. These plasmids typically comprises a strong viral promoter to drive the in vivo transcription and translation of the nucleic acid of interest (see e.g., Mor, et al ,(1995). The Journal of Immunology 155 (4): 2039-2046). Intron may also be included to improve mRNA stability and increase protein expression (Leitner et al, (1997). The Journal of Immunology 159 (12): 6112-61 19). Plasmids also typically include a strong polyadenylation/transcriptional termination signal, (Alarcon et al„ (1999). Adv. Parasitol. Advances in Parasitology 42: 343-410; Robinson et al., (2000). Adv. Virus Res. Advances in Virus Research 55: 1-74). Multi cistronic vectors can be constructed to express more than one immunogen, or to express an immunogen and an immunostimulatory molecule (Lewis et al., (1999). Advances in Virus Research (Academic Press) 54: 129-88). It is to be noted that advantageously in some embodiments, a multi cistronic vector can be constructed to include one or more immunogens as above defined and an inhibitor of a SUV KMT as previously defined herein.
In some embodiments, a vaccine or immunogenic composition may include separate DNA plasmids encoding, for example, one or more antigenic peptides/polypeptides and/or encoding an inhibitor of a SUV39 KMT as previously defined. The choice of expression vectors typically depends upon the peptide/polypeptides to be expressed, and is well within the skill of the ordinary artisan.
Plasmids can be introduced in vivo by a number of different methods. The two most popular approaches are injection of DNA in saline, using a standard hypodermic needle, and gene gun delivery. A schematic outline of the construction of a DNA vaccine plasmid and its subsequent delivery by these two methods into a host is illustrated at Scientific American (Weiner et al., (1999) Scientific American 281 (I): 34- 41 ). Alternative delivery methods may include aerosol instillation of naked DNA on mucosal surfaces, such as the nasal and lung mucosa, (Lewis et al., (1999). Advances in Virus Research (Academic Press) 54: 129-88) and topical administration of pDNA to the eye and vaginal mucosa (Lewis et al., (1999) Advances in Vims Research (Academic Press) 54: 129-88). Mucosal surface delivery has also been achieved using cationic liposome-DNA preparations, biodegradable microspheres, attenuated Shigella or Listeria vectors for oral administration to the intestinal mucosa, and recombinant adenovirus vectors.
In some embodiments, one or more antigenic peptides may be encoded and expressed in vivo using a viral-based system (e.g., an adenovirus system, an adeno associated virus (AAV) vector, a poxvirus, or a lentivirus). In some embodiments, the vaccine or immunogenic composition may include a viral based vector for use in a human individual in need thereof, such as, for example, an adenovirus. Plasmids that can be used for adeno associated virus, adenovirus, and lentivirus delivery are well known in the field. Typically, AAV and lentivirus delivery are widely used and comply well with the present invention.
In some embodiments, a nucleic acid construct is a mammalian expression cassette, preferably human expression cassette, wherein the one or more coding sequences of the one or more antigens are operably linked to appropriate regulatory sequence(s) for their expression in an individual’s target cells or tissue(s). In some particular embodiments, the target cell(s) or tissue(s) is epithelial cell(s) or tissue(s). Such sequences which are well-known in the art include in particular a promoter, and further regulatory sequences capable of further controlling the expression of a transgene, such as without limitation, enhancer, terminator and intron. In some particular embodiments, the expression cassette comprises a promoter; preferably further comprises one or more of an enhancer, terminator or intron. As previously mentioned in some embodiments the expression cassette may include a sequence coding for a KMT inhibitor, said coding sequence may be operably linked to the sequences coding for the one or more antigens or may include regulatory sequences. In other embodiments, the KMT inhibitor can be provided as a separate expression cassette.
The promoter may be a tissue-specific, ubiquitous, constitutive or inducible promoter that is functional in the individual’s target cells or tissue, in particular epithelial cell(s) or tissue(s). Examples of constitutive promoters which can be used in the present invention include without limitation: phosphogly cerate kinase promoter (PGK), elongation factor- 1 alpha (EF-1 alpha) promoter including the short form of said promoter (EFS), viral promoters such as cytomegalovirus (CMV) immediate early enhancer and promoter (optionally with the CMV enhancer), cytomegalovirus enhancer/chicken beta actin (CAG) promoter, SV40 early promoter and retroviral 5’ and 3’ LTR promoters including hybrid LTR promoters. Preferred ubiquitous promoter is CMV promoter. Examples of inducible promoters which can be used in the present invention include Tetracycline-regulated promoters. The promoters are advantageously human promoters, i.e., promoters from human cells or human viruses. Such promoters are well-known in the art and their sequences are available in public sequence data bases.
In some preferred embodiments, the nucleic acid construct is DNA, wherein the coding sequence of the antigen is operably linked to appropriate regulatory sequence(s) for their expression in an individual’s target cells or tissue(s) as disclosed above. The DNA construct advantageously comprises a mammalian expression cassette as disclosed above.
In some embodiments, the nucleic acid construct is RNA, preferably mRNA, wherein the coding sequence the antigen is operably linked to appropriate regulatory sequence(s) for their expression in an individual’s target cells or tissue(s). mRNA vaccines are well-known in the art (reviewed in Jackson et ah, Vaccines, 2020, 5, 11 , doi.10.1038). mRNA is delivered into the host cell cytoplasm where expression generates the antigen of interest. mRNA construct comprises a cap structure, 5’ and 3 ’untranslated regions (UTRs), and open reading frame (ORF), and a 3’poly(A) tail. mRNA construct may be non-replicating mRNA (MRM) or self-amplifying mRNA (SAM). SAM comprises the inclusion of genetic replication machinery derived from positive- strand mRNA viruses, most commonly alphavimses such as Sindbis and Semliki- Forest viruses. In SAM constructs, the ORF encoding viral structural protein is replaced by the transcript encoding the vaccine antigen of interest, and the viral RNA-dependent RNA polymerase is retained to direct cytoplasmic amplification of the replicon construct. Trans- replicating RNA are disclosed for example in WO 2017/162461 . RNA replicon from alphavims suitable for gene expression are disclosed in WO 2017/162460. mRNA manufacturing process uses plasmid DNA (pDNA) containing a DNA-dependent RNA polymerase promoter, such as T7, and the corresponding sequence for the mRNA construct. The pDNA is linearized to serve as a template for the DNA-dependent RNA polymerase to transcribe the mRNA, and subsequently degraded by a DNase process step. The addition of the 5 ’cap and the 3 ’poly (A) tail can be achieved during the in vitro transcription step or enzymatically after transcription. Enzymatic addition of the cap can be accomplished by using guanylyl transferase and 2’-0-methyltransferase to yield a CapO(N7MeGpppN) or Capl (NTMeQpppN2 oMe) structure, respectively, while the poly-A tail can be achieved through enzymatic addition via poly-A polymerase. mRNA is then purified using standard methods
In some embodiments of RNA vaccines as per the present invention, the antigen or epitope-encoding RNA is mono-, bi-, or multicistronic, preferably as defined herein. Bi- or multicistronic RNAs typically comprise two (bicistronic) or more (multicistronic) open reading frames (ORF). An open reading frame in this context is a sequence of codons that is translatable into a peptide or protein. The coding sequences in a bi- or multicistronic epitope-encoding RNA preferably encode distinct epitopes (or antigens or variants or fragments thereof comprising said epitopes) as defined herein. Bi- or even multicistronic epitope-encoding RNAs, may encode, for example, at least two, three, four, five, six or more (preferably different) epitopes (or antigens or variants or fragments thereof comprising said epitopes) as defined herein. The term “encoding two or more epitopes/pathway inhibitors” may mean, without being limited thereto, that the bi- or even multicistronic epitope-encoding RNA, may encode e.g. at least two, three, four, five, six or more (preferably different) epitopes (or antigens or variants or fragments thereof comprising said epitopes).
In some embodiments, the coding sequences encoding two or more epitopes (or antigens or variants or fragments thereof comprising said epitopes) may be separated in the bi- or multicistronic RNA by at least one IRES (internal ribosomal entry site) sequence. The term “IRES” (internal ribosomal entry site) refers to an RNA sequence that allows for translation initiation. An IRES can function as a sole ribosome binding site, but it can also serve to provide a bi- or even multicistronic epitope-encoding RNA as defined above, which encodes several epitopes (or antigens or variants or fragments thereof comprising said epitopes), which are to be translated by the ribosomes independently of one another. Examples of IRES sequences, which can be used according to the invention, are those from picornaviruses (e.g. FMDV), pestiviruses (CFFV), polioviruses (PV), encephalomyocarditis viruses (ECMV), foot and mouth disease viruses (FMDV), hepatitis C viruses (HCV), classical swine fever viruses (CSFV), mouse leukoma virus (MLV), simian immunodeficiency viruses (SIV) or cricket paralysis viruses (CrPV).
According to further embodiments the at least one coding sequence of the epitopeencoding RNA of the inventive combination may encode at least two, three, four, five, six, seven, eight and more epitopes (or antigens or variants or fragments thereof comprising said epitopes) as defined herein linked with or without an amino acid linker sequence, wherein said linker sequence can comprise rigid linkers, flexible linkers, cleavable linkers (e.g., self-cleaving peptides) or a combination thereof. Therein, epitopes (or antigens or variants or fragments thereof comprising said epitopes) may be identical or different or a combination thereof.
Preferably, the epitope-encoding RNA comprises a length of about 50 to about 20000, or 100 to about 20000 nucleotides, preferably of about 250 to about 20000 nucleotides, more preferably of about 500 to about 10000, even more preferably of about 500 to about 5000. The epitope-encoding RNA of the inventive combination may further be single stranded or double stranded. When provided as a double stranded RNA, the epitope-encoding RNA of the inventive combination preferably comprises a sense and a corresponding antisense strand.
In preferred embodiments, the epitope-encoding RNA of the inventive combination is an mRNA, a viral RNA or a replicon RNA, preferably a mRNA.
In some embodiments, the one or more nucleic acid of a vaccine composition (notably the antigen or epitope encoding RNA(s)) may thus be provided as a “stabilized” nucleic acids, i.e. which is essentially resistant to in vivo degradation (e.g. by an exo- or endonuclease).
Such stabilization can be effected, for example, by a modified phosphate backbone of the epitope-encoding RNA (or any other nucleic acid, in particular RNA, as defined herein). A backbone modification in connection with the present invention is a modification in which phosphates of the backbone of the nucleotides contained in said RNA (or any other nucleic acid, in particular RNA, as defined herein) are chemically modified. Nucleotides that may be preferably used in this connection contain e.g. a phosphorothioate-modified phosphate backbone, preferably at least one of the phosphate oxygens contained in the phosphate backbone being replaced by a sulfur atom. Stabilized epitope-encoding RNAs (or other nucleic acids, in particular RNAs, as defined herein) may further include, for example: non-ionic phosphate analogues, such as, for example, alkyl and aryl phosphonates, in which the charged phosphonate oxygen is replaced by an alkyl or aryl group, or phosphodiesters and alkylphosphotriesters, in which the charged oxygen residue is present in alkylated form. Such backbone modifications typically include, without implying any limitation, modifications from the group consisting of methylphosphonates, phosphoramidates and phosphorothioates (e.g. cytidine-5'-O-(1 -thiophosphate)). Specific modifications are described, which are preferably capable of “stabilizing” the epitope-encoding RNA of the inventive combination (or any other nucleic acid, in particular RNA, as defined herein) as well detailed in US2020085944A1 .
In any of the above-described embodiments, the nucleic acid construct as above defined may comprise at least one open frame encoding for an antigenic peptide and an open frame encoding for a KMT inhibitor (typically a suv39h1 inhibitor) as previously defined.
Various vectors have been used to improve the delivery efficiency of mRNA cancer vaccines, including several viral, non-viral, and cell-based vehicles among which LNPs are the most widely used delivery system (Delivery methods for RNA vaccines suitable for the present invention in particular related to LNPs have been recently review in Liu, J., Fu, M., Wang, M. et al. Cancer vaccines as promising immuno-therapeutics: platforms and current progress. J Hematol Oncol 15, 28 (2022), the content of which is summarized after). LNPs are mainly composed of ionizable amino lipid-like molecules, phospholipids, cholesterol, as well as lipid-anchored PEG. Optimization of ionizable lipids focuses on regulating head groups, connectors, and alkyl chains to regulate acid dissociation constant (pKa), fusion properties and metabolic behavior. Representative ionizable lipids include dilinoleylmethyl-4-dimethylaminobutyrate (DLin-MC3-DMA), 1 ,2-dioleoyl-sn-glycerol-3-phosphoethanolamine (DOPE). Furthermore, the ideal lipid material should be metabolized and cleared quickly after mRNA delivery, thus reducing the toxic side effects caused by the carrier and allowing multiple administrations. The uptake pathways of LNPs mainly contain apolipoprotein or albumin receptor-mediated endocytosis and non-specific pinocytosis. Recently, LNPs have been modified to achieve targeted delivery. For example, LNPs modified with mannose could target DCs through the mannose receptor CD206 (see Beissert T, Perkovic M, Vogel A, Erbar S, Walzer KC, Hempel T, et al. A trans-amplifying RNA vaccine strategy for induction of potent protective immunity. Mol Ther. 2020;28(1 ): 119— 28). Moreover, LNPs prepared by chip-based microfluidic devices have the advantages of high stability and repeatability, which is beneficial to GMP production of LNPs.
In preferred embodiments, the at least one RNA of (pharmaceutical) composition or vaccine (or any other nucleic acid, in particular RNA, as defined herein) is thus provided in a complexed form, i.e. complexed or associated with one or more (poly- )cationic compounds, preferably with (poly-)cationic polymers, (poly-)cationic peptides or proteins, e.g. protamine, (poly-)cationic polysaccharides and/or (poly-)cationic lipids. In this context, the terms “complexed” or “associated” refer to the essentially stable combination of the at least one RNA (or said other nucleic acid, in particular RNA) with one or more of the aforementioned compounds into larger complexes or assemblies without covalent binding.
In some embodiments, the RNA (or any other nucleic acid, in particular RNA, as defined herein) is complexed or associated with lipids (in particular cationic and/or neutral lipids) to form one or more liposomes, lipoplexes, lipid nanoparticles, or nanoliposomes. Therefore, in some embodiments, RNA composition or vaccine (or any other nucleic acid, in particular RNA, as defined herein) is provided in the form of a lipid-based formulation, in particular in the form of liposomes, lipoplexes, and/or lipid nanoparticles comprising said RNA (or said other nucleic acid, in particular RNA). It is also conceivable to provide the KMT inhibitor (notably the scuv39h1 inhibitor) complexed or associated with lipids to form one or more liposomes, lipoplexes, or lipid nanoparticles.
In some embodiments, RNAs of the (pharmaceutical) composition or vaccine (or any other nucleic acid, in particular RNA, as defined herein) are formulated as lipoplexes, i.e. cationic lipid bilayers sandwiched between nucleic acid (e.g. (epitope-encoding) RNA or DNA) layers.
In some embodiments, RNAs of the (pharmaceutical) composition or vaccine (or any other nucleic acid, in particular RNA, as defined herein) are formulated as emulsions. In another embodiments, said RNAs (and optionally inhibitor of KMT) are formulated in a cationic oil-in-water emulsion where the emulsion particle comprises an oil core and a cationic lipid which can interact with the nucleic acid(s) anchoring the molecule to the emulsion particle. In some embodiments, said RNA is formulated in a water-in- oil emulsion comprising a continuous hydrophobic phase in which the hydrophilic phase is dispersed.
In some embodiments, the RNA of the vaccine composition (or any other nucleic acid, in particular RNA, as defined herein) is is complexed or associated with a cationic or polycationic compound (“(poly-)cationic compound”) and/or a polymeric carrier. The term “(poly-)cationic compound” typically refers to a charged molecule, which is positively charged (cation) at a pH value typically from 1 to 9, preferably at a pH value of or below 9 (e.g. from 5 to 9), of or below 8 (e.g. from 5 to 8), of or below 7 (e.g. from 5 to 7), most preferably at a physiological pH, e.g. from 7.3 to 7.4. Poly-)cationic compounds being particularly preferred agents for complexation or association of RNA of the (pharmaceutical) composition or vaccine (or any other nucleic acid, in particular RNA, as defined herein) include protamine, nucleoline, spermine or spermidine, or other cationic peptides or proteins, such as poly-L-lysine (PLL), poly-arginine, basic polypeptides, cell penetrating peptides (CPPs), including HIV-binding peptides, HIV-1 Tat (HIV), Tat-derived peptides, Penetratin, VP22 derived or analog peptides, HSV VP22 (Herpes simplex), MAP, KALA or protein transduction domains (PTDs), PpT620, prolin-rich peptides, arginine-rich peptides, lysine-rich peptides, MPG-peptide(s), Pep-1 , L-oligomers, Calcitonin peptide(s), Antennapedia- derived peptides (particularly from Drosophila antennapedia), pAntp, plsl, FGF, Lactoferrin, Transportan, Buforin-2, Bac715-24, SynB, SynB(1 ), pVEC, hCT-derived peptides, SAP, or histones.
In some embodiments, the RNA of the (pharmaceutical) composition or vaccine (or any other nucleic acid, in particular RNA, as defined herein) is complexed or associated with a polymeric carrier. A “polymeric carrier” suitable to the present ivention might be a polymeric carrier formed by disulfide-crosslinked cationic components. The disulfide- crosslinked cationic components may be the same or different from each other. The polymeric carrier can also contain further components.
Pharmaceutical compositions and methods of administration
Typically, the compositions of the present invention are pharmaceutical compositions and formulations for administration, preferably sterile compositions and formulations.
A pharmaceutical composition of the disclosure generally comprises a vaccine composition and/or a KMT inhibitor in association with pharmaceutically acceptable carriers. Main pharmaceutically acceptable carriers include saline, solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Supplementary active compounds can further be incorporated into the compositions. A pharmaceutical composition is formulated to be compatible with its intended route of administration.
The present invention therefore encompasses pharmaceutical compositions comprising an effective amount of one or more compounds according to the present invention (including a pharmaceutically acceptable salt, thereof), optionally in combination with a pharmaceutically acceptable carrier, excipient or additive.
When administered as a combination, the (therapeutic) agents or components (i.e. the vaccine or immunogenic composition and the KMT inhibitor notably the Suv39h1 ) of the present invention can be formulated as separate compositions that are given at the same time or different times, or the two (therapeutic) components can be given as a single composition.
The compositions may be administered once daily, twice daily, once every two days, once every three days, once every four days, once every five days, once every six days, once every seven days, once every two weeks, once every three weeks, once every four weeks, once every two months, once every six months, or once per year. The dosing interval can be adjusted according to the needs of individual patients. For longer intervals of administration, extended release or depot formulations can be used.
The compositions of the invention can be used to treat diseases and disease conditions that are acute, and may also be used for treatment of chronic conditions. In particular, the compositions of the invention are used in methods to treat or prevent a neoplasia or an infectious disease.
In certain embodiments, the compounds of the invention are administered for time periods exceeding two weeks, three weeks, one month, two months, three months, four months, five months, six months, one year, two years, three years, four years, or five years, ten years, or fifteen years; or for example, any time period range in days, months or years in which the low end of the range is any time period between 14 days and 15 years and the upper end of the range is between 15 days and 20 years (e.g., 4 weeks and 15 years, 6 months and 20 years). In some cases, it may be advantageous for the compounds of the invention to be administered for the remainder of the patient's life. In some embodiments, the patient is monitored to check the progression of the disease or disorder, and the dose is adjusted accordingly. In some embodiments, treatment according to the invention is effective for at least two weeks, three weeks, one month, two months, three months, four months, five months, six months, one year, two years, three years, four years, or five years, ten years, fifteen years, twenty years, or for the remainder of the subject's life. As described herein, in certain embodiments, administration of the KMT inhibitor is initiated before initiation of administration of the vaccine or immunogenic composition. In other embodiments, administration of the inhibitor is initiated after initiation of administration of the vaccine or immunogenic composition. In still other embodiments, administration of the KMT inhibitor is initiated simultaneously with the initiation of administration of the vaccine or immunogenic composition.
Administration of KMT the inhibitor, such as a suv39h1 inhibitor, may continue every 2, 3, 4, 5, 6, 7, 8 or more weeks after the first administration of the said KMT inhibitor.
In combination therapies, one or more KMT inhibitors, such as a Suv39h1 inhibitor, may be administered to the patient throughout the treatment regimen.
In certain embodiments, administration of the KMT inhibitor, such as a Suv39h1 inhibitor, is withheld during the week prior to administration of the vaccine or immunogenic composition. In other embodiments, administration of the KMT inhibitor, is withheld during administration of the vaccine or immunogenic composition.
Surgical resection uses surgery to remove abnormal tissue in cancer, such as mediastinal, neurogenic, or germ cell tumors, or thymoma. In certain embodiments, administration of the KMT inhibitor, is initiated following tumor resection. In other embodiments, administration of a cancer vaccine or immunogenic composition is initiated 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15 or more weeks after tumor resection. In some embodiments, administration of the cancer vaccine or immunogenic composition is initiated 4, 5, 6, 7, 8, 9, 10, 11 or 12 weeks after tumor resection.
Prime/boost regimens refer to the successive administrations of a vaccine or immunogenic or immunological compositions. In certain embodiments, administration of the vaccine or immunogenic composition is in a prime/ boost dosing regimen, for example administration of the neoplasia vaccine or immunogenic composition at weeks 1 , 2, 3 or 4 as a prime and administration of the vaccine or immunogenic composition is at months 2, 3 or 4 as a boost. In another embodiment heterologous prime -boost strategies are used to elicit a greater cytotoxic T-cell response (see Schneider et ah, Induction of CD8+ T cells using heterologous prime-boost immunization strategies, Immunological Reviews Volume 170, Issue 1 , pages 29-38, August 1999). In another embodiment DNA encoding antigens is used to prime followed by a protein boost. In another embodiment protein is used to prime followed by boosting with a virus encoding the antigen. In another embodiment a virus encoding the antigen is used to prime and another virus is used to boost. In another embodiment protein is used to prime and DNA is used to boost. In some embodiments, a DNA vaccine or immunogenic composition is used to prime a T-cell response and a recombinant viral vaccine or immunogenic composition is used to boost the response. In some embodiments, a viral vaccine or immunogenic composition is co-administered with a protein or DNA vaccine or immunogenic composition to act as an adjuvant for the protein or DNA vaccine or immunogenic composition. The patient can then be boosted with either the viral vaccine or immunogenic composition, protein, or DNA vaccine or immunogenic composition (see Hutchings et al., Combination of protein and viral vaccines induces potent cellular and humoral immune responses and enhanced protection from murine malaria challenge. Infect Immun, 2007 Dec;75(l2):5SI9-26. Epub 2007 Oct 1 ))
As used herein, the term "fixed intermittent dosing regimen" refers to repeating cycles of preplanned drug administration in which the drug is administered on one or more consecutive days ("days on") followed by one or more consecutive days of rest on which the drug is not administered ("days off).
The pharmaceutical compositions can be processed in accordance with conventional methods of pharmacy to produce medicinal agents for administration to patients in need thereof, including humans and other mammals.
One of ordinary skill in the art from this disclosure and the knowledge in the art will recognize that a therapeutically effective amount of one of more compounds according to the present invention may vary with the condition to be treated, its severity, the treatment regimen to be employed, the pharmacokinetics of the agent used, as well as the patient (animal or human) treated.
To prepare the pharmaceutical compositions according to the present invention, a therapeutically effective amount of one or more of the compounds according to the present invention can be intimately admixed with a pharmaceutically acceptable carrier according to conventional pharmaceutical compounding techniques to produce a dose. A carrier may take a wide variety of forms depending on the form of preparation desired for administration, e.g., ocular, oral, topical or parenteral, including gels, creams ointments, lotions and time released implantable preparations, among numerous others. In preparing pharmaceutical compositions in oral dosage form, any of the usual pharmaceutical media may be used. Thus, for liquid oral preparations such as suspensions, elixirs and solutions, suitable carriers and additives including water, glycols, oils, alcohols, flavoring agents, preservatives, coloring agents and the like may be used. For solid oral preparations such as powders, tablets, capsules, and for solid preparations such as suppositories, suitable carriers and additives including starches, sugar carriers, such as dextrose, mannitol, lactose and related carriers, diluents, granulating agents, lubricants, binders, disintegrating agents and the like may be used. If desired, the tablets or capsules may be enteric- coated or sustained release by standard techniques.
The active compound is included in the pharmaceutically acceptable earner or diluent in an amount sufficient to deliver to a patient a therapeutically effective amount for the desired indication, without causing serious toxic effects in the patient treated,
The vaccine or immunogenic composition and the KMT inhibitor, such as suv39h1 inhibitor, and any additional agents, may be administered by injection, orally, parenterally, by inhalation spray, rectally, vaginally, or topically in dosage unit formulations containing conventional pharmaceutically acceptable carriers, adjuvants, and vehicles. The term parenteral as used herein includes, into a lymph node or nodes, subcutaneous, intravenous, intramuscular, intrasternal, infusion techniques, intraperitoneally, eye or ocular, intravitreal, intrabuccal, transdermal, intranasal, into the brain, including intracranial and intradural, into the joints, including ankles, knees, hips, shoulders, elbows, wrists, directly into tumors, and the like, and in suppository form. In certain embodiments, the vaccine or immunogenic composition and/or the KMT inhibitor, are administered intravenously or subcutaneously.
