WO2024253598A1 - Gpc3 chimeric antigen receptor secreting - Google Patents
Gpc3 chimeric antigen receptor secreting Download PDFInfo
- Publication number
- WO2024253598A1 WO2024253598A1 PCT/SG2024/050386 SG2024050386W WO2024253598A1 WO 2024253598 A1 WO2024253598 A1 WO 2024253598A1 SG 2024050386 W SG2024050386 W SG 2024050386W WO 2024253598 A1 WO2024253598 A1 WO 2024253598A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- sequence
- cdr
- identity
- chain variable
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/33—Antibodies; T-cell engagers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4261—Proteoglycans, e.g. glypican, brevican or CSPG4
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/303—Liver or Pancreas
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/53—Liver
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/50—Cell markers; Cell surface determinants
- C12N2501/515—CD3, T-cell receptor complex
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
Definitions
- the present disclosure relates broadly to antigen binding proteins, chimeric antigen receptors, and modified cells specific to Epithelial Cellular Adhesion Molecule (EpCAM).
- EpCAM Epithelial Cellular Adhesion Molecule
- the present disclosure relates to cell that expresses a chimeric antigen receptor targeting a tumour antigen, and a multi-specific antigen binding protein, variant or binding fragment thereof that binds one or more target, comprising a first antigen binding protein, variant or binding fragment thereof that binds to EpCAM (epithelial cell adhesion molecule) and a second antigen binding protein, variant or binding fragment thereof that binds to an immune cell marker.
- EpCAM epithelial Cellular Adhesion Molecule
- HCC hepatocellular carcinoma
- the current standard of care in metastatic or unresectable patients with sufficient liver function is a combination of atezolizumab (anti-PD-L1) and bevacizumab (anti- VEGF). Thereafter, second line treatments are less well defined, and certainly there is a tremendous unmet need in post Atezo-Bev patients.
- the female breast cancers are another example, in which the epithelial tissue originated ductal carcinoma and lobular carcinoma are the most common primary breast cancer types and in total account for 90% of all breast cancer cases.
- tumours found in skin ovary (>90%), kidney (>85%), lung (>85%), stomach (-89%), pancreas (>90%), head and neck (>90%) and prostate gland (>95%), among which the majorities are carcinomas.
- ovary >90%)
- kidney >85%
- lung >85%
- stomach 89%
- pancreas >90%)
- head and neck >90%)
- prostate gland >95%)
- the majorities are carcinomas.
- the chance of cure for “carcinoma in situ” is high, the five-year survival rate for most invasive or metastatic carcinomas are around 20-30%, even if multiple treatment modalities, such as surgery, chemotherapy, radiotherapy, and targeted therapies, are available.
- CAR chimeric antigen receptor
- Glypican 3 is an oncofoetal protein that can be used as a highly tumour-specific target. It is widely expressed during embryonic development; however, its expression is strictly suppressed in most adult tissues. Elevated GPC3 expression has been reported in a wide variety of tumour types such as liver, lung, gastric, ovarian, oesophageal and many others. Immunotherapies such as CAR T cell therapies targeting GPC3 has clinically proven to have some treatment efficacy and be generally safe. However, only a very limited number of patients achieved complete remission (CR).
- CAR T cell therapies targeting GPC3 has clinically proven to have some treatment efficacy and be generally safe. However, only a very limited number of patients achieved complete remission (CR).
- CAR T therapies using the FDA approved anti-CD19 directed “Kymriah” or “Yescarta” in treating various B cell originated leukaemia and lymphomas also faced the same problem of antigen escape.
- CAR T cells with dual targeting were often applied and the bispecific anti-CD19/CD20 CAR T-cell therapy had shown early promise to treat the relapsed or refractory B-cell Lymphomas.
- CAR T cells have intrinsic properties of high potency in killing cancer cells, a design of dual CAR with multiple targeting of two or more antigens may induce intolerable on-target, off-tumour toxicity and hence are considered extremely dangerous to patients with solid tumours.
- EpCAM Epithelial Cellular Adhesion Molecule
- Cancer therapy targeting EpCAM has undergone more than 10 years of clinical development.
- EpCAM is also expressed at low levels on normal epithelia
- anti- EpCAM CAR T cells have been demonstrated to be highly toxic to normal tissues. Due to the same fact, both Solitomab and Catumaxomab (anti-EpCAM BiTE) showed dose-limiting toxicities and failed to achieve FDA approval.
- EpCAM is found to be co-expressed with GPC3 in many cancers.
- a treatment that GPC3- targeting CAR T cells secreting anti-EpCAM bispecific T cell engager (BiTE) was developed in this present disclosure so that the presence of anti-EpCAM BiTE is restricted at tumour site to contribute to tumour eradication and tumour escape prevention to the maximal extent and at the same time avoid systemic toxicity.
- These CAR T cells were named as “GE CAR-BiTE T” (GPC3 targeting CAR T cells with anti-EpCAM BiTE secretion.
- CAR-BiTE T cells secreting anti-EpCAM BiTE first infiltrate and retain at the tumour site via CAR recognition of the specific tumour antigen expressed on the tumour cells.
- the CAR T cells Upon CAR target engagement, the CAR T cells will be activated and begin to expand and at the same time secrete anti-EpCAM BiTEs.
- the anti-EpCAM BiTEs exert their cytotoxicity by recruiting the T cells nearby.
- bystander T cells are physically directed to the close proximity of tumours and at the same time being activated and subsequently help the clearance of tumour cells. Since GPC3 overexpression is tumour-specific, the expansion of the anti-EpCAM BiTEs is presumably restricted at or near the tumour sites.
- EpCAM is also defined as a cancer stem cell marker as it is found to be expressed on cancer progenitor cells and cancer stem cells as well. Secretion of anti-EpCAM BITE by CAR T cells will concomitantly contribute to the prevention of cancer relapse and recurrence by eliminating cancer stem cells and progenitor cells.
- the GE CAR-BiTE cells equipped with the new BiTEs displayed superior properties in killing HepG2 and HT-29 cells at a comparable potency as MT110 BiTE. While T cells secreting MT110 also induced strong cytotoxicity against HeyA8 cells, GE CAR-BiTE T cells using the new BiTEs spared these target negative cells (FIGURE 5C, 5D and 5E). Furthermore, anti-EpCAM BiTE could be injected into tumour sites for targeted treatment.
- the anti-EpCAM BiTE of the present disclosure which is secreted by the CAR T cells only locally at the tumour site (and not administered systematically) restricts its potential toxicity. This turns an undruggable (or a difficult) target into a druggable target.
- a multi-specific antigen binding protein, variant or binding fragment thereof that binds one or more target comprising a first antigen binding protein, variant or binding fragment thereof that binds to EpCAM (epithelial cell adhesion molecule) and a second antigen binding protein, variant or binding fragment thereof that binds to an immune cell marker, wherein the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region and/or a light chain variable region selected from the group consisting of: (i) a heavy chain variable region comprising: (2C4, hu2C4, 1A5, 1 B8, 2B7, and 2D10) a CDR-H1 comprising:
- GSIFSGND SEQ ID NO: 25 - 2C4, hu2C4, 1A5, 2B7, and 2D10), or
- ITSGGST SEQ ID NO: 26 -204, hu2C4, 1A5, 2B7, and 2D10
- ITNGGST SEQ ID NO: 30 - 1 B8
- CDR-H3 comprising:
- a heavy chain variable region comprising: (1 B6, 101 , 1011 , 1 D4 and 1H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3)
- (ill) a heavy chain variable region comprising: (1 E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7)
- a light chain variable region comprising: (1 B6, 101, 1011 , 1 D4, 1 E4 and 1 H6) a CDR-L1 comprising:
- LGS SEQ ID NO: 10 -1 B6, 101 , 1011 , 1 D4 and 1 H6
- AAS SEQ ID NO: 20 - 1 E4
- CDR-L3 comprising:
- MQGLQTPYT SEQ ID NO: 23 - 1 H6; and or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region comprising: (1A5, 1 B8, 2B7, 2C4, 2D10 and hu2C4) a CDR-H1 comprising:
- GSIFSGND SEQ ID NO: 25 - 1A5, 2B7, 2C4, 2D10 and hu2C4
- ITSGGST SEQ ID NO: 26 - 1A5, 2B7, 2C4, 2D10 and hu2C4.
- TNGRWSGDTYYAHL SEQ ID NO: 33 - 2B7 or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (2C4-VHH, hu2C4-VHH, 1A5-VHH, and 2D10-VHH) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHH (SEQ ID NO: 27)
- a heavy chain variable region comprising: (1 B8-VHH) a CDR-H1 comprising GSSERFTS (SEQ ID NO: 29), a CDR-H2 comprising ITNGGST (SEQ ID NO: 30), and a CDR-H3 comprising MAGTS (SEQ ID NO: 31); and
- a heavy chain variable region comprising: (2B7-VHH) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHL (SEQ ID NO: 33) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region and/or a light chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (2C4, hu2C4, 1A5, and 2D10) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHH (SEQ ID NO: 27)
- a heavy chain variable region comprising: (1 B6, 1C1, 1C11, 1 D4, 1 H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3)
- a heavy chain variable region comprising: (1 E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7)
- a light chain variable region comprising: (1 B6 and 1C1) a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a light chain variable region comprising: (1C11) a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQGLQSPWT (SEQ ID NO: 15)
- a light chain variable region comprising: (1 D4) a CDR-L1 comprising QSLLHSNRYNY (SEQ ID NO: 17), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a light chain variable region comprising: (1 E4) a CDR-L1 comprising QSISDF (SEQ ID NO: 19), a CDR-L2 comprising AAS (SEQ ID NO: 20), and a CDR-L3 comprising QQSYIMPDT (SEQ ID NO: 21)
- a light chain variable region comprising: (1 H6) a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQGLQTPYT (SEQ ID NO: 23)
- a heavy chain variable region comprising: (1 B8-VHH) a CDR-H1 comprising GSSERFTS (SEQ ID NO: 29), a CDR-H2 comprising ITNGGST (SEQ ID NO: 30), and a CDR-H3 comprising MAGTS (SEQ ID NO: 31); and
- (x) a heavy chain variable region comprising: (2B7-VHH) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHL (SEQ ID NO: 33) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- (2B7-VHH) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHL (SEQ ID NO: 33) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain and/or a light chain variable domain selected from the group consisting of:
- a heavy chain variable domain comprising QVQLVESGGGLVQAGGSLRLSCAASGSIFSGNDMSWYRQAPGKGLE LVAVITSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYY CTNGRWSGDTYYAHHWGQGTL (SEQ ID NO: 37 - hu2C4-VHH)
- CTNGRWSGDTYYAHHWGQGTQ (SEQ ID NO: 36 - 2D10-VHH); and or fragment or variant or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical thereto and/or having two or three amino acids substitutions.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a single domain heavy chain variable domain having a sequence:
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (1 B6, 1C1 , 1C11, 1D4 and 1 H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3)
- a heavy chain variable region comprising: (1 E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7); and comprises a light chain variable region comprising: (1 B6, 1C1 , 1011 , 1 D4, 1E4 and 1 H6) a CDR-L1 comprising:
- LGS SEQ ID NO: 10 -1 B6, 101 , 1C11 , 1 D4 and 1H6
- AAS SEQ ID NO: 20 - 1 E4
- CDR-L3 comprising:
- MQGLQTPYT SEQ ID NO: 23 - 1 H6 or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region and a light chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (1 B6 and 1C1) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and a light chain variable region comprising: a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a heavy chain variable region comprising: (1C11) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and a light chain variable region comprising: a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQGLQSPWT (SEQ ID NO: 15)
- a heavy chain variable region comprising: (1D4) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and a light chain variable region comprising: a CDR-L1 comprising QSLLHSNRYNY (SEQ ID NO: 17), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a heavy chain variable region comprising: (1 H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and a light chain variable region comprising: a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQGLQTPYT (SEQ ID NO: 23); and
- a heavy chain variable region comprising: (1 E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7); and a light chain variable region comprising: (1 E4) a CDR-L1 comprising QSISDF (SEQ ID NO: 19), a CDR-L2 comprising AAS (SEQ ID NO: 20), and a CDR-L3 comprising QQSYIMPDT (SEQ ID NO: 21) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain and a light chain variable domain selected from the group consisting of: (i) a heavy chain variable domain comprising: (1 B6 and 1C1)
- LGGRFRYWGQGTL (SEQ ID NO: 4), and a light chain variable domain comprising
- LGGRFRYWGQGTL (SEQ ID NO: 4), and a light chain variable domain comprising
- LGGRFRYWGQGTL (SEQ ID NO: 4), and a light chain variable domain comprising
- PEDTAVYYCAREVEGSSYDAFDIWGQGTM (SEQ ID NO: 8), and a light chain variable domain comprising DIQLTQSPSSLSASVGDRVTITCRASQSISDFLNWYQQKPGKAPKLLIYAA
- a heavy chain variable domain comprising: (1 H6) EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWM GGIIPIFGTANYAQNFQGRVTMTADTSISTAYMELSSLRSEDTAVYYCARS LGGRFRYWGQGTL (SEQ ID NO: 4), and a light chain variable domain DVVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSP QLLIYLGSNRASGVPDRFSGSGSGTDFTLQISRVEAEDAGVYYCMQGLQT PYTFGQGTK (SEQ ID NO: 24), or fragment or variant or a sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical thereto and/or having two or three amino acids substitutions.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain encoded by a nucleotide sequence comprising:
- CTACTGGGGCCAGGGAACCCTG (SEQ ID NO: 41 - for clones 1B6, 101, 1C11 , 1 D4, 1 H6), or
- CAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATGCCC AGAAGACCGTATATCTGCAAACGAACGACTTGAAACCTGAGGACAC GGCCGTGTATTACTGCACAAACGGAAGATGGTCAGGCGATACTTA
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises heavy chain and/or light chain variable domains encoded by nucleotide sequences selected from the group consisting of:
- CTACTGGGGCCAGGGAACCCTG (SEQ ID NO: 41), and/or a light chain variable domain encoded by the nucleotide sequence comprising:
- CTACTGGGGCCAGGGAACCCTG (SEQ ID NO: 41), and/or a light chain variable domain encoded by the nucleotide sequence comprising:
- CTACTGGGGCCAGGGAACCCTG (SEQ ID NO: 41), and/or a light chain variable domain encoded by the nucleotide sequence comprising:
- CTACTGGGGCCAGGGAACCCTG (SEQ ID NO: 41), and/or a light chain variable domain encoded by the nucleotide sequence comprising:
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain encoded by the nucleotide sequence comprising:
- the multi-specific antigen binding protein, variant or fragment thereof is a bispecific antibody.
