WO2024253596A1 - Her2 chimeric antigen receptor secreting - Google Patents
Her2 chimeric antigen receptor secreting Download PDFInfo
- Publication number
- WO2024253596A1 WO2024253596A1 PCT/SG2024/050384 SG2024050384W WO2024253596A1 WO 2024253596 A1 WO2024253596 A1 WO 2024253596A1 SG 2024050384 W SG2024050384 W SG 2024050384W WO 2024253596 A1 WO2024253596 A1 WO 2024253596A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- sequence
- cdr
- chain variable
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4203—Receptors for growth factors
- A61K40/4205—Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ ErbB4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4254—Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/27—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by targeting or presenting multiple antigens
- A61K2239/29—Multispecific CARs
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/22—Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
Definitions
- the present disclosure relates broadly to antigen binding proteins, chimeric antigen receptors, and modified cells specific to Epithelial Cellular Adhesion Molecule (EpCAM).
- EpCAM Epithelial Cellular Adhesion Molecule
- the present disclosure relates to cell that expresses a chimeric antigen receptor targeting a tumour antigen, and a multi-specific antigen binding protein, variant or binding fragment thereof that binds one or more target, comprising a first antigen binding protein, variant or binding fragment thereof that binds to EpCAM (epithelial cell adhesion molecule) and a second antigen binding protein, variant or binding fragment thereof that binds to an cell marker.
- EpCAM epithelial Cellular Adhesion Molecule
- the cancer incidence worldwide is expected to rise to 28.4 million cases in 2040.
- Solid tumours such as liver cancer, lung cancer, stomach cancer and female breast cancer are among the leading causes of cancer-related death.
- the epithelial tissues are most abundantly found in the body, the malignancies of epithelial tissues, also known as “carcinomas”, account for 80 to 90 percent of all solid tumour cases.
- gastric adenocarcinoma accounts for 90-95% cancers of the stomach.
- the female breast cancers are another example, in which the epithelial tissue originated ductal carcinoma and lobular carcinoma are the most common primary breast cancer types and in total account for 90% of all breast cancer cases.
- tumours found in skin ovary (>90%), kidney (>85%), lung (>85%), liver (-85%), pancreas (>90%), head and neck (>90%) and prostate gland (>95%), among which the majorities are carcinomas.
- ovary >90%), kidney (>85%), lung (>85%), liver (-85%), pancreas (>90%), head and neck (>90%) and prostate gland (>95%), among which the majorities are carcinomas.
- CAR chimeric antigen receptor
- TAAs solid tumour associated antigens
- EpCAM is a well-known tumour associated antigen that is frequently overexpressed in almost all solid tumours originated from epithelium, however, neither CAR T cells nor systemically administered BiTEs targeting EpCAM ever achieved success due to its high systematic toxicity as EpCAM is also widely expressed on normal epithelia, albeit at low levels. Secretion of anti-EpCAM BiTE by CAR-T cells localizes the anti-EpCAM BiTE at or near the tumour site, which not only reduces tumour escape but also greatly enhances safety.
- HER2 targeting CAR T cells secreting anti-EpCAM BiTE (named as “HE CAR-BiTE T”) exerted superior efficacy in killing human tumours originating from gastric carcinomas in vitro.
- the present inventors approach took advantage of the following factors: 1) tumour- directed T cell expansion, and 2) tumour-restricted anti-EpCAM BiTE secretion, the latter being unachievable by the traditional approach of systemic treatment.
- the present disclosure also provides for the possibility of expanding the anti-EpCAM BITE secreting CAR T cell therapy to other cancer types to establish a broader scope of next-generation CAR T cell therapies.
- a multi-specific antigen binding protein, variant or binding fragment thereof that binds one or more target comprising a first antigen binding protein, variant or binding fragment thereof that binds to EpCAM (epithelial cell adhesion molecule) and a second antigen binding protein, variant or binding fragment thereof that binds to an immune cell marker, wherein the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region and/or a light chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (2C4, hu2C4, 1A5, 1 B8, 2B7, and 2D10) a CDR-H1 comprising:
- GSIFSGND SEQ ID NO: 25 - 2C4, hu2C4, 1A5, 2B7, and 2D10 ), or
- ITSGGST SEQ ID NO: 26 - 2C4, hu2C4, 1A5, 2B7, and 2D10), or
- ITNGGST SEQ ID NO: 30 - 1 B8
- CDR-H3 comprising:
- a heavy chain variable region comprising: (1 B6, 1C1 , 1C11 , 1 D4 and 1H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3)
- a heavy chain variable region comprising: (1 E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7)
- a light chain variable region comprising: (1 B6, 1C1 , 1C11 , 1D4, 1 E4 and 1 H6) a CDR-L1 comprising:
- LGS SEQ ID NO: 10 -1 B6, 1C1 , 1C11 , 1 D4 and 1 H6, or
- AAS SEQ ID NO: 20 - 1E4
- CDR-L3 comprising:
- MQGLQTPYT SEQ ID NO: 23 - 1 H6; and or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region comprising: (2C4, hu2C4, 1A5, 1 B8, 2B7, and 2D10) a CDR-H1 comprising:
- GSIFSGND SEQ ID NO: 25 - 2C4, hu2C4, 1A5, 2B7, and 2D10), or
- ITSGGST SEQ ID NO: 26 - 2C4, hu2C4, 1A5, 2B7, and 2D10), or
- MAGTS SEQ ID NO: 31 - 1 B8
- TNGRWSGDTYYAHL SEQ ID NO: 33 - 2B7 or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (2C4-VHH, hu2C4-VHH, 1A5-VHH, and 2D10-VHH) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHH (SEQ ID NO: 27)
- (II) a heavy chain variable region comprising: (1 B8-VHH) a CDR-H1 comprising GSSERFTS (SEQ ID NO: 29), a CDR-H2 comprising ITNGGST (SEQ ID NO: 30), and a CDR-H3 comprising MAGTS (SEQ ID NO: 31); and
- a heavy chain variable region comprising: (2B7-VHH) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHL (SEQ ID NO: 33) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region and/or a light chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (2C4, hu2C4, 1A5, and 2D10) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHH (SEQ ID NO: 27)
- a heavy chain variable region comprising: (1 B6, 1C1, 1C11 , 1 D4, 1 H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3)