Application of the subject therapeutics may be local, so as to be administered at the site of interest. In certain embodiments, the KMT inhibitor, such as suv39h1 inhibitor, is administered subcutaneously near the site of administration of the vaccine or immunogenic composition. It is to be understood by one skilled in the art administering the compositions that the concentration of the KMT inhibitor, administered to the subject may be changed based on the nature of the inhibitor, its specificity and the location of administration. The combination therapy according to the present invention may be utilized in combination with at least one known other therapeutic agent, or a pharmaceutically acceptable salt of said agent.
With reference to cancer treatment, a combined cancer treatment can include but is not limited to cancer chemotherapeutic agents, cytotoxic agents, hormones, anti- angiogens, radiolabelled compounds, immunotherapy, surgery, cryotherapy, and/or radiotherapy.
Conventional cancer chemotherapeutic agents include alkylating agents, antimetabolites, anthracyclines, topoisomerase inhibitors, microtubule inhibitors and B-raf enzyme inhibitors.
Alkylating agents include the nitrogen mustards (such as mechlorethamine, cyclophosphamide, ifosfamide, melphalan and chlorambucil), ethylenamine and methylenamine derivatives (such as altretamine, thiotepa), alkyl sulfonates (such as busulfan), nitrosoureas (such as carmustine, lomustine, estramustine), triazenes (such as dacarbazine, procarbazine, temozolomide), and platinum-containing antineoplastic agents (such as cisplatin, carboplatin, oxaliplatin).
Antimetabolites include 5-fluorouracil (5-Fll), 6-mercaptopurine (6-MP), Capecitabine (Xeloda®), Cytarabine (Ara-C®), Floxuridine, Fludarabine, Gemcitabine (Gemzar®), Hydroxyurea, Methotrexate, Pemetrexed (Alimta®).
Anthracyclines include Daunorubicin, Doxorubicin (Adriamycin®), Epirubicin. Idarubicin. Other anti-tumor antibiotics include Actinomycin-D, Bleomycin, Mitomycin- C, Mitoxantrone.
Topoisomerase inhibitors include Topotecan, Irinotecan (CPT-11 ), Etoposide (VP-16), Teniposide or Mitoxantrone
Microtubule inhibitors include Estramustine, Ixabepilone, the taxanes (such as Paclitaxel, Docetaxel and Cabazitaxel), and the vinca alkaloids (such as Vinblastine, Vincristine, Vinorelbine, Vindesine and Vinflunine)
B-raf enzyme inhibitors include vemurafenib (Zelboraf), dabrafenib (Tafinlar), and encorafenib (Braftovi) Immunotherapy includes but is not limited to immune checkpoint modulators (i.e. inhibitors and/or agonists), cytokines, immunomodulating monoclonal antibodies, cancer vaccines. Preferably immunotherapy includes administration immune checkpoint modulators. Examples include inhibitors of (e.g. antibodies that bind specifically to and inhibit activity of) PD-1 , CTLA4, LAG3, BTLA, OX2R, TIM-3, TIGIT, LAIR-1 , PGE2 receptors, and/or EP2/4 Adenosine receptors including A2AR. Preferably, the immune checkpoint modulators comprise anti-PD-1 and/or anti-PDL-1 inhibitors (e.g., anti-PD-1 and/or anti-PDL-1 antibodies).
In some embodiment, the combined cancer treatment is cell therapy an comprise administration of immune cell engineered to express one or more antigen receptors against one or more antigens. In some embodiments thereof, the said one or more antigens are also included in the vaccine composition. Well-suited cell therapy are typically described in WO2018234370A1 , W02021013950A1 or WO2023126458A1 , the content of which is included herein by reference in their entirety.
Pharmaceutical vaccine or immunogenic compositions of the invention are administered in combination with a KMT inhibitor to a patient in an amount sufficient to elicit an immune response, typically a cell mediated immune response, more particularly a T cell mediated response and notably an effective CTL response to the pathogen or tumor antigen and to cure or at least partially arrest symptoms and/or complications. An amount adequate to accomplish this is defined as “therapeutically effective dose.” Amounts effective for this use can depend on, e.g., the vaccine composition the KMT inhibitor, the manner of administration, the stage and severity of the disease being treated, the weight and general state of health of the patient, and the judgment of the prescribing physician. The patient's response and condition can be monitored by measuring specific CTL activity in the patient's blood to adapt doses and administration regimen.
Therapeutic Methods
The present invention provides methods of stimulating, enhancing or raising an immune response against an infectious disease or a tumor in an individual, said method comprising administering a vaccination regimen and an immune stimulation regimen to the individual; wherein the immune stimulation regimen comprises administration of KMT inhibitor, preferably wherein the KMT inhibitor is a Suv39H1 inhibitor; wherein the immune stimulation regimen and the vaccination regimen are administered sequentially in any order or simultaneously,
The vaccination regimen comprises the administration of a vaccine composition as previously defined.
The invention also provides a method of raising an immune response to an antigen or enhancing or augmenting an immune response to an antigen in an individual, comprising administering to the individual an effective amount of KMT inhibitor; typically, wherein an immune function or immune health of the individual is improved;
The invention also pertains to a method of treating and/or preventing an infectious disease or a tumor in an individual, said method comprising the administration to the individual of a medical preparation comprising:
- a first component that elicits an immune response in the individual;
- a second component comprising an KMT inhibitor notably a suv39h1 inhibitor; wherein the first and second components can be administered sequentially in any order or simultaneously.
The invention also encompasses a method of treating and/or preventing a disease, disorder or condition associated with the expression or the elevated expression of an antigen in an individual, optionally wherein the disease is an infectious disease or a neoplastic disease (tumor), said method comprising the administration to the individual of:
- a first component that elicits an immune response in the individual
- a second component comprising a KMT inhibitor; wherein the first and second components can be administered sequentially in any order or simultaneously.
Typically the immune response is a response again one or more pathogen or tumor antigens as herein described. The immune response typically includes a cell-mediated immune response, notably a T cell response, notably a T cell response, notably a CTL response. When the antigen is a tumor antigen, the methods of the invention lead to an increased neoplasia/tumor specific immune response in a subject, and are aimed at treating and or alleviating a symptom of cancer in a subject.
The herein methods and compositions may be used for a patient that has been diagnosed as having cancer, or at risk of developing cancer.
Typically, the described combination of the invention is administered in an amount sufficient to induce a CTL response. Administration of a KMT inhibitor may allow to reduce vaccination regimen and/or to increase and or extend immune response notably the immune response associated with particular type of antigen, such as antigen that have a low affinity and/or are expressed at low expression levels. This might be of high relevance for tumor specific antigen derived from dark or grey genome. In some embodiment, the composition, medical preparation and methods of the invention prevent and or limit recall infection or tumor relapse.
Patients may be screened before administration and after the administration of the compositions described herein. Patients may undergo screening assessments that document historical health status as well as their current and future health status in general and as related to their underlying disease. The screening assessments may include tests like vital signs (including diastolic and systolic blood pressure, heart rate, temperature, weight, and height), electrocardiograms, symptom directed physical exam, hematology (including hematocrit, hemoglobin, RBC count, WBC count with differential, and platelet count), chemistry (including tests for glucose, urea nitrogen, creatinine, sodium, potassium, calcium, total and direct bilirubin, AST, ALT, alkaline phosphatase, lactate dehydrogenase (LDH), and adrenocorticotropic hormone), liver function tests (such as detecting levels of AST, ALT, total and direct bilirubin), pregnancy testing, CT or MRI, surgical or core needle biopsy of a primary or metastatic tumor site for DNA and RNA sequencing, immunological analysis. Biopsies may be used to evaluate the presence of T-cell infiltrates in the tumor and their localization with respect to tumor margins by tests like immunohistochemistry, western blot analysis, RNA and DNA analysis. The presence of tumor-associated macrophages and DCs within the tumor micro-environment may also be evaluated. The list of markers for analysis may include, but not be limited to, the following: CD3, CD4, CD8, CD45RO, PD-L1 , PD-I, FoxP3, Granzyme B, Perforin, CD68, CD163, MHC Class I, MHC Class II, CD83 AND CD1 lb. Immune response parameters may be analyzed for changes over time from baseline levels before the administration of the treatments and may include summaries of characterization of nucleic acids (e.g., DNA mutations, transcript abundance), histopathology, and immune cell analyses in tissues obtained at the Pretreatment, Prevaccination Treatment, and Vaccination Treatment phases as well as at the time of preliminary assessment. Reporting the test results may include tables depicting shifts from earlier time points in order to compare changes in immune parameters. Descriptive statistics and frequency distributions may be used as appropriate. Immunological analyses may include summaries for CD8+ and CD4+ T-cell response measured by ex vivo IFN-g ELISpot and assessed through spot counts. Analyses can be used to assess changes from pretreatment to pre-vaccination treatment to vaccination treatment to preliminary assessment. Reporting may include medians and inter-quartile ranges, as well as tables depicting shifts from earlier time points for each patient. Additionally, nonparametric tests (e.g., Wilcoxon signed-rank test) may be used to determine differences in the ELISpot data between time points as appropriate. Fold changes in biomarkers measured on a continuous scale may be summarized and compared across response categories using the Wilcoxon rank-sum test between treatment arms for every cohort. For multi-gene assays, genes may be grouped into analysis sets to characterize biological functions of the cells as appropriate.
Tests and results may include a detailed characterization of the phenotype and abundance of antigen-specific T cells, both in the periphery and in the tumor microenvironment. The abundance of regulatory cells such as regulatory T cells or myeloid-derived suppressor cells, and T-cell recognition, activation, and cytotoxicity may also be evaluated with PBMCs and tumor cells. Additionally, ex vivo induction of neoantigen T-cell responses may also be performed on peripheral blood and leukopheresis samples. Presence of circulating tumor DNA (ctDNA) and vaccinespecific antibody responses may be evaluated after treatment with the compositions described herein.
The herein-described compositions and methods may be used on patients in need thereof with any cancer according to the general flow process comprising subject identification, collecting informed consent and pre-screening the patients. Patients can then undergo an assessment of the specific type of cancer and the mutations causing the cancer. The nucleic acid material collected from a patient may be used for exome sequencing (tumor and normal tissue), RNA sequencing for the preparation of specific personalized vaccine. Patients in need thereof may receive a series of priming vaccinations with a mixture of personalized tumor-specific peptides. Additionally, over a 4 week period the priming may be followed by two boosts during a maintenance phase. All vaccinations are subcutaneously delivered. The vaccine or immunogenic composition is evaluated for safety, tolerability, immune response and clinical effect in patients and for feasibility of producing vaccine or immunogenic composition and successfully initiating vaccination within an appropriate time frame. The first cohort can consist of 5 patients, and after safety is adequately demonstrated, an additional cohort of 10 patients may be enrolled. Peripheral blood is extensively monitored for peptidespecific T-cell responses and patients are followed for up to two years to assess disease recurrence.
For instance, the subject receiving the inventive combination, (pharmaceutical) composition or vaccine according to the invention may be a patient with cancer, preferably as defined herein, or a related condition, receiving chemotherapy (e.g. first- line or second-line chemotherapy), radiotherapy, chemoradiation (combination of chemotherapy and radiotherapy), tyrosine kinase inhibitors (e.g. EGFR tyrosine kinase inhibitors), antibody therapy and/or inhibitory and/or stimulatory checkpoint molecules (e.g. CTLA4 inhibitors), or a patient, who has achieved partial response or stable disease after having received one or more of the treatments specified above. Or, the subject receiving the inventive combination, (pharmaceutical) composition or vaccine according to the invention may be a patient with an infectious disease, preferably as defined herein, receiving antibiotic, antifungal or antiviral therapy.
In a further aspect, the present invention thus also relates to the use of the inventive combination, for supporting another therapy of cancer or an infectious disease. « Support” of the treatment or prophylaxis of cancer may be any combination of a conventional cancer therapy method of such as surgery, radiation therapy, chemotherapy (e.g. first-line or second-line chemotherapy), chemoradiation, treatment with tyrosine kinase inhibitors, treatment with inhibitory and/or stimulatory checkpoint molecules, preferably CTLA4 inhibitors, antibody therapy or any combination of these, and a therapy using the inventive combination, (pharmaceutical) composition or vaccine as defined herein.
Administration of the inventive combination, (pharmaceutical) composition or vaccine according to the invention may be accomplished prior to, simultaneously and/or subsequently to administering another therapeutic or subjecting the patient to another therapy that is useful for treatment of the particular disease or condition to be treated.
In preferred embodiments, the inventive combination is used for treatment or prophylaxis of cancer.
As used herein, the term “cancer” refers to a neoplasm characterized by the uncontrolled and usually rapid proliferation of cells that tend to invade surrounding tissue and to metastasize to distant body sites. The term encompasses benign and malignant neoplasms. Malignancy in cancers is typically characterized by anaplasia, invasiveness, and metastasis; whereas benign malignancies typically have none of those properties. The terms includes neoplasms characterized by tumor growth as well as cancers of blood and lymphatic system. Specific examples of cancer that can be treated with the inventive combination, (pharmaceutical) composition or vaccine include Acute Lymphoblastic Leukemia, Adult; Acute Lymphoblastic Leukemia, Childhood; Acute Myeloid Leukemia, Adult; Adrenocortical Carcinoma; Adrenocortical Carcinoma, Childhood; AIDS-Related Lymphoma; AIDS-Related Malignancies; Anal Cancer; Astrocytoma, Childhood Cerebellar; Astrocytoma, Childhood Cerebral; Bile Duct Cancer, Extrahepatic; Bladder Cancer; Bladder Cancer, Childhood; Bone Cancer, Osteosarcoma/Malignant Fibrous Histiocytoma; Brain Stem Glioma, Childhood; Brain Tumor, Adult; Brain Tumor, Brain Stem Glioma, Childhood; Brain Tumor, Cerebellar Astrocytoma, Childhood; Brain Tumor, Cerebral Astrocytoma/Malignant Glioma, Childhood; Brain Tumor, Ependymoma, Childhood; Brain Tumor, Medulloblastoma, Childhood; Brain Tumor, Supratentorial Primitive Neuroectodermal Tumors, Childhood; Brain Tumor, Visual Pathway and Hypothalamic Glioma, Childhood; Brain Tumor, Childhood (Other); Breast Cancer; Breast Cancer and Pregnancy; Breast Cancer, Childhood; Breast Cancer, Male; Bronchial Adenomas/Carcinoids, Childhood: Carcinoid Tumor, Childhood; Carcinoid Tumor, Gastrointestinal; Carcinoma, Adrenocortical; Carcinoma, Islet Cell; Carcinoma of Unknown Primary; Central Nervous System Lymphoma, Primary; Cerebellar Astrocytoma, Childhood; Cerebral Astrocytoma/Malignant Glioma, Childhood; Cervical Cancer; Childhood Cancers; Chronic Lymphocytic Leukemia; Chronic Myelogenous Leukemia; Chronic Myeloproliferative Disorders; Clear Cell Sarcoma of Tendon Sheaths; Colon Cancer; Colorectal Cancer, Childhood; Cutaneous T-Cell Lymphoma; Endometrial Cancer; Ependymoma, Childhood; Epithelial Cancer, Ovarian; Esophageal Cancer; Esophageal Cancer, Childhood; Ewing's Family of Tumors; Extracranial Germ Cell Tumor, Childhood; Extragonadal Germ Cell Tumor; Extrahepatic Bile Duct Cancer; Eye Cancer, Intraocular Melanoma; Eye Cancer, Retinoblastoma; Gallbladder Cancer; Gastric (Stomach) Cancer; Gastric (Stomach) Cancer, Childhood; Gastrointestinal Carcinoid Tumor; Germ Cell Tumor, Extracranial, Childhood; Germ Cell Tumor, Extragonadal; Germ Cell Tumor, Ovarian; Gestational Trophoblastic Tumor; Glioma. Childhood Brain Stem; Glioma. Childhood Visual Pathway and Hypothalamic; Hairy Cell Leukemia; Head and Neck Cancer; Hepatocellular (Liver) Cancer, Adult (Primary); Hepatocellular (Liver) Cancer, Childhood (Primary); Hodgkin's Lymphoma, Adult; Hodgkin's Lymphoma, Childhood; Hodgkin's Lymphoma During Pregnancy; Hypopharyngeal Cancer; Hypothalamic and Visual Pathway Glioma, Childhood; Intraocular Melanoma; Islet Cell Carcinoma (Endocrine Pancreas); Kaposi's Sarcoma; Kidney Cancer; Laryngeal Cancer; Laryngeal Cancer, Childhood; Leukemia, Acute Lymphoblastic, Adult; Leukemia, Acute Lymphoblastic, Childhood; Leukemia, Acute Myeloid, Adult; Leukemia, Acute Myeloid, Childhood; Leukemia, Chronic Lymphocytic; Leukemia, Chronic Myelogenous; Leukemia, Hairy Cell; Lip and Oral Cavity Cancer; Liver Cancer, Adult (Primary); Liver Cancer, Childhood (Primary); Lung Cancer, NonSmall Cell; Lung Cancer, Small Cell; Lymphoblastic Leukemia, Adult Acute; Lymphoblastic Leukemia, Childhood Acute; Lymphocytic Leukemia, Chronic; Lymphoma, AIDS-Related; Lymphoma, Central Nervous System (Primary); Lymphoma, Cutaneous T-Cell; Lymphoma, Hodgkin's, Adult; Lymphoma, Hodgkin's; Childhood; Lymphoma, Hodgkin's During Pregnancy; Lymphoma, Non-Hodgkin's, Adult; Lymphoma, Non-Hodgkin's, Childhood; Lymphoma, Non-Hodgkin's During Pregnancy; Lymphoma, Primary Central Nervous System; Macroglobulinemia, Waldenstrom's; Male Breast Cancer; Malignant Mesothelioma, Adult; Malignant Mesothelioma, Childhood; Malignant Thymoma; Medulloblastoma, Childhood; Melanoma; Melanoma, Intraocular; Merkel Cell Carcinoma; Mesothelioma, Malignant; Metastatic Squamous Neck Cancer with Occult Primary; Multiple Endocrine Neoplasia Syndrome, Childhood; Multiple Myeloma/Plasma Cell Neoplasm; Mycosis Fungoides; Myelodysplasia Syndromes; Myelogenous Leukemia, Chronic; Myeloid Leukemia, Childhood Acute; Myeloma, Multiple; Myeloproliferative Disorders, Chronic; Nasal Cavity and Paranasal Sinus Cancer; Nasopharyngeal Cancer; Nasopharyngeal Cancer, Childhood; Neuroblastoma; Neurofibroma; Non-Hodgkin's Lymphoma, Adult; Non-Hodgkin's Lymphoma, Childhood; Non-Hodgkin's Lymphoma During Pregnancy; Non-Small Cell Lung Cancer; Oral Cancer, Childhood; Oral Cavity and Lip Cancer; Oropharyngeal Cancer; Osteosarcoma/Malignant Fibrous Histiocytoma of Bone; Ovarian Cancer, Childhood; Ovarian Epithelial Cancer; Ovarian Germ Cell Tumor; Ovarian Low Malignant Potential Tumor; Pancreatic Cancer; Pancreatic Cancer, Childhood”, Pancreatic Cancer, Islet Cell; Paranasal Sinus and Nasal Cavity Cancer; Parathyroid Cancer; Penile Cancer; Pheochromocytoma; Pineal and Supratentorial Primitive Neuroectodermal Tumors, Childhood; Pituitary Tumor; Plasma Cell Neoplasm/Multiple Myeloma; Pleuropulmonary Blastoma; Pregnancy and Breast Cancer; Pregnancy and Hodgkin's Lymphoma; Pregnancy and Non-Hodgkin's Lymphoma; Primary Central Nervous System Lymphoma; Primary Liver Cancer, Adult; Primary Liver Cancer, Childhood; Prostate Cancer; Rectal Cancer; Renal Cell (Kidney) Cancer; Renal Cell Cancer, Childhood; Renal Pelvis and Ureter, Transitional Cell Cancer; Retinoblastoma; Rhabdomyosarcoma, Childhood; Salivary Gland Cancer; Salivary Gland Cancer, Childhood; Sarcoma, Ewing's Family of Tumors; Sarcoma, Kaposi's; Sarcoma (Osteosarcoma)/Malignant Fibrous Histiocytoma of Bone; Sarcoma, Rhabdomyosarcoma, Childhood; Sarcoma, Soft Tissue, Adult; Sarcoma, Soft Tissue, Childhood; Sezary Syndrome; Skin Cancer; Skin Cancer, Childhood; Skin Cancer (Melanoma); Skin Carcinoma, Merkel Cell; Small Cell Lung Cancer; Small Intestine Cancer; Soft Tissue Sarcoma, Adult; Soft Tissue Sarcoma, Childhood; Squamous Neck Cancer with Occult Primary, Metastatic; Stomach (Gastric) Cancer; Stomach (Gastric) Cancer, Childhood; Supratentorial Primitive Neuroectodermal Tumors, Childhood; T-Cell Lymphoma, Cutaneous; Testicular Cancer; Thymoma, Childhood; Thymoma, Malignant; Thyroid Cancer; Thyroid Cancer, Childhood; Transitional Cell Cancer of the Renal Pelvis and Ureter; Trophoblastic Tumor, Gestational; Unknown Primary Site, Cancer of, Childhood; Unusual Cancers of Childhood; Ureter and Renal Pelvis, Transitional Cell Cancer; Urethral Cancer; Uterine Sarcoma; Vaginal Cancer; Visual Pathway and Hypothalamic Glioma, Childhood;
Vulvar Cancer; Waldenstrom's Macro globulinemia; and Wilms' Tumor.
Infectious Diseases
The inventive combination, pharmaceutical composition or kit may also be used for treating infectious diseases. The term “infection” or “infectious disease” relates to the invasion and multiplication of microorganisms such as bacteria, viruses, and parasites that are not normally present within the body. An infection may cause no symptoms and be subclinical, or it may cause symptoms and be clinically apparent. An infection may remain localized, or it may spread through the blood or lymphatic system to become systemic. Infectious diseases in this context, preferably include viral, bacterial, fungal or protozoological infectious diseases. Specific examples of infectious diseases that can be treated with the inventive combination, (pharmaceutical) composition or vaccine include Acinetobacter infections, African sleeping sickness (African trypanosomiasis), AIDS (Acquired immunodeficiency syndrome), Amoebiasis, Anaplasmosis, Anthrax, Appendicitis, Arcanobacterium haemolyticum infections, Argentine hemorrhagic fever, Ascariasis, Aspergillosis, Astrovirus infections, Athlete's foot, Babesiosis, Bacillus cereus infections, Bacterial meningitis, Bacterial pneumonia, Bacterial vaginosis (BV), Bacteroides infections, Balantidiasis, Baylisascaris infections, Bilharziosis, BK virus infections, Black piedra, Blastocystis hominis infections, Blastomycosis, Bolivian hemorrhagic fever, Borrelia infectionss (Borreliosis), Botulism (and Infant botulism), Bovine tapeworm, Brazilian hemorrhagic fever, Brucellosis, Burkholderia infections, Buruli ulcer, Calicivirus infections (Norovirus and Sapovirus), Campylobacteriosis, Candidiasis (Candidosis), Canine tapeworm infections, Cat-scratch disease, Chagas Disease (American trypanosomiasis), Chancroid, Chickenpox, Chlamydia infections, Chlamydia trachomatis infections, Chlamydophila pneumoniae infections, Cholera, Chromoblastomycosis, Climatic bubo, Clonorchiasis, Clostridium difficile infections, Coccidioidomycosis, Cold, Colorado tick fever (CTF), Common cold (Acute viral rhinopharyngitis; Acute coryza), Condyloma acuminata, Conjunctivitis, Creutzfeldt- Jakob disease (CJD), Crimean-Congo hemorrhagic fever (CCHF), Cryptococcosis, Cryptosporidiosis, Cutaneous larva migrans (CLM), Cutaneous Leishmaniosis, Cyclosporiasis, Cysticercosis, Cytomegalovirus infections, Dengue fever, Dermatophytosis, Dientamoebiasis, Diphtheria, Diphyllobothriasis, Donavanosis, Dracunculiasis, Early summer meningoencephalitis (FSME), Ebola hemorrhagic fever, Echinococcosis, Ehrlichiosis, Enterobiasis (Pinworm infections), Enterococcus infections, Enterovirus infections, Epidemic typhus, Epiglottitis, Epstein-Barr Virus Infectious Mononucleosis, Erythema infectiosum (Fifth disease), Exanthem subitum, Fasciolopsiasis, Fasciolosis, Fatal familial insomnia (FFI), Fifth disease, Filariasis, Fish poisoning (Ciguatera), Fish tapeworm, Flu, Food poisoning by Clostridium perfringens, Fox tapeworm, Free-living amebic infections, Fusobacterium infections, Gas gangrene, Geotrichosis, Gerstmann-Straussler-Scheinker syndrome (GSS), Giardiasis, Glanders, Gnathostomiasis, Gonorrhea, Granuloma inguinale (Donovanosis), Group A streptococcal infections, Group B streptococcal infections, Haemophilus influenzae infections, Hand foot and mouth disease (HFMD), Hantavirus Pulmonary Syndrome (HPS), Helicobacter pylori infections, Hemolytic-uremic syndrome (HUS), Hemorrhagic fever with renal syndrome (HFRS), Henipavirus infections, Hepatitis A, Hepatitis B, Hepatitis C, Hepatitis D, Hepatitis E, Herpes simplex, Herpes simplex type I, Herpes simplex type II, Herpes zoster, Histoplasmosis, Hollow warts, Hookworm infections, Human bocavirus infections, Human ewingii ehrlichiosis, Human granulocytic anaplasmosis (HGA), Human metapneumovirus infections, Human monocytic ehrlichiosis, Human papillomavirus (HPV) infections, Human parainfluenza virus infections, Hymenolepiasis, Influenza, Isosporiasis, Japanese encephalitis, Kawasaki disease, Keratitis, Kingella kingae infections, Kuru, Lambliasis (Giardiasis), Lassa fever, Legionellosis (Legionnaires' disease, Pontiac fever), Leishmaniasis, Leprosy, Leptospirosis, Lice, Listeriosis, Lyme borreliosis, Lyme disease, Lymphatic filariasis (Elephantiasis), Lymphocytic choriomeningitis, Malaria, Marburg hemorrhagic fever (MHF), Marburg virus, Measles, Melioidosis (Whitmore's disease), Meningitis, Meningococcal disease, Metagonimiasis, Microsporidiosis, Miniature tapeworm, Miscarriage (prostate inflammation), Molluscum contagiosum (MC), Mononucleosis, Mumps, Murine typhus (Endemic typhus), Mycetoma, Mycoplasma hominis, Mycoplasma pneumonia, Myiasis, Nappy/diaper dermatitis, Neonatal conjunctivitis (Ophthalmia neonatorum), Neonatal sepsis (Chorioamnionitis), Nocardiosis, Noma, Norwalk virus infections, Onchocerciasis (River blindness), Osteomyelitis, Otitis media, Paracoccidioidomycosis (South American blastomycosis), Paragonimiasis, Paratyphus, Pasteurellosis, Pediculosis capitis (Head lice), Pediculosis corporis (Body lice), Pediculosis pubis (Pubic lice, Crab lice), Pelvic inflammatory disease (PID), Pertussis (Whooping cough), Pfeiffer's glandular fever, Plague, Pneumococcal infections, Pneumocystis pneumonia (PCP), Pneumonia, Polio (childhood lameness), Poliomyelitis, Porcine tapeworm, Prevotella infections, Primary amoebic meningoencephalitis (PAM), Progressive multifocal leukoencephalopathy, Pseudo-croup, Psittacosis, Q fever, Rabbit fever, Rabies, Rat-bite fever, Reiter's syndrome, Respiratory syncytial virus infections (RSV), Rhinosporidiosis, Rhinovirus infections, Rickettsial infections, Rickettsialpox, Rift Valley fever (RVF), Rocky mountain spotted fever (RMSF), Rotavirus infections, Rubella, Salmonella paratyphus, Salmonella typhus, Salmonellosis, SARS (Severe Acute Respiratory Syndrome), Scabies, Scarlet fever, Schistosomiasis (Bilharziosis), Scrub typhus, Sepsis, Shigellosis (Bacillary dysentery), Shingles, Smallpox (Variola), Soft chancre, Sporotrichosis, Staphylococcal food poisoning, Staphylococcal infections, Strongyloidiasis, Syphilis, Taeniasis, Tetanus, Three-day fever, Tick-borne encephalitis, Tinea barbae (Barber's itch), Tinea capitis (Ringworm of the Scalp), Tinea corporis (Ringworm of the Body), Tinea cruris (Jock itch), Tinea manuum (Ringworm of the Hand), Tinea nigra, Tinea pedis (Athlete's foot), Tinea unguium (Onychomycosis), Tinea versicolor (Pityriasis versicolor), Toxocariasis (Ocular Larva Migrans (OLM) and Visceral Larva Migrans (VLM)), Toxoplasmosis, Trichinellosis, Trichomoniasis, Trichuriasis (Whipworm infections), Tripper, Trypanosomiasis (sleeping sickness), Tsutsugamushi disease, Tuberculosis, Tularemia, Typhus, Typhus fever, Ureaplasma urealyticum infections, Vaginitis (Colpitis), Variant Creutzfeldt-Jakob disease (vCJD, nvCJD), Venezuelan equine encephalitis, Venezuelan hemorrhagic fever, Viral pneumonia, Visceral Leishmaniosis, Warts, West Nile Fever, Western equine encephalitis, White piedra (Tinea blanca), Whooping cough, Yeast fungus spots, Yellow fever, Yersinia pseudotuberculosis infections, Yersiniosis, and Zygomycosis.