- the multi-specific antigen binding protein, variant or fragment thereof is an immune cell engager selected from the group comprising a T cell engager, an NK cell engager, a monocyte engager and a macrophage engager.
- the multi-specific antigen binding protein, variant or fragment thereof is a bispecific T cell engager (BiTE), such as an inducible BITE, a noninducible BiTE or a constitutive expression BiTE.
- BiTE bispecific T cell engager
- the second antigen binding protein, variant or binding fragment thereof of the immune cell engager binds to the immune marker selected from the group consisting of CD3, NKG2D, CD4, CD8, CD16, and CD64.
- the multi-specific antigen binding protein is an inducible bispecific T cell engager comprising a Heavy chain antibody variable region (i.e. VHH) and/or a single chain variable fragment (scFv).
- VHH Heavy chain antibody variable region
- scFv single chain variable fragment
- the cell for example selected from the group consisting of a T cell, a macrophage, a monocyte, and an NK cell.
- the cell is a T cell, optionally a CAR T-cell.
- I. binds to GPC3 and secretes an inducible bispecific T cell engager that targets EpCAM and CD3 (GE CAR-BiTE T); or
- CD19 CAR-BiTE T binds to CD19 and secretes an inducible bispecific T cell engager that targets EpCAM and CD3 (CD19 CAR-BiTE T).
- a host cell comprising the vector as described herein.
- a method of producing / generating the cell as described herein comprising introducing the polynucleotide as described herein into the cell.
- composition comprising the cell as described herein.
- method of treating a disease in a subject in need thereof comprises administering to the subject the cell or composition as described herein, optionally the disease is a proliferative disease, optionally a cancer.
- antigen binding protein herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multi-specific antibodies as long as they exhibit the desired antigen-binding activity.
- antibody as used herein relates to whole (i.e., full length) antibodies (i.e., comprising the elements of two heavy chains and two light chains) and functionally active fragments thereof (i.e., molecules that contain an antigen binding domain that specifically binds an antigen, also termed antibody fragments or antigen-binding fragments).
- functionally active fragments thereof i.e., molecules that contain an antigen binding domain that specifically binds an antigen, also termed antibody fragments or antigen-binding fragments.
- antibody encompasses monovalent, i.e., antibodies comprising only one antigen binding domain (e.g., one- armed antibodies comprising a full-length heavy chain and a full-length light chain interconnected, also termed “half-antibody”), and multivalent antibodies, i.e., antibodies comprising more than one antigen binding domain, e g., bivalent.
- antigen binding fragment refers to functionally active antibody binding fragments including but not limited to Fab, modified Fab, Fab', modified Fab', F(ab')2, Fv, single domain antibodies, scFv, Fv, bi, tri or tetra-valent antibodies, Bis-scFv, diabodies, triabodies, tetrabodies and epitope-binding fragments of any of the above.
- binding fragment refers to a fragment capable of binding a target peptide or antigen with sufficient affinity to characterize the fragment as specific for the peptide or antigen.
- mAb refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e. each individual of a monoclonal antibody preparation is identical except for possible mutations (e.g., naturally occurring mutations), that may be present in minor amounts. Certain differences in the protein sequences linked to post-translational modifications (for example, cleavage of the heavy chain C-terminal lysine, deamidation of asparagine residues and/or isomerization of aspartate residues) may nevertheless exist between the various different antibody molecules present in the composition. Contrary to polyclonal antibody preparations, each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
- diabody refers to two Fv pairs, a first VH/VL pair and a further VH/VL pair which have two inter-Fv linkers, such that the VH of a first Fv is linked to the VL of the second Fv and the VL of the first Fv is linked to the VH of the second Fv.
- trimer (also referred to a Fab(scFv)2) as employed herein refers to a Fab fragment with a first scFv appended to the C-terminai of the light chain and a second scFv appended to the C-terminal of the heavy chain.
- tetrabody refers to a format similar to the diabody comprising fours Fvs and four inter-Fv linkers.
- multivalent antibody refers to an antibody comprising more than one antigen binding domain e.g., bivalent.
- Fv refers to two variable domains of full-length antibodies, for example co-operative variable domains, such as a cognate pair or affinity matured variable domains, i.e. , a VH and VL pair.
- scFv refers to single chain variable fragment which is a fusion protein of the variable regions of the heavy and light chains of the immunoglobulins, connected with a short linker peptide of ten to about 25 amino acids.
- bis-scFv as described herein refers to a bispecific scFv.
- dsscFv or “disulphide-stabilised single chain variable fragment” as employed herein refers to a single chain variable fragment which is stabilised by a peptide linker between the VH and VL variable domain and also includes an inter-domain disulphide bond between VH and VL.
- DVD-lg also known as dual V domain IgG refers to a full-length antibody with 4 additional variable domains, one on the N-terminus of each heavy and each light chain.
- Fab refers to as used herein refers to an antibody fragment comprising a light chain fragment comprising a VL (variable light) domain and a constant domain of a light chain (CL), and a VH (variable heavy) domain and a first constant domain (CHI) of a heavy chain.
- Dimers of a Fab’ according to the present disclosure create a F(ab’)2 where, for example, dimerization may be through the hinge.
- F(ab’) refers to a monovalent fragment of a single light chain homodimer, which is obtained by pepsin digestion of IgG, followed by reduction of the light chain disulfide bond.
- F(ab’)2 refers to a fragment of IgG that is prepared by pepsin digestion of IgG.
- the F(ab’)2 fragment is a disulfide-linked homodimer of the two light chain dimers, so it retains bivalent epitope binding like whole IgG, but as it lacks the heavy chains, it is smaller in size compared to a whole IgG.
- F(ab’)2 and F(ab’) fragments do not bind to immunoglobulin receptors on cells, which can be useful for achieving specific staining of the primary antibody target.
- constant domain(s) or “constant region”, as used herein are used interchangeably to refer to the domain(s) of an antibody which is outside the variable regions.
- the constant domains are identical in all antibodies of the same isotype but are different from one isotype to another.
- the constant region of a heavy chain is formed, from N to C terminal, by CH1 -hinge -CH2-CH3-optionally CH4, comprising three or four constant domains.
- DiFab refers to two Fab molecules linked via their C-terminus of the heavy chains or two Fab’ molecules linked via one or more disulfide bonds in the hinge region thereof.
- antibody binding variant refers to a polypeptide, for example, an antibody possessing the desired characteristics described herein and comprising a VH and/or a VL that has at least about 80% amino acid sequence identity with a VH and/or a VL of the reference antibody.
- antibody variants include, for instance, antibodies wherein one or more amino acid residues are added to or deleted from the VH and/or a VL domain.
- an antibody variant will have at least about 80% amino acid sequence identity, alternatively at least about 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity, to an antibody described herein.
- variant antibodies will have no more than one conservative amino acid substitution as compared to an antibody sequence provided herein, alternatively no more than about any of 2, 3, 4, 5, 6, 7, 8, 9, or 10 conservative amino acid substitutions as compared to an antibody sequence provided herein.
- an 'immune cell refers to any cell of the immune system, including but not limited to T-cells, helper T-cells, B-cells, natural killer (NK) cells, dendritic cells (DC), granulocytes (such as basophils, eosinophils, neutrophils), mast cells, monocytes, and macrophages.
- epitopes or “binding site” in the context of antibodies refers to a site (or a part) on an antigen to which the paratope of an antibody binds or recognizes.
- Epitopes can be formed both from contiguous amino acids (also often called “linear epitopes”) or non-contiguous amino acids formed by tertiary folding of a protein (often called “conformational epitopes”).
- contiguous amino acids also often called “linear epitopes”
- non-contiguous amino acids formed by tertiary folding of a protein often called “conformational epitopes”.
- An epitope typically includes at least 3, and more usually, at least 5-10 amino acids in a unique spatial conformation.
- Epitopes usually consist of chemically active surface groups of molecules such as amino acids, sugar side chains and usually have specific 3D structural and charge characteristics.
- the "class" of an antibody refers to the type of constant domain or constant region possessed by its heavy chain.
- the heavy chain constant domains that correspond to the different classes of immunoglobulins are called a, d, e, g, and m, respectively.
- chimeric antibody is an antibody molecule (or antigen-binding fragment thereof) in which (a) the constant region, or a portion thereof, is altered, replaced or exchanged so that the antigen binding site (variable region) is linked to a constant region of a different or altered class, effector function and/or species, or an entirely different molecule which confers new properties to the chimeric antibody, e. g., an enzyme, toxin, hormone, growth factor, drug, etc.; or (b) the variable region, or a portion thereof, is altered, replaced or exchanged with a variable region having a different or altered antigen specificity.
- a mouse antibody can be modified by replacing its constant region with the constant region from a human immunoglobulin. Due to the replacement with a human constant region, the chimeric antibody can retain its specificity in recognizing the antigen while having reduced antigenicity in human as compared to the original mouse antibody.
- chimeric antigen receptors refers to receptor protein that has been engineered to give T cells the new ability to target a specific antigen.
- the receptors are chimeric in that they combine both antigen-binding and T cell activating functions into a single receptor.
- CAR T cell therapy uses T cells engineered with CARs to treat cancer.
- T cells in CAR T immunotherapy are modified to recognize cancer cells in order to more effectively target and destroy them.
- CAR T cells can be derived either from T cells in a patient’s own blood (autologously) or from the T cells of another, healthy, donor (allogeneically). Once isolated from a person, these T cells are genetically engineered to express a specific CAR, which programs them to target an antigen that is present on the surface of tumours.
- CAR T cells are engineered to be specific to an antigen that is expressed on a tumour but is not expressed on healthy cells.
- CAR T cells destroy cells through extensive stimulated cell proliferation, increasing the degree to which they are toxic to other living cells (cytotoxicity) and by causing the increased secretion of factors that can affect other cells such as cytokines, interleukins and growth factors.
- the surface of CAR T cells can bear either two types of co-receptors, CD4 and CD8, each with different and interacting cytotoxic effects.
- human antibody or “humanized antibody” (or antigen-binding fragment thereof), as used herein, is intended to include antibodies (and antigen-binding fragments thereof) having variable regions in which both the framework and CDR regions are derived from sequences of human origin.
- antibodies or immunoglobulins are divided into the classes: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (subtypes), e.g. lgG1, lgG2, lgG3, and lgG4, lgA1 , and lgA2.
- human IgG constant region domains may be used, especially of the lgG1 and lgG3 isotypes when the antibody molecule is intended for therapeutic uses and antibody effector functions are required.
- lgG2 and lgG4 isotypes may be used when the antibody molecule is intended for therapeutic purposes and antibody effector functions are not required.
- the constant region also is derived from such human sequences.
- a humanized antibody (or antigen-binding fragment thereof) retains the reactivity of a non-human antibody while being less immunogenic in humans.
- the humanized antibodies of the present disclosure may include amino acid residues not encoded by human sequences (e. g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo, or a conservative substitution to promote stability or manufacturing). This definition of a humanized antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
- Human antibodies can be produced using various techniques known in the art, including phage-display libraries, administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e. g., immunized Xeno mice via a human B-cell hybridoma technology.
- recombinant humanized antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies isolated from a host cell transformed to express the humanized antibody, e. g., from a transfectoma, and antibodies prepared, expressed, created or isolated by any other means that involve splicing of all or a portion of a human immunoglobulin gene, sequences to other DNA sequences.
- isolated means, throughout this specification, that the antibody, or polynucleotide, as the case may be, exists in a physical milieu distinct from that in which it may occur in nature.
- isolated nucleic acid refers to a nucleic acid molecule that has been isolated from its natural environment or that has been synthetically created.
- An isolated nucleic acid may comprise synthetic DNA, for instance produced by chemical processing, cDNA, genomic DNA or any combination thereof.
- An isolated antibody refers to an antibody that is substantially free of other cellular material and/or chemicals.
- CDRs Complementarity Determining Regions
- Kabat i.e., "Kabat” numbering scheme
- Al-Lazikani Chothia
- ImMunoGenTics IMGT numbering scheme
- CDRs Complementarity Determining Regions
- Antibodies typically comprise six CDRs: three in the VH (H1 , H2, H3), and three in the VL (L1, L2, L3).
- sequence identity refers to the percentage sequence identities that are determined with antibody sequences maximally aligned by the Kabat numbering convention. After alignment, if a subject antibody region (e.g., the entire mature variable region of a heavy or light chain) is being compared with the same region of a reference antibody, the percentage sequence identity between the subject and reference antibody regions is the number of positions occupied by the same amino acid in both the subject and reference antibody region divided by the total number of aligned positions of the two regions, with gaps not counted, multiplied by 100 to convert to percentage.
- the antigen binding protein comprises a sequence that is at least 60% identical to any one of the sequences disclosed herein.