- a heavy chain variable region comprising: (1E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7)
- a light chain variable region comprising: (1 B6 and 1C1) a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a light chain variable region comprising: (1C11) a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQGLQSPWT (SEQ ID NO: 15)
- a light chain variable region comprising: (1 D4) a CDR-L1 comprising QSLLHSNRYNY (SEQ ID NO: 17), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a light chain variable region comprising: (1 E4) a CDR-L1 comprising QSISDF (SEQ ID NO: 19), a CDR-L2 comprising AAS (SEQ ID NO: 20), and a CDR-L3 comprising QQSYIMPDT (SEQ ID NO: 21)
- a light chain variable region comprising: (1 H6) a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQGLQTPYT (SEQ ID NO: 23)
- a heavy chain variable region comprising: (1 B8-VHH) a CDR-H1 comprising GSSERFTS (SEQ ID NO: 29), a CDR-H2 comprising ITNGGST (SEQ ID NO: 30), and a CDR-H3 comprising MAGTS (SEQ ID NO: 31); and
- (x) a heavy chain variable region comprising: (2B7-VHH) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHL (SEQ ID NO: 33) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- (2B7-VHH) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHL (SEQ ID NO: 33) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain and/or a light chain variable domain selected from the group consisting of: (i) a heavy chain variable domain comprising
- EIVLTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQS PQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQ GLQSPWTFGQGTK (SEQ ID NO: 16 - 1C11)
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a single domain heavy chain variable domain having a sequence:
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (1 B6, 1C1 , 1C11, 1D4 and 1 H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3)
- a heavy chain variable region comprising: (1 E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7); and comprises a light chain variable region comprising: (1 B6, 1C1 , 1C11 , 1 D4, 1E4 and 1 H6) a CDR-L1 comprising:
- LGS SEQ ID NO: 10 -1 B6, 1C1 , 1C11 , 1 D4 and 1 H6, or
- AAS SEQ ID NO: 20 - 1 E4
- CDR-L3 comprising:
- MQGLQTPYT SEQ ID NO: 23 - 1 H6 or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region and a light chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (1 B6 and 1C1) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and a light chain variable region comprising: a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a heavy chain variable region comprising: (1C11) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and a light chain variable region comprising: a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQGLQSPWT (SEQ ID NO: 15)
- a heavy chain variable region comprising: (1 D4) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and a light chain variable region comprising: a CDR-L1 comprising QSLLHSNRYNY (SEQ ID NO: 17), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a heavy chain variable region comprising: (1 H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and a light chain variable region comprising: a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQGLQTPYT (SEQ ID NO: 23); and (v) a heavy chain variable region comprising: (1 E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7); and a light chain variable
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain and a light chain variable domain selected from the group consisting of:
- a heavy chain variable domain comprising: (1 B6 and 1C1) EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWM GGIIPIFGTANYAQNFQGRVTMTADTSISTAYMELSSLRSEDTAVYYCARS LGGRFRYWGQGTL (SEQ ID NO: 4), and a light chain variable domain comprising DVVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSP QLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQT PYTFGQGTK (SEQ ID NO: 12)
- a heavy chain variable domain comprising: (1C11) EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWM GGIIPIFGTANYAQNFQGRVTMTADTSISTAYMELSSLRSEDTAVYYCARS LGGRFRYWGQGTL (SEQ ID NO: 4), and a light chain variable domain comprising EIVLTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQ LLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQSP WTFGQGTK (SEQ ID NO: 16)
- a heavy chain variable domain comprising: (1 D4) EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWM GGIIPIFGTANYAQNFQGRVTMTADTSISTAYMELSSLRSEDTAVYYCARS LGGRFRYWGQGTL (SEQ ID NO: 4), and a light chain variable domain comprising DVVMTQSPLSLPVTPGESASISCRSSQSLLHSNRYNYLDWYLQKPGQSP QLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQT PYTFGQGTK (SEQ ID NO: 18)
- a heavy chain variable domain comprising: (1 H6) EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWM GGIIPIFGTANYAQNFQGRVTMTADTSISTAYMELSSLRSEDTAVYYCARS LGGRFRYWGQGTL (SEQ ID NO: 4), and a light chain variable domain DVVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSP QLLIYLGSNRASGVPDRFSGSGSGTDFTLQISRVEAEDAGVYYCMQGLQT PYTFGQGTK (SEQ ID NO: 24), or fragment or variant or a sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical thereto and/or having two or three amino acids substitutions.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a light chain constant domain having a sequence:
- RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTK SFSRGEC SEQ ID NO: 14 clone 1C1 - light chain constant domain
- fragment or variant or a sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical thereto and/or having two or three amino acids substitutions.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain encoded by a nucleotide sequence comprising:
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises heavy chain and light chain variable domains encoded by nucleotide sequences selected from the group consisting of:
- CTACTGGGGCCAGGGAACCCTG (SEQ ID NO: 41), and a light chain variable domain encoded by the nucleotide sequence comprising:
- CTACTGGGGCCAGGGAACCCTG (SEQ ID NO: 41), and a light chain variable domain encoded by the nucleotide sequence comprising: GATGTTGTGATGACTCAGTCTCCACTCTCCCTGCCCGTCACCCCTG
- CTACTGGGGCCAGGGAACCCTG (SEQ ID NO: 41), and a light chain variable domain encoded by the nucleotide sequence comprising:
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain encoded by the nucleotide sequence comprising:
- the multi-specific antigen binding protein, variant or fragment thereof is a bispecific antibody.