Kits and Co-Packaqinq
In an aspect, the invention provides kits containing any one or more of the elements discussed herein to allow administration of the combination therapy. Elements may be provided individually or in combinations, and may be provided in any suitable container, such as a vial, a bottle, or a tube. In some embodiments, the kit includes instructions in one or more languages, for example in more than one language. In some embodiments, a kit comprises one or more reagents for use in a process utilizing one or more of the elements described herein. Reagents may be provided in any suitable container. For example, a kit may provide one or more delivery or storage buffers. Reagents may be provided in a form that is usable in a particular process, or in a form that requires addition of one or more other components before use (e.g. in concentrate or lyophilized form). A buffer can be any buffer, including but not limited to a sodium carbonate buffer, a sodium bicarbonate buffer, a borate buffer, a Tris buffer, a MOPS buffer, a HEPES buffer, and combinations thereof. In some embodiments, the buffer is alkaline. In some embodiments, the buffer has a pH from about 7 to about 10. In some embodiments, the kit comprises one or more of the vectors, proteins and/or one or more of the polynucleotides described herein. The kit may advantageously al low the provision of all elements of the systems of the invention. Kits can involve vector(s) and/or particle(s) and/or nanoparticle(s) containing or encoding nucleic acids (typically RNAs)(s) for 1 -50 or more antigens to be administered to an animal, mammal, primate, rodent, etc., with such a kit including instructions for administering to such a eukaryote; and such a kit can optionally include any of the anti-cancer agents described herein. The kit may include any of the components above (as well as instructions for use with any of the methods of the present invention.
In one embodiment the kit contains at least one vial with an immunogenic composition or vaccine and at least one vial with a KMT inhibitor. In one embodiment kits may comprise ready to use components that are mixed and ready to administer. In one aspect a kit contains a ready to use immunogenic or vaccine composition and a ready to use KMT inhibitor. The ready to use immunogenic or vaccine composition may comprise separate vials containing different pools of immunogenic compositions. The immunogenic compositions may comprise one vial containing a viral vector or DNA plasmid and the other vial may comprise immunogenic protein. The ready to use KMT inhibitor may comprise a cocktail of KMT inhibitors or a single KMT inhibitor agent or component. In another embodiment a kit may contain a ready to use KMT inhibitor and an immunogenic composition or vaccine in a ready to be reconstituted form. The immunogenic or vaccine composition may be freeze dried or lyophilized. The kit may comprise a separate vial with a reconstitution buffer that can be added to the lyophilized composition so that it is ready to be administered. The buffer may advantageously comprise an adjuvant or emulsion according to the present invention. In another embodiment the kit may comprise a ready to reconstitute KMT inhibitor and a ready to reconstitute immunogenic composition or vaccine. In this aspect both may be lyophilized. In this aspect separate reconstitution buffers for each may be included in the kit. The buffer may advantageously comprise an adjuvant or emulsion according to the present invention. In another embodiment the kit may comprise single vials containing a dose of immunogenic composition and KMT inhibitor agent that are administered together. In another aspect multiple vials are included so that one vial is administered according to a treatment timeline. One vial may only contain the KMT inhibitor agent or component for one dose of treatment, another may contain both the KMT inhibitor agent or component and immunogenic composition for another dose of treatment and one vial may only contain the immunogenic composition for yet another dose. In a further aspect the vials are labeled for their proper administration to a patient in need thereof. The immunogen or KMT inhibitor agent or component of any embodiment may be in a lyophilized form, a dried form or in aqueous solution as described herein. The immunogen may be a live attenuated virus, protein, or nucleic acid as described herein.
The inventive combination may also be used in combination therapy. Any other therapy useful for treating or preventing the diseases and disorders defined herein may be combined with the uses and methods disclosed herein.
Although the present invention and its advantages have been described in detail, it should be understood that various changes, substitutions and alterations can be made herein without departing from the spirit and scope of the invention as defined in the appended claims.
The present invention is further illustrated in the following Examples which are given for illustration purposes only and are not intended to limit the invention in any way.
EXAMPLES
Immunological memory is based on the capacity of immune cells to adapt to previously encountered pathogens. Three basic features of T cells are key for this adaptation: 1 ) antigen mediated clonal expansion, which biases the T cell repertoire to pathogens encountered previously, 2) epigenetic landscape remodeling that accelerates acquisition of effector functions, and 3) T cell redistribution to peripheral tissues, that maximizes the chances of early pathogen re-encounter. Central memory (TCM) cells are predominantly found in blood and secondary lymphoid organs, express lymphoid homing molecules such as CCR7 and CD62L, and are characterized by multipotency and a high proliferative capacity upon antigen reencounter. Effector memory (TEM) cells, patrol the blood and are characterized by high cytotoxic capacity upon renewed TCR signaling. Finally, the most recently characterized tissue resident memory (TRM) cells, reside in non-lymphoid tissues, and do not recirculate through blood. TRM cells downregulate tissue egress markers such as S1 PR1 and CCR7 and, very often but not always, constitutively express tissue retention molecules such as CD69. They provide local protection upon reinfection456 constitute a large proportion of the CD8+ T-cell memory population7 and are among the first to respond during secondary antigen encounters5.
Both activation signals during priming and tissue-derived signals are important for TRM differentiation, maturation, and persistence8. Fate decisions in the TRM linage occur in tissues (model of local divergence), or at the priming sites (systemic divergent model1), leading to a pool of TRM-poised T cells in the lymphoid compartment. In both cases, TRM precursors are already present in tissues during the effector phase of immune responses. However, the precise nature of the TRM precursors and their relationship to TCM, is still a matter of debate1. The differentiation of all T cell memory subtypes is accompanied by profound changes in the epigenetic landscape that maintain memory gene expression programs1415. Studies on epigenetic changes during TRM formation revealed both shared and tissue-specific epigenetic signatures16. Some of these changes occur early during immune responses, supporting the existence of poised T RM precursors among tissue homing effector cells17. The role of specific epigenetic regulators or chromatin modifiers in TRM formation is still largely unknown18.
Post-translational modifications of histone N-terminal tails regulate many features of chromatin biology and gene expression and play crucial roles in cell development in general19, including T cells20 21 22. Suppression of position effect variegation 3-9 1 (SUV39H1 ) was the first mammalian histone lysine methyltransferase (KMT) identified23. Together with its mammalian paralog SUV39H2, SUV39H1 introduces the second and third methyl groups on lysin 9 of histone H3 tails (H3K9me2 and H3K9me3). Through its KMT activity, SUV39H1 has essential roles in heterochromatin formation and spreading2425 26 and is one of the most conserved epigenetic silencing systems, even more than DNA methylation25. H3K9me3 is important for silencing lineage-inappropriate genes27 and for establishing linage cell identity during embryogenesis28, as well as an impediment to differentiated cells reprograming29. Previous work from the inventors showed that H3K9me3 and SUV39H1 silence Th1- related genes during CD4+ T cell commitment to Th2 cells22. More recently, we showed that during effector CD8+ T cell differentiation, SUV39H1 -mediated silencing of sternness genes is necessary to promote the establishment of cell identity, leading to the accumulation TCM cells in lymphoid tissues20. Finally, we also showed that in tumor models, including CAR T cells, SUV39H1 defect leads to a dual phenotype, increased TCM in lymphoid organs and increased effectors in tissues30 31.
The inventors now show that the absence of SUV39H1 promotes an increase in CD8+ TRM precursors and CD69+ CD103’ TRM cells at steady state, upon space-induced “homeostatic” expansion, and after flu infection. SUV39H1-defficiency led to greater differentiation of a transitional cell population expressing CD49d, consistent with increased TRM precursor differentiation. Accordingly, SUV39H1 -deficient effectors accumulating in lungs early upon flu infection give rise to CD69+ CD1 03’ TRM cells after adoptive transfer, confirming that SUV39H1 -deficiency leads to the accumulation of TRM precursors during the effector phase of infection. Finally, they show that lung SUV39H1 -defective TRM cells delay lung tumor metastasis more efficiently than WT cells. Increased CD8+ T cell differentiation into precursors of both TRM and TCM CD8+ T cells accounts for the observed double effect of SUV39H1 KO, i.e. increased TCM differentiation in lymphoid organs and increased TRM in tissues.
These new results now provide exciting evidence promoting the use of SUV39H1 inhibitors, typically in combination with immunotherapy, notably vaccination therapy and/or with cell therapy. The results provide evidence of a beneficial effect of Suv39H1 inhibition for both cancer treatment and infection diseases.
Material and methods
Mice, virus strains and cell lines C57BL/6J male mice were obtained from Charles River and used at 6-10 weeks of age. Suv39h1tm1 Jnw C57BL/6J (Suv39h1-KO) mice were kindly provided by T. Jenuwein and previously described (Peters, A. H. et al. Loss of the Suv39h histone methyltransferases impairs mammalian heterochromatin and genome stability. Cell 107, 323-337 (2001 ).), were backcrossed with C57BI6/J mice for at least nine generations. C57BL/6J-Tg(TcraTcrb)1100Mjb/J mice (OT-I), B6.SJL-Ptprca Pepcb/BoyJ (CD45.1 ). OT-I mice were crossed with CD45.1 mice to obtain OT- I/CD45.1/CD45.2 mice. Suv39h1 Flox/Flox (official name is B6-Suv39h1tm1 Ciphe) were originally produced at the Centre d’lmmunologie de Marseille (CIPHE, B. Malissen) and were subsequently bred in the animal facility of Institut Curie, they are described in Niborski, L. L. et al. CD8+T cell responsiveness to anti-PD-1 is epigenetically regulated by Suv39h1 in melanomas. Nat Common 13, 3739 (2022).
Mice were housed in Curie Institute SPF animal facilities. Live animal experiments were performed in accordance with the guidelines of the Ministere de I’enseignement superieur, de la recherche et de innovation (Project authorization: APAFIS #34372- 2021121522311823 v1 ).
Influenza A/HKX31 (H3N2) and A/PR8 (H1 N1 ) virus were purchased from Charles River. Influenza A/HKX31 (H3N2) and A/PR8 (H1 N1 ) virus expressing the OVA peptide SIINFEKL, (X31-OVA and PR8-OVA, respectively) were kindly provided by Dr. Stephen Turner and Dr. Richard Webby (Jenkins MR, Webby R, Doherty PC, Turner SJ. Addition of a Prominent Epitope Affects Influenza A Virus-Specific CD8 + T Cell Immunodominance Hierarchies When Antigen Is Limiting. J Immunol. 1 sept 2006;177(5):2917-25).
B16F10-expressing OVA (B16F10-OVA) stably expressing Luciferase (B16F10-OVA- Luc) were produced by transducing B16F10-OVA cells with lentiviral particles produced with the pTRIP-SFFV-mtagBFP-2A plasmid (kindly provided by Dr. Nicolas Manel), as previously described (Cerboni et al J Exp Med. 2017 Jun 5;214(6): 1769- 1785).
In-vivo staining and tissue preparation
Tissue homing and circulating cells were distinguished by intravascular staining as previously described32. Briefly, 15 ug of CD45.1-PE, CD45.1-APC, CD45.2-PE, CD45.2-APC, CD8a-PE or CD8a-APC in 100 ul of PBS were injected intravenously in the retroorbital sinus between 3’ and 5’ before killing the mice.
To isolate lymphocytes from the lungs, lungs were digested using GentleMACS® tissue dissociator (Milteny) in CO2 independent medium (Gibco 18045-054) with DNAse I 0,1 mg/ml (Roche 11-284-932-001 ) and Liberase® 0,1 mg/ml (Roche 05-401- 020-001 ).
For isolation of lymphocytes from the small intestinal epithelium (lELs), small gut was dissected from the caecum to the stomach, Peyer’s patches were removed, and the tissue was cut longitudinally and washed of luminal contents. The tissue was then cut into 0.5-cm pieces that were incubated while shaking in Hanks’ balanced salt solution (HBSS) without Ca2+ and Mg2+ (Gibco 14185-052) with EDTA 5 mM (Invitrogen 15575-038), FBS (Eurobio) 10% and DTT 1 mM (Euromedex 0006-b) at 37°C 3 times for 20’ and 1 time in HBSS without Ca2+ and Mg2+ for 20’. Cells within the supernatant were collected.
To isolate lymphocyte from the small gut Lamina Propria (LP) remaining gut pieces were incubated at 37 C with agitation in 2.5 ml of CO2 independent medium (Gibco 18045-054) with 0.17 U/ml of Liberase® (Roche 05-401-020-001 ), 1 mg/ml of collagenase (Sigma-Aldrich 11088866001 ) and 125 ug/ml of DNAse I (Roche 11284932001 ) for 30’ and then mechanically disaggregated in gentleMACS® tissue dissociator.
To isolate lymphocytes from skin, skin from the back of the mice was shaved and cleaned with EtOH. Then subcutaneous fat tissue was separated from the skin with the help of scalpels. Cleaned skin was then cut in small pieces with scissors and digested in 6 ml of CO2 independent medium (Gibco 18045-054) containing Hyaluronidase type IS 500 pg/ml (Sigma-Aldrich H3506), Liberase® 100 pg/ml (Roche 05-401-020-001 ), DNAse I 250 pg/ml (Roche 11284932001 ), 2% FBS (Eurobio) and 1 % Hepes (Gibco) for 1 h at 37 C with agitation. Then, tissue was mechanically disaggregated by using gentleMACS® tissue dissociator.
Liver was scratched using a 100 pM cell strainer (Falcon 352360) and a syringe plunge in PBS (Eurobio CS1 PBS01-01 ) supplemented with EDTA 2 mM (Invitrogen 15575- 038) and BSA 0.5% (Sigma-Aldrich A7906) -FACS buffer-.
Lymphocytes from digested lung, lELs, LP, skin and liver samples were enriched by 40%/80% Percoll® (Sigma-Aldrich) gradient63. Mediastinal, inguinal, and mesenteric lymph nodes and spleen were scratched using a 40 pM cell strainer (Falcon 352340) and a syringe plunge in CO2 independent medium (Gibco 18045-054) supplemented with 10% FBS (Eurobio).
Finally, cell suspensions were stained with the indicated fluorochrome coupled antibodies and analysed by FACS.
Cell staining for flow cytometry analysis
Cell suspensions were prepared in PBS and stained with Near IR (Fisher Scientific L34975) or Acqua LIVE/DEAD™ Fixable Cell Stain Kit (Fisher Scientific L34957) according to manufacturer’s instructions to exclude dead cells and then labelled in FACS buffer with the following antibodies: V500 Rat anti-Mouse CD4 (RM4-5, BD), eF450 CD5 Monoclonal Antibody (53-7.3, eBiosciences), FITC anti-CD8a (53-6.7, BD), PerCP-Cy5.5 CD8 a (53-6.7, BD), PE CD8 a Monoclonal Antibody (53-6.7, Ficher Scientific), BUV395 Rat Anti-Mouse CD8 p (H35-17.2, BD), APC anti-mouse CD25 Antibody (PC61 , Biolegend), PerCP-Cy5.5 Rat Anti-Mouse CD44 (IM7, BD), APC Rat Anti-Mouse CD44 (IM7, BD), APC-R700 Rat Anti-Mouse CD44 (IM7, BD), eFluor 450 CD45.1 Monoclonal Antibody (A20, Fisher Scientific), PE Mouse Anti-Mouse CD45.1 (A20, BD), APC-Cy7 CD45.1 (A20, BD), PE Mouse Anti-Mouse CD45.2 (104, BD), APC Mouse anti-Mouse CD45.2 (104, BD), BV605 Hamster Anti-Rat/Mouse CD49a (Ha31/8, BD), BV786 Rat Anti-Mouse CD49d (R1-2, BD), PE/Cyanine7 anti-mouse CD49d Antibody (R1-2, Biolegend), PE-Cy7 Rat Anti-Mouse CD62L (MEL-14, BD), APC Rat Anti-Mouse CD62L (MEL-14, BD), APC/Cyanine7 anti-mouse CD62L Antibody (MEL-14, Biolegend), PerCP-Cy5.5 Hamster Anti-Mouse CD69 (H1.2F3, BD), PE-Cy7 Hamster Anti-Mouse CD69 (H1.2F3, BD), Brilliant Violet 605™ antimouse CD73 Antibody (TY/11 .8, Biolegend), eFluor 450 CD103 Monoclonal Antibody (2E7, Fisher Scientific), eF660 CD127 (A7R34, eBiosciences), Brilliant Violet 711 antimouse CX3CR1 (SA011 F11 , Biolegend), BV711 CXCR3 (CXCR3-173, BD), Brilliant Violet 650™ anti-mouse Ly-6C Antibody (HK1.4, Biolegend), FITC anti-mouse Ly-6C (HK1.4, Biolegend), APC Ly-6C Monoclonal Antibody (HK1.4, eBiosciences), PE- CF594 Hamster Anti-Mouse KLRG1 (2F1 , BD), BUV737 Hamster Anti-Mouse TCR p Chain (H57-597, BD), Alexa-Fluor®488 Hamster Anti-Mouse TCR p Chain (H57-597, BD), PE-Cy™7 Hamster Anti-Mouse TCR p Chain (H57-597, BD), PE-CF594 TCR p Chain (H57-597, BD), eFluor 450 TRCR V alpha 2 (B20.1 , Invitrogen), PerCP/Cy5.5 anti-mouse TCR Va2 (B20.1 , Biolegend).
For some experiments, cells were fixed in 2% PFA (Electron Microscopy Sciences) during 20’ at room temperature. Cell suspensions were analyzed in a BD FacsVerse or a BD LSRFortessa cytometer. Data was analyzed by Flowjo 10 software version: 10.8.0.
Adoptive transfer
Secondary lymphoid organs (spleen, mesenteric, axillary, inguinal, brachial, cervical and lumbar lymph nodes) from Suv39H1 KO or WT OT-I male mice were collected, pooled and homogenized into single cell suspensions. Naive (CD44-) CD8+ T cells were enriched using the naive CD8+ T-cell isolation kit (Miltenyi Biotec, 130-096-543) according to manufacturer’s instructions. 1 x 106 or 5x104 cells of a 1 :1 mix of Suv39H1 KO and WT naive CD8+ T cells were adoptively transferred into Rag-KO or C57BL/6J male mice respectively. Cells were transferred intravenously by retroorbital injection. 24 h later, C57BL/6J mice were infected with the influenza virus strain X31- OVA.
Adoptive transfer of TRM precursors was made from lung tissue. Mice were injected with PE CD8 a Monoclonal Antibody (53-6.7, Ficher Scientific) as described before euthanasia. Lungs were digested as previously described and pooled enriched lymphocytes were stained with Acqua LIVE/DEAD™ Fixable Cell Stain Kit (Fisher Scientific L34957), eFluor 450 CD45.1 (A20, Fisher Scientific), PerCP-Cy5.5 CD8 a (53-6.7, BD), FITC anti-mouse Ly-6C (HK1.4, Biolegend), PE-CF594 TCR p Chain (H57-597, BD), PE/Cyanine7 anti-mouse CD49d Antibody (R1-2, Biolegend), APC Mouse anti-Mouse CD45.2 (104, BD), APC-R700 Rat Anti-Mouse CD44 (IM7, BD), APC/Cyanine7 anti-mouse CD62L Antibody (MEL-14, Biolegend). WT or SUV39H1 KO Total iv-, CD49d+/Ly6c- or CD49d+/Ly6c+ populations were FACS sorted from pooled lungs. Between 2x10ʌ4 and 4x1 ʌʌ4 cells of each population of a 1 :1 mix of Suv39H1 KO and WT cells were adoptively transferred. Cells were transferred intravenously by retroorbital injection
Tumours
1 x 106 B16-OVA-Luc cells were injected intravenously in the tale of the mice. Tumor burden was measured by bioluminescence imaging using Xenogen IVIS Imaging System (PerkinElmer) two times per week. Acquired bioluminescence data was analyzed using Living Image software (PerkinElmer) and expressed in average radiance (photons/sec/cm2/sr). The humane endpoint was defined by a maximum of 20% weight loss and additional clinical signs of distress.
Flu infection
Mice were infected by intranasal instillation with a sublethal dose of Influenza PR8 (5x105 EID50), X31 (2x105 EID50) or X31-OVA (2x105 TCID50) in 20 or 40 ul of PBS in the left nostril. Control group mice were instilled intranasally with PBS. In some experiments, 28 days after the first infection, mice were infected with a lethal dose of PR8 (2x106 -200-EID50). All infections were performed on anesthetized mice with ketamine (100mg/kg, Merial) and xylazine (7,5mg/kg, Bayer) in PBS administered intraperitoneally. The humane endpoint was defined by a maximum of 30% weight loss and additional clinical signs of distress.
Viral load by Q-PCR
Lungs were scratched using a 100 μM cell strainer (Falcon 352360) and a syringe plunge in FACS buffer and half of the lungs was centrifuged and lysed in RLT buffer (Qiagen
79216) supplemented with 1 % BMeOH (Sigma-Aldrich M3148) and saved at -80 C until further processing. RNA was extracted using RNeasy Mini kit (Qiagen 74104). RT PCR was performed using Superscript III (Invitrogen 10432122) and random primers (Promega C118A) following manufacturer’s instructions. Specific T aqMan probe for PA protein was designed using the AllelelD software (Premier Biosoft) using default parameters. Custom TaqMan probe (CCAAGTCATGAAGGAGAGGGAATACCGCT) was ordered from Fisher Scientific, and primers (Forward Primer: CGGTCCAAATTCCTGCTGA; Reverse primer: CATTGGGTTCCTTCCATCCA) were from Eurogentec. Concentrated TaqMan assays (20*) were prepared by mixing 5pl of TaqMan probe, 18 μl of each primer, and 59 μl of ddH 20. Glyceraldehyde-3-phospha tedehydrogenase (GAPDH) and hypoxanthine-guanine phsphoribosyl-transferase (HPRT1 ) TaqMan assays (Fisher Scientific) were used as housekeeping gene controls. qRT-PCR was performed in 384-well plates, using dTTP MasterMix (Eurogentec), according to the manufacturer ’s instructions (for each well, 0.5 pl of TaqMan assay, 5μl of Mastermix , and 4.5 pl of cDNA). Amplification was performed as recommended by the manufacturer, on Roche LightCycler 480, and the relative quantification tool from the analysis software was applied. Data were analyzed using Microsoft Excel to calculate AC t and further analyzed in GraphPadPrism.
In vitro T cell culture
Secondary lymphoid organs (mesenteric, axillary, inguinal, brachial, cervical, and lumbar lymph nodes and spleen) from SUV39H1-KO or WT OT-I male mice were collected, pooled and homogenized into single cell suspensions by scratching in a 40 pm cell strainer (Falcon) using a syringe plunge. Naive (CD44-) CD8+ T cells were enriched using the naive CD8+ T-cell isolation kit (Miltenyi 130-096-543) according to manufacturer’s instructions. Cells were then stained with Cell Trace Violet (Thermo Fisher). In brief cells were diluted at 10x106 cells par ml of a solution of 5 pM of Cell Trace Violet in PBS during 15min 37C and then washed with complete medium [RPMI, 100 mM Hepes, 2 mM Glutamax, 50 uM 2-mercaptoethanol, 100 U/100 ug/ml Penicillin/Streptomycin, 1x MEM Non-essential amino acids, 1 mM Sodium Pyruvate (all Gibco, Thermo Fisher), 10% SBF (Eurobio).
1x104 or 1x105 CTV-stained naive OTI CD8+ T cells were incubated for different time points with 2.5x104 or 2.5x105 splenocytes from CD3-KO mice preloaded with the indicated concentration of peptides (SIINFEKL, SIITFEKL or SIIVFEKL, GeneCust) in complete medium for the indicated periods of time. Then cells were stained for surface antibodies and analysed by FACS.
CITE-seq library preparation and sequencing
SUV39H1 KO (CD45.1/1 ) and WT (CD45.1/2) OTI cells were adoptively transferred into Rag KO mice and 34 days after transfer mice were stained with CD45.1-PE antibody intravenously and euthanized 5’ after injection as indicated above. Enriched lung leucocytes were stained with the following antibodies: CD8a-PerCP, TCRb- PECy7, CD4-FITC, CD45.2-APC, B220-eF450, MHCII-eF450, Nkp46-V450 and DAPI. The following cell populations were sorted in a FACSAria FACS sorter: WT iv+ (CD45.1 +/CD45.2+), WT iv- (CD45.1-/CD45.2+), KO iv+ (CD45.1 +, CD45.2-), KO iv- (CD45.1-, CD45.2-) from 6 mice and pooled by population. After sorting, cells were stained with TotalSeq-A0078 anti-mouse CD49d, TotalSeq-A0112 anti-mouse CD62L, TotalSeq-A0073 anti-mouse/human CD44, Total Seq-A0197 anti-mouse CD69, TotalSeq-A0013 anti-mouse Ly-6C Antibody, and each sorted population was stained with a different hashtag antibody: KOiv+, Total Seq-A0301 anti-mouse Hashtag 1 ; WT iv+, Total Seq-A0302 anti-mouse Hashtag 2; WT iv-, TotalSeq-A0303 anti-mouse Hashtag 3, KO iv-: TotalSeq-A0304 anti-mouse Hashtag 4 (all from Biolegend). Equal number of cells from each population were pooled and then subjected to 10X single cell RNA seq library preparation targeting 1x104 total cells. The single-cell library method used was the Chromium Single Cell v3 with single-indexing. The RNA samples and antibody derived tag (ADT/HTO) samples were pooled separately. RNA samples were sequenced to a depth of 100,000 reads/cell on a NovaSeq S4.
RNA-seq and TCRb library preparation and sequencing
For RNA and TCRb sequencing from ex-vivo naive, memory and Trm populations, secondary lymphoid organs (mesenteric, axillary, inguinal, brachial, cervical and lumbar lymph nodes and spleen) from Suv39H1-KO or WT male mice were collected, pooled, homogenized into single cell suspensions and stained with CD4-V500, CD44- PerCPCy5.5, TCRb-FITC, CD122-PE, CD8a-APC-Cy7 and DAPL Liver leucocytes were enriched as described before and stained with CD4-V500 CD69-PerCPCy5.5, Ly6c-AF488, TCRb-PECy7, CD8-APCCy7 and DAPL Naive (DAPI- /CD8a+/TCRb+/CD4-/CD44-/CD122-), and memory (DAPI-/CD8a+/TCRb+/CD4- /CD44+/CD122+) CD8+ T cells from pooled spleen and LN and CD69+ Trm (DAPI- /CD8a+/TCRb+/CD4-/CD69+/Ly6c-) from liver were FACS sorted directly into buffer RLT (Qiagen) supplemented with 2-mercaptoethanol (Sigma-Aldrich) and frozen at - 80 C. Total RNA was isolated using RNeasy Plus Micro kit (Qiagen 74004) according to manufacturer’s instructions and quantified by NanoDrop (Thermo-Fisher). Total RNA size distribution was determined by RNA 6000 Pico Kit for 2100 Bioanalyzer systems (Agilent).
For RNA sequencing, cDNA library was prepared using a SMART-Seq v4 Ultra Low Input RNA kit (Takara) according to manufacturer’s instructions. Libraries were quantified by Qubit fluorometric quantification (Invitrogen) with dsDNA HS (High Sensitivity) Assay Kit and size distribution was determined by Agilent High Sensitivity DNA Kit. 100bp paired-end sequencing was performed on an Illumina NovaSeq - S1 . For TCRb sequencing, libraries were prepared from purified total RNA using iRepertoire kit for TCRb mouse sequencing according to manufacturer’s instructions. 150bp paired-end sequencing was performed on an Illumina MiSeq - nanoV2-300 with 10% PhiX. For mRNA sequencing from in vitro activated cells, cells were stained with DAPI, CD8a-PE and TCRb5 APC and DAPI-/CD8a+/TCRb+ cells were FACS sorted in a FACSAria Fusion directly into buffer RLT (Qiagen) supplemented with 2- mercaptoethanol (Sigma-Aldrich) and frozen at -80 C. Total RNA was isolated using RNeasy Plus Micro kit (Qiagen 74004) according to the manufacturer’s instructions. RNA was quantified by NanoDrop (Thermo-Fisher) and size distribution was analyzed by using Agilent RNA 6000 Nano kit (Agilent). mRNA sequencing libraries were prepared from 100ng of total RNA using the Stranded mRNA Prep Ligation library preparation kit (Illumina), which allows to perform a strand specific sequencing. This protocol includes a first step of polyA selection using magnetic beads to focus sequencing on polyadenylated transcripts. After RNA fragmentation, cDNA synthesis was then performed and resulting fragments were used for dA-tailing followed by ligation of RNA Index Anchors. PCR amplification with indexed primers (IDT for Illumina RNA UD Indexes) was finally achieved, with 15 cycles, to generate the final cDNA libraries. Individual library quantification and quality assessment was performed using Qubit fluorometric assay (Invitrogen) with dsDNA HS (High Sensitivity) Assay Kit and LabChip GX Touch using a High Sensitivity DNA chip (Perkin Elmer). Libraries were then equimolarly pooled and quantified by qPCR using the KAPA library quantification kit (Roche). Sequencing was carried out on the NovaSeq 6000 instrument from Illumina using paired-end 2 x 100 bp, to obtain around 35 million clusters (70 million raw paired-end reads) per sample.
Bulk RNA-seq analysis
Bulk RNA-seq fastq reads were mapped to reference mouse genome mm10 using STAR (v2.7.1.a). Gene expression was quantified using featurecounts from Subread (v1.6.4) with Gencode mouse genes annotations (gtf file release M22, GRCm38.p6) and default parameters. Genes raw counts matrices were imported to R (v4.2.1 ). TPM and FPKM normalized expression values were calculated using calculateFPKM and calculateTPM functions from scuttle R package (version 1 .8.4). Low expressed genes were filtered out using a threshold of 0.5 FPKM. Only genes expressed above this threshold in all samples from at least 1 condition were retained. Count normalization and differential expression analyses were performed using DESeq2 R package (version 1.36.0). Genes with Benjamin-Hochberg (BH) adjusted p-value below 0.05 were considered as significantly differentially expressed between conditions. Gene Set Enrichment Analyses (GSEA) were performed using GSEA software (v4.3.2) from MsigDB with curated gene signatures and default parameters: Number of permutations = 1000; Permutation type = phenotype when more than 7 samples were compared in each condition otherwise gene_set). Bubble gum representations were created within R using R package ggplot2 (v3.4.4).