- the antigen binding protein may comprise a sequence that is at least about 60%, at least about 61%, at least about 62%, at least about 63%, at least about 64%, at least about 65%, at least about 66%, at least about 67%, at least about 68%, at least about 69%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical
- the antigen binding protein comprises a sequence or an amino acid region or is encoded by a nucleotide region that differs by about one, about two, about three, about four, about five, about six, about seven, about eight, about nine, about ten or more amino acids or nucleobase with the sequence as disclosed herein.
- the antigen binding protein comprises an amino acid sequence having one or more amino acid mutations with respect to any one of the sequences disclosed herein.
- the antigen binding protein comprises an amino acid sequence having one, or two, or three, or four, or five, or six, or seen, or eight, or nine, or ten, or fifteen, or twenty amino acid mutations with respect to any one of the sequences disclosed herein.
- the one or more amino acid mutations may be independently selected from substitutions, insertions, deletions, and truncations.
- the amino acid mutations are amino acid substitutions, and may include conservative and/or non-conservative substitutions.
- “Conservative substitutions” may be made, for instance, on the basis of similarity in polarity, charge, size, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the amino acid residues involved.
- the 20 naturally occurring amino acids can be grouped into the following six standard amino acid groups: (1) hydrophobic: Met, Ala, Vai, Leu, lie; (2) neutral hydrophilic: Cys, Ser, Thr; Asn, Gin; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; and (6) aromatic: Trp, Tyr, Phe.
- “conservative substitutions” are defined as exchanges of an amino acid by another amino acid listed within the same group of the six standard amino acid groups shown above. For example, the exchange of Asp by Glu retains one negative charge in the so modified polypeptide.
- glycine and proline may be substituted for one another based on their ability to disrupt a-helices.
- non-conservative substitutions are defined as exchanges of an amino acid by another amino acid listed in a different group of the six standard amino acid groups (1) to (6) shown above.
- the substitutions may also include non-classical amino acids.
- Illustrative non-classical amino acids include, but are not limited to, selenocysteine, pyrrolysine, N-formylmethionine p-alanine, GABA and 5-Aminolevulinic acid, 4- aminobenzoic acid (PABA), D-isomers of the common amino acids, 2,4-diaminobutyric acid, a-amino isobutyric acid, 4-aminobutyric acid, Abu, 2-amino butyric acid, y-Abu, s- Ahx, 6-amino hexanoic acid, Aib, 2-amino isobutyric acid, 3-amino propionic acid, ornithine, norleucine, norvaline, hydroxyproline, sarcosme, citrulline, homocitrulline, cysteic acid, t-butylglycine, t-butylalanine,
- amino acid mutation may be in the CDRs of the antigen binding protein (e.g., the CDR1, CDR2 or CDR3 regions).
- amino acid alteration may be in the framework regions (FRs) of the antigen binding protein (e.g., the FR1 , FR2, FR3, or FR4 regions).
- the mutations do not substantially reduce the antigen binding protein’s capability to specifically bind to a target. In some examples, the mutations do not substantially reduce the antigen binding protein’s capability to specifically bind to a target and without functionally modulating (e.g., partially or fully neutralizing) the target. Modification of the amino acid sequences may be achieved using any known technique in the art e.g., site-directed mutagenesis or PCR based mutagenesis.
- polynucleotide refers to a linear polymer whose molecule is composed of many nucleotide units, constituting a section of a nucleic acid molecule. Polynucleotides are made up of long chains of nucleotides like deoxyribonucleic acid (DNA) and ribonucleic acid (RNA).
- DNA deoxyribonucleic acid
- RNA ribonucleic acid
- affinity refers to the strength of all noncovalent interactions between an antibody thereof and the target protein.
- binding affinity refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
- the affinity of a molecule for its binding partner can be generally represented by the dissociation constant (KD). Affinity can be measured by common methods known in the art, including those described herein.
- Kd refers to the constant of dissociation which is obtained from the ratio of Kd to Ka (i.e. Kd / Ka) and is expressed as a molar concentration (M).
- Kd and Ka refer to the dissociation rate and association rate, respectively, of a particular antigen-antibody interaction.
- KD values for antibodies can be determined using methods well established in the art.
- the term “low affinity” refers to KD of 100 nM or more.
- moderate affinity refers to KD ranging from 10nM to 100nM.
- high affinity refers to KD of 1 to 10nM.
- very high affinity refers to KD of 1nM or less.
- EC50 refers to the concentration of an antibody or an antigen-binding protein/portion thereof, which induces a response, either in an in vivo or an in vitro assay, which is 50% of the maximal response (i.e., halfway between the maximal response and the baseline).
- multi-specific or “multi-specific antibody” as employed herein refers to an antibody as described herein which has at least two binding domains, i.e. two or more binding domains, for example two or three binding domains, wherein the at least two binding domains independently bind two different antigens or two different epitopes on the same antigen.
- Multi-specific antibodies are generally monovalent for each specificity (antigen).
- Muiti-specific antibodies described herein encompass monovalent and multivalent, e.g. bivalent, trivalent, tetr forest multi-specific antibodies.
- bispecific or “bispecific antibody” as employed herein refers to an antibody with two antigen specificities or an antibody that has the ability to simultaneously bind to two target antigens/sites.
- a “bispecific T cell engager” refers to a class of artificial bispecific monoclonal antibodies that direct a host’s immune system, such as the T cells’ cytotoxic activity against target cells (such as cancer cells).
- BiTEs are fusion proteins consisting of two single-chain variable fragments (scFvs) of different antibodies, or amino acid sequences from four different genes, on a single peptide chain of about 55 kDa.
- One of the scFvs binds to an immune cell (such as a T cell via the CD3 receptor), and the other to target of interest (e.g., a tumour cell via a tumour specific molecule).
- BiTEs form a link between an immune cell (e.g., a T cell) and a target cell (such as a tumour cell). This causes the immune cell (e.g., T cell) to exert cytotoxic activity on tumour cells. For example, if the immune cell is a T cell, the T cell would exert cytotoxic activity by producing proteins like perforin and granzymes that enter tumour cells and initiate the cell’s apoptosis.
- BiTE may refer to the BiTE® immune-oncology platform that was developed by Amgen® Oncology. In some examples, BiTE may also refer to the bispecific T-cell engager platform as known in the art that refers to recombinant proteins that simultaneously bind two different antigens and have the ability to engage an immune cell (such as T cell).
- the term “nanobody” refers to a single domain antibody (sdAb), with an antibody fragment consisting of a single monomeric variable antibody domain.
- the bispecific T cell engager (BiTE) is a nanobody with a heavy chain only (VHH).
- a “nanobody with a heavy chain only” refers to nanobodybased heavy chain antibody.
- a heavy-chain antibody is an antibody which consists of two heavy chains and lacks the two light chains usually found in antibodies.
- a "vector” is any molecule or composition that has the ability to carry a nucleic acid sequence into a suitable host cell where e.g., synthesis of the encoded polypeptide can take place.
- a vector is a nucleic acid that has been engineered, using recombinant DNA techniques that are known in the art, to incorporate a desired nucleic acid sequence (e.g., a nucleic acid of the present disclosure).
- Expression vectors typically contain one or more of the following components (if they are not already provided by the nucleic acid molecules): a promoter, one or more enhancer sequences, an origin of replication, a transcriptional termination sequence, a complete intron sequence containing a donor and acceptor splice site, a leader sequence for secretion, a ribosome binding site, a polyadenylation sequence, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element.
- Vectors are typically selected to be functional in the host cell in which the vector will be used (the vector is compatible with the host cell machinery such that amplification of the gene and/or expression of the gene can occur.
- the vector as described herein may be an expression vector and/or a cloning vector.
- host cell is intended to refer to a cell into which an expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term “host cell” as used herein.
- treating refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) a medical condition, which includes but is not limited to diseases, symptoms and disorders.
- a medical condition also includes a body’s response to a disease or disorder, e.g. inflammation.
- Those in need of such treatment include those already with a medical condition as well as those prone to getting the medical condition or those in whom a medical condition is to be prevented.
- subject as used herein includes patients and non-patients.
- patient refers to individuals suffering or are likely to suffer from a medical condition
- non-patients refer to individuals not suffering and are likely to not suffer from the medical condition.
- Non-patients include healthy individuals, non-diseased individuals and/or an individual free from the medical condition.
- subject includes humans and animals. Animals may include, but is not limited to, mammals (for example nonhuman primates, canine, murine and the like), and the like.
- “Murine” refers to any mammal from the family Muridae and I or Leporidae, such as mouse, rat, rabbit, and the like.
- preventing and/or “reducing the severity of symptoms” refers to process of delaying the onset, reducing the severity of symptoms, reducing and/or preventing weight loss, preventing death, inhibiting deterioration, inhibiting further deterioration, and/or ameliorating at least one sign or symptom of a disease.
- the term "and/or”, e.g., "X and/or Y” is understood to mean either "X and Y" or "X or Y" and should be taken to provide explicit support for both meanings or for either meaning.
- the word “substantially” whenever used is understood to include, but not restricted to, “entirely” or “completely” and the like.
- terms such as “comprising”, “comprise”, and the like whenever used are intended to be non-restricting descriptive language in that they broadly include elements/components recited after such terms, in addition to other components not explicitly recited.
- reference to a “one” feature is also intended to be a reference to “at least one” of that feature.
- Terms such as “consisting”, “consist”, and the like may in the appropriate context, be considered as a subset of terms such as “comprising”, “comprise”, and the like.
- the individual numerical values within the range also include integers, fractions and decimals. Furthermore, whenever a range has been described, it is also intended that the range covers and teaches values of up to 2 additional decimal places or significant figures (where appropriate) from the shown numerical end points. For example, a description of a range of 1% to 5% is intended to have specifically disclosed the ranges 1 .00% to 5.00% and also 1 .0% to 5.0% and all their intermediate values (such as 1 .01 %, 1.02% ... 4.98%, 4.99%, 5.00% and 1.1%, 1.2% ... 4.8%, 4.9%, 5.0% etc.,) spanning the ranges. The intention of the above specific disclosure is applicable to any depth/breadth of a range.
- At least 95% identical as employed herein is intended to refer to an amino acid sequence which over its full length is 95% identical or more to a reference sequence, such as 96, 97, 98 or 99% identical. Software programmes can be employed to calculate percentage identity.
- the disclosure may have disclosed a method and/or process as a particular sequence of steps. However, unless otherwise required, it will be appreciated that the method or process should not be limited to the particular sequence of steps disclosed. Other sequences of steps may be possible. The particular order of the steps disclosed herein should not be construed as undue limitations. Unless otherwise required, a method and/or process disclosed herein should not be limited to the steps being carried out in the order written. The sequence of steps may be varied and still remain within the scope of the disclosure.
- engineering an cell in order for the EpCAM BiTE to be secreted at the target site minimizes toxicity, reduces side effects, and/or reduces non-specific cytotoxicity.
- the target antigen is a molecule associated with a disease.
- the molecule may be an extracellular molecule, an intracellular molecule, and/or a transmembrane molecule.
- the molecule may be a polypeptide, a polynucleotide, a carbohydrate, and the like.
- the chimeric antigen receptor targets a diseased cell.
- the diseased cells may include but are not limited to a cell from a proliferative disease (such as tumour / cancer, an inflammatory disease), and the like.
- the diseased cell may be a cell from cancer / tumour, optionally the cancer cell is a solid tumour.
- the solid tumour may include tumours with epithelial origins such as carcinoma.
- carcinoma may include but is not limited to liver cancer (such as hepatocellular carcinoma), lung cancer (such as lung squamous cell carcinoma), stomach cancer (such as gastric adenocarcinoma), breast cancer, skin cancer (such as melanoma), ovary cancer (such as ovarian clear cell carcinoma), kidney cancer, pancreas cancer, head and neck cancer, prostate gland cancer, esophagus cancer, bladder cancer, colon cancer, childhood cancers (such as hepatoblastomas, nephroblastomas, yolk sac tumours, and the like), and the like.
- the tumour cell may include benign, premalignant, malignant tumours, and the like.
- the tumour cell may include a stem cell, a progenitor cell, and the like.
- the tumour cell may include a human xenograft in an animal model.
- the human xenograft may include Hep3B, HepG2, and the like.
- the human xenograft is a Hep3B xenograft and / or a HepG2 xenograft in a mice model.
- the tumour cell may include tumour cell lines such as but is not limited to gastric adenocarcinoma cell line (such as AGS), breast cancer cell line (such as MDA-MB468), liver adenocarcinoma cell line (such as Hep3B (GPC3 High EpCAM High ), HepG2 (GPC3 High EpCAM High ), HT-29 (GPC3 l0W EpCAM High ), HeyA8 (GPC3- ve EpCAM- ve ), Huh7 (GPC3 High EpCAM High ), and the like.
- gastric adenocarcinoma cell line such as AGS
- breast cancer cell line such as MDA-MB4608
- liver adenocarcinoma cell line such as Hep3B (GPC3 High EpCAM High ), HepG2 (GPC3 High EpCAM High ), HT-29 (GPC3 l0W EpCAM High ), HeyA8 (GPC3- ve EpCAM- ve ), Huh7 (GP
- the target antigen is an epithelial marker, which may include but is not limited to receptor tyrosine-protein kinase erbB-2 (HER2), glypican 3 (GPC3), Claudin 18.2, receptor tyrosine kinase like orphan receptor 1 (ROR1), delta like canonical notch ligand 3 (DLL3), carcinoembryonic antigen (CEA), mucin 1 (MUC1), mucin 16 (MUC16), CEA Cell Adhesion Molecule 7 (CEACAM7), prominin-1 (CD133), cluster of differentiation 147 (CD147), prostate stem cell antigen (PSCA), prostate-specific membrane antigen (PSMA), mesothelin (MSLN), mesenchymal-epithelial transition factor (c-Met), folate receptor alpha (FRa), and the like.