- the multi-specific antigen binding protein, variant or fragment thereof is an immune cell engager selected from the group comprising a T cell engager, an NK cell engager, a monocyte engager and a macrophage engager.
- the multi-specific antigen binding protein, variant or fragment thereof is a bispecific T cell engager (BITE), such as an inducible BITE, a non-inducible BiTE or a constitutive expression BiTE.
- BITE bispecific T cell engager
- the second antigen binding protein, variant or binding fragment thereof of the immune cell engager binds to the immune marker selected from the group consisting of CD3, NKG2D, CD4, CD8, CD16, and CD64.
- the multi-specific antigen binding protein is an inducible bispecific T cell engager comprising a Heavy chain antibody variable region (i.e. VHH) and/or a single chain variable fragment (scFv).
- VHH Heavy chain antibody variable region
- scFv single chain variable fragment
- the cell is an immune cell for example selected from the group consisting of a T cell, a macrophage, a monocyte, and an NK cell.
- the cell is a T cell, optionally a CAR T-cell.
- the cell binds to HER2 and secretes an inducible bispecific T cell engager that targets EpCAM and CD3 (HE CAR-BiTE T).
- a host cell comprising the vector as described herein.
- a method of producing / generating the cell as described herein comprising introducing the polynucleotide as described herein into the cell.
- composition comprising the cell as described herein.
- a method of treating a disease in a subject in need thereof comprises administering to the subject the cell or composition as described herein, optionally the disease is a proliferative disease, optionally a cancer.
- antigen binding protein herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multi-specific antibodies as long as they exhibit the desired antigen-binding activity.
- antibody as used herein relates to whole (i.e., full length) antibodies (i.e., comprising the elements of two heavy chains and two light chains) and functionally active fragments thereof (i.e., molecules that contain an antigen binding domain that specifically binds an antigen, also termed antibody fragments or antigen-binding fragments).
- functionally active fragments thereof i.e., molecules that contain an antigen binding domain that specifically binds an antigen, also termed antibody fragments or antigen-binding fragments.
- antibody encompasses monovalent, i.e., antibodies comprising only one antigen binding domain (e g., one- armed antibodies comprising a full-length heavy chain and a full-length light chain interconnected, also termed “half-antibody”), and multivalent antibodies, i.e., antibodies comprising more than one antigen binding domain, e.g., bivalent.
- antigen binding fragment refers to functionally active antibody binding fragments including but not limited to Fab, modified Fab, Fab', modified Fab', F(ab')2, Fv, single domain antibodies, scFv, Fv, bi, tri or tetra-valent antibodies, Bis-scFv, diabodies, triabodies, tetrabodies and epitope-binding fragments of any of the above.
- binding fragment refers to a fragment capable of binding a target peptide or antigen with sufficient affinity to characterize the fragment as specific for the peptide or antigen.
- mAb refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e. each individual of a monoclonal antibody preparation are identical except for possible mutations (e g., naturally occurring mutations), that may be present in minor amounts. Certain differences in the protein sequences linked to post-translational modifications (for example, cleavage of the heavy chain C-terminal lysine, deamidation of asparagine residues and/or isomerization of aspartate residues) may nevertheless exist between the various different antibody molecules present in the composition. Contrary to polyclonal antibody preparations, each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
- diabody refers to two Fv pairs, a first VH/VL pair and a further VH/VL pair which have two inter-Fv linkers, such that the VH of a first Fv is linked to the VL of the second Fv and the VL of the first Fv is linked to the VH of the second Fv.
- trimer (also referred to a Fab(scFv)2) as employed herein refers to a Fab fragment with a first scFv appended to the C-terminal of the light chain and a second scFv appended to the C-terminal of the heavy chain.
- tetrabody as employed herein refers to a format similar to the diabody comprising fours Fvs and four inter-Fv linkers.