Single cell RNA-seq analysis
Single cell RNA-seq fastq reads for gene expression were processed using the Cell Ranger Single Cell Software Suite (v3.1 .0) to perform quality control, barcode and UMI processing, and single cell 3' gene counting. Reads were mapped to mm10 transcriptome (v3.0.0). HTO (hashtag oligos) sequencing reads defining sample of origin and ADT (antibody-derived tags) sequencing reads assessing cell surface protein expression were processed using CITE-seq count (v1 .4.5). Single cell gene expression data were imported within R (v4.2.1 ) and downstream analyses were performed using Seurat R package (v4.3.0.1 ). Cells with less than 200 features expressed and/or more than 10% of mitochondrial content were filtered out. ADT and HTO processed data from CITE-seq count were then imported in the Seurat object in two new assays. After CLR normalization, HTO data were demultiplexed with Seurat function HTODemux to assess sample of origin of each cell (blood-KO, blood-WT, tissue-KO, tissue-WT). Only singlet cells were kept for downstream analysis while cells positive for two or more hashtag oligos (doublets) and cells negative for all hashtag oligos were removed. For protein level assessment, counts from the ADT assay were normalized using the CLR method and used in downstream analyses to support annotation of the clusters defined by gene expression. For gene expression analysis, after log-normalization, the 5000 most variable genes were scaled and used to compute Principal Component Analysis (PCA). Top 30 principal components were chosen to compute UMAP and performed clustering steps. Differential expression analysis on gene expression was computed on clusters identified at resolutions 0.8 and 1 .2. Scores for curated signatures were computed using AddModuleScore function from Seurat. Prediction of differentiation state of cells was computed using R package CytoTRACE (vO.3.3). Transcription factor and regulon activities were evaluated using R package SCENIC (v1.3.1 ). Trajectory analysis was performed using R tools suite dynverse (dyno vO.1.2, dynmethods v1.0.5, dynwrap 1.2.4, dynguidelines v1.0.1 , dynfeature 1.0.1 , dynplot 1.1.2, dynutils 1.0.11 , dynparam 1.0.2, dyndimred 1.0.4). Differentially expressed genes excluding genes from the cell cycle cluster were used for the input matrix in the trajectory analysis. Following recommendations from dynguidelines::guidelines function on the dataset, slingshot (ti_slingshot) was used as the trajectory inference method within infer_trajectory function from dynwrap. Abundance of spliced and unspliced reads was evaluated using velocyto (vO.17.17) on cellranger output. From velocyto loom file output, python package scvelo (vO.2.5) was used to process, assess, and represent RNA velocity. Silhouette scores for each cluster were computed using the silhouette function from R package cluster (v2.1.4). For computing original proportions of each population (WTiv+, KOiv+, WTiv- and KOiv- ) within each cluster we used formula 1 :
Figure imgf000133_0001
Where psc is the proportion of sample s in cluster c, pcs is the proportion of cluster c in sample s, ps is the proportion of sample s among the whole lung and po is the proportion of cluster c in sample i.
Statistical analysis and plots
Heatmaps, barplots, violin plots, dotplots, scatter plots, LIMAP representations and volcano plots of single cell and bulk sequencing data were computed within R (v4.2.1 ) using R packages ggplot2 (v3.4.4), Seurat (v4.3.0.1 ), ComplexHeatmap (v2.14.0), scvelo (vO.2.5) and dynplot (v1 .1 .2). Statistical analysis and other plots were made by GraphPad Prism version 10.11. Plots were exported into Affinity Designer version 1 .10.8 to build the figures.
Effect of SUV39H1 inactivation in human naive T cells
The effect of SUV39H1 inactivation was investigated in human naive T cells. Total CD3+ T cells were purified from peripheral blood mononuclear cells (PBMCs), isolated from anonymous healthy donor leukapheresis rings (provided by EFS-Etablissement Francais du Sang), by density gradient centrifugation using Lymphoprep. Naive (CD45RA+CCR7+CD27+), Central Memory (CD45RA-CCR7+CD27+), and Effector Memory (CD45RO-CCR7-) were sorted from PBMC-purified total CD3+ T cells using BD FACSAria Hu sorter (Fig 2A.).
SUV39H1 inactivation by Crispr/Cas9 was performed in the sorted and bulk populations as follows: T cells were plated at a concentration 106 cells /ml using X- VIVO 15 media supplemented with 5 % human serum (Sigma Aldrich) and 0.5 pM p- mercaptoethanol, and stimulated with Dynabeads human T-Activator CD3/CD28 in a ratio of 1 bead per cell. Cells were recovered from the cultures 48 hours after and then subjected to magnetic removal of activation beads. We used a duplex (crRNA:tracrRNA) guide RNA format, which was generated by annealing at equimolar concentrations to form the duplex at 95 °C for 5 min. RNPs were then formed by combining precomplexed duplex (crRNA:tracrRNA) with Hifi Cas9 Nuclease V3 (IDT) at a molar ratio of 3:1 and incubating them 10 min at room temperature. Nucleofection was done with P3 Primary Cell 4D-Nuleofector® X kit S adding between 2 x 106 cells with 10 pg of Cas9 in 5 pl of RNP and 20 pl of nucleofection solution. After electroporation using the EO-115 program (4D-Nucleofector Core Unit, Lonza), 200 pl of complete X-VIVO 15 with 500 lU/ml rhlL-2 was added to each reaction and cells were cultured at 32°C. After 16 h, cells were diluted in complete X-VIVO 15 with 500 lU/ml rhlL-2 at a concentration of 106 cells/ml. Cells were collected after 72 h (DO) to check KO efficiency, phenotyping, and in vitro restimulation with Dynabeads as above.
SUV39H1 inactivation efficiency was tested indirectly by looking into the levels of H3K9me3, which were reduced in SUV39H1-KO T cells produced from all 3 sorted populations.
Results
As illustrated in figure 1 , the results show that naive T cells from SUV39H1 -deficient mice show increased initial response, more particularly figure 1 D illustrates that naive T cells deficient for Suv39h1 exhibit and increased response at lower antigen load or at lower antigen affinity as compared to naive wild type T cells.
Effect of SUV39H1 inactivation in human naive T cells is illustrated on Figure 2. Total CD3- and naive-derived SUV39H1-KO T cells showed increased frequencies of memory CD45RO+CD27+ cells compared to mock T cells (Fig. 2C). In contrast, neither central memory- nor effector memory-derived T cells showed enrichment for memory T cells in SUV39H1-KO compared to mock (Fig. 2C). A week after stimulation with aCD3/aCD28 beads, naive-derived SUV39H1-KO were enriched in memory CD62L+ cells and depleted in exhausted TIM-3+PD-1 + cells, like total CD3-derived cells (Fig. D, E). In central memory-derived SUV39H1-KO cells, SUV39H1 inactivation had no effect on the proportions of memory/effector differentiation (Fig. 2 D, E). Effector memory-derived T cells (both mock and SUV39H1-KO) failed to survive after re- stimulation in vitro. These results indicate that SUV39H1 primarily contributes to heterochromatin formation at stem/memory loci in differentiating naive, but not in already committed central memory T cells.
Figure 3 shows that Suv39h1 deficient mice have increased memory population at homeostatic state, in particular the results shows that the numbers of central memory T cells (CD44+CD62L+) is increased in lymphoid organs (e.g., spleen, lymph nodes) while Effector Memory T cells (CD44+CD62L-) are more elevated in tissues (e.g., liver). Moreoever the results show an increased numbers of CD69+ tissues resident T cells in Suv39h1 KO mice.
Figure 4 provides in vivo evidence that Suv39h1 provides better protection in flu recall infections. In a model of Heterosubtypic flu infection, SUV39H1-KO CD8+ T cells expand faster and CD69+/CD103+ resident memory cells are increased following vaccination.
The inventors have further noted that decreased viral titer is decreased after vaccination upon Suv39h1 inhibition (data not shown).
Figures 5-9: Activation of CD8+ T cells leads to the differentiation of short-lived terminal effectors and long-lived memory precursors. Some of these memory precursors remain in lymphoid organs and become central memory T cells (TCM), while others home to non-lymphoid peripheral tissues early after antigen recognition and give rise to tissue resident memory T cells (TRM). The early stages of memory precursor differentiation into TCM and TRM remain poorly understood. The results included herein provide evidence that at steady state, during space-induced “homeostatic” expansion and after infection, deletion of SUV39H1 in CD8+ T cells leads to the accumulation of both TCM and TRM, in lymphoid and non-lymphoid tissues, respectively. In non-lymphoid tissues, these cells express CD49d and CD69 and single cell RNAseq analyses indicate that they differentiate from a transitional population of TRM precursors. Consistently, SUV39H1 -deficiency enhances TRM differentiation after adoptive transfer of effector cells into infected mice. Moreover, SUV39H1 -defective TRM that accumulated in lungs re-expand more strongly than WT controls after re-infection, and delay tumor growth more effectively than WT control TRM .
These results show that SUV39H1 deficiency in CD8+ T cells favors the differentiation of TRM precursors, which enhances TRM colonization and persistence in lungs and other peripheral non-lymphoid tissues.
SUV39H1 -deficiency ieads to the accumuiation of CD8+ tissue resident memory T cells (TRM) at steady state
The inventors have previously shown that SUV39H1 silences sternness genes during effector differentiation of CD8+ T cells upon Lysteria monocytogenes (Lm) infection20. During Lm infection in SUV39H1 KO mice, not only Lm.-specific TcM accumulate in the spleen, but also CD69+ CD8+ T cells accumulate in the liver. These results suggest that SUV39H1 deficiency, in addition to promoting TCM formation, may affect the differentiation of TRM cells. To investigate this possibility, the inventors first quantified CD8+ TRM in tissues at steady state in SUV39H1 -deficient mice and WT littermates. As shown before, TCM (CD62L+ CD44+) in lymphoid organs, including spleen and inguinal lymph nodes (iLN) accumulated among SUV39H1 -deficient CD8+ T cells. CD62L’ CD44+ CD8+, but not CD4+, T cells also accumulated in non-lymphoid organs, including the liver. They observed a similar increased accumulation of CD62L’ CD44+ CD8+ T cells in tissues of conditional SUV39H1flox/flox CD4-Cre mice (Cre+) mice compared to WT (Cre-) littermates (Fig 5 A). In contrast, these cells did not accumulate in the small intestines of SUV39H1flox/flox CD4-Cre+ mice, where the great majority of CD8+ T cells were CD62L CD44+ (Fig 5 A).
SUV39H1 KO mice did not show any defect in thymic T cell development (data not shown) and the number of naive CD8+ T cells in lymphoid organs were like those in WT mice, suggesting normal T cell development. Accumulation of CD62L’ CD44+ cells in the liver was not dependent on the age of the animals (data not shown), excluding any possible effect of early aging on the accumulation of CD8+ T cells in tissues of SUV39H1-defficient mice7.
Unsupervised analysis of expression of memory and resident memory markers by flow cytometry (not shown) reveals that SUV39H1 -deficient cells express higher levels of the TRM marker CD69 and the integrins CD49d and CD49a, while expression of the circulatory marker Ly6c and the terminal effector marker CX3CR1 were low. Proportions and numbers of both CD69+ CD103’ and CD49d+ Ly6c_ CD8+ T cells were increased in livers of conditional SUV39H1 -deficient mice as compared to WT littermates (Fig 5 B). To further validate tissue residency of these cells, as opposed to blood contaminating cells, the inventors stained cells intravascularly (iv) with anti- CD45.2 mAbs for 5’ before mice euthanasia32. The extravascular (iv-) fraction of lung tissue CD8+ T cells was increased in conditional SUV39H1 KO mice, both in percentage and cell numbers per organ (Fig 5 C). Moreover, the iv- fraction from SUV39H1-defficient mice was enriched in CD69+ CD103’ and CD49d+ Ly6c_ cells like in the liver. Altogether these results suggest that lack of SUV39H1 has a T cell intrinsic effect on CD8+ TRM accumulation.
To firmly establish that these cells are bona fide TRM, the inventors next purified CD69+ Ly6c TRM from the liver of both WT (Cre-) and conditional SUV39H1-defficient mice (Cre+) and used RNAseq and TCRseq to analyze gene expression and TCR clonality. Both SUV39H1 sufficient and deficient TRM displayed high levels of computed TRM signatures, showing no differences when comparing signature enrichment between Cre- and Cre+ cells, , and showed very similar list of upregulated genes compared to naive CD8+ T cells. TCR-beta sequencing analysis of liver TRM (CD69+ Ly6c_) showed no increase in clonality among SUV39H1 -deficient cells (compared to WT cells, data not shown), indicating that accumulation of TRM in tissues is not due to increased clonal size. Altogether these results show that SUV39H1 -deficiency leads to the accumulation of bona fide CD8+ CD69+ CD103’ TRM cells at steady state.
Lack of SUV39H1 promotes tissue homing and CD8+ TRM ceiis differentiation from naive ceiis
To evaluate the intrinsic role of SUV39H1 in CD8+ T cell tissue homing and TRM differentiation, the inventors adoptively transferred naive WT and SUV39H1 -deficient OT-I CD8+ T cells at a 1 :1 ratio into lymphopenic RAG-KO mice (Fig 6 A). Transferring naive CD8+ T cells into lymphopenic hosts induces their expansion and promotes differentiation of TRM cells in the gut after 27 days33. Between 33 and 35 days after transfer, SUV39H1-defficient cells accumulate up to 10 times more than WT cells in non-lymphoid organs. The KO:WT ratio was slightly over 1 in lymphoid organs, indicating a clear bias of SUV39H1 -defective T cells for homing to non-lymphoid tissues, compared to lymphoid organs. Like at steady state, SUV39H1 -deficient OT-I cells accumulated more than WT cells in the iv- compartment of the lung upon space- induced “homeostatic” proliferation (Fig 6 B). Both percentages and numbers of CD49d+ Ly6c_ cells were higher among SUV39H1 -deficient OT-I cells in all tested organs. Like at steady state, CD49d+ Ly6c_ cells in iv- lung compartments expressed high levels of CD69 both in WT and KO cells, further suggesting that this population is enriched in TRM cells (Fig 6 D). These results show that SUV39H1 -deficiency in CD8+ naive T cells promotes the differentiation of CD49d-expressing TRM .
CD8+ TRM differentiation upon flu infection is enhanced in the absence of SUV39H1
The inventors next investigated the role of SUV39H1 in CD8+ TRM formation after flu infection, a well-stablished model of TRM differentiation in vivo34 35 36. In lungs of flu- infected mice, the extravascular (iv-) proportion of CD8+ T cells was increased as compared to uninfected mice (not shown). No differences were observed between SUV39H1 -deficient and sufficient T cells. Among these flu-induced lung-homing cells, however, they observed an accumulation of CD69+ CD103’ TRM CD8+ T cells in SUV39H1 -deficient mice, 35 days after PR8 flu infection.
To evaluate the functionality of the SUV39H1 KO TRM cells in lungs after flu infection, the inventors made use of an heterosubtypic flu infection model in which protection to secondary infection is dependent on CD8+ TRM cells34 35 (Fig 7 A). Mice were rechallenged 28 days after the first infection to avoid waning of the TRM population in the lungs, which depends on the replenishment by circulating TEM cells35. They observed an accumulation of CD49d+ Ly6c_ among the extravascular (iv-) CD8+ T cells in the lungs of conditional SUV39H1 KO (Ore-) mice, 28 days after X31 infection (Fig 7 B). These cells also express high levels of CD127 and CXCR3, and low levels of KLRG1 , suggesting that they constitute true memory, rather than long-lived effector populations. Three days after the secondary infection with PR8 flu, an overall accumulation of CD8+ T cells was observed in the lung tissue (iv-), and an increase in the numbers of CD49d+ Ly6c_ and CD69+ CD103’ CD8+ T cells among CD44+ iv- cells (Fig 7 C).
Finally, the inventors also observed relatively lower viral loads in the lungs of SUV39H1 conditional KO mice 3 days after PR8 secondary infection, compared to WT littermates in mice that were previously infected with X31 flu strain. Altogether these results suggest that SUV39H 1 -deficiency promotes the formation of protective CD49d+ CD69+ CD8+ TRM cells upon flu infection. CITE-seq analysis of lung-homing CD8+ T cells
To further characterize SUV39H1-KO T cells homing to tissues, the inventors used CITE-seq analysis of sorted cells from lungs of RAG-KO mice that had received WT and SUV39H1-KO OT-I cells (as in Fig 6.). To obtain sufficient cells for the analysis of all populations, they mixed equal numbers of cells from WT and KO genotypes (expressing distinct congenic markers CD45.1 and 2), coming from the iv+ or iv- fractions. They used hashtag-coupled antibody staining to deconvolute the 4 populations (WT iv+, WT iv-, KO iv+, KO iv-), and they also stained all cells with hashtag-coupled antibodies for CD62L, CD44, CD49d, Ly6c, CD69 and CD103 to evaluate protein expression of these markers. The inventors then performed scRNA- seq using the 10x Genomics Chromium platform. In total, they obtained 4807 cells after removing non-T cell contaminants, low-quality cells, doublets, and cells with no hashtag identification. Unsupervised clustering partitioned cells into 9 clusters based on their transcriptome. They used differential gene expression analyses and analyses of canonical marker genes and gene signatures to assign identities to the different clusters. Clusters were named after their class and most differentially expressed gene. They identified one cluster of cycling cells (Cycling Mki67), four clusters of central memory cells (TCM CCR7 a-c and TCM Jun), three clusters of effector cells (TEW Lgals3, CTL GzmA and TEW CD49d), and one cluster of resident memory cells (TRM Rbpj) (Fig 4 A). TCM cells were separated from TEW and TRM cells on the Uniform Manifold Approximation and Projection (UMAP) dimensional reduction plot.
The top 5 upregulated genes in TCM clusters (TCM CCR7 a-c and TCM Jun) include Foxpl , Sell, CCR7 and Ly6c2 -encoding Ly6c, except for TCM CCR7 a-. Cluster TCM Jun also expresses Fos and CD69, probably reflecting recent activation. This cluster also upregulated Klf2, a transcription factor expressed in recirculating cells37. The cytotoxic CTL GzmA cluster expresses markers of cytotoxic effectors, like granzyme A and B (Gzma, Gzmb), CX3CR1 and interferon gamma (Ifng). Also, effector cluster TEW Lgals3 expresses effector (Ifng) and terminal effector markers such as Klrcl and Klrkl , encoding NKG2D. In addition, they found Itga4 (encoding CD49d) among the top 5 upregulated genes in effector cluster TEW CD49d. This cluster also expresses high levels of effector and memory markers such as Ccl5, Eomes and Tox as well as Gzmk and Nr4a2. Among these genes, some are also implicated in TRM differentiation, such as Nr4a211, or TRM maintenance, such as Eomes38. Additionally, some of these genes are also upregulated upon TCR-dependent cell activation, like Tox and Eomes39 40. Among the top 5 upregulated genes in TRM Rbpj cells are Rbpj36, Cxcr612 and Pdcdl (encoding PD116), all markers of bona fide TRM cells, and RGS1 , a G protein regulator that is involved in inhibition of T cell trafficking to lymph nodes41). Additionally, cluster TRM Rbpj expresses high levels of TRM signatures from the literature. Other typic markers of TRM cells like Hobbit (Zfp683), Blimp-1 (Prdml ) or CD103 (Itgae) were not detected at the RNA level in our dataset. To further evaluate the identity of this cluster, the inventors analyzed transcription factors (TF) activity using Single-Cell rEgulatory Network Inference and Clustering (SCENIC42). Among the 10 the highest fold-changes in TF activity (regulons) for each cluster, they identified several active regulons in TRM Rbpj cells that are related to TRM biology. Among these regulons is Srebp2, recently involved in the metabolic adaptation of TRM cells43; the AP-1 family members Fosb, Fos, Jund and Jun, highly expressed in TRM cells361644; and Prmdl 12 -encoding for BLIMP1- Runx313, Tbx2145 -encoding for Tbet-, and Irf446 all having roles in TRM formation and maintenance.
Regarding the expression levels of their protein markers, TRM Rbpj, TEA CD49d, as well as TEW Lgals3, and Cycling Mki67 clusters, all express high levels of CD49d and low levels of Ly6c proteins, as detected by hashtag-coupled antibodies. In addition, even though Cd69, encoding CD69, was expressed at low RNA levels in cluster TRM Rbpj (Fig 4 B), it was highly expressed at the protein level (not shown). Finally, as expected, cluster TRM Rbpj is specific of lung extravascular compartments (iv-)(Fig 7 C and D). Consistent with previous results, both TRM Rbpj and TEW CD49d clusters were among the most overrepresented in KO cells (together with the minor cytotoxic cluster CTL GzmA), compared to WT cells.
Altogether, these results show that SUV39H1 deficiency leads to accumulation of CD8+ TRM cells in lungs, suggesting that epigenetic silencing by SUV39H1 restrains the formation of CD8+ T RM and/or T RM precursor cells in a cell intrinsic manner.
SUV39H1 regulates the developmental pathway of TRM cells
To investigate a possible role of SUV39H1 in the differentiation of TRM precursors, the inventors performed trajectory analysis using 2 different algorithms, Slingshot47 and Scvelo48. Both analyses suggested a differentiation trajectory starting with TCM CCR7 clusters, which differentiate into TEff CD49d. TEW CD49d represent a branching point to the two final differentiation branches that would then drive to either TEW Lgasl3 and CTL GzmA or TRM Rbpj. The majority of the top 50 genes varying the most along the trajectory ordered by Slingshot pseudo-time, are shared between TRM Rbpj and the three effector clusters (TEW Lgals3, TEW CD49d and CTL GzmA;). Some of these genes (CD3g, Itga4, GzmK and Tox) are shared by TEW CD49d and TRM Rbpj, but not by the other effector clusters. Altogether, these results suggest that TEW CD49d cells are enriched in TRM precursors. This hypothesis is consistent with most cycling cells being related to TEW CD49d cluster, as suggested by label transfer of cycling cells into other clusters (using Seurat label transfer method).
To evaluate if the TEW CD49d cluster is enriched in TRM precursors, the inventors used the Cytotrace score, a proxy for sternness as a function of gene expression diversity per cell49. The Cytotrace score for cluster TEW CD49d showed bimodal distribution, suggesting the presence of a high sternness subcluster among TEW CD49d cells. To further explore this possibility, they computed the Silhouette score for each cell, a parameter that indicates how well assigned to its cluster each cell is. This score can be used to estimate if a cluster represents a defined stable cluster (high Silhouette score), or a transitional state between two stable clusters (low Silhouette score). At 0.8 resolution, all clusters have high Silhouette scores. Nevertheless, at higher resolution (1.2), TEW CD49d, resolved into 2 clusters, one of which has lower Silhouette score than all other clusters, suggesting that these cells are transitional (i.e. in transition between two stable states). This transitional cluster share genes with TEW CD49d cells, including Itga4, Eomes and Nr4a2. Some of the upregulated genes in the TEW transitional cluster, including Eomes and Slamf6, are also upregulated in TRM precursors11.
Slingshot analysis at this higher resolution indicates that TEW transitional cluster differentiates into TRM (TRM Rbpj or TRM CD103) and circulatory effector clusters (TEW Lgals3 and CTL GzmA). Likewise, Cytotrace analysis at 1 .2 resolution showed that the TEW transitional cluster has higher sternness score than all other effector and TRM clusters. Altogether these results indicate that the TEW CD49 cluster includes transitional cells with features of TRM precursors. Even though cluster TEA transitional was not overrepresented in SUV39H1 -deficient samples, computation of the original proportions of cells in lungs before sorting (see Methods) showed that the majority of TEW transitional cells in lungs were deficient for SUV39H1. Altogether these results suggest that CD49d-expressing TRM precursors accumulate in the absence of SUV39H1 expression.
TRM precursors differentiation is increased in the absence of SUV39H1
To investigate if cells that accumulate in tissues in the absence of SUV39H1 have increased TRM precursor potential, the inventors transferred WT and SUV39H1- defficeint naive OT-I cells in a 1 :1 ratio into B6 mice and then infected the mice with the flu strain X31 expressing the SIINFEKL peptide (X31-0VA, Fig 5 A). 30 days after infection, CD69+ CD103’ TRM cells accumulated among SUV39H1-KO OT-I cells in lungs (Fig 8 B), reminiscent of what we have seen ex-vivo at steady state (Fig 1 ) and after flu infection. They also found an increase in CD69+ CD103+ numbers, but not proportions, among SUV39H1 -deficient OT-I cells compared to WT control cells (Fig 8 B). SUV39H1-KO cells expressing CD49d accumulated in the lungs during the effector phase of the infection (Fig 8 C). Also, cells expressing CD49d and low levels of Ly6c were enriched in CD69+ KLRGT and CD49a+ CX3CRT cells, both expressed in TRM precursors139 (Fig 8 C). They also observed an increase in CD49a+ CX3CR1- cells among liver-homing CD8+ T cells at steady state. Altogether these results suggest that SUV39H1-defficiency leads to accumulation of TRM precursors both at steady state and during the effector phase of flu infection.
To formally test if SUV39H1 KO enhances TRM precursor function, WT and KO OTI cells from the intravascular (iv-) compartment of the lung were FACS-sorted 9 days after X31-OVA infection and adoptively transferred intravenously at 1 :1 ratio into recipient mice previously infected with X31-OVA (Fig. 8 D). After 28 days, mice had higher proportions of SUV39H1 -deficient OT-I cells, compared to WT cells, among CD69+ CD103’ CD8+ T cells in the iv- compartment of the lung (Fig 8 E). These findings show that SUV39H1 -deficient CD8+ T cells homing to the lungs during the acute phase of infection are enriched in TRM precursors compared to WT cells.
SUV39H1 deficient TRM CD8+ T cells delay lung tumor metastasis growth
The results presented so far show that SUV39H1 deficiency increases precursor frequency and TRM colonization in lungs, both, after Flu infection (Fig 7) and during spaced-induced expansion in RAG KO mice (Fig 6).
To evaluate the protective potential of the TRM CD8+ T cells formed in the absence of SUV39H1 , the inventors transferred naive OT-I CD8+ T cells from SUV39H1-KO mice or WT littermates into RAG-KO mice. Between 33 and 35 days later, the inventors challenged the mice with an intravenous injection of B16-0VA cells expressing Luciferase (B16-OVA-Luc, Fig 9 A). The numbers of iv- CD8+ T cells in the lungs 33 days after transfer were similar in mice that received WT or SUV39H1 -KO OT-I cells (Fig 9 B), while SUV39H1-KO iv- cells were enriched in CD49d+ Ly6c_ cells, reminiscent of what was found in co-transfer experiments. Mice adoptively transferred with either WT or SUV39H1-KO OT-1 cells showed delayed B16-OVA-Luc growth as compared to mice that did not receive any OTI cells (Fig 9 C). In mice that received SUV39H1-KO OT-I cells, however, tumor growth delay was significantly stronger compared to mice bearing WT OT-I cells (Fig 9 C and D).
These results suggest that, even though the proportions of CD8+ T cells in the lung tissue were similar in WT and SUV39H1 KO mice, the increased proportions of CD8+ CD49d+TRM cells formed in the absence of SUV39H1 are more efficient delaying tumor growth, compared to WT TRM cells.
Discussion
The present results show that like TCM in lymphoid tissues, TRM numbers and proportions are increased in non-lymphoid tissues in absence of SUV39H1 expression. Increased presence of TRM occurs in different tissues, including lungs, liver, and small gut. It occurs at steady state, and after spaced-induced “homeostatic” expansion or Flu infection.
Then, what is the cellular mechanism underlying these differences: increased tissue colonization, TRM lifespan and /or tissue retention?
The effect of the SUV39H1 -defect was particularly strong in a model of competition between WT and KO T cells, in which SUV39H1 KO TRM surpassed WT TRM by 10- folds in small gut or liver colonization. In addition, scRNAseq analyses showed increased proportions of a population of TRM precursors in SUV39H1 KO cells homing to lungs compared to WT cells. Adoptive transfer of purified SUV39H1-defficient lung homing effectors to flu infected mice shows increased TRM colonization, indicating increased TRM precursor capacity in absence of SUV39H1 expression.