- the chimeric antigen receptor binds to GPC3.
- GPC3 is a well-known oncofoetal protein that can be used as a highly tumour-specific target. It is widely expressed during embryonic development but strictly suppressed in most adult tissues. Elevated GPC3 expression has been reported in a wide variety of tumour types such as liver, lung, gastric, ovarian, oesophageal and many others. At the same time, EpCAM is widely expressed on almost all carcinomas but is also expressed at low levels on normal epithelia. Anti-EpCAM CAR T cells have been demonstrated to be highly toxic to normal tissues, with anti-EpCAM BITE (such as Solitomab and Catumaxomab) showing doselimiting toxicities and failed to achieve FDA approval.
- anti-EpCAM BITE such as Solitomab and Catumaxomab
- the inventors of the present disclosure engineered CAR-T cells to produce a second tumour-targeting molecule, namely the anti-EpCAM bispecific T cell engager (BiTEs), via secretion.
- EpCAM is a well-known tumour associated antigen that is frequently over-expressed in almost all solid tumours originating from the epithelium, however, neither CAR T cells nor systemically administered BiTEs targeting EpCAM has ever achieved success due to its high systematic toxicity as EpCAM is also widely expressed on normal epithelia, albeit at low levels.
- Secretion of anti-EpCAM BITE by CAR-T cells localizes the anti-EpCAM BiTE at or near the tumour site, which not only reduces tumour escape but also greatly enhances safety.
- GPC3 targeting CAR-T cells as the carriers of anti-EpCAM BiTEs.
- the present disclosure demonstrated that GPC3 targeting CAR T cells secreting anti-EpCAM BiTE (named as “GE CAR-BiTE T”) exerted superior efficacy in eradicating human xenograft tumours originating from hepatocellular carcinomas, both in vitro and in vivo.
- a multi-specific antigen binding protein, variant or binding fragment thereof that binds one or more target comprising a first antigen binding protein, variant or binding fragment thereof that binds to EpCAM (epithelial cell adhesion molecule) and a second antigen binding protein, variant or binding fragment thereof that binds to an immune cell marker, wherein the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region and/or a light chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (2C4, hu2C4, 1A5, 1 B8, 2B7, and 2D10) a CDR-H1 comprising:
- GSIFSGND SEQ ID NO: 25 - 2C4, hu2C4, 1A5, 2B7, and 2D10), or
- ITSGGST SEQ ID NO: 26 - 2C4, hu2C4, 1A5, 2B7, and 2D10), or
- ITNGGST SEQ ID NO: 30 - 1 B8
- CDR-H3 comprising:
- a heavy chain variable region comprising: (1 B6, 101 , 1011 , 1 D4 and 1H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3)
- a heavy chain variable region comprising: (1 E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7)
- a light chain variable region comprising: (1 B6, 1C1 , 1C11 , 1 D4, 1 E4 and 1 H6) a CDR-L1 comprising:
- LGS SEQ ID NO: 10 -1 B6, 101 , 1C11 , 1 D4 and 1 H6, or
- AAS SEQ ID NO: 20 - 1 E4
- CDR-L3 comprising:
- MQGLQTPYT SEQ ID NO: 23 - 1 H6; and or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region comprising: (2C4, hu2C4, 1A5, 1B8, 2B7, and 2D10) a CDR-H1 comprising:
- ITSGGST SEQ ID NO: 26 - 2C4, hu2C4, 1A5, 2B7, and 2D10), or
- TNGRWSGDTYYAHL SEQ ID NO: 33 - 2B7 or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (2C4-VHH, hu2C4-VHH, 1A5-VHH, and 2D10-VHH and) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHH (SEQ ID NO: 27)
- a heavy chain variable region comprising: (1 B8-VHH) a CDR-H1 comprising GSSERFTS (SEQ ID NO: 29), a CDR-H2 comprising ITNGGST (SEQ ID NO: 30), and a CDR-H3 comprising MAGTS (SEQ ID NO: 31); and
- a heavy chain variable region comprising: (2B7-VHH) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHL (SEQ ID NO: 33) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region and/or a light chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (2C4, hu2C4, 1A5, and 2D10) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHH (SEQ ID NO: 27)
- a heavy chain variable region comprising: (1 B6, 1C1 , 1C11 , 1 D4, 1 H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3)
- a heavy chain variable region comprising: (1E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7)
- a light chain variable region comprising: (1 B6 and 1C1) a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a light chain variable region comprising: (1011) a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQGLQSPWT (SEQ ID NO: 15)
- a light chain variable region comprising: (1 D4) a CDR-L1 comprising QSLLHSNRYNY (SEQ ID NO: 17), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a light chain variable region comprising: (1 E4) a CDR-L1 comprising QSISDF (SEQ ID NO: 19), a CDR-L2 comprising AAS (SEQ ID NO: 20), and a CDR-L3 comprising QQSYIMPDT (SEQ ID NO: 21)
- a light chain variable region comprising: (1 H6) a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQGLQTPYT (SEQ ID NO: 23)
- a heavy chain variable region comprising: (1 B8-VHH) a CDR-H1 comprising GSSERFTS (SEQ ID NO: 29), a CDR-H2 comprising ITNGGST (SEQ ID NO: 30), and a CDR-H3 comprising MAGTS (SEQ ID NO: 31); and
- (x) a heavy chain variable region comprising: (2B7-VHH) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHL (SEQ ID NO: 33) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- (2B7-VHH) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHL (SEQ ID NO: 33) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain and/or a light chain variable domain selected from the group consisting of:
- a heavy chain variable domain comprising QVQLVESGGGLVQAGGSLRLSCAASGSIFSGNDMSWYRQAPGKGLE LVAVITSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYY CTNGRWSGDTYYAHHWGQGTL (SEQ ID NO: 37 - hu2C4-VHH)
- CTNGRWSGDTYYAHLWGQGTQ (SEQ ID NO: 34 - 2B7-VHH) (xiii) a heavy chain variable domain comprising
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a single domain heavy chain variable domain having a sequence:
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (1 B6, 101 , 1011, 1D4 and 1 H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3)
- a heavy chain variable region comprising: (1 E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7); and/or comprises a light chain variable region comprising: (1 B6, 1C1 , 1C11 , 1 D4, 1E4 and 1 H6) a CDR-L1 comprising:
- LGS SEQ ID NO: 10 -1 B6, 1C1 , 1C11 , 1 D4 and 1H6
- AAS SEQ ID NO: 20 - 1 E4
- CDR-L3 comprising:
- MQGLQTPYT SEQ ID NO: 23 - 1 H6 or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region and/or a light chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (1 B6 and 101) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and/or a light chain variable region comprising: a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a heavy chain variable region comprising: (1C11) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and/or a light chain variable region comprising: a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQGLQSPWT (SEQ ID NO: 15)
- a heavy chain variable region comprising: (1D4) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and/or a light chain variable region comprising: a CDR-L1 comprising QSLLHSNRYNY (SEQ ID NO: 17), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a heavy chain variable region comprising: (1 H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and/or a light chain variable region comprising: a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQGLQTPYT (SEQ ID NO: 23); and
- a heavy chain variable region comprising: (1 E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7); and/or a light chain variable region comprising: (1 E4) a CDR-L1 comprising QSISDF (SEQ ID NO: 19), a CDR-L2 comprising AAS (SEQ ID NO: 20), and a CDR-L3 comprising QQSYIMPDT (SEQ ID NO: 21) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain and/or a light chain variable domain selected from the group consisting of:
- a heavy chain variable domain comprising: (1 B6 and 1C1) EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWM GGIIPIFGTANYAQNFQGRVTMTADTSISTAYMELSSLRSEDTAVYYCARS LGGRFRYWGQGTL (SEQ ID NO: 4), and/or a light chain variable domain comprising DVVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSP QLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQT PYTFGQGTK (SEQ ID NO: 12)
- a heavy chain variable domain comprising: (1C11) EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWM GGIIPIFGTANYAQNFQGRVTMTADTSISTAYMELSSLRSEDTAVYYCARS LGGRFRYWGQGTL (SEQ ID NO: 4), and/or a light chain variable domain comprising EIVLTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQ LLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQSP WTFGQGTK (SEQ ID NO: 16)
- a heavy chain variable domain comprising: (1 D4) EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWM GGIIPIFGTANYAQNFQGRVTMTADTSISTAYMELSSLRSEDTAVYYCARS LGGRFRYWGQGTL (SEQ ID NO: 4), and/or a light chain variable domain comprising DVVMTQSPLSLPVTPGESASISCRSSQSLLHSNRYNYLDWYLQKPGQSP QLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQT PYTFGQGTK (SEQ ID NO: 18)
- a heavy chain variable domain comprising: (1E4) QVQLQQSGPGLVKPSQTLSLTCAISGDSISSNSVAWNWIRQSPSRGLEWL GRTYYRSKWYSDYAISVKGRLDINPDTSKNQFSLQLNSVTPEDTAVYYCA REVEGSSYDAFDIWGQGTM (SEQ ID NO: 8), and/or a light chain variable domain comprising DIQLTQSPSSLSASVGDRVTITCRASQSISDFLNWYQQKPGKAPKLLIYAA SSLQTGVPSRFGGSGSGTEFTLTISSLQPEDLGTYYCQQSYIMPDTFGQG TK (SEQ ID NO: 22), or
- EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWM GGIIPIFGTANYAQNFQGRVTMTADTSISTAYMELSSLRSEDTAVYYCARS LGGRFRYWGQGTL (SEQ ID NO: 4), and/or a light chain variable domain DVVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSP QLLIYLGSNRASGVPDRFSGSGSGTDFTLQISRVEAEDAGVYYCMQGLQT PYTFGQGTK (SEQ ID NO: 24), or fragment or variant or a sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical thereto and/or having two or three amino acids substitutions.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a light chain constant domain having a sequence:
- RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTK SFSRGEC SEQ ID NO: 14 clone 1C1 - light chain constant domain
- fragment or variant or a sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical thereto and/or having two or three amino acids substitutions.