- multivalent antibody refers to an antibody comprising more than one antigen binding domain e.g., bivalent.
- Fv refers to two variable domains of full-length antibodies, for example co-operative variable domains, such as a cognate pair or affinity matured variable domains, i.e. , a VH and VL pair.
- scFv refers to single chain variable fragment which is a fusion protein of the variable regions of the heavy and light chains of the immunoglobulins, connected with a short linker peptide of ten to about 25 amino acids.
- bis-scFv as described herein refers to a bispecific scFv.
- dsscFv or “disulphide-stabilised single chain variable fragment” as employed herein refers to a single chain variable fragment which is stabilised by a peptide linker between the VH and VL variable domain and also includes an inter-domain disulphide bond between VH and VL.
- DVD-lg also known as dual V domain IgG refers to a full-length antibody with 4 additional variable domains, one on the N-terminus of each heavy and each light chain.
- Fab refers to as used herein refers to an antibody fragment comprising a light chain fragment comprising a VL (variable light) domain and a constant domain of a light chain (CL), and a VH (variable heavy) domain and a first constant domain (CHI) of a heavy chain.
- Dimers of a Fab’ according to the present disclosure create a F(ab’)2 where, for example, dimerization may be through the hinge.
- F(ab’) refers to a monovalent fragment of a single light chain homodimer, which is obtained by pepsin digestion of IgG, followed by reduction of the light chain disulfide bond.
- F(ab’)2 refers to a fragment of IgG that is prepared by pepsin digestion of IgG.
- the F(ab’)2 fragment is a disulfide-linked homodimer of the two light chain dimers, so it retains bivalent epitope binding like whole IgG, but as it lacks the heavy chains, it is smaller in size compared to a whole IgG.
- F(ab’)2 and F(ab’) fragments do not bind to immunoglobulin receptors on cells, which can be useful for achieving specific staining of the primary antibody target.
- constant domain(s) or “constant region”, as used herein are used interchangeably to refer to the domain(s) of an antibody which is outside the variable regions.
- the constant domains are identical in all antibodies of the same isotype but are different from one isotype to another.
- the constant region of a heavy chain is formed, from N to C terminal, by CH1 -hinge -CH2-CH3-optionally CH4, comprising three or four constant domains.
- DiFab as employed herein refers to two Fab molecules linked via their C-terminus of the heavy chains or two Fab’ molecules linked via one or more disulfide bonds in the hinge region thereof.
- antibody binding variant refers to a polypeptide, for example, an antibody possessing the desired characteristics described herein and comprising a VH and/or a VL that has at least about 80% amino acid sequence identity with a VH and/or a VL of the reference antibody.
- antibody variants include, for instance, antibodies wherein one or more amino acid residues are added to or deleted from the VH and/or a VL domain.
- an antibody variant will have at least about 80% amino acid sequence identity, alternatively at least about 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity, to an antibody described herein.
- variant antibodies will have no more than one conservative amino acid substitution as compared to an antibody sequence provided herein, alternatively no more than about any of 2, 3, 4, 5, 6, 7, 8, 9, or 10 conservative amino acid substitutions as compared to an antibody sequence provided herein.
- an 'immune cell refers to any cell of the immune system, including but not limited to T-cells, helper T-cells, B-cells, natural killer (NK) cells, dendritic cells (DC), granulocytes (such as basophils, eosinophils, neutrophils), mast cells, monocytes, and macrophages.
- epitopes or “binding site” in the context of antibodies refers to a site (or a part) on an antigen to which the paratope of an antibody binds or recognizes.
- Epitopes can be formed both from contiguous amino acids (also often called “linear epitopes”) or non-contiguous amino acids formed by tertiary folding of a protein (often called “conformational epitopes ”).
- contiguous amino acids also often called “linear epitopes”
- non-contiguous amino acids formed by tertiary folding of a protein often called “conformational epitopes ”.
- An epitope typically includes at least 3, and more usually, at least 5-10 amino acids in a unique spatial conformation.
- Epitopes usually consist of chemically active surface groups of molecules such as amino acids, sugar side chains and usually have specific 3D structural and charge characteristics.
- the "class" of an antibody refers to the type of constant domain or constant region possessed by its heavy chain.
- the heavy chain constant domains that correspond to the different classes of immunoglobulins are called a, d, e, g, and m, respectively.
- chimeric antibody is an antibody molecule (or antigen-binding fragment thereof) in which (a) the constant region, or a portion thereof, is altered, replaced or exchanged so that the antigen binding site (variable region) is linked to a constant region of a different or altered class, effector function and/or species, or an entirely different molecule which confers new properties to the chimeric antibody, e. g., an enzyme, toxin, hormone, growth factor, drug, etc.; or (b) the variable region, or a portion thereof, is altered, replaced or exchanged with a variable region having a different or altered antigen specificity.
- a mouse antibody can be modified by replacing its constant region with the constant region from a human immunoglobulin. Due to the replacement with a human constant region, the chimeric antibody can retain its specificity in recognizing the antigen while having reduced antigenicity in human as compared to the original mouse antibody.
- chimeric antigen receptors refers to receptor protein that has been engineered to give T cells the new ability to target a specific antigen.