Altogether, these results show that TRM precursors colonize non-lymphoid tissues more efficiently in absence of SUV39H1 expression. Consistent with this interpretation, no evidence was observed that SUV39H1 KO affects T cell survival or expansion in tissues (no differences in apoptosis signatures or in dividing T cell populations in the single cell analyses). Increased precursor differentiation and tissue colonization are also consistent with the observed increased expression of CD49d in SUV39H1 KO T cells, an adhesion molecule involved in the trans-migration of T cells from blood to tissues53.
At the molecular level, these results provide evidence that H3K9 trimethylation by SUV39H1 plays a critical role in the control of the balance between effector and memory differentiation. The results presented also show a similar mechanism for SUV39H1 in the control of TRM differentiation: some of the loci that are silenced by SUV39H1 during the differentiation of short-lived effectors, like IL-7R, could promote TRM differentiation in absence of SUV39H1 expression. Therefore, the epigenetic pathways that control TCM and TRM share some fundamental control mechanisms.
Adoptive transfer of SUV39H1 -deficient cells in the peak of the infection have both higher potentials to become TRM (Fig 8 D) and TCM20 suggesting that TCM and TRM have common precursors. As shown here, SUV39H1 ablation, increases the formation of TRM precursors among tissue homing-effector cells, causing TRM cells accumulation in tissues. These TRM precursor cells express high levels of the integrin CD49d and other molecules found in TRM precursors by others, including CD49a, Slamf6, EOMES, CD69 and IL7R91011. The results presented here suggest that TRM and TCM precursors share epigenetic mechanisms of differentiation. This could be related to a common origin of TCM and TRM precursors. Alternatively, sternness gene repression in effector cells by SUV39H1 could counteract both TCM and TRM precursors independently.
TRM populations in tissues are heterogenous. CD103+ CD8+ TRM cells locate to epithelial structures, while CD103’ TRM cells home to the stroma2. Also, recent work shows that CD103- TRM cells can replenish the CD103+ TRM pool upon re-infection. The TRM accumulation observed in absence of SUV39H1 expression mostly concerns CD103’ TRM, suggesting that SUV39H1 KO can promote the differentiation of CD69+CD103’ or reduce the transition to CD103+ TRM cells. In any case, over representation of CD49d+ Ly6c_ TRM in SUV39H1-KO is consistent with increased tissue homing (due to increased CD49d expression) and reduced lymphoid homing (due to reduced Ly6c expression).
Several studies focusing on epigenetic changes during TRM differentiation have described both common and tissue specific regulatory networks and key transcription factors directing the generation and maintenance of the TRM linage. However, the role of specific epigenetic regulators and chromatin modifiers in TRM formation is largely unknown. McDonald et al, found that the canonical BAF complex, crucial for nucleosome reorganization during novel enhancer establishment, was necessary for late-stage differentiation of TRM cells but was dispensable for circulatory memory formation18. The role of SUV39H1 in TRM differentiation, seems to be the opposite to BAF. It is possible that SUV39H1 is necessary to silence specific enhancers during effector differentiation, leading to enhanced TCM and TRM differentiation in absence of SUV39H1.
Previous work from the inventors also showed that SUV39H1 -deficiency in CAR-T cells improve anti-tumor efficacy31. This effect was linked to less exhaustion and higher memory persistence in the absence of SUV39H1. On the contrary, the capacity of memory SUV39H1 -deficient cells to prevent bloodborne Listeria monocytogenes re- infection was reduced compared to WT cells20.
The inventors now further provide evidence that CD8+ TRM formed in the absence of SUV39H1 show higher efficacy to control reinfection. Also, SUV39H1 -deficient TRM cells formed in lungs were able to longer delay tumor metastases growth compared to WT TRM cells.
These results therefore show that the increase in TRM cell differentiation in absence of SUV39H1 improves the efficacy of memory immune responses in tissues, both against tumors and infections.
Altogether the present results provide evidence that inhibition of expression or function of SUV39H1 in T cells can promote efficient immune responses in the context of both adoptive and non-adoptive immunotherapies.
References
1. Kok, L., Masopust, D. & Schumacher, T. N. The precursors of CD8+ tissue resident memory T cells: from lymphoid organs to infected tissues. Nat Rev Immunol 22, 283-293 (2022).
2. Mueller, S. & Mackay, L. Tissue-resident memory T cells: local specialists in immune defence. Nat Rev Immunol 16, 79-89 (2015).
3. Heeg, M. & Goldrath, A. W. Insights into phenotypic and functional CD8 + T RM heterogeneity. Immunological Reviews imr.13218 (2023) doi:10.1111/imr.13218.
4. McMaster, S. R. et al. Memory T Cells Generated by Prior Exposure to Influenza Cross React with the Novel H7N9 Influenza Virus and Confer Protective Heterosubtypic Immunity. PLoS ONE 10, e0115725 (2015). 5. Schenkel, J. M. etal. Resident memory CD8 T cells trigger protective innate and adaptive immune responses. 1254536 (2014).
6. Ariotti, S. et al. Skin-resident memory CD8 + T cells trigger a state of tissue-wide pathogen alert. Science 346, 101-105 (2014).
7. Wijeyesinghe, S. et al. Expansible residence decentralizes immune homeostasis. Nature (2021 ) doi:10.1038/s41586-021-03351-3.
8. Dijkgraaf, F. E., Kok, L. & Schumacher, T. N. M. Formation of Tissue-Resident CD8 + T-Cell Memory. Cold Spring Harb Perspect Biol a038117 (2021) doi: 10.1101/cshperspect.a038117.
9. Parga-Vidal, L. et al. Hobit identifies tissue-resident memory T cell precursors that are regulated by Eomes. Sci. Immunol. 6, eabg3533 (2021 ).
10. Milner, J. J. et al. Heterogenous Populations of Tissue-Resident CD8+ T Cells Are Generated in Response to Infection and Malignancy. Immunity 52, 808-824. e7 (2020).
11. Kurd, N. S. etal. Early precursors and molecular determinants of tissue-resident memory CD8 + T lymphocytes revealed by single-cell RNA sequencing. Sci. Immunol. 5, eaaz6894 (2020).
12. Mackay, L. K. et al. Hobit and Blimpl instruct a universal transcriptional program of tissue residency in lymphocytes. Science 352, 459-463 (2016).
13. Milner, J. et al. Runx3 programs CD8+ T cell residency in non-lymphoid tissues and tumours. Nature 552, 253 (2017).
14. Henning, A., Roychoudhuri, R. & Restifo, N. Epigenetic control of CD8+ T cell differentiation. Nat Rev Immunol 18, 340 (2018).
15. Pace, L. & Amigorena, S. Epigenetics of T cell fate decision. Current Opinion in Immunology 63, 43-50 (2020).
16. Crowl, J. T. Tissue-resident memory CD8+ T cells possess unique transcriptional, epigenetic and functional adaptations to different tissue environments. Nature Immunology 31 .
17. Kok, L. et al. A committed tissue-resident memory T cell precursor within the circulating CD8+ effector T cell pool. Journal of Experimental Medicine 217, e20191711 (2020). 18. McDonald, B. et al. Canonical BAF complex activity shapes the enhancer landscape that licenses CD8+ T cell effector and memory fates. Immunity 56, 1303- 1319.e5 (2023).
19. Strahl, B. D. & Allis, C. D. The language of covalent histone modiOcations. 403, (2000).
20. Pace, L. et al. The epigenetic control of sternness in CD8+ T cell fate commitment. Science 359, 177-186 (2018).
21. Crompton, J. G. et al. Lineage relationship of CD81 T cell subsets is revealed by progressive changes in the epigenetic landscape. Molecular Immunology.
22. Allan, R. S. et al. An epigenetic silencing pathway controlling T helper 2 cell lineage commitment. Nature 487, 249-253 (2012).
23. Rea, S., Eisenhaber, F., Ponting, C. P., Allis, C. D. & Jenuwein, T. Regulation of chromatin structure by site-speci®c histone H3 methyltransferases. 406, (2000).
24. Fodor, B. D., Shukeir, N., Reuter, G. & Jenuwein, T. Mammalian Su ( var ) Genes in Chromatin Control. Annu. Rev. Cell Dev. Biol. 26, 471-501 (2010).
25. Allis, C. D. & Jenuwein, T. The molecular hallmarks of epigenetic control. Nat Rev Genet 17, 487-500 (2016).
26. Probst, A. V., Dunleavy, E. & Almouzni, G. Epigenetic inheritance during the cell cycle. Nat Rev Mol Cell Biol 10, 192-206 (2009).
27. Wang, C. et al. Reprogramming of H3K9me3-dependent heterochromatin during mammalian embryo development. Nat Cell Biol 20, 620-631 (2018).
28. Nicetto, D. et al. H3K9me3-heterochromatin loss at protein-coding genes enables developmental lineage specification. Science 363, 294-297 (2019).
29. Becker, J. S. et al. Genomic and Proteomic Resolution of Heterochromatin and Its Restriction of Alternate Fate Genes. Molecular Cell 68, 1023-1037. e15 (2017).
30. Niborski, L. L. et al. CD8+T cell responsiveness to anti-PD-1 is epigenetically regulated by Suv39h1 in melanomas. Nat Commun 13, 3739 (2022).
31 . Lopez-Cobo, S. et al. SUV39H1 Ablation Enhances Long-term CAR T Function in Solid Tumors. Cancer Discovery 14, 120-141 (2024).
32. Anderson, K. et al. Intravascular staining for discrimination of vascular and tissue leukocytes. Nat Protec t, nprot.2014.005 (2014).
33. Casey, K. et al. Antigen-Independent Differentiation and Maintenance of Effector-like Resident Memory T Cells in Tissues. J Immunol 188, 4866-4875 (2012). 34. Wu, T., Hu, Y., Lee, Y. & of leukocyte ... B.-K. Lung-resident memory CD8 T cells (TRM) are indispensable for optimal cross-protection against pulmonary virus infection. Journal of leukocyte ... (2014) doi:10.1189/jlb.O313180.
35. Slutter, B. et al. Dynamics of influenza-induced lung-resident memory T cells underlie waning heterosubtypic immunity. Sci Immunol 2, eaag2031 (2017).
36. Hombrink, P. etal. Programs for the persistence, vigilance and control of human CD8+ lung-resident memory T cells. Nat Immunol 17, 1467-1478 (2016).
37. Skon, C. et al. Transcriptional downregulation of S1 pr1 is required for the establishment of resident memory CD8+ T cells. Nat Immunol 14, 1285-1293 (2013).
38. Lin, Y. H. et al. Small intestine and colon tissue-resident memory CD8+ T cells exhibit molecular heterogeneity and differential dependence on Eomes. Immunity S1074761322006434 (2022) doi:10.1016/j.immuni.2022.12.007.
39. Scott, A. C. et al. TOX is a critical regulator of tumour-specific T cell differentiation. Nature 571, 270-274 (2019).
40. Knudson, K. M., Goplen, N. P., Cunningham, C. A., Daniels, M. A. & Teixeiro, E. Low-Affinity T Cells Are Programmed to Maintain Normal Primary Responses but Are Impaired in Their Recall to Low-Affinity Ligands. Cell Reports 4, 554-565 (2013).
41. Gibbons, D. L. et al. Cutting Edge: Regulator of G Protein Signaling-1 Selectively Regulates Gut T Cell Trafficking and Colitic Potential. The Journal of Immunology 187, 2067-2071 (2011 ).
42. Aibar, S. et al. SCENIC: single-cell regulatory network inference and clustering. Nat Methods 14, 1083-1086 (2017).
43. Reina-Campos, M. etal. Metabolic programs of T cell tissue residency empower tumour immunity. Nature 621, 179-187 (2023).
44. Chen, Y., Shen, J., Kasmani, M. Y., Topchyan, P. & Cui, W. Single-Cell Transcriptomics Reveals Core Regulatory Programs That Determine the Heterogeneity of Circulating and Tissue-Resident Memory CD8+ T Cells. Cells 10, 2143 (2021 ).
45. Mackay, L. K. et al. T-box Transcription Factors Combine with the Cytokines TGF-p and IL-15 to Control Tissue-Resident Memory T Cell Fate. Immunity 43, HOI- 1111 (2015).
46. Harberts, A. et al. Interferon regulatory factor 4 controls effector functions of CD8 + memory T cells. Proc. Natl. Acad. Sci. U.S.A. 118, e2014553118 (2021 ). M . Street, K. et al. Slingshot: cell lineage and pseudotime inference for single-cell transcriptomics. Bmc Genomics 19, 477 (2018).
48. Bergen, V., Lange, M., Peidli, S., Wolf, F. A. & Theis, F. J. Generalizing RNA velocity to transient cell states through dynamical modeling. Nat Biotechnol 38, 1408- 1414 (2020).
49. Gulati, G. S. et al. Single-cell transcriptional diversity is a hallmark of developmental potential. Science 367, 405-411 (2020).
50. Chang, J. T., Wherry, E. J. & Goldrath, A. W. Molecular regulation of effector and memory T cell differentiation. Nat Immunol 15, 1104-1115 (2014).
51 . Kaech, S. M. & Cui, W. Transcriptional control of effector and memory CD8+ T cell differentiation. Nat Rev Immunol 12, 749-761 (2012).
52. Mackay, L. K. et al. The developmental pathway for CD103(+)CD8+ tissueresident memory T cells of skin. Nat. Immunol. 14, 1294-301 (2013).
53. Siegelman, M. H., Stanescu, D. & Estess, P. The CD44-initiated pathway of T- cell extravasation uses VLA-4 but not LFA-1 for firm adhesion. J. Clin. Invest. 105, 683-691 (2000).
54. Takamura, S. Divergence of Tissue-Memory T Cells: Distribution and Function- Based Classification. Cold Spring Harb Perspect Biol 12, a037762 (2020).
55. Fung, H. Y., Teryek, M., Lemenze, A. D. & Bergsbaken, T. CD103 fate mapping reveals that intestinal CD103 " tissue-resident memory T cells are the primary responders to secondary infection. Sci. Immunol. 7, eabl9925 (2022).
56. Von Hoesslin, M. et al. Secondary infections rejuvenate the intestinal CD103 + tissue-resident memory T cell pool. Sci. Immunol. 7, eabp9553 (2022).
57. Jensen, I. J. & Farber, D. L. Gutsy memory T cells stand their ground against pathogens. Sci. Immunol. 7, eade7168 (2022).
58. Buquicchio, F. A. et al. A Unique Epigenomic Landscape Defines CD8 + Tissue- Resident Memory T Cells, http://biorxiv.org/lookup/doi/10.1101/2022.05.04.490680 (2022) doi:10.1101/2022.05.04.490680.
59. Hayward, S. L. et al. Environmental cues regulate epigenetic reprogramming of airway-resident memory CD8+ T cells. Nat Immunol 21, 309-320 (2020).
60. Peters, A. H. F. M. et al. Loss of the Suv39h Histone Methyltransferases Impairs Mammalian Heterochromatin and Genome Stability. Cell 107, 323-337 (2001 ). 61 . Malissen, M. et al. Altered T cell development in mice with a targeted mutation of the CD3-epsilon gene. The EMBO Journal 14, 4641-4653 (1995).
62. Jenkins, M. R., Webby, R., Doherty, P. C. & Turner, S. J. Addition of a Prominent Epitope Affects Influenza A Virus-Specific CD8 + T Cell Immunodominance Hierarchies When Antigen Is Limiting. J Immunol 177, 2917-2925 (2006).
63. Pertoft, H., Laurent, T. C., Laas, T. & Kagedal, L. Density gradients prepared from colloidal silica particles coated by polyvinylpyrrolidone (Percoll). Analytical Biochemistry 88, 271-282 (1978).
Sequences
• SEQ ID NO: 1
GCTCTTCTCGCGAGGCCGGCTAGGCCCGAATGTCGTTAGCCGTGGGGAAAGATGGCGGAAAATTTAAAAG
GTGAAGCAGTGGAGGCAGAGGCGCGGGCCCGCTGGCCGGGCCGGGTGGGCTGGAGGGGTGGCGTTGCCGG
CTCGGGGCCCCGGCGTCCGAGGCCCCGGCGCCGGGAGCCGGAAGCTCGGCGCGGAAAGGATGAGGCTCGG
GGAGCGCGGGCCTGGTGCGCGGGGCTGGGCGGGGCTCAGGGGAGGGGGCGCGCGCCTCGGAACGCAGCGG
GCCTGGGGCTAAGTGGGGACGCAGGAGGGGGGCGCGCGCTGCAGATCGCGGCCGGACCGGCGCGCGCACG
CGCGGGGGCTTGTCGAGGAGGCCGCGCCCGCGCGCGGGAAAATCGGCCCCTGGTGACCGTTACCCATTCG
GTGTCCACGCGAGACGCCGGAAGGGGAGGGAAGATAAGGGGGACAGACCCCCCCTTCAGAGTGCGGGGAC
TGAGAACTCTTCTGGGGGAAAGTATCGCCTCTCGGCGTGATGGGGGAAGGGTTTGGAATAGAGGATCTCC
CAGAAGAGAGAAATGGGGCCTTCCTAATAGGACAGCTGGACTCCCCCATGTGCAGGGAAAGAGGGGTGAC
TCAGTTATGTTGGGGGGCCCCTCTATGTGACGAAAGCCGCAGGGAGGATGGGTTCCACAAGTGGGAGGAC
CTCTGAGGGGTTCAGGAGAGTCCACCTGTGGCCAGTTCCGGAGCCAGCAGCTGGAGGGTGTTAATTGGGA
CCACTTAAGTGGGGTTTCAAATGCAAGTGAAGGAAGGGGTTTGCGAGGACAGGCTGTAGGGAGAGGAAAG
CGTGGGCACAGGCGGGCTCAGTCTCCACTTGGTCTTGCCTAAGTAGGGGGGGTAGGGCTTGCACACGAAA
TAATTTTGAAAAGCTCTTGTACGTTTTTAGGTTGACATCTAAAGTTTAGGTGTGATTTTTGCAATGGGAG
GCAGAAAATATTAAACATTTTAAAAAGATGATATAGGATGAGGACTGACTGCCCTTGGAATGTTTTGAGA
CATGATTTGATAAAATGGCTTCTAAAGTACTTTGATTAAGAATGTGCCTTGAATCAGAAAGAAATCTGTT
TTTTAAAATCCGTGTGTCTTACAAAATTTTGGCAGTCCCAGAAATATACCAGGTATATTTAAAAGAATCA
GTGTCACTAATCTGTACCGCTTTGCGTATAAATTCAGAGCATAACCCTTTGGATGAGCTTTACTCTTCAC
AGAAAGATGGATGAGACAGAAAGTCAAAATGCAGTGTGAAAAAATATACCTTGTGGATTTAAGGCACCCA
GATTGATCATTTAAGGAGCCTTCCTGTAATGTAGTATCATTCCACAATCTCTTGCTCATAATTCCGAAAT
CTAAAAAGCCCTGAAAACTGAAATCCTTTTCTTAAATTTGGCACCATTTATGGCAAAAGTAGATTATAAA
GTGGAACTCTTCTGTGAGGCTATTTTATATCTCTATTTCTCCTATTTAATGTGGGAAATTCATACTTTTG
CTGCAGGACGGTTAATGCATTTGATTATAGCTTGATGTCCCCTGGCCACGCTGGGGGTGTTAGGTGATGT
ATGGGATATCCTAGAACTAGTCTTGTAAAATCCAAAAAATTTTGAATTCCAAAACACATCTGGCCCAGGA
GTTTGAGATAAGGGATTAAAGACCAGTCTTTCCAGTTACGCCTTTGTTTGGTGCCCTGGAGGTTTTAATC
TTGTCCTCCCATCCGCCCCACCTCGGGGCACTGCATCCTACTGAGATGGGGGGTTGTTCTCTTTCTTTTG
CAAAGTGGAGAGAGGGGTGATCAGGTCCTGAACCCAAAGCAGGTTTGCAGGCAGTTTTAGGAATGACATG
GAGTTTGAAGCTCTGGAAATAGATTCCTTTAGGACAATTCATGTTGCAAACCCCGCTTAGAGGTCTGCTG
CTCCAGGGGCAGCTTTGGGCAGTGAGTATTGGGGTTCAAAGCACATTTCTGTTGTAGAACAGTCTCAGCA
CTGGGGAAGGCCTGTGGATTAAATTTCCCTGACTCTTAGTCAGTCTTTGGGATGTCCCAGGGAGGATTTG
GGGTCCCCTTTGACTCCTGGCCTAGTCAGGCTGCCCAGTAATAGTTCTTTCTGCCCCGCTTGATCCAGGC
TGCAGCGTGTGTTGCAAGTCTTCTTGGAATCAGCTGCAGGACCTGTGCCGCCTGGCCAAGCTCTCCTGCC
CTGCCCTCGGTATCTCTAAGAGGAACCTCTATGACTTTGAAGTCGAGTACCTGTGCGATTACAAGAAGAT
CCGCGTGAGTCTGGGGTGACCATGCTCTGGGAGGGGACAGGTCACAAGGAAGTTAGTGTCCTGCCCTCTT
GTCCCCAACTGCCCACATCTGTTTCCAAAGGGAATTTTCTCCTTTGACCCTGAAAACACAGGATGAATAG
ACCCTTTTATCCCTATGTTACAGATAGGGAAACTAAGTAGCTTTCTGGGCAGGAGCCGGAATGAATTCCC
AAATAAATCTCTTCCCATCTCCCTAGGAATACAAAGTAATTGCAGAGATTGAGATGCTGAACCCTGGAGT
GGAAATGTCAATAGCTAATGGCTATTGAGCACTTTCAGTGTGCCAGGCGTTTCCTCTCGGAAACTCATTT
AATCCCCTAACAACTGAAATGGGGATAGTTATTGCCAGAAGGGGGAGTGGCAGGATGGTTAGGAGAACAA
ACTGGAGTCAGCATGCTTGGGTTCCAGTCCTGGTTGTGTTACCCCAGGCTACCTACCCAAACCTTCAGTA
CTTCATTTTCCTTGTCGTAAAAGAGGGATAACTAGGAGCATCTACCTCATGTGGGGTTGTGAGGATTAAG
TTAGTTAATAATACATGTAAGCTGCCTAGAACAGGCAAGGACTTGTCAGGGTCCAGGTGAGCCAGGGTGG
TGGCAGTGATGATGGTTTGTCACTGGACGTATTTTGAAGGTGGGGCCAACGGGATGTGCAGAGGGTGGGT
GTCGGAAGTGTGAACAAAAGAGAAGTCAAGGATGACTCCAGGAGTTCCGGTCTGAACAGCTAGAAGGGAG
GGAGCTGATGATGGGGAAGACCAAGGAGAGGAGTGGGTTTGGGAGATTAATTAAAAGTTGGAACAGTTTG
GACAGACAGTAAGGGGGAGAGGAGGATTTGAACCTAGTAATCCTCACTCTAGAGCCCATGCTTTTTAATC
ACCGCATGAAGTCATTCCAGAAAAGGGGTGGGGTGGGGTAGGTGTTATCCATCAGCTTTGGGATGGAAGC
CCCATGAAGGCTGGCCCAAAGATCTCACTACTTACGGTACCCCCGTCCCCCTACCCACCCCCAACAGGAA
CAGGAATATTACCTGGTGAAATGGCGTGGATATCCAGACTCAGAGAGCACCTGGGAGCCACGGCAGAATC
TCAAGTGTGTGCGTATCCTCAAGCAGTTCCACAAGGACTTAGAAAGGGAGCTGCTCCGGCGGCACCACCG
GTCAAAGACCCCCCGGCACCTGGACCCAAGCTTGGCCAACTACCTGGTGCAGAAGGCCAAGCAGAGGCGG
GCGCTCCGTCGCTGGGAGCAGGAGCTCAATGCCAAGCGCAGCCATCTGGGACGCATCACTGTAGAGAATG
AGGTGGACCTGGACGGCCCTCCGCGGGCCTTCGTGTACATCAATGAGTACCGTGTTGGTGAGGGCATCAC
CCTCAACCAGGTGGCTGTGGGCTGCGAGTGCCAGGACTGTCTGTGGGCACCCACTGGAGGCTGCTGCCCG
GGGGCGTCACTGCACAAGTTTGCCTACAATGACCAGGGCCAGGTGCGGCTTCGAGCCGGGCTGCCCATCT
ACGAGTGCAACTCCCGCTGCCGCTGCGGCTATGACTGCCCAAATCGTGTGGTACAGAAGGGTATCCGATA TGACCTCTGCATCTTCCGCACGGATGATGGGCGTGGCTGGGGCGTCCGCACCCTGGAGAAGATTCGCAAG AACAGCTTCGTCATGGAGTACGTGGGAGAGGTAGGGAGATGGGACCCGGTGTGTGTGTGCAGCTCTTCCC ACCCTGTGTTCACAGTGTGCACCCGGCTCTCCTCACTGTGTGTCTGAAACTCCCTGCTTTCCCTATGGGA AAGGCCTGGGAGACTGATCTGAGTGTCACAGGGACATTGGGCAGGGGCTAGTATTCCAAGCTGGTACACA CCAGCATGGCCATGCTGGTGGTTACAGGAACACCAAAATACTTCTGCACTGGGTTGACTTTATCAGGGTA CTTAGCAAAGAAGAAAAGTGGGAGCTGAGATCCAGGCAGCCTTAGCATTCCTTGTAACAGGCCATGTGGT CTGGCATAGGGCTGCATCAGCTGGAAAGGCACTTCCTCTTCTCATTTCACAAGGGCCCATCTTATCACCA AGCAGTATCTGCCTGAGGAGCATTGTTTTACCAGTCTGCACAGAAGGAACGCAGTCTGGAGTAGGATGAG ACATGCCTTGGACAAAGGTTGGCTAACTCCTTTAGACTTTCAGGACACTGGGGAAGGCCGAGTGTATTAG GCAAGCCAGCCATTGTAAAAACAACCCCCTCATCTTAGTGACTTTGCACATTACAAGTTTGCTTGCTCAT GGAACAGTCCATTGTGGGGGTTTGAGTGGGTATCCTTTCACACAGCAACTGGGACACCTAGGCTCTTTCC CTCCTGTGCCTTTGCTGTGCCTTGAAGCCTTGGAGTCACTACCAGATCCTCAGCATTGCCTGGCAGGCGG GCCAAGTGGGGGATAGAAGGGGCCCATCCTAGTGGGCCAGGCCTAGATGCAGCACCCATCACTTCTGCCC
ATGCTCCACTGGCTGGAACTGAGTCACTGGCCTTACCTCCATGCAAGAGAGGCAACAGGATGTGCTTTAG CCATGTGCCCAGCTGCACAAGGCTAAAGCACAGCCATAACTAGCAACTAGATAACTAGCAAGTATCTACA ACAGAAAAATGTCGCATTCTAAGATGGGATGCAGTTAGCATTTGGGATGAGATGATTTTTCGTTATGTAG AACTGTCTCATGCATTGGGGGACATTTAGCATCCCTGGACCTTGACCATTTAAATCCATGAGTGTGCCCT GTCATAGTGACAACCCCAGATACCTCTATATATAGCCATAGGTCCCTTAGGGGTGTGATATAGTTGGAAA GTGACAGAAACTGGCCTGAGGAACACTCACATGAGGGTGTCCACACTGTAGCACTGATACTGATGACAAG GAGAGGCTCCTACTCTGAGAAACTGTACAGAGGGTCACATCTGACAGGGACAGAGACAATCTTGGGTAGA ACAATCTACACCACAGAGGACCCTGACAGTCTGGGCAAGGAGACAGCCACACCCTGTCCAGATAACCCTG CTGGCCTGCTGGAGGAGATGTCTACATGCCACAGGACCTGGCCATCTGGAAGGAGGAGGTGGGGAGGTGT CCACACCCTGAGGGCTCCTGACAGTGGGCGGGGGAAGGAGTCCTGATAATCTGCAGGAAGTCCATGTCCC
ACAGTGACCCCAGTGACCTGGAGGAAGAGCTTGTGCTCTCCACACTCTAGAGGACCTGGTGGTCTGACTT AGGAAGTGTTCACACCCATGTTGTCATGACAGGAAAAAGAAGTGTCCTCACCCCAGAGGGATCCGGACAG CCTGGAGATCTAGTCTACACCCAAGGGCACCCTGACAGTATCGGGGGAAGTGTCCATGCCCTCAATGTCC TGACGCTCTGGAGGAAGTGTCCAGAGGTTGAAGGAACCCAAACTCTCTGGAGGAGATGTCCAGACCCCAT AGGACCCAGACAGTCCACCGTCCTAGGGGCTGCACAGAGCAGGAAGTATCTCAGCCTCACTGTACTGGCA TCTGGAGGAAACACTGTCTACCACACAGGGTCCTGACAGTCGAGGAGGAAGACTACACCCCAAGGGCAGC CTCAGACCCTCCTGGGCCTGAGACTTTTCTGGCTGCTCTTCCTTAGTGTCAGTGTCTTTAATCCTCCCAG GGATCCTCTCAGCCCTGTCCTCACCCTTCCTGCTCTCCACACATTCTTGCTGCACTATTTCCTGACCGCC CTCCAGCACCCTCAGACCCATGGGTCCTCCTGATGGTGCCACAGGCCTCCGGAAAGAGCCAAACTCATCT TCCCGCATTCCCCTCTGAAGAGACAGTATAGCAAATGGTTAGGAGGGTGGACTCTGGATCCTGACTGCCC GAGGCTGAATCCCAGCTCCACTACTCATCAGCAATCACTAACCTCTGTGCCTGCATTTACTATGTAAAAT GGGAACAATAATAGCACTCACCTCACAGGCTTGTTACAAAAATTAAATGAGTTACTATGTATCAAGCACT TGGAAAAAGCACTTGAACAGTGTTCAGTACACAGTAAGTTTGATACAAATGTTATCAGCATAGTTCAAAC TTCAGCAAATCCAAAATGTCTGGAAGACCAAGTTTTTTTGTAACCCATCTGGCTACAGGACCCAGCCTGA CCGGATAGGGTCCTATTTGTAGTTTTTATTTATCCTACTTGGGGTAATAGTCATACATTTCGTTGCAGCA GTTCTAATTTACTTGATTCTGTAGTGCCGTCCCAGATGCTGCCAGGGTGTTACGGAATCAAGGGCCTATC TGCACACCATGCTATCTACTGTCCTTCTTCAGCTGGGACATGTACTGACAGTCTGTACCAAGAGCTCCCT CCACGGGAGCTGCCCTTCCCTCCTTTGCAGCCTCCCACATTGGGTCAGAACTTTCACGTTCCTGCAGAAC ATTCCCATCCTCACCCAAGAGACAATGCCAGCCTATTTTATCCATTCTAAAACATGCATTTTCTTCCTAT TTTAACATCTCGGAAATGAAGATGTCTTAATTAAATCATGGTGTATCATTTATAATTAACAGCAGTTTTT CCTTTCTTGGTAAAGGGCACATAAAATTAAGGGTGTGCCTTACATTTATAACTGGTCCTCATAACCACTC CTAACATTGCTCACTCTCCTATCAGAAACAGGAACACCTTTCACGTCCATGATCTTGTATGGATCTTTAC AACAGCCCCTGTCAGGTTGGGATTTTGTCACTGTCATTCCCATTCTGCAGATGAGAAAACTGAGGCCCAG AGAGGTAGAATAACTTGATTAAAATCACAAAAGTAGTACAATGGATAAAAAAATAAAGGCCCAAATAATA TCTAAAACTGGTACCCTGCCAGGCTGTAGCTTTTTTTTTTTTTTTTTAGCTGAGGAAACAGGCACAGAGA GAACATTCAGGATCCCATATCCAGGAGGGGGCAGAGCAGCAGCTGACTCCAAGTCTTCTAGTTCCCATTC ACGTCAGCACCCTCTCGGAACTGCCAGCTTACAGCCTGTCTTTTCCATTCATTCTGGAGAGCTGTTAGGG AGCAGAGACAGGCCCATCTGTTCCCAAGCTTTCAGGGTTGACCAATCATTAGAGAATGGGACTGAAAAGA AGATGAGAAGGAACCAAGAAGTGTTTGTGCCCTGGAGGGCCTGCAGTATGACTCACTCCTGGTGAGACTG GGAGAGCAGGTAGTGGCAGAATAGGCATGAAGATGGAGACTAGGAAGGATGTGGGCACTCCTCCTGGCTC AAGGAGGGCCTACGGTGAAAAAGATGGCTCATACCCCACCCACTAGGCCTGTGAGCCTGGGAGAGGCTGC CCTTTGATCCCAGGACTTGATCAGACAAGTGGCCAGCTTCTGAGGTAGGGGAGGAACGGGAAGCTTGGAA GGCTGCCTAGAGAGGTCCCATCTGTTTGAGCTGATGCCACAAGGAAGACTGTTCTCCAGGAGGTGAAGGG AGACTGATCTTGACATATTCCACCCTCATGTTGTGGCCCTTAGGAGAGAGTCCCCACTCTTCCACCAGGT GGTAAAGCCCTTTTATGATCTGCAACTCGTTTTAGAGAATCCGTCTCTTCTCCATTCCCCCTCAAGCCCT AAGCACTGTTTCCTGATCACAGTCTTACACTGTGGGTGTGTGAATCTGTCTCTCTGTGACCAGACTTTGA CCCCTTGAGGGCAGGGACCAATCCTGGTTCCTGTGTATCCCCTACCCACCTGTGACCCCTGAGAGTGGAC CGGGCCTGGTCCCTGTGTCTCCCTGATCAGACCGTGAGCCCTGCATGCTGGGACTGGGCACAAGGAAGGC CTCAATAAAAACCCTGGCAAGGGAGCCAGGTTCCTCAAGGAACAGAACTGGAGCACGGGGCAGTGGGTAG TGTGGCCCGAGGCAGGGTAAATCTTGGTTTCCTCAAGGCATTGTTAGTCAGCCTTTGGCATGGAACACAG CCTTGAGGGGACAGCCAGGGAGAACACCAGTGTGGCCATCCTAGCTAAGGAGATGGATTCCCAAGTCAGA AGGGCATGGTCACCGGCCCACATGAGGGTGAGCAAGGAAGGAAGCCCGAGAGGGGTCTCTGGAGAAGGGA
GGGGAAGGAAGAAGTGTGGCGGGGGAGTACTGGAGCTACCTGGAGGGCCGCCACTTGGACAGAGGACAGG CTGCTAAGCCAGGAAGCAGAATCAAAGTAAACAGCAGTCCCCATGTGTCTCCTGTGTGCTGTGCACTGTT CTTGGCTGAGGTACAGTGGGACCCCTACCCAGGGAAGGGCCTGGTCAGCTACGCTTGGGGATTGGCAGGA GGCTGCCGTTGCTGGCCTCAGGGAAGAGGGGCCATGGGGCCGGAGATTTGTTGGCGTGGATTGGGAGGCA AGGACAGGCTGGGGCTAGGATGGCAGCAAAGCTTCCCATTTCCTAGGACAGGTAGGGAACCAGCTGGGGA GGAGGCACCCACTGCCGTCTGAAGCACCAGTTGGCACTGCGCAGCCCTGGGCCGAGGGAGAGCTTCTCTC ACTGTGCTCTCCCTTCATCTTTCCTCCTCCTCTGCTGCTGTCTCTGAAGTGTGTGGCCTCAGCCTCTTTC TGGCTCTCTGAACCTGGGCCTCCCTCTGCCTCTGCCTCCACCTCTCTTGTCTTGAGGCCCTTGCCCCCTT TCCCCATGGCCTGGGTCTCTTCTTCCCCTCTCTCCACGCCCTCCCTGCTGGGTCCTGCATGGGCTCAGGC TCCCTTGCCTGGATCAGTAAGTATCTCTCCCTGTGGCACCCTGGGTCACTTTCTTTCTTGCCCTTGCTTT GGTCTCTCCTGATCACCTTCCTGCTCCGTCCCAAGGCACTGGAGGCTCCAGGGGTTCTTGGGCAGCTCTT GCTGGGTGGCGGCAGGAGGTGCTCGCGTGGCCCCAGTTGGGCCCTGCAGCCAGGCCAGCCTGCACTCACC GCCAGGGACTCCTCCTGCTAGCCAGAGGCCTGAGGCGGGCCAGGCAGTTGCCAGCTGAGGCCCAGCTCCT CAGGAAGGGCCGACAGACTCTCTGCGTCACTGCCCATGTGTGTCCACGGGCAGGGGTGCCTCCTGCTCCC TGTCCTTCAGAAGTCAGGAGCAGTGCCGGCTTTCCTGAGACTTCGCGGCCAATCTCCCCTTACCCATGGC CCTTTCCCTAGATCATTACCTCAGAGGAGGCAGAGCGGCGGGGCCAGATCTACGACCGTCAGGGCGCCAC CTACCTCTTTGACCTGGACTACGTGGAGGACGTGTACACCGTGGATGCCGCCTACTATGGCAACATCTCC CACTTTGTCAACCACAGTGTGGGTACCCCCGGCAGGCGGGCAAGGGGTCGAGAGGGGCAGGCTGGAGCCC CTCCTCACTCTCCCAACTGTTCTTTCTCGCCCAGTGTGACCCCAACCTGCAGGTGTACAACGTCTTCATA GACAACCTTGACGAGCGGCTGCCCCGCATCGCTTTCTTTGCCACAAGAACCATCCGGGCAGGCGAGGAGC TCACCTTTGATTACAACATGCAAGGTGGGGGTGGCAAGGGACTGGGGGCAGGGGCGCACTGTGACTTGGG ACACAAGGACCCCTCCCAAAGGCACACCAGTCACTCAGAGAACCAAGGAAAATTCTTTAGCGGGAGCTTT AAGATGCTCTTCCTGACTCCCAGTCCCCCATTCGGACTACTAGACCCCTGCCTACCCCTCGAGTCCCCTC ATTCCCAGCCCCTGAACCCTAACCCTGAGGCATTCATACCAACTTCTCCCAAGATTCCTGGAGAGTTAAG AAACTCCTGACTCCAGTCTTGACTGAGTTTCCCTCATCCCCCAGCCCCTCCCCACTCCTAGCTCCCTTTG GCCTTCTTCATCCCAAGCCTCTGGACACCCTTGTGGCCTCCAGCCAGTCCCCTCCTTGATAAGCTAGCCA CCTCTGAGACCCTCAAGGGCAGGTCTTTGGCAGGAGAGTTCAGATGTACCTCTGGATGCCCAGGTGGCCC TCTATTCCTGCCCCTGCCCCCCCCCACACACCTAAAACGACCCTCCTGGTTCCTTGACGGCTCCCTGCCT CCCCCAGCATTCTTCAACCCCTGGCCTGAACAACCTCCAGTGCTGAGCCCTGGCCCTAGCCCCAAACCAC CAACCCTAAGATCTCCCAACTCAAATCCCAGAGTTGCTCCCAGCCCCAAAGATCCTTGGTCTCATGGTAT AAAGGGTAGTGGGACCCTTCATCCAGGCCTTCTAACAAGTCCCCTGCCTCCTTCCCTACCTTCCTCCCTC CCTCCTTCTCCCCCTCCCTCCCTGCCTCCTTCCCTCCTCTCCTCCCTGGCTGTGACTCCACAGTGGACCC CGTGGACATGGAGAGCACCCGCATGGACTCCAACTTTGGCCTGGCTGGGCTCCCTGGCTCCCCTAAGAAG CGGGTCCGTATTGAATGCAAGTGTGGGACTGAGTCCTGCCGCAAATACCTCTTCTAGCCCTTAGAAGTCT GAGGCCAGACTGACTGAGGGGGCCTGAAGCTACATGCACCTCCCCCACTGCTGCCCTCCTGTCGAGAATG ACTGCCAGGGCCTCGCCTGCCTCCACCTGCCCCCACCTGCTCCTACCTGCTCTACGTTCAGGGCTGTGGC CGTGGTGAGGACCGACTCCAGGAGTCCCCTTTCCCTGTCCCAGCCCCATCTGTGGGTTGCACTTACAAAC CCCCACCCACCTTCAGAAATAGTTTTTCAACATCAAGACTCTCTGTCGTTGGGATTCATGGCCTATTAAG GAGGTCCAAGGGGTGAGTCCCAACCCAGCCCCAGAATATATTTGTTTTTGCACCTGCTTCTGCCTGGAGA TTGAGGGGTCTGCTGCAGGCCTCCTCCCTGCTGCCCCAAAGGTATGGGGAAGCAACCCCAGAGCAGGCAG ACATCAGAGGCCAGAGTGCCTAGCCCGACATGAAGCTGGTTCCCCAACCACAGAAACTTTGTACTAGTGA AAGAAAGGGGGTCCCTGGGCTACGGGCTGAGGCTGGTTTCTGCTCGTGCTTACAGTGCTGGGTAGTGTTG GCCCTAAGAGCTGTAGGGTCTCTTCTTCAGGGCTGCATATCTGAGAAGTGGATGCCCACATGCCACTGGA AGGGAAGTGGGTGTCCATGGGCCACTGAGCAGTGAGAGGAAGGCAGTGCAGAGCTGGCCAGCCCTGGAGG TAGGCTGGGACCAAGCTCTGCCTTCACAGTGCAGTGAAGGTACCTAGGGCTCTTGGGAGCTCTGCGGTTG CTAGGGGCCCTGACCTGGGGTGTCATGACCGCTGACACCACTCAGAGCTGGAACCAAGATCTAGATAGTC CGTAGATAGCACTTAGGACAAGAATGTGCATTGATGGGGTGGTGATGAGGTGCCAGGCACTGGGTAGAGC ACCTGGTCCACGTGGATTGTCTCAGGGAAGCCTTGAAAACCACGGAGGTGGATGCCAGGAAAGGGCCCAT GTGGCAGAAGGCAAAGTACAGGCCAAGAATTGGGGGTGGGGGAGATGGCTTCCCCACTATGGGATGACGA GGCGAGAGGGAAGCCCTTGCTGCCTGCCATTCCCAGACCCCAGCCCTTTGTGCTCACCCTGGTTCCACTG GTCTCAAAAGTCACCTGCCTACAAATGTACAAAAGGCGAAGGTTCTGATGGCTGCCTTGCTCCTTGCTCC CCCACCCCCTGTGAGGACTTCTCTAGGAAGTCCTTCCTGACTACCTGTGCCCAGAGTGCCCCTACATGAG ACTGTATGCCCTGCTATCAGATGCCAGATCTATGTGTCTGTCTGTGTGTCCATCCCGCCGGCCCCCCAGA CTAACCTCCAGGCATGGACTGAATCTGGTTCTCCTCTTGTACACCCCTCAACCCTATGCAGCCTGGAGTG GGC AT CAATAAAAT GAAC T GT C GAG T GAACAAA • SEQ ID NO: 2 Human Suv39h1
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQK G
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
• SEQ ID NO: 3 IncRNA AF196970.3 RNA sequence
CGAGGCAGGGCUUUGGCUACUGGAGAUCGUAGGUUCGAAUCCCGUCUGGGA
AGUUCAACUUGUGCACCUGUAAAAGAAGCUGGCAUUAUUGGCUUGUACUCAA
GGGCUGGCACAGAGUGUGUCGGGGUGCGGACGCCCCAGCCACGCCCAUCAU
CCGUGCGGAAGAUGCAGAGGUCAUAUCGGAUACCCUUCUGUACCACACGAUU
UGGGCAGUCAUAGCCGCAGCGGCAGCGGGAGUUGCACUCGUAGAUGGGCAG
CCCGGCUCGAAGCCGCACCUGGCCCUGGUCAUUGUAGGCAAACUUGUGCAG
UGACGCCCCCGGGCAGCAGCCUCCAGUGGGUGCCCACAGACAGUCCUGGCA
CUCGCAGCCCACAGCCACCUGGUUGAGGGUGAUGCCCUCACCAACACGGUAC
UCAUUGAUGUACACGAAGGCCCGCGGAGGGCCGUCCAGGUCCACCUCAUUCU
CUACAGUGAUGCGUCCCAGAUGGCUGCGCUUGGCAUUGAGCUCCUGCUCCC
AGCGACGGAGCGCCCGCCUCUGCUUGGCCUUCUGCACCAGGUAGUUGGCCA
AGCUUGGGUCCAGGUGCCGGGGGGUCUUUGACCGGUGGUGCCGCCGGAGC
AGCUCCCUUUCUAAGUCCUUGUGGAACUGCUUGAGGAUACGCACACACUUGA
GAUUCUGCCGUGGCUCCCAGGUGCUCUCUGAGUCUGGAUAUCCACGCCAUU
UCACCAGGGUCAAAGGAGAAAAUUCCCUUUGGAAACAGAUGUGGGCAGUUGG
GGACAAGAGGGCAGGACACUAACUUCCUUGUGACCUGUCCCCUCCCAGAGCA
UGGUCACCCCAGACUCACGCGGAUCUUCUUGUAAUCGCACAGGUACUCGACU
UCAAAGUCAUAGAGGUUCCUCUUAGAGAUACCGAGGGCAGGGCAGGAGAGC
• SEQ ID NO: 4 IncRNA AF196970.3 exon 1 RNA sequence
CGAGGCAGGGCUUUGGCUACUGGAGAUCGUAGGUUCGAAUCCCGUCUGGGA
AGUUCAACUUGUGCACCUGUAAAAGAAGCUGGCAUUAUUGGCUUGUACUCAA
GGGCUGGCACAGAGUGUGUCGG
• SEQ ID NO: 5 IncRNA AF196970.3 exon 2 RNA sequence GGUGCGGACGCCCCAGCCACGCCCAUCAUCCGUGCGGAAGAUGCAGAGGUC
AUAUCGGAUACCCUUCUGUACCACACGAUUUGGGCAGUCAUAGCCGCAGCGG
CAGCGGGAGUUGCACUCGUAGAUGGGCAGCCCGGCUCGAAGCCGCACCUGG
CCCUGGUCAUUGUAGGCAAACUUGUGCAGUGACGCCCCCGGGCAGCAGCCU
CCAGUGGGUGCCCACAGACAGUCCUGGCACUCGCAGCCCACAGCCACCUGGU
UGAGGGUGAUGCCCUCACCAACACGGUACUCAUUGAUGUACACGAAGGCCCG
CGGAGGGCCGUCCAGGUCCACCUCAUUCUCUACAGUGAUGCGUCCCAGAUG
GCUGCGCUUGGCAUUGAGCUCCUGCUCCCAGCGACGGAGCGCCCGCCUCUG
CUUGGCCUUCUGCACCAGGUAGUUGGCCAAGCUUGGGUCCAGGUGCCGGGG
GGUCUUUGACCGGUGGUGCCGCCGGAGCAGCUCCCUUUCUAAGUCCUUGUG
GAACUGCUUGAGGAUACGCACACACUUGAGAUUCUGCCGUGGCUCCCAGGUG
CUCUCUGAGUCUGGAUAUCCACGCCAUUUCACCAG
• SEQ ID NO: 6 IncRNA AF196970.3 exon 3 RNA sequence
GGUCAAAGGAGAAAAUUCCCUUUGGAAACAGAUGUGGGCAGUUGGGGACAAG
AGGGCAGGACACUAACUUCCUUGUGACCUGUCCCCUCCCAGAGCAUGGUCAC
CCCAGACUCACGCGGAUCUUCUUGUAAUCGCACAGGUACUCGACUUCAAAGU
CAUAGAGGUUCCUCUUAGAGAUACCGAGGGCAGGGCAGGAGAGC
• SEQ ID NO : 7 shRNA #1
GTTGCAAGTCTTCTTGGAATCAGCTG -TTGATATCCG -
CAGCTGATTCCAAGAAGACTTGCAAC
• SEQ ID NO : 8 shRNA #2
AGTCGAGTACCTGTGCGATTA - CTCGAG - TAATCGCACAGGTACTCGACT
• SEQ ID NO : 9 shRNA #3
AGATCCGCGAACAGGAATATT - CTCGAG - AATATTCCTGTTCGCGGATCT
• SEQ ID NO : 10 shRNA #4
GATCCGCGAACAGGAATATTA - CTCGAG - TAATATTCCTGTTCGCGGATC
• SEQ ID NO : 11 shRNA #5
GCAGTTCCACAAGGACTTAGA - TCAAGAG - TCTAAGTCCTTGTGGAACTGC