- the antigen binding protein, variant or fragment thereof comprises a heavy chain variable region and/or a light chain variable region encoded by nucleic acid sequences selected from the group consisting of:
- a heavy chain variable region comprising: (1 B6 and 1C1) a CDR-H1 comprising GGAGGCACCTTCAGCAGCTATGCT (SEQ ID NO: 38), a CDR-H2 comprising ATCATCCCTATCTTTGGTACAGCA (SEQ ID NO: 38),
- a CDR-H3 comprising GCGAGATCGTTGGGTGGGAGATTTCGCTAC (SEQ ID NO: 40); and/or a light chain variable region comprising: a CDR-L1 comprising
- CAGAGCCTCCTGCATAGTAATGGATACAACTAT (SEQ ID NO: 46)
- CDR-L2 comprising TTGGGTTCT
- CDR-L3 comprising ATGCAAGCTCTACAAACTCCGTACACT (SEQ ID NO: 48)
- a heavy chain variable region comprising: (1C11) a CDR-H1 comprising GGAGGCACCTTCAGCAGCTATGCT (SEQ ID NO: 38), a CDR-H2 comprising ATCATCCCTATCTTTGGTACAGCA (SEQ ID NO: 39), and a CDR-H3 comprising GCGAGATCGTTGGGTGGGAGATTTCGCTAC (SEQ ID NO: 40); and/or a light chain variable region comprising: a CDR-L1 comprising
- CAGAGCCTCCTGCATAGTAATGGATACAACTAT (SEQ ID NO: 46)
- CDR-L2 comprising TTGGGTTCT
- CDR-L3 comprising ATGCAAGGTCTACAAAGTCCCTGGACG (SEQ ID NO: 52)
- a heavy chain variable region comprising: (1 D4) a CDR-H1 comprising GGAGGCACCTTCAGCAGCTATGCT (SEQ ID NO: 38), a CDR-H2 comprising ATCATCCCTATCTTTGGTACAGCA (SEQ ID NO: 39), and a CDR-H3 comprising GCGAGATCGTTGGGTGGGAGATTTCGCTAC (SEQ ID NO: 40); and/or a light chain variable region comprising: a CDR-L1 comprising
- CAGAGCCTCCTGCATAGTAATAGATACAACTAT (SEQ ID NO: 54)
- CDR-L2 comprising TTGGGTTCT
- CDR-L3 comprising ATGCAAGCTCTACAAACTCCGTACACT (SEQ ID NO: 48)
- a heavy chain variable region comprising: (1 H6) a CDR-H1 comprising GGAGGCACCTTCAGCAGCTATGCT (SEQ ID NO:
- CAGAGCCTCCTGCATAGTAATGGATACAACTAT (SEQ ID NO: 46)
- CDR-L2 comprising TTGGGTTCT
- CDR-L3 comprising ATGCAAGGTCTACAGACTCCGTACACT
- a heavy chain variable region comprising: (1 E4) a CDR-H1 comprising GGGGACAGTATCTCTAGTAACAGTGTTGCT
- GCAAGAGAAGTTGAGGGCAGCAGCTATGATGCTTTTGATATC (SEQ ID NO: 44); and/or a light chain variable region comprising: (1 E4) a CDR-L1 comprising CAGAGTATTAGCGACTTT (SEQ ID NO: 56), a CDR-L2 comprising GCTGCATCG (SEQ ID NO: 57), and a CDR-L3 comprising TTACATTATGCCCGACACT (SEQ ID NO: 58) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the antigen binding protein, variant or fragment thereof comprises a heavy chain variable region encoded by nucleic acid sequences selected from the group consisting of:
- a heavy chain variable region comprising: (2C4-VHH, 1A5-VHH, 2D10-VHH and hu2C4-VHH) a CDR-H1 comprising GGAAGCATCTTCAGTGGCAATGAC (SEQ ID NO:
- a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO: 62), a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO: 62), a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO: 62), a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO: 62), a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO:
- a heavy chain variable region comprising: (1 B8-VHH) a CDR-H1 comprising GGAAGCTCCGAAAGATTCACATCA (SEQ ID NO: 66), a CDR-H2 comprising ATTACTAATGGTGGTAGCACA (SEQ ID NO: 67), and a CDR-H3 comprising ATGGCGGGTACGTCC (SEQ ID NO: 68); and
- a heavy chain variable region comprising: (2B7-VHH) a CDR-H1 comprising GGAAGCATCTTCAGTGGCAATGAC (SEQ ID NO: 62), a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO: 63), and a CDR-H3 comprising ACAAACGGAAGATGGTCAGGCGATACTTACTATGCCCATCTC (SEQ ID NO: 62), a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO: 63), and a CDR-H3 comprising ACAAACGGAAGATGGTCAGGCGATACTTACTATGCCCATCTC (SEQ ID NO: 62), a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO: 63), and a CDR-H3 comprising ACAAACGGAAGATGGTCAGGCGATACTTACTATGCCCATCTC (SEQ ID NO: 62),
- ID NO: 70 or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain encoded by a nucleotide sequence comprising:
- CTACTGGGGCCAGGGAACCCTG (SEQ ID NO: 41 - for clones 1B6, 101, 1011 , 1 D4, 1 H6), or
- CAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATGCCC AGAAGACCGTATATCTGCAAACGAACGACTTGAAACCTGAGGACAC GGCCGTGTATTACTGCACAAACGGAAGATGGTCAGGCGATACTTA
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain encoded by a nucleotide sequence comprising: (i) GAGGTCCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGG GTCCTCGGTGAAGGTCTCCTGCAAGGCTTCTGGAGGCACCTTCAG CAGCTATGCTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCT
- CTACTGGGGCCAGGGAACCCTG SEQ ID NO: 41 - for clones 1B6, 1C1, 1C11 , 1 D4, 1 H6), or
- CCAG (SEQ ID NO: 69 - clone 1B8), or (v) CAGGTGCAGCTGCAGGAGTCTGGGGGAGGCTTGGTGCAGCCTGG AGGGTCTCTGAGACTCTCCTGTGCAGACTCTGGAAGCATCTTCAG TGGCAATGACATGGCCTGGTACCGCCGGGCTCCAGGGGTGGAGC GCGAGTTGGTCGCGGTTATTACTAGCGGTGGTAGTACACACTATG CAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATGCCC AGAAGACCGTATATCTGCAAACGAACGACCTGAAACCTGAGGACA CGGCCGTGTATTACTGCACAAACGGAAGATGGTCAGGCGATACTT ACTATGCCCATCTCTGGGGCCAGGGGACCCAG (SEQ ID NO: 71 - clone 2B7), or
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises heavy chain and/or light chain variable domains encoded by nucleotide sequences selected from the group consisting of:
- CTACTGGGGCCAGGGAACCCTG (SEQ ID NO: 41), and/or a light chain variable domain encoded by the nucleotide sequence comprising:
- the antigen binding protein, variant or fragment thereof comprises comprises a light chain constant domain encoded by the nucleotide sequence comprising CGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCA GTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCC CAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTA ACTCCCAGGAGAGTGTCGCAGAGCAGGACAGCAAGGACAGCACCTACAG CCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAC TCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAG AGCTTCAACAGGGGAGAGTGT (SEQ ID NO: 50 - clone 1B6 - light chain constant domain), or CGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCA GTTGAAATCTGGAACTGCCTCTGTTG
- the multi-specific antigen binding protein may comprise an amino acid sequence having one or more amino acid mutations with respect to any one of the sequences disclosed herein.
- the antigen binding protein comprises an amino acid sequence having one, or two, or three, or four, or five, or six, or seen, or eight, or nine, or ten, or fifteen, or twenty amino acid mutations with respect to any one of the sequences disclosed herein.
- the one or more amino acid mutations may be independently selected from substitutions, insertions, deletions, and truncations.
- the amino acid mutations are amino acid substitutions, and may include conservative and/or non-conservative substitutions.
- the mutations do not substantially reduce the antigen binding protein’s capability to specifically bind to a target. In some examples, the mutations do not substantially reduce the antigen binding protein’s capability to specifically bind to a target and without functionally modulating (e.g., partially or fully neutralizing) the target.
- the multi-specific antigen binding protein may be a bispecific, a tri-specific, a tetra-specific antigen binding protein, and the like. In some examples, the multi-specific antigen binding protein is a bispecific antigen binding protein. In some examples, the multi-specific antigen binding protein, variant or fragment thereof is a bispecific antibody. In some examples, the multi-specific antigen binding protein may be provided as a nanobody. In some examples, the multi-specific antigen binding protein may be provided as a Fc region. In some examples, the multispecific antigen binding protein is an inducible bispecific T cell engager comprising a heavy chain antibody variable region (i.e. VHH) and/or a single chain variable fragment (scFv). In some embodiments, the bispecific T cell engager (BiTE) is a nanobody with a heavy chain only (VHH).
- VHH heavy chain antibody variable region
- scFv single chain variable fragment
- the bispecific T cell engager (BiTE) is a nanobody with
- the multi-specific antigen binding protein, variant or fragment thereof is an inducible bispecific immune cell engager. In some examples, the multispecific antigen binding protein is secreted by the cell, optionally an immune cell. In some examples, the multi-specific antigen binding protein, variant or fragment thereof is a bispecific T cell engager (BiTE).
- BiTE bispecific T cell engager
- a bispecific T cell engager refers to a class of artificial bispecific monoclonal antibodies that direct a host’s immune system, such as the T cells’ cytotoxic activity against target cells (such as cancer cells).
- BiTEs are fusion proteins consisting of two single-chain variable fragments (scFvs) of different antibodies, or amino acid sequences from four different genes, on a single peptide chain of about 55 kDa.
- scFvs single-chain variable fragments
- One of the scFvs binds to T cells via the CD3 receptor, and the other to a target of interest (e.g. a tumour cell via a tumour specific molecule).
- target of interest e.g. a tumour cell via a tumour specific molecule
- BiTEs form a link between T cells and target cells (such as tumour cells). This causes T cells to exert cytotoxic activity on the target cells (such as tumour cells) by producing proteins like perforin and granzymes that enter tumour cells and initiate the cell’
- BiTE may refer to the BiTE® immune-oncology platform that was developed by Amgen® Oncology. In some examples, BiTE may also refer to the bispecific T-cell engager platform as known in the art that refers to recombinant proteins that simultaneously bind two different antigens and have the ability to engage an immune cell (such as T cell).
- the bispecific T cell engager (BiTE) binds to two antigens; wherein the first antigen is EpCAM; and wherein the second antigen is an immune cell marker.
- the second antigen binding protein, variant or binding fragment thereof binds to the immune marker selected from the group consisting of CD3, NKG2D, CD4, CD8, CD16, and CD64.
- the multi-specific antigen binding protein is an inducible bispecific T cell engager comprising a Heavy chain antibody variable region (i.e. VHH) and/or a single chain variable fragment (scFv).
- VHH Heavy chain antibody variable region
- scFv single chain variable fragment
- the multi-specific antigen binding protein, variant or fragment thereof is an inducible bispecific T cell engager. In some examples, the multi-specific antigen binding protein is secreted by the cell. In some examples, the bispecific T cell engager (BiTE) binds to two antigens; wherein the first antigen is EpCAM; and wherein the second antigen is an immune cell marker. In some examples, the second antigen binding protein, variant or binding fragment thereof binds to the immune marker selected from the group consisting of CD3, NKG2D, CD4, CD8, CD16, CD64, and the like.
- the multi-specific antigen binding protein is an inducible bispecific T cell engager comprising a Heavy chain antibody variable region (i.e. VHH) and/or a single chain variable fragment (scFv).
- VHH Heavy chain antibody variable region
- scFv single chain variable fragment
- the bispecific T cell engager (BiTE) binds to two antigens; wherein the first antigen is an Epithelial Cellular Adhesion Molecule (EpCAM); and wherein the second antigen is CD3.
- the CD3 may include CD3 , CD3e, CD3y, CD36, and the like.
- the modified/engineered immune cell may be but is not limited to a macrophage, a dendritic cell, a T cell, a B cell, an eosinophil, a basophil, a neutrophil, a mast cell, a natural killer T cell (NKT cell), a natural killer cell (NK cell), a macrophage, a monocyte, and the like.
- the modified/engineered immune cell is a T cell, an NK cell, or a macrophage.
- the modified/engineered immune cell is a T cell.
- the cell may bind to more than one host cell antigen. Therefore, in some examples, the cell may further bind to one host cell antigen, two host cell antigens, three host cell antigens, four host cell antigens, and the like.
- the engineered cell binds to a target antigen and secretes a BiTE that targets EpCAM and CD3 (CAR-BITE T).
- the cell i. binds to GPC3 and secretes an inducible bispecific T cell engager that targets EpCAM and CD3 (GE CAR-BITE T); or ii. binds to CD19 and secretes an inducible bispecific T cell engager that targets EpCAM and CD3 (CD19 CAR-BiTE T).
- the cell binds to GPC3 and secretes a BiTE that targets EpCAM and CD3 (GE CAR-BiTE T).
- the CAR T cell targets GPC3 alone (GE CAR-T).
- the anti-EpCAM BiTEs exert their cytotoxicity by recruiting the immune cells (such as T cells) nearby.
- immune cells such as T cells
- bystander T cells are physically directed to the close proximity of tumours and at the same time being activated and help the clearance of tumour cells.
- CAR T cells By applying local secretion of anti-EpCAM BiTE by CAR T cells, it converts a non-druggable target into a druggable target as it diminishes the on- target, off-tumour toxicity that might be brought by systematic delivery.
- EpCAM is also defined as a cancer stem cell marker expressed on cancer progenitor cells and cancer stem cells
- secretion of anti-EpCAM BiTE by CAR T cells will concomitantly contribute to the prevention of cancer relapse and recurrence by eliminating cancer stem cells and progenitor cells.
- GPC3 targeting CAR T cells secreting anti-EpCAM BiTE exerted superior efficacy in eradicating human xenograft tumours originating from hepatocellular carcinomas, both in vitro and in vivo.
- GE CAR-BITE T cells killed the Hep3B (GPC3 High , EpCAM High ) target cells at a slightly faster rate than the anti-GPC3 CAR alone (GE CAR T)(FIGURE 2C), suggesting that the BiTE has a crucial role in facilitating target-cell killing.
- Culture supernatant harvested from the GE CAR-BiTE T cells were shown to direct efficient T cells mediated target cell killing (FIGURE 2D).
- FIGURE 3C In terms of in vivo data, in Hep3B xenografts, while both the CAR T and GE CAR- BiTE T treatments reduced tumour growth, only the GE CAR-BiTE treated mice achieved complete tumour regression (FIGURE 3C, FIGURE 3D) and similarly exhibited good safety profile without causing weight loss of mice (FIGURE 3B).
- FIGURE 3F and FIGURE 3G further show the superior efficacy in tumour control and long-term mice survival when using GE CAR-BiTE T cells expanded in culture medium containing IL-7 and IL-15.
- tumours from all three GE CAR-BiTE T cell treated mice were successfully cured (FIGURE 4D, FIGURE 4E) and the mice all survived (FIGURE 4G) without any significant weight loss (FIGURE 4F).
- polypeptide comprising a multispecific antigen binding protein.
- the multispecific antigen binding protein is a bi-specific antibody.
- the polypeptide comprises a multispecific antigen binding protein that binds to EpCAM (epithelial cell adhesion molecule) and an immune cell.
- the multispecific antigen binding protein is a bispecific immune cell engager that is capable of engaging both an antigen and an immune cell.
- the polypeptide comprises an anti-EpCAM antigen binding protein. In some examples, the polypeptide comprises a single domain anti-EpCAM antibody, optionally an anti-EpCAM H-chain antibody variable region (i.e. , VHH).
- the polypeptide comprises an anti-immune cell antigen binding protein. In some examples, the polypeptide comprises an anti-immune cell antigen binding protein that binds to an immune cell activation marker. In some examples, the immune cell activation marker is CD3, NKG2D, CD4, CD8, CD16, CD64, and the like. In some examples, the polypeptide binds to CD3. In some examples, the CD3 may include CD3£, CD3E, CD3y, CD36, and the like.
- the polypeptide comprises an anti-CD3 antigen binding protein. In some examples, the polypeptide comprises a single-chain variable fragment of an anti-CD3 antibody (anti-CD3 scFv).
- the immune cell is a T cell, an NK cell, a macrophage, or a monocyte. In some examples, the immune cell is a T cell.
- the polypeptide is a bispecific antibody/antigen binding protein.
- the bispecific antibody/antigen binding protein is a bispecific T cell engager (BiTE), such as an inducible BiTE, a non-inducible BiTE or a constitutive expression BiTE.
- the bispecific T cell engager (BiTE) binds to two antigens, wherein the first antigen is EpCAM and wherein the second antigen is an immune cell marker.
- the second antigen is an immune cell marker that is involved in the activation of the immune cell.
- the second antigen targeted by the bispecific T cell engager may include but is not limited to CD3, NKG2D, CD28, CD16, CD64, and the like.
- the polypeptide comprises a BiTE that bi-specifically binds to EpCAM and a T cell.
- the polypeptide comprises a BiTE that bi-specifically binds to EpCAM and CD3.
- the EpCAM targeted by the BiTE is modified with an anti-EpCAM VHH paired with an anti-CD3 scFv.