- the receptors are chimeric in that they combine both antigen-binding and T cell activating functions into a single receptor.
- CAR T cell therapy uses T cells engineered with CARs to treat cancer.
- T cells in CAR T immunotherapy are modified to recognize cancer cells in order to more effectively target and destroy them.
- CAR T cells can be derived either from T cells in a patient’s own blood (autologously) or from the T cells of another, healthy, donor (allogeneically). Once isolated from a person, these T cells are genetically engineered to express a specific CAR, which programs them to target an antigen that is present on the surface of tumours.
- CAR T cells are engineered to be specific to an antigen that is expressed on a tumour but is not expressed on healthy cells.
- CAR T cells destroy cells through extensive stimulated cell proliferation, increasing the degree to which they are toxic to other living cells (cytotoxicity) and by causing the increased secretion of factors that can affect other cells such as cytokines, interleukins and growth factors.
- the surface of CAR T cells can bear either two types of co-receptors, CD4 and CD8, each with different and interacting cytotoxic effects.
- human antibody or “humanized antibody” (or antigen-binding fragment thereof), as used herein, is intended to include antibodies (and antigen-binding fragments thereof) having variable regions in which both the framework and CDR regions are derived from sequences of human origin.
- antibodies or immunoglobulins are divided into the classes: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (subtypes), e.g. lgG1, lgG2, lgG3, and lgG4, lgA1 , and lgA2.
- human IgG constant region domains may be used, especially of the lgG1 and lgG3 isotypes when the antibody molecule is intended for therapeutic uses and antibody effector functions are required.
- lgG2 and lgG4 isotypes may be used when the antibody molecule is intended for therapeutic purposes and antibody effector functions are not required.
- the constant region also is derived from such human sequences.
- a humanized antibody (or antigen-binding fragment thereof) retains the reactivity of a non-human antibody while being less immunogenic in humans. This can be achieved, for instance, by retaining the non-human CDR regions and replacing the remaining parts of the antibody with their human counterparts (i.
- the humanized antibodies of the present disclosure may include amino acid residues not encoded by human sequences (e. g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo, or a conservative substitution to promote stability or manufacturing). This definition of a humanized antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
- Human antibodies can be produced using various techniques known in the art, including phage-display libraries, administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e. g., immunized xenomice via a human B-cell hybridoma technology.
- recombinant humanized antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies isolated from a host cell transformed to express the humanized antibody, e. g., from a transfectoma, and antibodies prepared, expressed, created or isolated by any other means that involve splicing of all or a portion of a human immunoglobulin gene, sequences to other DNA sequences.
- isolated means, throughout this specification, that the antibody, or polynucleotide, as the case may be, exists in a physical milieu distinct from that in which it may occur in nature.
- isolated nucleic acid refers to a nucleic acid molecule that has been isolated from its natural environment or that has been synthetically created.
- An isolated nucleic acid may comprise synthetic DNA, for instance produced by chemical processing, cDNA, genomic DNA or any combination thereof.
- An isolated antibody refers to an antibody that is substantially free of other cellular material and/or chemicals.
- CDRs Complementarity Determining Regions
- Kabat i.e., "Kabat” numbering scheme
- Al-Lazikani Chothia
- ImMunoGenTics IMGT numbering scheme
- CDRs Complementarity Determining Regions
- Antibodies typically comprise six CDRs: three in the VH (H1 , H2, H3), and three in the VL (L1, L2, L3).
- sequence identity refers to the percentage sequence identities that are determined with antibody sequences maximally aligned by the Kabat numbering convention. After alignment, if a subject antibody region (e.g., the entire mature variable region of a heavy or light chain) is being compared with the same region of a reference antibody, the percentage sequence identity between the subject and reference antibody regions is the number of positions occupied by the same amino acid in both the subject and reference antibody region divided by the total number of aligned positions of the two regions, with gaps not counted, multiplied by 100 to convert to percentage.
- the antigen binding protein as disclosed herein may comprise a sequence that is at least 60% identical to any one of the sequences disclosed herein.
- the antigen binding protein may comprise a sequence that is at least about 60%, at least about 61%, at least about 62%, at least about 63%, at least about 64%, at least about 65%, at least about 66%, at least about 67%, at least about 68%, at least about 69%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical
- the antigen binding protein comprises a sequence or an amino acid region or is encoded by a nucleotide region that differs by about one, about two, about three, about four, about five, about six, about seven, about eight, about nine, about ten or more amino acids or nucleobase with the sequence as disclosed herein.
- the antigen binding protein comprises an amino acid sequence having one or more amino acid mutations with respect to any one of the sequences disclosed herein.
- the antigen binding protein comprises an amino acid sequence having one, or two, or three, or four, or five, or six, or seen, or eight, or nine, or ten, or fifteen, or twenty amino acid mutations with respect to any one of the sequences disclosed herein.
- the one or more amino acid mutations may be independently selected from substitutions, insertions, deletions, and truncations.
- amino acid mutations are amino acid substitutions, and may include conservative and/or non-conservative substitutions.
- “Conservative substitutions” may be made, for instance, on the basis of similarity in polarity, charge, size, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the amino acid residues involved.