Claims

1 . A medical preparation comprising:
- a first component that elicits an immune response in an individual
- a second component comprising an inhibitor of a lysine methyl transferase (KMT), optionally a Suv39h1 inhibitor; wherein the first and second components can be administered to the individual sequentially in any order or simultaneously; optionally wherein the medical preparation is for treating and/or preventing a disease, disorder or condition associated with the expression or the elevated expression of an antigen, optionally wherein the disease is an infectious disease or a tumor; optionally wherein the medical preparation prevents recall infections or tumor relapses, optionally wherein the medical preparation prevents, reduces or delays tumor metastasis growth.
2. A method of treating and/or preventing an infectious disease or a tumor in an individual, said method comprising the administration to the individual of a medical preparation comprising:
- a first component that elicits an immune response in the individual;
- a second component comprising a KMT inhibitor, optionally a Suv39h1 inhibitor; wherein the first and second components can be administered sequentially in any order or simultaneously.
3. A method of treating and/or preventing a disease, disorder or condition associated with the expression, or the elevated expression, of an antigen in an individual, optionally wherein the disease is an infectious disease or a neoplastic disease (tumor), said method comprising the administration to the individual of:
- a first component that elicits an immune response in the individual
- a second component comprising KMT inhibitor, optionally a Suv39h1 inhibitor; wherein the first and second components can be administered sequentially in any order or simultaneously.
4. A medical preparation of claim 1 , or a therapeutic method of any one of claim 2 or 3, wherein the first component comprises (i) antigen derived from a pathogen or a cancer cell, (ii) one or more peptide(s) comprising one or more epitopes for inducing an immune response against an antigen, (iii) a polynucleotide encoding the one or more peptides, (iv) one or more antigen presenting cells (APCs) comprising the peptide or the polynucleotide encoding the peptide, (v) a T cell receptor (TCR) specific for the neoepitope in complex with an HLA protein, (vi) a chimeric antigen receptor (CAR) specific for the neoepitope, or an (vii) an immune cell comprising a receptor as defined in iv) or v), or a combination thereof.
5. The medical preparation of claim 1 , wherein the medical preparation raises, enhances or augments an immune response to an antigen, optionally wherein the immune response is a cell-mediated immune response, notably a T cell mediated immune response, notably wherein the immune response comprises the generation of antigen-specific T cells.
6. A medical preparation or a therapeutic method according to any one of the preceding claims, wherein the first component is an immunogenic or vaccine composition; optionally wherein the first component is present in a formulation for targeting the lymphatic system, e.g., secondary lymphoid organs, in particular spleen; optionally wherein the first component is present in a formulation for targeting APCs, optionally dendritic cells, optionally wherein dendritic cells are immature dendritic cells.
7. A medical preparation, or a therapeutic method, according to any one of the preceding claims, wherein the second component increases sensitivity and initial response of naive T cells; and/or increases expansion and recall response of memory cells.
8. A medical preparation, or a therapeutic method, according to any one of the preceding claims, wherein the first and second components are present in the same or separate formulations.
9. A method of stimulating an immune response against an infectious disease or a tumor in an individual, said method comprising administering a vaccination regimen and an immune stimulation regimen to the individual; wherein the immune stimulation regimen comprises the administration of a KMT inhibitor, preferably wherein the KMT inhibitor is a Suv39H1 inhibitor; wherein the immune stimulation regimen and the vaccination regimen are administered sequentially in any order or simultaneously, optionally wherein the immune stimulation regimen increases sensitivity and initial response of naive T cells; and/or increases expansion and recall response of memory cells.
10. The method of claim 9, wherein the vaccination regimen comprises the administration of a vaccine composition comprising (i) and antigen derived from pathogen or a cancer cell, (ii) one or more peptide(s) comprising an an epitope for inducing an immune response against an antigen, (iii) a polynucleotide encoding the peptide, (iv) one or more APCs comprising the peptide or the polynucleotide encoding the peptide (v), or a combination thereof.
11 . A method of raising an immune response to an antigen or enhancing or augmenting an immune response to an antigen in an individual, said method comprising a step of administering to the individual an effective amount of a KMT inhibitor; optionally wherein the immune response is a cell-mediated immune response, notably a T cell mediated immune response, notably wherein the immune response comprises the generation of antigen-specific T cells; optionally wherein the immune is a response to a vaccination regimen.
12. A pharmaceutical composition comprising an KMT inhibitor, wherein the said composition increases sensitivity and initial response of naive T cells; and/or increases expansion and recall response of memory cells; wherein the pharmaceutical composition is a vaccine composition and/or is an immune cell composition; optionally wherein, the vaccine composition comprises (i) an antigen derived from a pathogen or a cancer cell, (ii) a peptide comprising an epitope of a protein for inducing an immune response against an antigen, (iii) a polynucleotide encoding the peptide, (iv) one or more APCs comprising the peptide or the polynucleotide encoding the peptide, or a combination thereof. optionally wherein, the immune response against an infectious disease or a tumor is an immune response against one or more infectious disease antigens or is an immune response against one or tumor antigens, optionally wherein the one or more antigens is a tumor antigen, optionally wherein the antigen is a tumor associated antigen (TAA) or a tumor specific antigen (TSA).
13. A medical preparation, a therapeutic method or a composition according to any one of the preceding claims, wherein the antigen is derived from a cancer cell or a human pathogen; optionally wherein the antigen is derived from a human pathogen selected from the group consisting of bacteria, virus, fungi, parasitic microorganisms and multicellular parasites ; optionally wherein the antigen is derived from a human pathogen and the human pathogen is selected from coronavirus, Herpes simplex virus (HSV), HIV, hepatitis B virus, hepatitis C virus, meningitis B, Haemophilus influenza type B, pertussis, diphtheria, tetanus, influenza virus, RSV, HPV, measles, rubella virus, mumps virus, HCMV, VZV, Dengue virus, poliovirus, Ebola virus and rotavirus, or any combination of two or more thereof.
14. A medical preparation, a therapeutic method or a composition according to any of the preceding claims, wherein the KMT inhibitor, notably the inhibitor of SUV39H1 , is a nucleic acid, a peptide, a ribonucleic complex, a small molecule or a combination thereof.
15. A medical preparation, a therapeutic method or a composition according to any one of the preceding claims, wherein the KMT inhibitor is selected from an inhibitor of SUV39H1 (KMT1A), SUV39H2 (KMT1 B), G9a (EHMT2/KMT1C), G9a-like protein 1 ; GLP (EHMT1/KMT1 D), SETDB1 (KMT1 E), SETDB2 (KMT1 F), or a combination thereof.
16. A medical preparation, a therapeutic method or a composition according to any one of the preceding claims, wherein the KMT inhibitor targets HP1 proteins.
17. A medical preparation, a therapeutic method or a composition according to any one of the preceding claims, wherein the antigen is a neoantigen or a grey or dark genome antigen; optionally wherein the antigen is expressed at low expression level, typically as compared to TAAs.
18 A therapeutic method according to any one of the preceding claims, wherein the individual has no detectable neoplasia or tumor but is at high risk for disease recurrence.
19. A therapeutic method according to any one of the preceding claims which further comprises the administration of a checkpoint inhibition regimen.
20. The medical preparation, or the method according to any one of the preceding claims, which is for use in cancer treatment in combination with at least one further therapeutic agent, optionally a chemotherapeutic agent, or an immunotherapeutic agent, optionally a checkpoint inhibitor.
PCT/EP2024/075141 2023-09-07 2024-09-09 Methods and compositions for improving immune response Pending WO2025052001A1 (en)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
EP23306492.2 2023-09-07
EP23306492.2A EP4520334A1 (en) 2023-09-07 2023-09-07 Methods and compositions for improving immune response
EP24305749 2024-05-14
EP24305749.4 2024-05-14

Publications (1)

Publication Number Publication Date
WO2025052001A1 true WO2025052001A1 (en) 2025-03-13

Family

ID=92672294

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2024/075141 Pending WO2025052001A1 (en) 2023-09-07 2024-09-09 Methods and compositions for improving immune response

Country Status (1)

Country Link
WO (1) WO2025052001A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN121202972A (en) * 2025-09-23 2025-12-26 北京大学 A short peptide targeting SUV39H1 and its application in tumor treatment