- the anti-EpCAM VHH pairs with an anti-CD3 scFv that may include a clone Okt3 (Nb01-013A), or an anti-CD3 clone used by another anti-EpCAM in the art (MT110)(Nb01-013B).
- an anti-CD3 scFv that may include a clone Okt3 (Nb01-013A), or an anti-CD3 clone used by another anti-EpCAM in the art (MT110)(Nb01-013B).
- polynucleotide encoding the cell and/or the polypeptide and/or multispecific antigen binding protein as described herein.
- a polynucleotide comprising a sequence encoding an immune cell engager and a chimeric antigen receptor (CAR), wherein the immune cell engager is capable of bi-specifically binding to EpCAM (epithelial cell adhesion molecule) and an immune cell, and wherein the CAR is capable of binding to a first antigen.
- CAR chimeric antigen receptor
- a polynucleotide comprising a sequence encoding a chimeric antigen receptor capable of recognizing, binding, and engaging a GPC3 positive cell.
- the first antigen is GPC3. Therefore, in some examples, the CAR is capable of binding to GPC3.
- the polynucleotide further comprises sequences encoding one or more co-stimulatory domain, a signal peptide, a hinge, and/or a signalling domain.
- the co-stimulatory domain may include, but is not limited to 4-1 BB, CD28, CD27, OX-40, and the like.
- the signal peptide may be, but is not limited to, a IgH signal peptide, a IgK signal peptide, a CD8 signal peptide, and the like.
- the hinge may be, but is not limited to, an IgH hinge, a hinge and / or transmembrane domain of an immunoglobulin-like protein (such as IgA, IgD, IgE, IgG, IgM, and the like), CD28, CD8, 4-1 BB, and the like.
- an immunoglobulin-like protein such as IgA, IgD, IgE, IgG, IgM, and the like
- CD28 CD8, 4-1 BB, and the like.
- sequence encoding CAR encodes for an antigen binding protein capable of binding GPC3 (or anti-GPC3 antigen binding protein), or fragment, or variant thereof. In some examples, the sequence encoding CAR encodes for a singlechain variable fragment. In some examples, the sequence encoding CAR encodes for an anti-GPC3 scFv.
- the sequence encoding CAR further encodes for an immune cell signalling domain.
- the signalling domain may include, but is not limited to, a CD3, a TCF ⁇ , a FcR ⁇ , a FcR ⁇ 3, a CD3 ⁇ , a CD30, a CD3 ⁇ , a CD3 ⁇ a CD3 ⁇ , a CD22, a CD79a, a CD79b, a CD66d intracellular domain, and the like.
- the CD3 intracellular domain may be one or more of CD3£, CD3e, CD3y, CD35, and the like.
- the sequence encoding CAR further encodes for a CD3 intracellular domain (signalling domain).
- the sequence encoding CAR encodes for an anti-GPC3 scFv, a CD28 costimulatory domain, a 4-1 BB co-stimulatory domain, an IgH signal peptide, an IgH hinge, and a CD3 signalling domain.
- the sequence encoding the immune cell engager encodes for a multi-specific antigen binding protein.
- the multi-specific antigen binding protein is a bi-specific antibody.
- the sequence encoding the immune cell engager encodes for an antigen binding protein capable of binding EpCAM (anti-EpCAM antigen binding protein), or fragment, or variant thereof, and an anti- immune cell antigen binding protein.
- the sequence encoding the immune cell engager encodes for a single chain variable fragment (scFv) or a single variable domain located on a heavy chain (VHH).
- the sequence encoding the immune cell engager encodes for an anti-EpCAM scFv or an anti-EpCAM VHH. In some examples, the sequence encoding the immune cell engager encodes for an anti-immune cell antigen binding protein that binds to an immune cell activation marker. In some examples, the immune cell activation marker may include but is not limited to CD3, NKG2D, CD4, CD8, CD16, CD64, and the like.
- the immune activation marker may be in VHH form or scFv form.
- the sequence encoding the immune cell engager encodes for an antigen binding protein capable of binding CD3 (anti-CD3 antigen binding protein), or fragment, or variant thereof.
- the sequence encoding the immune cell engager encodes for a single chain variable fragment (scFv) or a VHH form.
- the sequence encoding the immune cell engager encodes for an anti-CD3 scFv or an anti-CD3 single domain VHH.
- the immune cell engager may include a His-tag.
- the immune cell engager comprises an anti-EpCAM antigen binding protein, a linker, an anti-CD3 scFv or an anti-CD3 single domain VHH, and a His- tag.
- the linker is a cleavable linker, which may include but is not limited to, P2A, T2A, F2A, and the like.
- the immune cell is a T cell, an NK cell, a macrophage, or a monocyte. In some examples, the immune cell is a T cell.
- the polynucleotide comprises the sequence encoding an immune cell engager is a sequence encoding a bispecific T cell engager (BiTE), such as an inducible BiTE, a non-inducible BiTE or a constitutive expression BiTE.
- BiTE bispecific T cell engager
- the polynucleotide comprises the sequence encoding BiTE that bi-specifically binds to EpCAM and a T cell.
- the polynucleotide comprises the sequence encoding for an anti-GPC3 scFv CAR with CD3 intracellular domain, and the sequence encoding for a BiTE that binds to EpCAM and a T cell.
- the vector is selected from the group consisting of a plasmid, a viral particle, a phage, a baculovirus, a yeast plasmid, a lipid based vehicle, a polymer microsphere, a liposome, and a cell based vehicle, a colloidal gold particle, lipopolysaccharide, polypeptide, polysaccharide, a viral vehicle, an adenovirus, a retrovirus, a lentivirus, an adeno-associated viruses, a herpesvirus, a vaccinia virus, a foamy virus, a cytomegalovirus, a Semliki forest virus, a poxvirus, a pseudorabies virus, an RNA virus vector, a DNA virus vector and a vector derived from a combination of a plasmid and a phage DNA, further optionally wherein said
- the vector is a lentiviral vector.
- a host cell comprising the vector of as disclosed herein or polynucleotide or polypeptide as disclosed herein.
- the host cell comprises cloning or expression vectors as described above and/or nucleic acid sequences encoding for the antigen binding protein, antibodies and binding fragments thereof as described herein.
- the host cell can be any type of cell capable of being transformed or transfected with the nucleic acid or vector so as to produce an antigen binding protein or binding fragment/protein thereof encoded thereby.
- the host cell comprising the nucleic acid or vector can be used to produce the antigen binding protein or binding fragment/protein thereof, or a portion thereof (e.g., a heavy chain sequence, or a light chain sequence encoded by the nucleic acid or vector).
- the cell After introducing the nucleic acid or vector into the cell, the cell is cultured under conditions suitable for expression of the encoded sequence.
- the antibody, antigen binding protein, or fragment, or portion of the antibody then can be isolated from the cell.
- the host cells may be prokaryotic host cells (such as E. coli) or eukaryotic host cells (such as a yeast cell, an insect cell, or a vertebrate cell).
- the host cell when cultured under appropriate conditions, expresses an antibody or binding fragment thereof which can subsequently be collected from the culture medium (if the host cell secretes it into the medium) or directly from the host cell producing it (if it is not secreted). Selection of an appropriate host cell will depend upon various factors, such as desired expression levels, polypeptide modifications that are desirable or necessary for activity, such as glycosylation or phosphorylation, and ease of folding into a biologically active molecule.
- the host cell may comprise a bacterial cell, a yeast cell, an animal cell e.g., a mammalian cell and/or a plant cell.
- Suitable mammalian host cells include CHO, myeloma or hybridoma cells. Many are available from the American Type Culture Collection (ATCC), Manassas, Va. Examples include mammalian cells, such as Chinese hamster ovary cells (CHO) (ATCC No. CCL61), human embryonic kidney (HEK) 293 or 293T cells (ATCC No. CRL1573), 3T3 cells (ATCC No. CCL92), or PER.C6 cells. Other cell types of use in expressing antibodies include lymphocytic cell lines, e.g. NSO myeloma cells and SP2 cells, COS cells.
- lymphocytic cell lines e.g. NSO myeloma cells and SP2 cells, COS cells.
- the host cell expresses/secretes the antigen binding protein, variant or fragment thereof as disclosed herein.
- a cell that expresses/secretes an immune cell engager that is specific to EpCAM.
- the cell is a stem cell, for example selected from the group comprising a mesenchymal stem cell, neural stem cell and a pluripotent stem cell, such as an induced pluripotent stem cell (iPSC).
- a mesenchymal stem cell a mesenchymal stem cell.
- the stem cell is a neural stem cell.
- the stem cell is a pluripotent stem cell, such as an iPSC.
- the cell is an immune cell.
- the immune cell expresses/secretes an immune cell engager which is specific to EpCAM.
- the immune cell engager is selected from the group comprising a T cell engager, an NK cell engager, a monocyte engager and a macrophage engager.
- the immune cell expresses/secretes a bispecific T cell engager (BiTE) which is specific to EpCAM.
- BiTE bispecific T cell engager
- the immune cell expresses/secretes a bispecific T cell engager (BiTE), such as an inducible, non-inducible or constitutive expression BiTE comprising the antigen binding protein, variant or fragment thereof as disclosed herein.
- BiTE bispecific T cell engager
- the present inventors have established that immune cells, such as CAR T-cells, are able to secrete EpCAM BiTEs. It was not previously known that this was possible.
- immune cells such as CAR T-cells
- this allows the EpCAM immune engagers to be be secreted at the target site (for example at the site of a solid tumour), thereby minimising toxicity and/or side effects.
- the immune cell may include but is not limited to a macrophage, a dendritic cell, a T cell, a B cell, an eosinophil, a basophil, a neutrophil, a mast cell, a natural killer T cell (NKT cell), natural killer cell (NK cell), a macrophage, a monocyte, and the like.
- the immune cell is a NK cell.
- the immune cell is a macrophage.
- the immune cell is a dendritic cell.
- the immune cell is a monocyte.
- the immune cell is a T-cell.
- the immune cell is a CAR T-cell, such as an anti-GPC3, anti-HER2 or anti-CD19 CAR T-cell.
- the CAR T-cell is an anti-GPC3 CAR T-cell.
- the CAR T-cell is an anti-HER2 CAR T-cell.
- the CAR T-cell is an anti- CD19 CAR T-cell.
- the immune cell is a CAR T-, CAR NK-, CAR macrophage-, or CAR monocyte-cell,
- the immune cell may bind to more than one host cell antigen. Therefore, in some examples, the immune cell may further bind to one host cell antigen, two host cell antigens, three host cell antigens, four host cell antigens, and the like.
- a method of producing / generating the cell as described herein comprising introducing the polynucleotide as described herein into the cell.
- a linker such as P2A cleavable linker
- the culture supernatant of the host cell transformed or transfected with the vector is harvested.
- the method comprises introducing into the cell a vector as described herein.
- the vector is introduced via viral transduction.
- composition comprising the cell or the supernatant of the cell as described herein.
- composition comprising the (engineered) cell or the supernatant of the cell as described herein and suitable pharmaceutical composition thereof.
- the composition is a prophylactic and/or therapeutic composition.
- Pharmaceutically acceptable agents for use in the present pharmaceutical compositions include carriers, excipients, diluents, antioxidants, preservatives, colouring, flavouring and diluting agents, emulsifying agents, suspending agents, solvents, fillers, bulking agents, buffers, delivery vehicles, tonicity agents, cosolvents, wetting agents, complexing agents, buffering agents, antimicrobials, and surfactants.
- compositions or pharmaceutical composition as described herein for use in therapy/medicine/vaccine optionally the composition may further include an excipient and/or stabilizers.
- a method of treating a disease in a subject in need thereof comprises administering to the subject the cell of as described herein, optionally the disease is a proliferative disease.
- the cell or composition or pharmaceutical composition is to be administered to the subject through one or more routes of administration including, but not limited to, topical, intravascular, intravenous, oral, subcutaneous, intraarterial, intrathecal, intraperitoneal, intranasal, intradermal, intramuscular, and the like.
- polynucleotide an antibody, a bi-specific T cell engager, an engineered cell, an engineered immune cell, a method, a composition, or a pharmaceutical composition as described herein.
- the disease is a proliferative disease.
- the disease is tumour or cancer.
- the disease is a carcinoma and may include but is not limited to liver cancer (such as hepatocellular carcinoma), lung cancer (such as lung squamous cell carcinoma), stomach cancer (such as gastric adenocarcinoma), breast cancer, skin cancer (such as melanoma), ovary cancer (such as ovarian clear cell carcinoma), kidney cancer, pancreas cancer, head and neck cancer, prostate gland cancer, oesophagus cancer, bladder cancer, colon cancer, childhood cancers (such as hepatoblastomas, nephroblastoma, yolk sac tumours, and the like), and the like.
- liver cancer such as hepatocellular carcinoma
- lung cancer such as lung squamous cell carcinoma
- stomach cancer such as gastric adenocarcinoma
- breast cancer such as melanoma
- ovary cancer such as ovarian clear cell carcinoma
- kidney cancer pancreas cancer, head and
- the disclosure may have disclosed a method and/or process as a particular sequence of steps. However, unless otherwise required, it will be appreciated that the method or process should not be limited to the particular sequence of steps disclosed. Other sequences of steps may be possible. The particular order of the steps disclosed herein should not be construed as undue limitations. Unless otherwise required, a method and/or process disclosed herein should not be limited to the steps being carried out in the order written. The sequence of steps may be varied and still remain within the scope of the disclosure.
- CDRs are in bold (CDR1);in bold and in italics (CDR2), or in bold, in italics and underlined (CDR3). Highlighted residues/bases show differences between the 1 B6 and 1C1 light chain constant domains.
- Example embodiments of the disclosure will be better understood and readily apparent to one of ordinary skill in the art from the following discussions and if applicable, in conjunction with the figures. It should be appreciated that other modifications may be made without deviating from the scope of the invention.