- the 20 naturally occurring amino acids can be grouped into the following six standard amino acid groups: (1) hydrophobic: Met, Ala, Vai, Leu, lie; (2) neutral hydrophilic: Cys, Ser, Thr; Asn, Gin; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; and (6) aromatic: Trp, Tyr, Phe.
- “conservative substitutions” are defined as exchanges of an amino acid by another amino acid listed within the same group of the six standard amino acid groups shown above. For example, the exchange of Asp by Glu retains one negative charge in the so modified polypeptide.
- glycine and proline may be substituted for one another based on their ability to disrupt a-helices.
- non-conservative substitutions are defined as exchanges of an amino acid by another amino acid listed in a different group of the six standard amino acid groups (1) to (6) shown above.
- the substitutions may also include non-classical amino acids.
- non-classical amino acids include, but are not limited to, selenocysteine, pyrrolysine, N-formylmethionine p-alanine, GABA and b-Aminolevulinic acid, 4- aminobenzoic acid (PABA), D-isomers of the common amino acids, 2,4-diaminobutyric acid, a-amino isobutyric acid, 4-aminobutyric acid, Abu, 2-amino butyric acid, y-Abu, s- Ahx, 6-amino hexanoic acid, Aib, 2-amino isobutyric acid, 3-amino propionic acid, ornithine, norleucine, norvaline, hydroxyproline, sarcosme, citrulline, homocitrulline, cysteic acid, t-butylglycine, t-butylalanine
- amino acid mutation may be in the CDRs of the antigen binding protein (e.g., the CDR1, CDR2 or CDR3 regions).
- amino acid alteration may be in the framework regions (FRs) of the antigen binding protein (e.g., the FR1 , FR2, FR3, or FR4 regions).
- the mutations do not substantially reduce the antigen binding protein’s capability to specifically bind to a target. In some examples, the mutations do not substantially reduce the antigen binding protein’s capability to specifically bind to a target and without functionally modulating (e.g., partially or fully neutralizing) the target.
- Modification of the amino acid sequences may be achieved using any known technique in the art e.g., site-directed mutagenesis or PCR based mutagenesis.
- polynucleotide refers to a linear polymer whose molecule is composed of many nucleotide units, constituting a section of a nucleic acid molecule. Polynucleotides are made up of long chains of nucleotides like deoxyribonucleic acid (DNA) and ribonucleic acid (RNA).
- DNA deoxyribonucleic acid
- RNA ribonucleic acid
- affinity refers to the strength of all noncovalent interactions between an antibody thereof and the target protein.
- binding affinity refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
- the affinity of a molecule for its binding partner can be generally represented by the dissociation constant (KD). Affinity can be measured by common methods known in the art, including those described herein.
- Kd refers to the constant of dissociation which is obtained from the ratio of Kd to Ka (i.e. Kd / Ka) and is expressed as a molar concentration (M).
- Kd and Ka refer to the dissociation rate and association rate, respectively, of a particular antigen-antibody interaction.
- KD values for antibodies can be determined using methods well established in the art.
- the term “low affinity” refers to KD of 100 nM or more.
- moderate affinity refers to KD ranging from 10nM to 100nM.
- high affinity refers to KD of 1 to 10nM.
- very high affinity refers to KD of 1nM or less.
- EC50 refers to the concentration of an antibody or an antigen-binding protein/portion thereof, which induces a response, either in an in vivo or an in vitro assay, which is 50% of the maximal response (i.e., halfway between the maximal response and the baseline).
- multi-specific antigen binding protein refers to a multispecific antigen binding protein that may bind to two or more host cell target antigens. Therefore, the term “multi-specific” or “multi-specific antibody” as employed herein refers to an antibody as described herein which has at least two binding domains, i.e. two or more binding domains, for example two or three binding domains, wherein the at least two binding domains independently bind two different antigens or two different epitopes on the same antigen. Multi-specific antibodies are generally monovalent for each specificity (antigen). Multi-specific antibodies described herein encompass monovalent and multivalent, e.g. bivalent, trivalent, tetravalent multi-specific antibodies
- bispecific or “bispecific antibody” as employed herein refers to an antibody with two antigen specificities or an antibody that has the ability to simultaneously bind to two target antigens/sites.
- a “bispecific T cell engager” refers to a class of artificial bispecific monoclonal antibodies that direct a host’s immune system, such as the T cells’ cytotoxic activity against target cells (such as cancer cells).
- BiTEs are fusion proteins consisting of two single-chain variable fragments (scFvs) of different antibodies, or amino acid sequences from four different genes, on a single peptide chain of about 55 kDa.
- One of the scFvs binds to an immune cell (such as a T cell via the CD3 receptor), and the other to target of interest (e.g., a tumour cell via a tumour specific molecule).
- BiTEs form a link between an immune cell (e.g., a T cell) and a target cell (such as a tumour cell). This causes the immune cell (e.g., T cell) to exert cytotoxic activity on tumour cells. For example, if the immune cell is a T cell, the T cell would exert cytotoxic activity by producing proteins like perforin and granzymes that enter tumour cells and initiate the cell’s apoptosis.