Citations (68)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US131A (en) 1837-02-24 Machine foe cutting eur fedm skins
US6566A (en) 1849-07-03 Manufacture of bags and sacks
US5356802A (en) 1992-04-03 1994-10-18 The Johns Hopkins University Functional domains in flavobacterium okeanokoites (FokI) restriction endonuclease
EP0405867B1 (en) 1989-06-27 1995-03-15 SMITHKLINE BEECHAM BIOLOGICALS s.a. Novel compounds
US5436150A (en) 1992-04-03 1995-07-25 The Johns Hopkins University Functional domains in flavobacterium okeanokoities (foki) restriction endonuclease
US5487994A (en) 1992-04-03 1996-01-30 The Johns Hopkins University Insertion and deletion mutants of FokI restriction endonuclease
EP0802979A1 (en) 1994-07-29 1997-10-29 Chiron Corporation Secreted viral proteins useful for vaccines and diagnostics
WO1999032619A1 (en) 1997-12-23 1999-07-01 The Carnegie Institution Of Washington Genetic inhibition by double-stranded rna
US5981732A (en) 1998-12-04 1999-11-09 Isis Pharmaceuticals Inc. Antisense modulation of G-alpha-13 expression
WO2000014257A1 (en) 1998-09-04 2000-03-16 Sloan-Kettering Institute For Cancer Research Fusion receptors specific for prostate-specific membrane antigen and uses thereof
US6046321A (en) 1999-04-09 2000-04-04 Isis Pharmaceuticals Inc. Antisense modulation of G-alpha-i1 expression
US6107091A (en) 1998-12-03 2000-08-22 Isis Pharmaceuticals Inc. Antisense inhibition of G-alpha-16 expression
WO2001036646A1 (en) 1999-11-19 2001-05-25 Cancer Research Ventures Limited Inhibiting gene expression with dsrna
WO2001068836A2 (en) 2000-03-16 2001-09-20 Genetica, Inc. Methods and compositions for rna interference
US6365354B1 (en) 2000-07-31 2002-04-02 Isis Pharmaceuticals, Inc. Antisense modulation of lysophospholipase I expression
US6410323B1 (en) 1999-08-31 2002-06-25 Isis Pharmaceuticals, Inc. Antisense modulation of human Rho family gene expression
US6410319B1 (en) 1998-10-20 2002-06-25 City Of Hope CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies
US6451995B1 (en) 1996-03-20 2002-09-17 Sloan-Kettering Institute For Cancer Research Single chain FV polynucleotide or peptide constructs of anti-ganglioside GD2 antibodies, cells expressing same and related methods
US20020131960A1 (en) 2000-06-02 2002-09-19 Michel Sadelain Artificial antigen presenting cells and methods of use thereof
US6566135B1 (en) 2000-10-04 2003-05-20 Isis Pharmaceuticals, Inc. Antisense modulation of caspase 6 expression
US6573099B2 (en) 1998-03-20 2003-06-03 Benitec Australia, Ltd. Genetic constructs for delaying or repressing the expression of a target gene
US6991797B2 (en) 1993-07-02 2006-01-31 Statens Serum Institut M. tuberculosis antigens
US20060057120A1 (en) 2002-12-06 2006-03-16 Northwest Biotherapeutics Inc. Administration of dendritic cells partially matured in vitro for the treatment of tumors
US7070995B2 (en) 2001-04-11 2006-07-04 City Of Hope CE7-specific redirected immune cells
US7446179B2 (en) 2000-11-07 2008-11-04 City Of Hope CD19-specific chimeric T cell receptor
US7446190B2 (en) 2002-05-28 2008-11-04 Sloan-Kettering Institute For Cancer Research Nucleic acids encoding chimeric T cell receptors
WO2009079796A1 (en) 2007-12-24 2009-07-02 Id Biomedical Corporation Of Quebec Recombinant rsv antigens
WO2010149745A1 (en) 2009-06-24 2010-12-29 Glaxosmithkline Biologicals S.A. Recombinant rsv antigens
WO2011008974A2 (en) 2009-07-15 2011-01-20 Novartis Ag Rsv f protein compositions and methods for making same
US20110301073A1 (en) 2010-05-17 2011-12-08 Sangamo Biosciences, Inc. Novel DNA-binding proteins and uses thereof
US20120178169A1 (en) 2009-12-10 2012-07-12 Voytas Daniel F Tal effector-mediated dna modification
WO2012129514A1 (en) 2011-03-23 2012-09-27 Fred Hutchinson Cancer Research Center Method and compositions for cellular immunotherapy
WO2012158613A1 (en) 2011-05-13 2012-11-22 Novartis Ag Pre-fusion rsv f antigens
US8324353B2 (en) 2001-04-30 2012-12-04 City Of Hope Chimeric immunoreceptor useful in treating human gliomas
US8339645B2 (en) 2008-05-27 2012-12-25 Canon Kabushiki Kaisha Managing apparatus, image processing apparatus, and processing method for the same, wherein a first user stores a temporary object having attribute information specified but not partial-area data, at a later time an object is received from a second user that includes both partial-area data and attribute information, the storage unit is searched for the temporary object that matches attribute information of the received object, and the first user is notified in response to a match
EP2537416A1 (en) 2007-03-30 2012-12-26 Memorial Sloan-Kettering Cancer Center Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes
US8398282B2 (en) 2011-05-12 2013-03-19 Delphi Technologies, Inc. Vehicle front lighting assembly and systems having a variable tint electrowetting element
WO2013071154A1 (en) 2011-11-11 2013-05-16 Fred Hutchinson Cancer Research Center Cyclin a1-targeted t-cell immunotherapy for cancer
US20130149337A1 (en) 2003-03-11 2013-06-13 City Of Hope Method of controlling administration of cancer antigen
US8479118B2 (en) 2007-12-10 2013-07-02 Microsoft Corporation Switching search providers within a browser search box
WO2013123061A1 (en) 2012-02-13 2013-08-22 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Bispecific chimeric antigen receptors and therapeutic uses thereof
WO2013126726A1 (en) 2012-02-22 2013-08-29 The Trustees Of The University Of Pennsylvania Double transgenic t cells comprising a car and a tcr and their methods of use
US20130287748A1 (en) 2010-12-09 2013-10-31 The Trustees Of The University Of Pennsylvania Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer
WO2013166321A1 (en) 2012-05-03 2013-11-07 Fred Hutchinson Cancer Research Center Enhanced affinity t cell receptors and methods for making the same
WO2014031687A1 (en) 2012-08-20 2014-02-27 Jensen, Michael Method and compositions for cellular immunotherapy
US20140087426A1 (en) 2012-09-24 2014-03-27 The Chinese University Of Hong Kong Transcription activator-like effector nucleases (talens)
WO2014055668A1 (en) 2012-10-02 2014-04-10 Memorial Sloan-Kettering Cancer Center Compositions and methods for immunotherapy
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
WO2014066435A1 (en) 2012-10-22 2014-05-01 City Of Hope Etp derivatives
US20140120622A1 (en) 2012-10-10 2014-05-01 Sangamo Biosciences, Inc. T cell modifying compounds and uses thereof
WO2017162461A1 (en) 2016-03-21 2017-09-28 Biontech Rna Pharmaceuticals Gmbh Trans-replicating rna
WO2017162460A1 (en) 2016-03-21 2017-09-28 Biontech Rna Pharmaceuticals Gmbh Rna replicon for versatile and efficient gene expression
WO2018234367A1 (en) 2017-06-20 2018-12-27 Institut Curie Inhibitor of suv39h1 histone methyltransferase for use in cancer combination therapy
WO2018234370A1 (en) 2017-06-20 2018-12-27 Institut Curie DEFECTIVE IMMUNE CELLS AGAINST SUV39H1
EP3359563B1 (en) 2015-10-07 2019-07-31 Biontech Cell & Gene Therapies Gmbh Antigen receptors and uses thereof
US10577371B2 (en) * 2017-09-18 2020-03-03 Augusta University Research Institute, Inc. Small molecule histone methyltransferase SUV39H1 inhibitor and uses thereof
US20200085944A1 (en) 2017-03-17 2020-03-19 Curevac Ag Rna vaccine and immune checkpoint inhibitors for combined anticancer therapy
WO2021013798A1 (en) 2019-07-21 2021-01-28 Glaxosmithkline Biologicals Sa Therapeutic viral vaccine
WO2021013950A1 (en) 2019-07-23 2021-01-28 Mnemo Therapeutics Immune cells defective for suv39h1
WO2021035194A1 (en) * 2019-08-22 2021-02-25 Juno Therapeutics, Inc. Combination therapy of a t cell therapy and an enhancer of zeste homolog 2 (ezh2) inhibitor and related methods
WO2021043804A1 (en) 2019-09-02 2021-03-11 Institut Curie Immunotherapy targeting tumor neoantigenic peptides
WO2022189639A1 (en) 2021-03-11 2022-09-15 Mnemo Therapeutics Tumor neoantigenic peptides and uses thereof
WO2022189626A2 (en) 2021-03-11 2022-09-15 Mnemo Therapeutics Tumor neoantigenic peptides
WO2022189620A1 (en) 2021-03-11 2022-09-15 Institut Curie Transmembrane neoantigenic peptides
WO2023059900A2 (en) * 2021-10-08 2023-04-13 Invivyd, Inc. Pharmaceutical formulations comprising anti-coronavirus s protein antibodies and uses thereof
WO2023126458A1 (en) 2021-12-28 2023-07-06 Mnemo Therapeutics Immune cells with inactivated suv39h1 and modified tcr
WO2023139269A1 (en) 2022-01-21 2023-07-27 Mnemo Therapeutics Modulation of suv39h1 expression by rnas
WO2023222928A2 (en) 2022-05-20 2023-11-23 Mnemo Therapeutics Compositions and methods for treating a refractory or relapsed cancer or a chronic infectious disease

Patent Citations (72)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US131A (en) 1837-02-24 Machine foe cutting eur fedm skins
US6566A (en) 1849-07-03 Manufacture of bags and sacks
EP0405867B1 (en) 1989-06-27 1995-03-15 SMITHKLINE BEECHAM BIOLOGICALS s.a. Novel compounds
US5356802A (en) 1992-04-03 1994-10-18 The Johns Hopkins University Functional domains in flavobacterium okeanokoites (FokI) restriction endonuclease
US5436150A (en) 1992-04-03 1995-07-25 The Johns Hopkins University Functional domains in flavobacterium okeanokoities (foki) restriction endonuclease
US5487994A (en) 1992-04-03 1996-01-30 The Johns Hopkins University Insertion and deletion mutants of FokI restriction endonuclease
US6991797B2 (en) 1993-07-02 2006-01-31 Statens Serum Institut M. tuberculosis antigens
EP0802979A1 (en) 1994-07-29 1997-10-29 Chiron Corporation Secreted viral proteins useful for vaccines and diagnostics
US6451995B1 (en) 1996-03-20 2002-09-17 Sloan-Kettering Institute For Cancer Research Single chain FV polynucleotide or peptide constructs of anti-ganglioside GD2 antibodies, cells expressing same and related methods
WO1999032619A1 (en) 1997-12-23 1999-07-01 The Carnegie Institution Of Washington Genetic inhibition by double-stranded rna
US6506559B1 (en) 1997-12-23 2003-01-14 Carnegie Institute Of Washington Genetic inhibition by double-stranded RNA
US6573099B2 (en) 1998-03-20 2003-06-03 Benitec Australia, Ltd. Genetic constructs for delaying or repressing the expression of a target gene
WO2000014257A1 (en) 1998-09-04 2000-03-16 Sloan-Kettering Institute For Cancer Research Fusion receptors specific for prostate-specific membrane antigen and uses thereof
US6410319B1 (en) 1998-10-20 2002-06-25 City Of Hope CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies
US6107091A (en) 1998-12-03 2000-08-22 Isis Pharmaceuticals Inc. Antisense inhibition of G-alpha-16 expression
US5981732A (en) 1998-12-04 1999-11-09 Isis Pharmaceuticals Inc. Antisense modulation of G-alpha-13 expression
US6046321A (en) 1999-04-09 2000-04-04 Isis Pharmaceuticals Inc. Antisense modulation of G-alpha-i1 expression
US6410323B1 (en) 1999-08-31 2002-06-25 Isis Pharmaceuticals, Inc. Antisense modulation of human Rho family gene expression
WO2001036646A1 (en) 1999-11-19 2001-05-25 Cancer Research Ventures Limited Inhibiting gene expression with dsrna
WO2001068836A2 (en) 2000-03-16 2001-09-20 Genetica, Inc. Methods and compositions for rna interference
US20020131960A1 (en) 2000-06-02 2002-09-19 Michel Sadelain Artificial antigen presenting cells and methods of use thereof
US6365354B1 (en) 2000-07-31 2002-04-02 Isis Pharmaceuticals, Inc. Antisense modulation of lysophospholipase I expression
US6566135B1 (en) 2000-10-04 2003-05-20 Isis Pharmaceuticals, Inc. Antisense modulation of caspase 6 expression
US7446179B2 (en) 2000-11-07 2008-11-04 City Of Hope CD19-specific chimeric T cell receptor
US7070995B2 (en) 2001-04-11 2006-07-04 City Of Hope CE7-specific redirected immune cells
US7265209B2 (en) 2001-04-11 2007-09-04 City Of Hope CE7-specific chimeric T cell receptor
US7354762B2 (en) 2001-04-11 2008-04-08 City Of Hope Method for producing CE7-specific redirected immune cells
US7446191B2 (en) 2001-04-11 2008-11-04 City Of Hope DNA construct encoding CE7-specific chimeric T cell receptor
US8324353B2 (en) 2001-04-30 2012-12-04 City Of Hope Chimeric immunoreceptor useful in treating human gliomas
US7446190B2 (en) 2002-05-28 2008-11-04 Sloan-Kettering Institute For Cancer Research Nucleic acids encoding chimeric T cell receptors
US20060057120A1 (en) 2002-12-06 2006-03-16 Northwest Biotherapeutics Inc. Administration of dendritic cells partially matured in vitro for the treatment of tumors
US20130149337A1 (en) 2003-03-11 2013-06-13 City Of Hope Method of controlling administration of cancer antigen
EP2537416A1 (en) 2007-03-30 2012-12-26 Memorial Sloan-Kettering Cancer Center Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes
US8479118B2 (en) 2007-12-10 2013-07-02 Microsoft Corporation Switching search providers within a browser search box
WO2009079796A1 (en) 2007-12-24 2009-07-02 Id Biomedical Corporation Of Quebec Recombinant rsv antigens
US8339645B2 (en) 2008-05-27 2012-12-25 Canon Kabushiki Kaisha Managing apparatus, image processing apparatus, and processing method for the same, wherein a first user stores a temporary object having attribute information specified but not partial-area data, at a later time an object is received from a second user that includes both partial-area data and attribute information, the storage unit is searched for the temporary object that matches attribute information of the received object, and the first user is notified in response to a match
WO2010149745A1 (en) 2009-06-24 2010-12-29 Glaxosmithkline Biologicals S.A. Recombinant rsv antigens
WO2011008974A2 (en) 2009-07-15 2011-01-20 Novartis Ag Rsv f protein compositions and methods for making same
US20120178169A1 (en) 2009-12-10 2012-07-12 Voytas Daniel F Tal effector-mediated dna modification
US20110301073A1 (en) 2010-05-17 2011-12-08 Sangamo Biosciences, Inc. Novel DNA-binding proteins and uses thereof
US20130287748A1 (en) 2010-12-09 2013-10-31 The Trustees Of The University Of Pennsylvania Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer
WO2012129514A1 (en) 2011-03-23 2012-09-27 Fred Hutchinson Cancer Research Center Method and compositions for cellular immunotherapy
US8398282B2 (en) 2011-05-12 2013-03-19 Delphi Technologies, Inc. Vehicle front lighting assembly and systems having a variable tint electrowetting element
WO2012158613A1 (en) 2011-05-13 2012-11-22 Novartis Ag Pre-fusion rsv f antigens
WO2013071154A1 (en) 2011-11-11 2013-05-16 Fred Hutchinson Cancer Research Center Cyclin a1-targeted t-cell immunotherapy for cancer
WO2013123061A1 (en) 2012-02-13 2013-08-22 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Bispecific chimeric antigen receptors and therapeutic uses thereof
WO2013126726A1 (en) 2012-02-22 2013-08-29 The Trustees Of The University Of Pennsylvania Double transgenic t cells comprising a car and a tcr and their methods of use
WO2013166321A1 (en) 2012-05-03 2013-11-07 Fred Hutchinson Cancer Research Center Enhanced affinity t cell receptors and methods for making the same
WO2014031687A1 (en) 2012-08-20 2014-02-27 Jensen, Michael Method and compositions for cellular immunotherapy
US20140087426A1 (en) 2012-09-24 2014-03-27 The Chinese University Of Hong Kong Transcription activator-like effector nucleases (talens)
WO2014055668A1 (en) 2012-10-02 2014-04-10 Memorial Sloan-Kettering Cancer Center Compositions and methods for immunotherapy
US20140120622A1 (en) 2012-10-10 2014-05-01 Sangamo Biosciences, Inc. T cell modifying compounds and uses thereof
WO2014066435A1 (en) 2012-10-22 2014-05-01 City Of Hope Etp derivatives
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
EP3359563B1 (en) 2015-10-07 2019-07-31 Biontech Cell & Gene Therapies Gmbh Antigen receptors and uses thereof
WO2017162461A1 (en) 2016-03-21 2017-09-28 Biontech Rna Pharmaceuticals Gmbh Trans-replicating rna
WO2017162460A1 (en) 2016-03-21 2017-09-28 Biontech Rna Pharmaceuticals Gmbh Rna replicon for versatile and efficient gene expression
US20200085944A1 (en) 2017-03-17 2020-03-19 Curevac Ag Rna vaccine and immune checkpoint inhibitors for combined anticancer therapy
WO2018234367A1 (en) 2017-06-20 2018-12-27 Institut Curie Inhibitor of suv39h1 histone methyltransferase for use in cancer combination therapy
WO2018234370A1 (en) 2017-06-20 2018-12-27 Institut Curie DEFECTIVE IMMUNE CELLS AGAINST SUV39H1
US10577371B2 (en) * 2017-09-18 2020-03-03 Augusta University Research Institute, Inc. Small molecule histone methyltransferase SUV39H1 inhibitor and uses thereof
WO2021013798A1 (en) 2019-07-21 2021-01-28 Glaxosmithkline Biologicals Sa Therapeutic viral vaccine
WO2021013950A1 (en) 2019-07-23 2021-01-28 Mnemo Therapeutics Immune cells defective for suv39h1
WO2021035194A1 (en) * 2019-08-22 2021-02-25 Juno Therapeutics, Inc. Combination therapy of a t cell therapy and an enhancer of zeste homolog 2 (ezh2) inhibitor and related methods
WO2021043804A1 (en) 2019-09-02 2021-03-11 Institut Curie Immunotherapy targeting tumor neoantigenic peptides
WO2022189639A1 (en) 2021-03-11 2022-09-15 Mnemo Therapeutics Tumor neoantigenic peptides and uses thereof
WO2022189626A2 (en) 2021-03-11 2022-09-15 Mnemo Therapeutics Tumor neoantigenic peptides
WO2022189620A1 (en) 2021-03-11 2022-09-15 Institut Curie Transmembrane neoantigenic peptides
WO2023059900A2 (en) * 2021-10-08 2023-04-13 Invivyd, Inc. Pharmaceutical formulations comprising anti-coronavirus s protein antibodies and uses thereof
WO2023126458A1 (en) 2021-12-28 2023-07-06 Mnemo Therapeutics Immune cells with inactivated suv39h1 and modified tcr
WO2023139269A1 (en) 2022-01-21 2023-07-27 Mnemo Therapeutics Modulation of suv39h1 expression by rnas
WO2023222928A2 (en) 2022-05-20 2023-11-23 Mnemo Therapeutics Compositions and methods for treating a refractory or relapsed cancer or a chronic infectious disease

Non-Patent Citations (176)