- Example embodiments are not necessarily mutually exclusive as some may be combined with one or more embodiments to form new exemplary embodiments. The example embodiments should not be construed as limiting the scope of the disclosure.
- Figures 1A to 1 H show Hep3B xenografts in NSG mouse can be suppressed by anti-GPC3 CAR T (5C4) cells but cannot be completely eradicated as escaped tumour cells lost GPC3 expression.
- Figure 1A shows a FACS analysis of tumour markers (GPC3 and EpCAM) expressed on the Hep3B cells.
- Figures 1B to 1 D show the results of two million Hep3B cells that were subcutaneously injected into the right flanks of NSG mice (Day -26). At Day 0, mice were grouped according to the tumour size and ten million anti-GPC3 CAR T (5C4) cells or Mock T cells were intravenously injected into these mice via tail vein (Day 0).
- Figure 1 B shows the percentage of CAR expression on anti-GPC3 CAR T (5C4) cells detected by flow cytometry analysis.
- Figure 1C shows tumour sizes that were measured and recorded every 3 to 7 days.
- Figure 1 D shows the FACS analysis of tumour markers (GPC3 and EpCAM) expressed on the re-emerged tumours from an anti-GPC3 CAR T (5C4) treated mouse at 70 days post CAR T cell infusion.
- Figure 1E to 1H shows the results of two million Hep3B cells that were subcutaneously injected into the right flanks of NSG mice (Day -21).
- mice were grouped according to the tumour size and four million sorted anti-GPC3 CAR T (5C4) cells with enriched CAR positive populations or Mock T cells were intravenously injected into these mice via tail vein (Day 0).
- Figure 1 E shows that after lentiviral transduction, T cells expressing anti- GPC3 CAR T (5C4) cells were enriched by flow sorting and the percentage of CAR expression on sorted anti-GPC3 CAR T (5C4) cells were detected by flow cytometry analysis.
- Tumour size ( Figure 1F) and weight (Figure 1G) of each mouse were measured and recorded every 3 to 7 days.
- Figure 1 H shows FACS analysis of tumour markers expressed on the re-emerged tumours from three anti-GPC3 CAR T (5C4) treated mice at 71 days post CAR T infusion.
- Figures 2A to 2D show the construction and in vitro characterization of GE CAR- BiTE T cells.
- Figure 2A shows the structure map of GE CAR-BiTE.
- Figure 2B shows the percentage of CAR expression on anti-GPC3 CAR T (5C4) and GE CAR- BiTE T (sequence of “MT110” was used as BiTE) cells detected by flow cytometry analysis.
- Figure 2D shows the percentage of cytolysis of Hep3B cells mediated by anti-EpCAM BiTE activated naive T cells.
- Figures 3A to 3G show human GE CAR-BiTE T cells completely eradicated large Hep3B xenografts in vivo.
- Figures 3A to 3E show the results after lentiviral transduction, where anti-GPC3 CAR T (5C4) cells, GE CAR-BiTE T cells or mock T cells were cultured and expanded in T cell growth medium containing IL-2 (50 unit per ml). Two million Hep3B cells were subcutaneously injected into the right flank of NSG mice (Day -27).
- mice On Day 0, mice were re-grouped according to the measurable tumour size (3- 5 mice per group) and eight million GE CAR-BiTE cells, CAR T (5C4) cells, or mock T cells were intravenously injected into these mice via tail vein.
- Figure 3A shows the percentage of CAR expression on anti-GPC3 CAR T (5C4) and GE CAR- BiTE T (sequence of “MT110” was used as BiTE) cells detected by flow cytometry analysis.
- Weight (Figure 3B) and tumour size (Figure 3C) of each mouse were measured and recorded every 3 to 7 days.
- Figure 3D shows tumour sizes of each individual mouse in each treatment group were shown.
- Figure 3E shows tumours of selected mice were excised and the expression of the tumour markers GPC3 and EpCAM were analyzed.
- Figures 3F and 3G shows results after lentiviral transduction, where anti-GPC3 CAR T (5C4) cells, GE CAR-BiTE T cells or mock T cells were cultured and expanded in T cell growth medium containing IL-7 (20 ng/ml) and IL-15 (5 ng/ml).
- IL-7 20 ng/ml
- IL-15 5 ng/ml
- Two million Hep3B (GPC3 positive, EpCAM positive) cells were subcutaneously injected into the right flank of NSG mice (Day -21). On Day 0, mice were re-grouped according to the measurable tumour size (3-6 mice per group) and eight million GE CAR-BiTE cells, CAR T (5C4) cells, or mock T cells were intravenously injected into these mice via tail vein.
- Figure 3F shows the tumour sizes of each mouse were measured and recorded every 3-4 days.
- Figure 3G shows the survival curves of the mice from “Tumour only” group (grey dotted line), “Mock T” group (grey solid line), “CAR T (5C4)” group (black dotted line) and “GE CAR- BiTE T” group (black solid line). Death was defined either when autonomous death of the mice was observed or when the bearing tumour size of the mice exceeds 2700mm 3 .
- Figures 4A to 4G show human GE CAR-BITE T cells completely eradicated HepG2 xenografts in vivo.
- Figures 4A and 4B show the results after one million HepG2 cells were subcutaneously injected into the right flank of NSG mice (Day -9). On Day 0, mice were re-grouped according to the measurable tumour size and ten million CAR T (5C4) cells or mock T cells were intravenously injected into these mice via tail vein.
- Figure 4A shows the percentage of CAR expression on anti-GPC3 CAR T (5C4) cells detected by flow cytometry analysis.
- Figure 4B shows tumour sizes of each mouse were measured and recorded every 3 to 7 days.
- Figures 4C to 4G shows the results when one million HepG2 cells were subcutaneously injected into the right flank of NSG mice (Day -4). On Day 0, mice were re-grouped according to the measurable tumour size and three million GE CAR-BiTE T cells, CA T (5C4) cells, or mock T cells were intravenously injected into these mice via tail vein.
- Figure 4C shows the percentage of CAR expression on anti-GPC3 CAR T (5C4) and GE CAR- BiTE T (sequence of “MT110” was used as BiTE) cells detected by flow cytometry analysis.
- Figure 4D shows the tumour sizes of each mouse were measured and recorded every 3 to 7 days.
- Figure 4E shows the tumour sizes of each individual mouse in each treatment group were shown.
- Figure 4F shows the weights of each mouse were measured and recorded every 3 to 7 days.
- Figure 4G shows the survival curves of the mice. Death was defined either when autonomous death of the mice was observed or when the bearing tumour size of the mice exceeds 1700mm 3
- Figures 5A to 5H show GE CAR-BiTE T cells using anti-EpCAM VHH constructed BiTEs has superior properties in killing potency and specificity.
- Figure 5A shows the structural format of MT110 BiTE, Nb01-013A BiTE or Nb01-013B BiTE antibodies secreted by GE CAR-BiTE cells.
- Figure 5B shows FACS analysis of tumour markers (GPC3 and EpCAM) expressed on HepG2, HT-29 and HeyA8 cells.
- FIGs 6A and 6B shows human GE CAR-BiTE T cells using anti-EpCAM VHH constructed BiTEs are more superior tumour killing in in vivo HepG2 xenografts.
- One million HepG2 cells were subcutaneously injected into the right flank of 30 male NSG mice (Day -4). On Day 0, mice were re-grouped according to the measurable tumour size and three million CAR T (5C4) cells, GE CAR-BITE T cells (“MT110”, “Nb01-013A” or “Nb01-013B” was used as BiTE), or Mock T cells were intravenously injected into these mice via tail vein.
- Figure 6A shows the tumour sizes of each individual mouse in each treatment group were measured and recorded every 3 to 7 days.
- Figure 6B shows the weights of different groups of mice were measured and recorded every 3 to 7 days.
- Figures 7A to 7D show GE CAR-BiTE T cells using anti-EpCAM VHH constructed BiTEs exerted superior killing potency and the secreted anti-EpCAM BiTE by GE CAR-BiTE T cells could elicit target cell killing independent of high GPC3 expression.
- Figure 7A shows the structural formats of anti-GPC3 CAR T (5C4) or GE CAR-BiTE T cells (anti-GPC3 CAR T secreting anti-EpCAM BiTE, “MT110”, “Nb01- 013A” or “Nb01-013B” was used as BiTE) or 19E CAR-BiTE T cells (anti-CD19 CAR T secreting anti-EpCAM BiTE, “Nb01-013A” or “Nb01-013B” was used as BiTE).
- Figures 8A to D show Human GE CAR-BiTE T cells using anti-EpCAM VHH constructed BiTEs showed superior tumour killing in in vivo Hep3B xenografts.
- Figure 8A shows a schematic representation of the timeline of the in vivo Hep3B xenograft model. Two million Hep3B cells were subcutaneously injected into the right flank of 50 male NSG mice (Day -21).
- mice were re-grouped according to the measurable tumour size and eight million CAR T (5C4) cells, GE CAR-BiTE T cells (Anti-EpCAM BiTE secreting anti-GPC3 CAR T cells, “MT110”, “Nb01-013A” or “Nb01-013B” was used as BiTE), 19E CAR-BiTE T cells (Anti-EpCAM BiTE secreting anti-CD19 CAR T cells, “Nb01-013A” or “Nb01-013B” was used as BiTE), or Mock T cells were intravenously injected into these mice via tail vein.
- CAR T GE CAR-BiTE T cells
- MT110 Anti-EpCAM BiTE secreting anti-GPC3 CAR T cells, “MT110”, “Nb01-013A” or “Nb01-013B” was used as BiTE
- 19E CAR-BiTE T cells Anti-EpCAM BiTE secreting anti-CD19 CAR T cells, “Nb01-013A”
- Figures 9A to 9F show Human GE CAR-BITE T cells using anti-EpCAM VHH constructed BiTEs showed superior in vivo T cell expansion in Hep3B mouse xenograft models.
- cheek bleed on weekly intervals was done for flow cytometry analysis to monitor the T cell numbers in the peripheral blood, as well as Luminex® Multiplex Assays on the cytokine levels.
- Figure 9A shows the number of CD3 positive human T cells in the mouse peripheral blood from selected groups of mice after 5 weeks of T cell infusion.
- Figure 9B shows a time-course analysis of CAR positive human T cells in the mouse peripheral blood in the group of CAR T (5C4) treatment.
- Figure 9C shows a time-course analysis of CAR positive human T cells in the mouse peripheral blood in the group of GE CAR-BiTE T (Nb01-013A) treatment.
- the levels of Interferon-gamma (Figure 9D), GM-CSF ( Figure 9E), and Perforin ( Figure 9F) in the peripheral blood from the selected groups of mice after 5 weeks of T cell infusion were measured by Luminex® Multiplex Assays.
- Figures 10A to 10C show Human GE CAR-BiTE cells using anti-EpCAM VHH constructed BiTEs showed superior localized T cell expansion within the tumour in Hep3B mouse xenograft models.
- Figure 10A shows the numbers of CD3 positive human T cells in the mouse tumours from selected mice were presented as number of cells per gram tumour.
- Figure 10B shows the numbers of CAR positive human T cells in the mouse tumours from selected mice were presented as number of cells per gram tumour.
- Figure 10C shows the percentages of CAR positive T cells within the population of human T cells in the mouse tumours from the selected mice. * Marked the mice showing effective tumour controls.
- FIG 11 shows a comparison of CAR T cells enriched in the tumours and those dispersed in the peripheral blood.
- selected mice with observed tumour control effects (M18, M49, M38 and M40) were analyzed by flow cytometry analysis for both CAR T cells in the peripheral blood and CAR T cells from the excised tumour.
- the total numbers of CAR positive T cells in tumours were calculated by multiplying the total weights of the tumours, while the total numbers of CAR positive T cells in the peripheral blood were calculated by multiplying the average blood volume of the experimental mice ( ⁇ 2ml).
- Figure 12 shows the detection of anti-EpCAM BiTE molecule Nb01-013A secreted from GE CAR-BiTE T cells by ELISA.
- Figure 12A shows the detection of anti- EpCAM BiTE molecule when anti-GPC3 CAR T (5C4) cells or GE CAR-BiTE T (Nb01- 013A) cells were cultured in T cell growth medium containing IL-7 (20 ng/ml) and IL-15 (5 ng/ml). The starting cell density was 0.5 million per ml and the percentages of CAR expression in both cultures were around 60%.
- FIG. 12B shows the detection of anti-EpCAM BiTE molecule when GE CAR-BiTE T (Nb01-013A) cells were co-cultured with Hep3B (GPC3 High , EpCAM High ), HT-29 (GPC3 Low , EpCAM High ) or HeyA8 (GPC3- ve , EpCAM ve ) cells at an E:T ratio of 2:1.
- the percentage of CAR expression in GE CAR-BiTE T (Nb01- 013A) cells used in all co-cultures was 8.5%.
- Supernatants were collected daily (24h, 48h, 72h) for an ELISA to detect the amount of secreted anti-EpCAM BiTE molecule Nb01-013A after the co-culture of GE CAR-BiTE T (Nb01-013A) cells with different target cells.
- human EpCAM-Fc tag protein was used to coat the ELISA plate overnight, after blocking with Casein for 2 hours, the culture supernatants containing the anti- EpCAM BiTE molecule Nb01-013A were added to the plate. After 1-hour incubation, the plate was washed, and the bound BiTE molecules were detected by an HRP conjugated secondary antibody against the His-tag.