- BiTE may refer to the BiTE® immune-oncology platform that was developed by Amgen® Oncology. In some examples, BiTE may also refer to the bispecific T-cell engager platform as known in the art that refers to recombinant proteins that simultaneously bind two different antigens and have the ability to engage an immune cell (such as T cell).
- the term “nanobody” refers to a single domain antibody (sdAb), with an antibody fragment consisting of a single monomeric variable antibody domain.
- the bispecific T cell engager (BiTE) is a nanobody with a heavy chain only (VHH).
- a “nanobody with a heavy chain only” refers to nanobodybased heavy chain antibody.
- a heavy-chain antibody is an antibody which consists of two heavy chains and lacks the two light chains usually found in antibodies.
- a "vector” is any molecule or composition that has the ability to carry a nucleic acid sequence into a suitable host cell where e.g., synthesis of the encoded polypeptide can take place.
- a vector is a nucleic acid that has been engineered, using recombinant DNA techniques that are known in the art, to incorporate a desired nucleic acid sequence (e.g., a nucleic acid of the present disclosure).
- Expression vectors typically contain one or more of the following components (if they are not already provided by the nucleic acid molecules): a promoter, one or more enhancer sequences, an origin of replication, a transcriptional termination sequence, a complete intron sequence containing a donor and acceptor splice site, a leader sequence for secretion, a ribosome binding site, a polyadenylation sequence, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element.
- Vectors are typically selected to be functional in the host cell in which the vector will be used (the vector is compatible with the host cell machinery such that amplification of the gene and/or expression of the gene can occur.
- the vector as described herein may be an expression vector and/or a cloning vector.
- host cell is intended to refer to a cell into which an expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term “host cell” as used herein.
- treating refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) a medical condition, which includes but is not limited to diseases, symptoms and disorders.
- a medical condition also includes a body’s response to a disease or disorder, e.g. inflammation.
- Those in need of such treatment include those already with a medical condition as well as those prone to getting the medical condition or those in whom a medical condition is to be prevented.
- subject as used herein includes patients and non-patients.
- patient refers to individuals suffering or are likely to suffer from a medical condition
- non-patients refer to individuals not suffering and are likely to not suffer from the medical condition.
- Non-patients include healthy individuals, non-diseased individuals and/or an individual free from the medical condition.
- subject includes humans and animals. Animals may include, but is not limited to, mammals (for example nonhuman primates, canine, murine and the like), and the like.
- “Murine” refers to any mammal from the family Muridae and / or Leporidae, such as mouse, rat, rabbit, and the like.
- preventing and/or “reducing the severity of symptoms” as used herein refers to process of delaying the onset, reducing the severity of symptoms, reducing and/or preventing weight loss, preventing death, inhibiting deterioration, inhibiting further deterioration, and/or ameliorating at least one sign or symptom of a disease.
- the word “substantially” whenever used is understood to include, but not restricted to, “entirely” or “completely” and the like.
- terms such as “comprising”, “comprise”, and the like whenever used are intended to be non-restricting descriptive language in that they broadly include elements/components recited after such terms, in addition to other components not explicitly recited.
- reference to a “one” feature is also intended to be a reference to “at least one” of that feature.
- Terms such as “consisting”, “consist”, and the like may in the appropriate context, be considered as a subset of terms such as “comprising”, “comprise”, and the like.
- the individual numerical values within the range also include integers, fractions and decimals. Furthermore, whenever a range has been described, it is also intended that the range covers and teaches values of up to 2 additional decimal places or significant figures (where appropriate) from the shown numerical end points. For example, a description of a range of 1% to 5% is intended to have specifically disclosed the ranges 1 .00% to 5.00% and also 1 .0% to 5.0% and all their intermediate values (such as 1 .01 %, 1.02% ... 4.98%, 4.99%, 5.00% and 1.1%, 1.2% ... 4.8%, 4.9%, 5.0% etc.,) spanning the ranges. The intention of the above specific disclosure is applicable to any depth/breadth of a range.
- At least 95% identical as employed herein is intended to refer to an amino acid sequence which over its full length is 95% identical or more to a reference sequence, such as 96, 97, 98 or 99% identical. Software programmes can be employed to calculate percentage identity.
- the disclosure may have disclosed a method and/or process as a particular sequence of steps. However, unless otherwise required, it will be appreciated that the method or process should not be limited to the particular sequence of steps disclosed. Other sequences of steps may be possible. The particular order of the steps disclosed herein should not be construed as undue limitations. Unless otherwise required, a method and/or process disclosed herein should not be limited to the steps being carried out in the order written. The sequence of steps may be varied and still remain within the scope of the disclosure.
- the present disclosure provides engineered cells expressing
- the first target antigen is an antigen associated with a disease.
- the target antigen is a molecule associated with a disease.
- the molecule may be an extracellular molecule, an intracellular molecule, and/or a transmembrane molecule.
- the molecule may be a polypeptide, a polynucleotide, a carbohydrate, and the like.
- the first target antigen is a diseased cell and the like.
- the diseased cells may include but are not limited to a cell from a proliferative disease (such as tumour / cancer, an inflammatory disease), and the like.
- the diseased cell may be a cell from cancer / tumour.
- the cancer cell is a solid tumour.
- the solid tumour may include tumours with epithelial origins such as carcinoma.