* Cited by examiner, † Cited by third party
Title
AIBAR, S. ET AL.: "SCENIC: single-cell regulatory network inference and clustering", NAT METHODS, vol. 14, 2017, pages 1083 - 1086, XP037171468, DOI: 10.1038/nmeth.4463
ALARCON ET AL., ADV. PARASITOL. ADVANCES IN PARASITOLOGY, vol. 42, 1999, pages 343 - 410
ALLAN, RHYS S ET AL.: "An epigenetic silencing pathway controlling T helper 2 cell lineage commitment", NATURE, vol. 487, no. 7406, 2012, pages 249 - 253, XP093091115, DOI: 10.1038/nature11173
ALLIS, C. DJENUWEIN, T: "The molecular hallmarks of epigenetic control", NAT REV GENET, vol. 17, 2016, pages 487 - 500
ANDERSON, K. ET AL.: "Intravascular staining for discrimination of vascular and tissue leukocytes", NAT PROTOC, 2014, pages 9
ANZALONE AVGAO XDPODRACKY CJNELSON ATKOBLAN LWRAGURAM A ET AL.: "Programmable deletion, replacement, integration and inversion of Large DNA sequences with twin prime editing", NAT BIOTECHNOL, vol. 40, no. 5, 2022, pages 731 - 40, XP037927032, DOI: 10.1038/s41587-021-01133-w
ANZALONE AVRANDOLPH PBDAVIS JRSOUSA AAKOBLAN LWLEVY JM ET AL.: "Search-and-Replace genome editing without double-strand breaks or donor DNA", NATURE, vol. 576, no. 7785, 2019, pages 149 - 57, XP055980447, DOI: 10.1038/s41586-019-1711-4
ARIOTTI, S. ET AL.: "Skin-resident memory CD8 T cells trigger a state of tissue-wide pathogen alert", SCIENCE, vol. 346, 2014, pages 101 - 105
ATTIG JYOUNG GRHOSIE L ET AL.: "LTR retroelement expansion of the human cancer transcriptome and immunopeptidome revealed by de novo transcript assembly", GENOME RES, vol. 29, no. 10, 2019, pages 1578 - 1590, XP002795956, DOI: 10.1101/gr.248922.119
BARRY M: "Single-cycle adenovirus vectors in the current vaccine landscape", EXPERT REV VACCINES, 2018
BAUMANN MDIESKAU APLOERTSCHER BM ET AL.: "Chemical science", vol. 6, 2010, ROYAL SOCIETY OF CHEMISTRY, article "Tricyclic Analogues of Epidithiodioxopiperazine Alkaloids with Promising In Vitro and In Vivo Antitumor Activity", pages: 4451 - 4457
BECKER, J. S. ET AL.: "Genomic and Proteomic Resolution of Heterochromatin and Its Restriction of Alternate Fate Genes", MOLECULAR CELL, vol. 68, 2017, pages 1023 - 1037
BEERLI ET AL., NATURE BIOTECHNOL., vol. 20, 2002, pages 135 - 141
BEISSERT TPERKOVIC MVOGEL AERBAR SWALZER KCHEMPEL T ET AL.: "A trans-amplifying RNA vaccine strategy for induction of potent protective immunity", MOL THER, vol. 28, no. 1, 2020, pages 119 - 28, XP055847688, DOI: 10.1016/j.ymthe.2019.09.009
BERGEN, V.LANGE, M.PEIDLI, S.WOLF, F. ATHEIS, F. J.: "Generalizing RNA velocity to transient cell states through dynamical modeling", NAT BIOTECHNOL, vol. 38, 2020, pages 1408 - 1414, XP037311068, DOI: 10.1038/s41587-020-0591-3
BIEDERSTADT AMANZAR GSDAHER M: "Multiplexed engineering and precision gene editing in cellular immunotherapy", FRONT IMMUNOL, vol. 13, 2022, pages 1063303
BONTE PEARRIBAS YAMERLOTTI A ET AL.: "Single-cell RNA-seq-based proteogenomics identifies glioblastoma-specific transposable elements encoding HLA-I-presented peptides", CELL REP, vol. 39, no. 10, 2022, pages 110916, XP055964846, DOI: 10.1016/j.celrep.2022.110916
BOSCH BJVAN DER ZEE RDE HAAN CAROTTIER P: "The coronavirus spike protein is a class I virus fusion protein: structural and functional characterization of the fusion core complex", J VIROL, vol. 77, no. 16, August 2003 (2003-08-01), pages 8801 - 11, XP002360112, DOI: 10.1128/JVI.77.16.8801-8811.2003
BUQUICCHIO, F. A. ET AL., A UNIQUE EPIGENOMIC LANDSCAPE DEFINES CD8 TISSUE-RESIDENT MEMORY T CELLS, 2022, Retrieved from the Internet <URL:http://biorxiv.org/lookup/doi/10.1101/2022.05.04.490680>
CASEY, K. ET AL.: "Antigen-Independent Differentiation and Maintenance of Effector-like Resident Memory T Cells in Tissues", J IMMUNOL, vol. 188, 2012, pages 4866 - 4875
CERBONI ET AL., J EXP MED., vol. 214, no. 6, 5 June 2017 (2017-06-05), pages 1769 - 1785
CHANG ET AL., ACC. CHEM. RES., vol. 52, 2019, pages 665 - 675
CHANG, J. T.WHERRY, E. J.GOLDRATH, A. W: "Molecular regulation of effector and memory T cell differentiation", NAT IMMUNOL, vol. 15, 2014, pages 1104 - 1115, XP037924577, DOI: 10.1038/ni.3031
CHEN, Y.SHEN, J.KASMANI, M. Y.TOPCHYAN, PCUI, W: "Single-Cell Transcriptomics Reveals Core Regulatory Programs That Determine the Heterogeneity of Circulating and Tissue-Resident Memory CD8+ T Cells", CELLS, vol. 10, 2021, pages 2143
CHENG, X.COLLINS, R.E.ZHANG, X: "Structural and Sequence Motifs of Protein (Histone) Methylation Enzymes", ANNU. REV. BIOPHYS. BIOMOL. STRUCT., vol. 34, 2005, pages 267 - 294
CHOO ET AL., CURR. OPIN. STRUCT. BIOL., vol. 10, 2000, pages 411 - 416
COLAS PCOHEN BJESSEN TGRISHINA IMCCOY JBRENT R: "Genetic selection of peptide aptamers that recognize and inhibit cyclin-dependent kinase 2", NATURE, vol. 380, no. 6574, 11 April 1996 (1996-04-11), pages 548 - 50, XP000904376, DOI: 10.1038/380548a0
COLLANTES JCTAN VMXU H ET AL.: "Development and Characterization of a Modular CRISPR and RNA Aptamer Mediated Base Editing System", CRISPR J., vol. 4, no. 1, 2021, pages 58 - 68, XP055847136, DOI: 10.1089/crispr.2020.0035
CORGNAC, STÉPHANIE ET AL.: "Isolation of tumor-resident CD8+ T cells from human lung tumors", STAR PROTOCOLS, vol. 2, 12 January 2021 (2021-01-12)
CRITCHLOWJACKSON, TRENDS BIOCHEM SCI, vol. 23, no. 10, October 1998 (1998-10-01), pages 394 - 8
CROMPTON, J. G. ET AL.: "Lineage relationship of CD81 T cell subsets is revealed by progressive changes in the epigenetic landscape", MOLECULAR IMMUNOLOGY.
CROWL, J. T.: "Tissue-resident memory CD8+ T cells possess unique transcriptional, epigenetic and functional adaptations to different tissue environments", NATURE IMMUNOLOGY, pages 31
DAVILA ET AL., PLOS ONE, vol. 8, no. 4, 2013, pages e61338
DIJKGRAAF, F. E.KOK, LSCHUMACHER, T. N. M: "Formation of Tissue-Resident CD8 T-Cell Memory", COLD SPRING HARB PERSPECT BIOL, 2021
DILLON, S.C.ZHANG, X.TRIEVEL, R.C.CHENG, X: "The SET-domain protein superfamily: Protein lysine methyltransferases", GENOME BIOL, vol. 6, 2005, pages 227, XP002496742, DOI: 10.1186/gb-2005-6-8-227
DONINI MMOREA VDESIDERIO APASHKOULOV DVILLANI METRAMONTANO ABENVENUTO E: "Engineering stable cytoplasmic intrabodies with designed specificity", J MOL BIOL., vol. 330, no. 2, 4 July 2003 (2003-07-04), pages 323 - 32, XP004432726, DOI: 10.1016/S0022-2836(03)00530-8
DRAPER SJHEENEY JL: "Viruses as vaccine vectors for infectious diseases and cancer", NAT REV MICROBIOL, vol. 8, 2010, pages 62 - 73, XP055484517, DOI: 10.1038/nrmicro2240
DUDEK TKNIPE DM: "Replication-defective viruses as vaccines and vaccine vectors", VIROLOGY, vol. 344, 2006, pages 230 - 9, XP024896310, DOI: 10.1016/j.virol.2005.09.020
ESKELAND, R. ET AL., BIOCHEMISTRY, vol. 43, 2004, pages 3740 - 3749
FODOR, B. D.SHUKEIR, N.REUTER, GJENUWEIN, T: "Mammalian Su ( var ) Genes in Chromatin Control", ANNU. REV. CELL DEV. BIOL., vol. 26, 2010, pages 471 - 501
FRITSCH LROBIN PMATHIEU JR ET AL.: "A subset of the histone H3 lysine 9 methyltransferases Suv39h1, G9a, GLP, and SETDB1 participate in a multimeric complex", MOL CELL, vol. 37, no. 1, 2010, pages 46 - 56
FUNG, H. Y.TERYEK, M.LEMENZE, A. DBERGSBAKEN, T: "CD103 fate mapping reveals that intestinal CD103 tissue-resident memory T cells are the primary responders to secondary infection", SCI. IMMUNOL, vol. 7, 2022
GAJ ET AL., TRENDS IN BIOTECHNOLOGY, vol. 31, no. 7, 2013, pages 397 - 405
GARDINER, D. M. ET AL.: "The epipolythiodioxopiperazine (ETP) class of fungal toxins: distribution, mode of action, functions and biosynthesis", MICROBIOL, vol. 151, 2005, pages 1021 - 1032, XP009160260, DOI: 10.1099/mic.0.27847-0
GAUDELLI N.M.KOMOR A.C.REES H.A.PACKER M.S.BADRAN A.H.BRYSON D.I.LIU D.R: "Programmable base editing of A · T to G · C in genomic DNA without DNA cleavage", NATURE, vol. 551, 2017, pages 464 - 471, XP037336615, DOI: 10.1038/nature24644
GIBBONS, D. L. ET AL.: "Cutting Edge: Regulator of G Protein Signaling-1 Selectively Regulates Gut T Cell Trafficking and Colitic Potential", THE JOURNAL OF IMMUNOLOGY, vol. 187, 2011, pages 2067 - 2071
GREINER DBONALDI TESKELAND RROEMER EIMHOF A: "Identification of a specific inhibitor of the histone methyltransferase SU(VAR)3-9", NAT CHEM BIOL., no. 3, August 2005 (2005-08-01), pages 143 - 5, XP055023658, DOI: 10.1038/nchembio721
GULATI, G. S. ET AL.: "Single-cell transcriptional diversity is a hallmark of developmental potential", SCIENCE, vol. 367, 2020, pages 405 - 411
HALE ET AL., CELL, vol. 139, 2009, pages 945 - 956
HARBERTS, A. ET AL.: "Interferon regulatory factor 4 controls effector functions of CD8 memory T cells.", PROC. NATL. ACAD. SCI. U.S.A., vol. 118, 2021
HAYWARD, S. L. ET AL.: "Environmental cues regulate epigenetic reprogramming of airway-resident memory CD8+ T cells", NAT IMMUNOL, vol. 21, 2020, pages 309 - 320, XP037075397, DOI: 10.1038/s41590-019-0584-x
HEEG, MGOLDRATH, A. W: "Insights into phenotypic and functional CD8 T RM heterogeneity", IMMUNOLOGICAL REVIEWS, 2023
HENNING, A.ROYCHOUDHURI, RRESTIFO, N: "Epigenetic control of CD8+ T cell differentiation", NAT REV IMMUNOL, vol. 18, 2018, pages 340, XP055660663, DOI: 10.1038/nri.2017.146
HOMBRINK, P. ET AL.: "Programs for the persistence, vigilance and control of human CD8+ lung-resident memory T cells", NAT IMMUNOL, vol. 17, 2016, pages 1467 - 1478, XP037115684, DOI: 10.1038/ni.3589
HUTCHINGS ET AL.: "Combination of protein and viral vaccines induces potent cellular and humoral immune responses and enhanced protection from murine malaria challenge", INFECT IMMUN, vol. 75, no. 12, 1 October 2007 (2007-10-01)
HYLAND SBEERLI RRBARBAS CFHYNES NEWELS W: "Generation and functional characterization of intracellular antibodies interacting with the kinase domain of human EGF receptor", ONCOGENE, vol. 22, 2003, pages 1557 - 67, XP037737097, DOI: 10.1038/sj.onc.1206299
IRIGUCHI, S.YASUI, Y.KAWAI, Y ET AL.: "A clinically applicable and scalable method to regenerate T-cells from iPSCs for off-the-shelf T-cell immunotherapy", NAT COMMUN, vol. 12, 2021, pages 430
ISALAN ET AL., NATURE BIOTECHNOL., vol. 19, 2001, pages 656 - 660
JACKSON, VACCINES, vol. 5, 2020, pages 11
JENKINS MRWEBBY RDOHERTY PCTURNER SJ: "Addition of a Prominent Epitope Affects Influenza A Virus-Specific CD8 + T Cell Immunodominance Hierarchies When Antigen Is Limiting", J IMMUNOL., vol. 177, no. 5, 1 September 2006 (2006-09-01), pages 2917 - 25
JENKINS, M. R.WEBBY, R.DOHERTY, P. CTURNER, S. J.: "Addition of a Prominent Epitope Affects Influenza A Virus-Specific CD8 T Cell Immunodominance Hierarchies When Antigen Is Limiting", J IMMUNOL, vol. 177, 2006, pages 2917 - 2925
JENSEN, I. J.FARBER, D. L: "Gutsy memory T cells stand their ground against pathogens", SCI. IMMUNOL, vol. 7, 2022
KAECH, S. M.CUI, W: "Transcriptional control of effector and memory CD8+ T cell differentiation", NAT REV IMMUNOL, vol. 12, 2012, pages 749 - 761, XP037923182, DOI: 10.1038/nri3307
KAHLES ALEHMANN KVTOUSSAINT NCHÜSER MSTARK SGSACHSENBERG TSTEGLE OKOHLBACHER OSANDER CCANCER GENOME ATLAS RESEARCH NETWORK ET AL.: "Comprehensive analysis of alternative splicing across tumors from 8,705 patients", CANCER CELL, vol. 34, 2018, pages 211 - 224
KARGINOVHANNON, MOL. CELL, vol. 37, 2010, pages 7
KIM ET AL., NATURE BIOTECHNOLOGY, vol. 31, 2013, pages 251 - 258
KIM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 883 - 887
KIM, J. BIOL. CHEM., vol. 269, no. 31, 1994
KNIPPING FNEWBY GAEIDE CR ET AL.: "Disruption of HIV-1 co-receptors CCR5 and CXCR4 in primary human T cells and hematopoietic stem and progenitor cells using base editing", MOL THER., vol. 30, no. 1, 2022, pages 130 - 144, XP093105156, DOI: 10.1016/j.ymthe.2021.10.026
KNUDSON, K. M.GOPLEN, N. P.CUNNINGHAM, C. A.DANIELS, M. ATEIXEIRO, E: "Low-Affinity T Cells Are Programmed to Maintain Normal Primary Responses but Are Impaired in Their Recall to Low-Affinity Ligands", CELL REPORTS, vol. 4, 2013, pages 554 - 565
KOK, L. ET AL.: "A committed tissue-resident memory T cell precursor within the circulating CD8+ effector T cell pool", JOURNAL OF EXPERIMENTAL MEDICINE, vol. 217, 2020, pages e20191711
KOK, L.MASOPUST, DSCHUMACHER, T. N.: "The precursors of CD8+ tissue resident memory T cells: from lymphoid organs to infected tissues", NAT REV IMMUNOL, vol. 22, 2022, pages 283 - 293, XP037816172, DOI: 10.1038/s41577-021-00590-3
KOMOR A.C.KIM Y.B.PACKER M.S.ZURIS J.A.LIU D.R: "Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage", NATURE, vol. 533, no. 7603, 2016, pages 420 - 424, XP093078921, DOI: 10.1038/nature17946
KURD, N. S. ET AL.: "Early precursors and molecular determinants of tissue-resident memory CD8 T lymphocytes revealed by single-cell RNA sequencing", SCI. IMMUNOL., 2020, pages 5
L. HAMMERICHN. BHARDWAJH.E. KOHRTJ.D. BRODY: "In situ vaccination for the treatment of cancer", IMMUNOTHERAPY, vol. 8, no. 3, 2016, pages 315 - 330
LE DTPARDOLL DMJAFFEE EM: "Cellular vaccine approaches", CANCER J, vol. 16, no. 4, 2010, pages 304 - 10
LEITNER ET AL., THE JOURNAL OF IMMUNOLOGY, vol. 159, no. 12, 1997, pages 6112 - 61 19
LEWIS ET AL.: "Advances in Vims Research", vol. 54, 1999, ACADEMIC PRESS, pages: 129 - 88
LI ET AL., NUCL. ACIDS RES., vol. 39, 2011, pages 6315 - 6325
LI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4275 - 4279
LI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2764 - 2768
LI F: "Structure, Function, and Evolution of Coronavirus Spike Proteins", ANNU REV VIROL, vol. 3, no. 1, 29 September 2016 (2016-09-29), pages 237 - 261, XP055807566, DOI: 10.1146/annurev-virology-110615-042301
LIANG, Y.CHEN, F.WANG, K.LAI, L: "Base editors: development and applications in biomedicine", FRONTIERS OF MEDICINE, 2023
LIN ET AL., NUCL. ACIDS RES, vol. 42, 2014, pages e47
LIN, Y. H. ET AL.: "Small intestine and colon tissue-resident memory CD8+ T cells exhibit molecular heterogeneity and differential dependence on Eomes", IMMUNITY, 2022
LIU, J.FU, M.WANG, M. ET AL.: "Cancer vaccines as promising immuno-therapeutics: platforms and current progress", J HEMATOL ONCOL, vol. 15, 2022, pages 28
LLOYD ET AL., FRONTIERS IN IMMUNOLOGY, vol. 4, no. 221, 2013, pages 1 - 7
LOBATO MNRABBITTS TH: "Intracellular antibodies and challenges facing their use as therapeutic agents", TRENDS MOL MED, vol. 9, 2003, pages 390 - 6, XP055014705, DOI: 10.1016/S1471-4914(03)00163-1
LOFBLOM JFELDWISCH JTOLMACHEV VCARLSSON JSTAHL SFREJD FY: "Affibody molecules: engineered proteins for therapeutic, diagnostic and biotechnological applications", FEBS LETT., vol. 584, no. 12, 18 June 2010 (2010-06-18), pages 2670 - 80
LÓPEZ-COBO, S. ET AL.: "SUV39H1 Ablation Enhances Long-term CAR T Function in Solid Tumors", CANCER DISCOVERY, vol. 14, 2024, pages 120 - 141
LU ET AL., MOL THER NUCLEIC ACIDS, vol. 10, 2018, pages 387 - 397
MACKAY, L. K. ET AL.: "Hobit and Blimp1 instruct a universal transcriptional program of tissue residency in lymphocytes", SCIENCE, vol. 352, 2016, pages 459 - 463
MACKAY, L. K. ET AL.: "T-box Transcription Factors Combine with the Cytokines TGF-β and IL-15 to Control Tissue-Resident Memory T Cell Fate", IMMUNITY, vol. 43, 2015, pages 1101 - 1111, XP029351831, DOI: 10.1016/j.immuni.2015.11.008
MACKAY, L. K. ET AL.: "The developmental pathway for CD103(+)CD8+ tissue-resident memory T cells of skin", NAT. IMMUNOL., vol. 14, 2013, pages 1294 - 301
MALISSEN, M. ET AL.: "Altered T cell development in mice with a targeted mutation of the CD3-epsilon gene", THE EMBO JOURNAL, vol. 14, 1995, pages 4641 - 4653, XP055772395, DOI: 10.1002/j.1460-2075.1995.tb00146.x
MARSCHALL ALDUBEL SBOLDICKE T: "Specific in vivo knockdown of protein function by intrabodies", MABS, vol. 7, no. 6, 2015, pages 1010 - 35, XP055967073, DOI: 10.1080/19420862.2015.1076601
MARSCHALL, A. L ET AL., MABS, 2015
MCDONALD, B ET AL.: "Canonical BAF complex activity shapes the enhancer landscape that licenses CD8+ T cell effector and memory fates", IMMUNITY, vol. 56, 2023, pages 1303 - 1319
MCMASTER, S. R. ET AL.: "Memory T Cells Generated by Prior Exposure to Influenza Cross React with the Novel H7N9 Influenza Virus and Confer Protective Heterosubtypic Immunity", PLOS ONE, vol. 10, 2015
MEANSFEENEY: "A recent review of protein modification techniques", BIOCONJUGATE CHEM, vol. 1, 1990, pages 2 - 12
MERLOTTI ASADACCA BARRIBAS YA ET AL.: "Noncanonical splicing junctions between exons and transposable elements represent a source of immunogenic recurrent neo-antigens in patients with lung cancer", SCI IMMUNOL, vol. 8, no. 80, 2023, XP093058241
MERRIFIELD RB: "Solid phase peptide synthesis. I. The synthesis of a tetrapeptide", J. AM. CHEM. SOC., vol. 85, 1963, pages 2149 - 54, XP002257754, DOI: 10.1021/ja00897a025
MILLER ET AL., NAT. BIOTECH., vol. 29, 2011, pages 143 - 148
MILNER, J ET AL.: "Runx3 programs CD8+ T cell residency in non-lymphoid tissues and tumours", NATURE, vol. 552, 2017, pages 253, XP055712103, DOI: 10.1038/nature24993
MILNER, J. J. ET AL.: "Heterogenous Populations of Tissue-Resident CD8+ T Cells Are Generated in Response to Infection and Malignancy", IMMUNITY, vol. 52, 2020, pages 808 - 824
MOK BYKOTRYS AVRAGURAM AHUANG TPMOOTHA VKLIU DR: "Crispr-free base editors with enhanced activity and expanded targeting scope in mitochondrial and nuclear", DNA NAT BIOTECHNOL, vol. 40, 2022, pages 1378 - 87, XP093031796, DOI: 10.1038/s41587-022-01256-8
MOORE CBGUTHRIE EHHUANG MTTAXMAN DJ: "Short hairpin RNA (shRNA): design, delivery, and assessment of gene knockdown", METHODS MOL BIOL., vol. 629, 2010, pages 141 - 58
MOR ET AL., THE JOURNAL OF IMMUNOLOGY, vol. 155, no. 4, 1995, pages 2039 - 2046
MOSCOUBOGDANOVE, SCIENCE, vol. 326, 2009, pages 1501 - 1512
MOSS, VACCINE, vol. 31, no. 39, 2013, pages 4220 - 4222
MUELLER, SMACKAY, L: "Tissue-resident memory T cells: local specialists in immune defence", NAT REV IMMUNOL, vol. 16, 2015, pages 79 - 89
NELSON JWRANDOLPH PBSHEN SPEVERETTE KACHEN PJANZALONE AV ET AL.: "Engineered pegrnas improve prime editing efficiency", NAT BIOTECHNOL, vol. 40, no. 3, 2022, pages 402 - 10, XP093043230, DOI: 10.1038/s41587-021-01039-7
NIBORSKI, L. L. ET AL.: "CD8+ T cell responsiveness to anti-PD-1 is epigenetically regulated by Suv39h1 in melanomas", NAT COMMUN, vol. 13, 2022, pages 3739, XP093091124, DOI: 10.1038/s41467-022-31504-z
NICETTO, D. ET AL.: "H3K9me3-heterochromatin loss at protein-coding genes enables developmental lineage specification", SCIENCE, vol. 363, 2019, pages 294 - 297
NISHIOKA, KENICHI ET AL.: "Set9, a novel histone H3 methyltransferase that facilitates transcription by precluding histone tail modifications required for heterochromatin formation", GENES & DEVELOPMENT, vol. 16, no. 4, 2002, pages 479 - 89, XP002287438, DOI: 10.1101/gad.967202
PABO ET AL., ANN. REV. BIOCHEM., vol. 70, 2001, pages 313 - 340
PACE, L. ET AL.: "The epigenetic control of stemness in CD8+ T cell fate commitment", SCIENCE, vol. 359, 2018, pages 177 - 186, XP002778853, DOI: 10.1126/science.aah6499
PACE, LAMIGORENA, S: "Epigenetics of T cell fate decision", CURRENT OPINION IN IMMUNOLOGY, vol. 63, 2020, pages 43 - 50, XP086145735, DOI: 10.1016/j.coi.2020.01.002
PADEKEN JMETHOT SPGASSER SM: "Establishment of H3K9-methylated heterochromatin and its functions in tissue differentiation and maintenance", NAT REV MOL CELL BIOL., vol. 23, no. 9, 2022, pages 623 - 640
PARGA-VIDAL, L. ET AL.: "Hobit identifies tissue-resident memory T cell precursors that are regulated by Eomes", SCI. IMMUNOL, vol. 6, 2021
PATEL, D.J.WANG, Z: "Readout of Epigenetic Modifications", ANNU. REV. BIOCHEM., vol. 82, 2013, pages 81 - 118
PERTOFT, H.LAURENT, T. C.LAAS, TKAGEDAL, L: "Density gradients prepared from colloidal silica particles coated by polyvinylpyrrolidone (Percoll", ANALYTICAL BIOCHEMISTRY, vol. 88, 1978, pages 271 - 282, XP024822292, DOI: 10.1016/0003-2697(78)90419-0
PETERS, A. H. ET AL.: "Loss of the Suv39h histone methyltransferases impairs mammalian heterochromatin and genome stability", CELL, vol. 107, 2001, pages 323 - 337, XP002967635, DOI: 10.1016/S0092-8674(01)00542-6
PETERS, A. H. F. M. ET AL.: "Loss of the Suv39h Histone Methyltransferases Impairs Mammalian Heterochromatin and Genome Stability", CELL, vol. 107, 2001, pages 323 - 337, XP002967635, DOI: 10.1016/S0092-8674(01)00542-6
PETRIE HTKINCADE PW: "Many roads, one destination for T cell progenitors", THE JOURNAL OF EXPERIMENTAL MEDICINE, vol. 202, no. 1, 2005, pages 11 - 13
POLLARD CDE KOKER SSAELENS XVANHAM GGROOTEN J: "Challenges and advances towards the rational design of mRNA vaccines", TRENDS MOL MED, vol. 19, no. 12, 2013, pages 705 - 13
POUWELS ET AL.: "Cloning Vectors: A Laboratory Manual", 1985, ELSEVIER
PROBST, A. V.DUNLEAVY, EALMOUZNI, G: "Epigenetic inheritance during the cell cycle.", NAT REV MOL CELL BIOL, vol. 10, 2009, pages 192 - 206
RANKIN ET AL.: "Overexpressing Long Noncoding RNAs Using Gene-activating CRISPR", J VIS EXP, 2019
REINA-CAMPOS, M. ET AL.: "Metabolic programs of T cell tissue residency empower tumour immunity", NATURE, vol. 621, 2023, pages 179 - 187
ROBINSON ET AL., ADV. VIRUS RES. ADVANCES IN VIRUS RESEARCH, vol. 55, 2000, pages 1 - 74
SADELAIN ET AL., CANCER DISCOV, vol. 3, no. 4, April 2013 (2013-04-01), pages 388 - 398
SADEQI NEZHAD, MUHAMMAD ET AL.: "Induced Pluripotent Stem Cells (iPSCs) Provide a Potentially Unlimited T Cell Source for CAR-T Cell Development and Of -the-Shelf Products", PHARMACEUTICAL RESEARCH, vol. 38, no. 6, 2021, pages 931 - 945, XP037486859, DOI: 10.1007/s11095-021-03067-z
SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY
SANDERJOUNG, NAT. BIOTECH., vol. 32, 2014, pages 347 - 355
SANDERJOUNG, NATURE BIOTECHNOLOGY, vol. 32, no. 4, pages 347 - 355
SCHENKEL, J. M. ET AL., RESIDENT MEMORY CD8 T CELLS TRIGGER PROTECTIVE INNATE AND ADAPTIVE IMMUNE RESPONSES, 2014
SCHNEIDER: "Induction of CD8+ T cells using heterologous prime-boost immunization strategies", IMMUNOLOGICAL REVIEWS, vol. 170, August 1999 (1999-08-01), pages 29 - 38, XP000981910, DOI: 10.1111/j.1600-065X.1999.tb01326.x
SCOTT, A. C. ET AL.: "TOX is a critical regulator of tumour-specific T cell differentiation", NATURE, vol. 571, 2019, pages 270 - 274, XP036861519, DOI: 10.1038/s41586-019-1324-y
SEGAL ET AL., CURR. OPIN. BIOTECHNOL., vol. 12, 2001, pages 632 - 637
SHAH NMJANG HJLIANG Y ET AL.: "Pan-cancer analysis identifies tumor-specific antigens derived from transposable elements", NAT GENET, vol. 55, no. 4, 2023, pages 631 - 639
SHINKAI Y: "Tachibana M. H3K9 methyltransferase G9a and the related molecule GLP", GENES DEV, vol. 25, no. 8, 2011, pages 781 - 788
SIEGELMAN, M. H.STANESCU, DESTESS, P: "The CD44-initiated pathway of T-cell extravasation uses VLA-4 but not LFA-1 for firm adhesion", J. CLIN. INVEST., vol. 105, 2000, pages 683 - 691
SKON, C. ET AL.: "Transcriptional downregulation of S1 pr1 is required for the establishment of resident memory CD8+ T cells", NAT IMMUNOL, vol. 14, 2013, pages 1285 - 1293
SLUTTER, B ET AL.: "Dynamics of influenza-induced lung-resident memory T cells underlie waning heterosubtypic immunity", SCI IMMUNOL, vol. 2, 2017
SMART ACMARGOLIS CAPIMENTEL HHE MXMIAO DADEEGBE DFUGMANN TWONG KKVAN ALLEN EM: "Intron retention is a source of neoepitopes in cancer", NAT BIOTECHNOL, vol. 36, 2018, pages 1056 - 1058, XP055680534, DOI: 10.1038/nbt.4239
SNIGDHA SPRIETO GAPETROSYAN A ET AL.: "H3K9me3 Inhibition Improves Memory, Promotes Spine Formation, and Increases BDNF Levels in the Aged Hippocampus", THE JOURNAL OF NEUROSCIENCE, vol. 36, no. 12, 2016, pages 3611 - 3622, XP055728763, DOI: 10.1523/JNEUROSCI.2693-15.2016
STEINMAN, ANN. REV. IMMUNOL., vol. 9, 1991, pages 271 - 96
STREET, K. ET AL.: "Slingshot: cell lineage and pseudotime inference for single-cell transcriptomics", BMC GENOMICS, vol. 19, 2018, pages 477
SWANSON ET AL., PNAS, vol. 108, 2011, pages 9619 - 9624
TAKAMURA, S: "Divergence of Tissue-Memory T Cells: Distribution and Function-Based Classification.", COLD SPRING HARB PERSPECT BIOL, vol. 12, 2020
TAVERNA, S.D.LI, H.RUTHENBURG, A.ALLIS, C.D.PATEL, D.J: "How chromatin-binding modules interpret histone modifications: Lessons from professional pocket pickers", NAT. STRUCT. MOL. BIOL., vol. 14, 2007, pages 1025 - 1040
TAXMAN DJ: "siRNA and shRNA design", RNA INTERFERENCE METHODS FOR PLANTS AND ANIMALS, vol. 10, 2009, pages 228 - 253
TURTLE ET AL., CURR. OPIN. IMMUNOL., vol. 24, no. 5, October 2012 (2012-10-01), pages 633 - 39
UDAGAWA, S. ET AL.: "The production of chaetoglobosins, sterigmatocystin, O-methylsterigmatocystin, and chaetocin by Chaetomium spp. and related fungi", CAN. J. MICROBIOL, vol. 25, 1979, pages 170 - 177
ULITSKY ET AL., CELL, vol. 147, no. 7, 2011, pages 1537 - 1550
VAN IMPE KBETHUYNE JCOOL SIMPENS FRUANO-GALLEGO DDE WEVER OVANLOO BVAN TROYS MLAMBEIN KBOUCHERIE C ET AL.: "A nanobody targeting the F-actin capping protein CapG restrains breast cancer metastasis", BREAST CANCER RES, vol. 15, 2013, pages R116, XP021173961, DOI: 10.1186/bcr3585
VERARDIET AH, HUM VACCIN IMMUNOTHER, vol. 8, July 2012 (2012-07-01)
VON HOESSLIN, M. ET AL.: "Secondary infections rejuvenate the intestinal CD103 tissue-resident memory T cell pool", SCI. IMMUNOL, vol. 7, 2022
WANG ET AL., PROC NATL ACAD SCI U S A., vol. 113, no. 11, 2016, pages 2868 - 2873
WANG, C. ET AL.: "Reprogramming of H3K9me3-dependent heterochromatin during mammalian embryo development", NAT CELL BIOL, vol. 20, 2018, pages 620 - 631, XP036488742, DOI: 10.1038/s41556-018-0093-4
WANG, HAIYING ET AL.: "A simple and effective method to purify and activate T cells for successful generation of chimeric antigen receptor T (CAR-T) cells from patients with high monocyte count", JOURNAL OF TRANSLATIONAL MEDICINE, vol. 20, 19 December 2022 (2022-12-19)
WANG, T.XU, C.LIU, Y.FAN, K.LI, Z.SUN, X.OUYANG, H.ZHANG, X.ZHANG, J.LI, Y. ET AL.: "Crystal Structure of the Human Suv39h1 Chromodomain and Its Recognition of Histone H3K9me2/3", PLOS ONE, vol. 7, 2012, pages e52977
WEBBER BRLONETREE C-IKLUESNER MGJOHNSON MJPOMEROY EJDIERS MD ET AL.: "Highly efficient multiplex human T cell engineering without double-strand breaks using Cas9 base editors.", NAT COMMUN, vol. 10, no. 1, 2019, pages 5222, XP055834302, DOI: 10.1038/s41467-019-13007-6
WEBER ET AL., PLOS ONE, vol. 6, 2011, pages el9722
WEBER, H. P. ET AL.: "The molecular structure and absolute configuration of chaetocin", ACTA CRYST, vol. B28, no. 28097-03-2, 1972, pages 2945 - 2951
WEINER ET AL., SCIENTIFIC AMERICAN, vol. 281, 1999, pages 129 - 41
WEIRICH SKHELLA MSJELTSCH A: "Structure, Activity and Function of the Suv39h1 and Suv39h2 Protein Lysine Methyltransferases", LIFE, vol. 11, no. 7, 2021, pages 703, XP093039687, DOI: 10.3390/life11070703
WIJEYESINGHE, S. ET AL.: "Expansible residence decentralizes immune homeostasis", NATURE, 2021
WILBIE ET AL., ACC CHEM RES., vol. 52, no. 6, 2019, pages 1555 - 1564
WU ET AL., CANCER, no. 2, 18 March 2012 (2012-03-18), pages 160 - 75
WU, T.HU, Y.LEE, Y: "Lung-resident memory CD8 T cells (TRM) are indispensable for optimal cross-protection against pulmonary virus infection", JOURNAL OF LEUKOCYTE, 2014
YANG ET AL., MOL CELL, vol. 49, 2013, pages 1083 - 1096
YIN ET AL., CELL STEM CELL, vol. 16, no. 5, 7 May 2015 (2015-05-07), pages 504 - 16
ZENG WBALL AR JRYOKOMORI K.: "HP1: heterochromatin binding proteins working the genome", EPIGENETICS, vol. 5, no. 4, 2010, pages 287 - 292
ZHANG ET AL.: "Overexpression of IncRNAs with endogenous lengths and functions using a IncRNA delivery system based on transposon", J NANOBIOTECHNOL, vol. 19, 2021, pages 303

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN121202972A (en) * 2025-09-23 2025-12-26 北京大学 A short peptide targeting SUV39H1 and its application in tumor treatment

Similar Documents

Publication Publication Date Title
AU2019262218B2 (en) Natural killer cells engineered to express chimeric antigen receptors with immune checkpoint blockade
JP7672702B2 (en) Multiplex genome editing of immune cells to enhance function and resistance to inhibitory environments
US20220265718A1 (en) Immune cells expressing engineered antigen receptors
ES2993268T3 (en) Genetically engineered t cells with regnase-1 and/or tgfbrii disruption have improved functionality and persistence
JP2024001104A (en) Modified cells and methods of treatment
US11186825B2 (en) Compositions and methods for evaluating and modulating immune responses by detecting and targeting POU2AF1
US12241053B2 (en) Modulation of novel immune checkpoint targets
JP2022519935A (en) How to make CAR-NK cells and how to use them
WO2017075478A2 (en) Compositions and methods for evaluating and modulating immune responses by use of immune cell gene signatures
WO2025052001A1 (en) Methods and compositions for improving immune response
KR20250008931A (en) Cryopreservation of NK cell products for off-the-shelf immunotherapy
JP2024531910A (en) LAT-activated chimeric antigen receptor T cells and methods of use thereof
EP4520334A1 (en) Methods and compositions for improving immune response
US20240390419A1 (en) Cd3 epsilon chimeric antigen receptors and methods of use thereof
JP2025529218A (en) Modulation of B-cell translocation gene 1 (BTG1) for use in adoptive cell therapy
US20220401479A1 (en) Large-scale combined car transduction and crispr gene editing of t cells
EA048895B1 (en) MULTIPLEX GENOME EDITING OF IMMUNE CELLS TO ENHANCE FUNCTIONALITY AND RESISTANCE TO SUPPRESSIVE ENVIRONMENTS

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 24765682

Country of ref document: EP

Kind code of ref document: A1