- the construct of GE CAR-BiTE T was designed by fusing the anti-EpCAM BiTE gene (sequence of “MT110” was used) to the anti-GPC3 CAR (clone 5C4) lentiviral construct via a P2A cleavable linker ( Figure 2A). Following lentiviral transduction and expansion ( Figure 2B), CAR T cells were tested for their in vitro killing efficacy. Interestingly, the GE CAR-BiTE T cells killed the Hep3B (GPC3 High , EpCAM High ) target cells at a slightly faster rate than the anti-GPC3 CAR alone ( Figure 2C), suggesting the crucial role of the BiTE in facilitating target-cell killing.
- the GE CAR-BiTE cytotoxic function was further tested in an assay in which only the culture supernatant harvested from the GE CAR-BiTE T cells were shown to direct efficient T cells (naive T cells isolated from a donor PBMC) mediated target cell killing (Figure 2D).
- tumour control by the GE CAR- BiTE T was assessed with Hep3B xenograft in the NSG mice, with the transduction rate assessed by flow cytometry analysis (Figure 3A). While both the CAR T (5C4) and GE-CAR-BiTE T treatments reduced tumour growth, only the GE-CAR-BiTE treated mice achieved complete tumour regression ( Figure 3C, 3D) and similarly exhibited good safety profile without causing weight loss of mice ( Figure 3B). Further analysis revealed that the tumour cells that survived anti-GPC3 CAR T (5C4) treatment lost GPC3 while still expressing EpCAM (Figure 3E).
- HepG2 Similar to Hep3B, another HCC cell line HepG2 similarly expressed high level of GPC3 and EpCAM on the cell surface.
- anti- GPC3 targeting CAR T alone was relatively ineffective in treating HepG2 derived xenograft even if CAR T cells were infused at a much earlier date post tumour inoculation (9 days in the HepG2 model, compared to 21-27 days in the Hep3B model) ( Figure 4A and 4B). The inventors suspected that this is because HepG2 xenograft had a much faster growth rate than Hep3B xenograft in mice.
- MT110 generally have lower T cell viability and poor T cell expansion rate compared to CAR T (5C4) cells.
- MT110 was replaced with a different version of BiTE where the anti- EpCAM arm was replaced with an in-house identified anti-EpCAM VHH (clone 2C4) and was paired with two different anti-CD3 scFv (clone Okt3 or the anti-CD3 clone used in “MT110”). They were named as “Nb01-013A” and “Nb01-013B” respectively ( Figure 5A).
- the present inventors have developed a novel CAR T cell therapy in targeting GPC3 positive solid tumours by arming the single antigen targeting CAR T cells with an additional targeting of EpCAM positive cancer cells by localized secretion of anti- EpCAM BITE to overcome the challenges of tumour heterogeneity.
- CAR T cells secreting anti-EpCAM BiTE the efficacy of CAR T cell therapies could be maximised by recruiting the nearby bystander T cells (T cell populations without expressing a CAR) to contribute to the tumour clearance and concurrently avoid the systematic toxicity that might be brought by other means of delivery of anti-EpCAM BiTEs.
- the present disclosure has shown the development of a prototype (GE CAR-BiTE), which also serves as a proof-of-concept. While GE CAR-BiTE has been demonstrated to work successfully, the present technology is not limited to GPC3- targeting CAR but can be extended to many other tumour antigens which will be applied as a CAR target for various types of carcinomas happened in multiple organs.
- mice were voluntarily culled when the humane point was hit (tumour sizes exceeded 3000 mm 3 ), before the in vivo expansion of GE CAR-BiTE T (MT110) cells reached the threshold points in executing a significant tumour control effect. This may be due to the donor variations in the T cells used to generate the CAR T cells in different experiments.
- GE CAR-BiTE T (“Nb01-013A” or “Nb01-013B” used as BiTE) cells generated using the same T cell donor showed much potent tumour control efficacies, suggesting that replacing the anti-EpCAM arm with our anti-EpCAM 2C4-VHH significantly improved the in vivo expansion as well as the in vivo killing potency of the GE CAR-BiTE T cells.
- mice from “Tumour only”, “Mock T”, “GE CAR-BiTE T (MT110)”, “19E CAR-BiTE T (Nb01-013A)” and “19E CAR-BiTE T (Nb01-013B)” groups were voluntarily culled as most of their tumour sizes are close to the humane point.
- the inventors have selected 1 to 2 mice from each group to analyse the tumour infiltrating human T cells from the excised tumours.
- CAR T (5C4) and GE CAR-BiTE T (Nb01- 013A) group all treated mice showed good control of tumour growth and hence the inventors randomly chose one mouse from each of these two groups for FACS analysis but leaving the rest 8 mice for continuous monitoring.
- Anti-EpCAM llama VHH BiTE secreted by GE CAR-BiTE T cells can be detected from the cell cultures
- Both anti-GPC3 CAR T (5C4) and GE CAR-BiTE T (Nb01-013A) cells were cultured in T cell growth medium containing IL-7 and IL-15 at the starting cell density of 0.5 million per ml. Cell culture supernatants were collected daily for a consecutive four days, followed by an ELISA to detect the amount of secreted anti-EpCAM BiTE molecule Nb01-013A. The results clearly showed that the amount of secreted Nb01-013A molecules increased over time, suggesting a continuous secretion and accumulation of anti-EpCAM VHH BiTE from the GE CAR-BiTE T (Nb01-013A) cell cultures ( Figure 12A).
- GE CAR-BiTE T (Nb01-013A) cells were cocultured with different target cells, including Hep3B (GPC3 High , EpCAM High ), HT-29 (GPC3 Low , EpCAM High ) and HeyA8 (GPC3- ve , EpCAM’ ve ).
- the percentage of CAR expression in GE CAR-BiTE T (Nb01-013A) cells used in all co-cultures was 8.5%.
- VHH BiTE molecules constructed from an anti-EpCAM VHH clone 2C4 (“Nb01-013A” and “Nb01- 013B”) in GE CAR-BiTE T cells achieved a more efficient and potent tumour killing than GE CAR-BiTE T cells using “MT 110”, with the best efficacy observed when using “Nb01 - 013A” as the BiTE molecule.
- Embodiments of modified cells as disclosed herein takes advantage of the following factors: 1) tumour- directed T cell expansion, and 2) tumour-restricted anti- EpCAM BiTE secretion, the latter being unachievable by the traditional approach of systemic delivery.
- the anti-EpCAM BiTE secreting CAR T cell as disclosed herein can be expanded to other cancer types to establish a broader scope of nextgeneration CAR T cell therapies.
- Anti-GPC3 CAR T cells secreting anti-EpCAM BiTE can be used to treat GPC3 expressing cancers such as hepatocellular carcinoma, ovarian clear cell carcinoma (OCCC), lung squamous cell carcinomas, melanomas, and some childhood cancers (hepatoblastomas, nephroblastoma, and yolk sac tumours), as well as certain stomach cancers.
- cancers such as hepatocellular carcinoma, ovarian clear cell carcinoma (OCCC), lung squamous cell carcinomas, melanomas, and some childhood cancers (hepatoblastomas, nephroblastoma, and yolk sac tumours), as well as certain stomach cancers.
- Anti-EpCAM BiTE secreting CAR T cells may be configured to target other tumour specific antigens including but not limited to HER2, Claudin18.2, ROR1 , DLL3, CEA, MUC1 , MUC16, CEACAM7, CD133, CD147, PSCA, PSMA, MSLN, c-Met, FRa, and the like.
- These anti-EpCAM BiTE secreting CAR T cells can be used to target various solid cancers including liver, breast, head and neck, gastric, pancreas, lung, prostate, kidney, ovarian, oesophagus, bladder, and colon cancers.
- This present disclosure provides for an improvement to treatment efficacy of the current single targeting CAR T cells against solid tumours by advantageously overcoming the tumour heterogeneity and treatment associated tumour escape using anti-EpCAM BiTE. Also, by applying local secretion of anti-EpCAM BiTE by CAR T cells, it converts a non-druggable target into a druggable target as it diminishes the on-target, off-tumour toxicity that might be brought by systematic delivery. In addition, by targeting cancer progenitor and cancer stem cells that express EpCAM, it further contributes to complete tumour eradication and tumour relapse prevention.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Gastroenterology & Hepatology (AREA)
- Microbiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Hematology (AREA)
- Toxicology (AREA)
- General Engineering & Computer Science (AREA)
- Mycology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Claims
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2024284712A AU2024284712A1 (en) | 2023-06-07 | 2024-06-07 | Gpc3 chimeric antigen receptor secreting |
| EP24819701.4A EP4724574A1 (en) | 2023-06-07 | 2024-06-07 | Gpc3 chimeric antigen receptor secreting |
| CN202480051126.3A CN121666446A (en) | 2023-06-07 | 2024-06-07 | GPC3 chimeric antigen receptor secretion |
| KR1020267000437A KR20260033002A (en) | 2023-06-07 | 2024-06-07 | GPC3 chimeric antigen receptor secretion |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| SG10202301604Y | 2023-06-07 | ||
| SG10202301604Y | 2023-06-07 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2024253598A1 true WO2024253598A1 (en) | 2024-12-12 |
Family
ID=93794578
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/SG2024/050386 Ceased WO2024253598A1 (en) | 2023-06-07 | 2024-06-07 | Gpc3 chimeric antigen receptor secreting |
Country Status (5)
| Country | Link |
|---|---|
| EP (1) | EP4724574A1 (en) |
| KR (1) | KR20260033002A (en) |
| CN (1) | CN121666446A (en) |
| AU (1) | AU2024284712A1 (en) |
| WO (1) | WO2024253598A1 (en) |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021050591A1 (en) * | 2019-09-10 | 2021-03-18 | Cytoimmune Therapeutics, Inc. | Bispecific antibody car cell immunotherapy |
| CN113481165A (en) * | 2020-07-16 | 2021-10-08 | 山东博安生物技术股份有限公司 | CAR-T secreting bispecific T cell adaptors and uses for treating solid tumors |
| WO2022018262A1 (en) * | 2020-07-24 | 2022-01-27 | Cellectis S.A. | T-cells expressing immune cell engagers in allogenic settings |
| WO2022109611A1 (en) * | 2020-11-20 | 2022-05-27 | Simcere Innovation, Inc. | Armed dual car-t compositions and methods for cancer immunotherapy |
-
2024
- 2024-06-07 CN CN202480051126.3A patent/CN121666446A/en active Pending
- 2024-06-07 AU AU2024284712A patent/AU2024284712A1/en active Pending
- 2024-06-07 EP EP24819701.4A patent/EP4724574A1/en active Pending
- 2024-06-07 KR KR1020267000437A patent/KR20260033002A/en active Pending
- 2024-06-07 WO PCT/SG2024/050386 patent/WO2024253598A1/en not_active Ceased
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021050591A1 (en) * | 2019-09-10 | 2021-03-18 | Cytoimmune Therapeutics, Inc. | Bispecific antibody car cell immunotherapy |
| CN113481165A (en) * | 2020-07-16 | 2021-10-08 | 山东博安生物技术股份有限公司 | CAR-T secreting bispecific T cell adaptors and uses for treating solid tumors |
| WO2022018262A1 (en) * | 2020-07-24 | 2022-01-27 | Cellectis S.A. | T-cells expressing immune cell engagers in allogenic settings |
| WO2022109611A1 (en) * | 2020-11-20 | 2022-05-27 | Simcere Innovation, Inc. | Armed dual car-t compositions and methods for cancer immunotherapy |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20260033002A (en) | 2026-03-10 |
| CN121666446A (en) | 2026-03-13 |
| AU2024284712A1 (en) | 2026-01-15 |
| EP4724574A1 (en) | 2026-04-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN111971090B (en) | Bispecific EGFR/CD16 antigen-binding protein | |
| US12428493B2 (en) | Antibodies that bind PSMA and gamma-delta T cell receptors | |
| JP2023538945A (en) | Anti-ROR1 antibodies and related bispecific binding proteins | |
| KR20180030856A (en) | Human CD3 binding antibody | |
| KR20240008345A (en) | Composition comprising a T cell re-induction therapeutic agent and an anti-CD44 therapeutic agent | |
| CN105431205B (en) | IgE antibodies for inhibiting tumor metastasis | |
| CN115894701A (en) | Antibodies that bind CD3 and uses thereof | |
| EP4417626A1 (en) | Novel antibody-cytokine fusion protein, preparation method therefor and use thereof | |
| EP4724497A1 (en) | Multispecific antigen binding protein against epcam | |
| JP7811028B2 (en) | Human cxcl16 antibodies and uses thereof | |
| WO2024253598A1 (en) | Gpc3 chimeric antigen receptor secreting | |
| WO2024253596A1 (en) | Her2 chimeric antigen receptor secreting | |
| EP4180457A1 (en) | Anti-cldn-18.2 antibody and use thereof | |
| RU2792240C2 (en) | Bispecific antigen-binding protein egfr/cd16 | |
| KR20260038271A (en) | Anti-TROP2 antibody | |
| HK40115653A (en) | Novel antibody-cytokine fusion protein, preparation method therefor and use thereof | |
| WO2023196869A1 (en) | Epha2 antibodies | |
| WO2022037582A1 (en) | Anti-cd3 and anti-cldn-18.2 bispecific antibody and use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 24819701 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2025571292 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2025571292 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: AU2024284712 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020267000437 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024819701 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2024284712 Country of ref document: AU Date of ref document: 20240607 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2024819701 Country of ref document: EP Effective date: 20260107 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202508099Q Country of ref document: SG |
|
| WWP | Wipo information: published in national office |
Ref document number: 11202508099Q Country of ref document: SG |
|
| ENP | Entry into the national phase |
Ref document number: 2024819701 Country of ref document: EP Effective date: 20260107 |
|
| ENP | Entry into the national phase |
Ref document number: 2024819701 Country of ref document: EP Effective date: 20260107 |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020267000437 Country of ref document: KR |
|
| WWP | Wipo information: published in national office |
Ref document number: 2024819701 Country of ref document: EP |