- carcinoma may include but is not limited to liver cancer, lung cancer, stomach cancer (such as gastric adenocarcinoma), breast cancer, skin cancer, ovary cancer, kidney cancer, pancreas cancer, head and neck cancer, prostate gland cancer, esophagus cancer, bladder cancer, colon cancer, and the like.
- the tumour cell may include benign, premalignant, malignant tumours, and the like.
- the tumour cell may include a stem cell, a progenitor cell, and the like.
- the tumour cell may include tumour cell lines such as but is not limited to gastric adenocarcinoma cell line (such as AGS), breast cancer cell line (such as MDA-MB468, MCF7, SKBR3, BT474, MDA-MB231 , MDA-MB436), glioblastoma (A-172), and the like.
- target antigen is an epithelial marker.
- the epithelial markers may include but is not limited to receptor tyrosine-protein kinase erbB- 2 (HER2), glypican 3 (GPC3), Claudin 18.2, receptor tyrosine kinase like orphan receptor 1 (ROR1), delta like canonical notch ligand 3 (DLL3), carcinoembryonic antigen (CEA), mucin 1 (MUC1), mucin 16 (MUC16), CEA Cell Adhesion Molecule 7 (CEACAM7), prominin-1 (CD133), cluster of differentiation 147 (CD147), prostate stem cell antigen (PSCA), prostate-specific membrane antigen (PSMA), mesothelin (MSLN), mesenchymal-epithelial transition factor (c-Met), folate receptor alpha (FRa), and the like.
- the first antigen is HER2. Therefore, in some embodiments, the chimeric
- HER2 expressing cancer may include but is not limited to, gastric / gastroesophageal cancer, breast cancer, head and neck cancer, ovarian cancer, endometrium cancer, bladder cancer, lung cancer, colon cancer, and the like.
- the CAR T cell targets HER 2 alone (HE CAR-T).
- the cell expresses a multi-specific antigen binding protein that binds to one or more markers.
- the multi-specific antigen binding protein may bind to EpCAM and an immune marker.
- EpCAM is widely expressed on almost all carcinomas but is also expressed at low levels on normal epithelia.
- Anti-EpCAM CAR T cells have been demonstrated to be highly toxic to normal tissues, with anti-EpCAM BiTE (such as Solitomab and Catumaxomab) showed dose-limiting toxicities and failed to achieve FDA approval.
- EpCAM Epithelial Cellular Adhesion Molecule
- Cancer therapy targeting EpCAM has undergone more than 10 years of clinical development.
- EpCAM is also expressed at low levels on normal epithelia
- anti- EpCAM CAR T cells have been demonstrated to be highly toxic to normal tissues. Due to the same fact, both Solitomab and Catumaxomab (anti-EpCAM BiTE) showed dose-limiting toxicities and failed to achieve FDA approval.
- HER2 has been found in approximately 10-30% of gastric/gastroesophageal cancers and 15-30% of breast cancers. In addition, HER2 overexpression has also been reported in other cancers like ovary, endometrium, bladder, lung, colon, as well as head and neck cancers. Immunotherapies such as CAR T cell therapies targeting HER2 has clinically proven to have some treatment efficacy and be generally safe, unless antibody clones with very high antigen binding affinities were used. However, only a very limited number of patients achieved complete remission (CR).
- CAR T cell therapies targeting HER2 has clinically proven to have some treatment efficacy and be generally safe, unless antibody clones with very high antigen binding affinities were used. However, only a very limited number of patients achieved complete remission (CR).
- CAR T therapies using the FDA approved anti-CD19 directed “Kymriah” or “Yescarta” in treating various B cell originated leukaemia and lymphomas also faced the same problem of antigen escape.
- CAR T cells with dual targeting were often applied and the bispecific anti-CD19/CD20 CAR T-cell therapy had shown early promise to treat the relapsed or refractory B-cell Lymphomas.
- CAR T cells have intrinsic properties of high potency in killing cancer cells, a design of dual CAR with multiple targeting of two or more antigens may induce intolerable on-target, off- tumour toxicity and hence are considered extremely dangerous to patients with solid tumours.
- EpCAM is found to be co-expressed with HER2 in many cancers.
- HER2- targeting CAR T cells secreting anti-EpCAM bispecific T cell engager (BiTE) was developed in this invention so that the presence of anti-EpCAM BiTE is restricted at tumour site to contribute to tumour eradication and tumour escape prevention to the maximal extent and at the same time avoid systemic toxicity.
- HE CAR-BiTE T HER2 targeting CAR T cells with anti-EpCAM BiTE secretion.
- CAR-BiTE T cells secreting anti-EpCAM BiTE first infiltrate and retain at the tumour site via CAR recognition of the specific tumour antigen expressed on the tumour cells.
- the CAR T cells Upon CAR target engagement, the CAR T cells will be activated and begin to expand and at the same time secrete anti-EpCAM BITEs.
- the anti-EpCAM BiTEs exert their cytotoxicity by recruiting the T cells nearby.
- bystander T cells are physically directed to the proximity of tumours and at the same time being activated and subsequently help the clearance of tumour cells. Since HER2 overexpression is tumour-specific, the expansion of the anti-EpCAM BiTEs is presumably restricted at or near the tumour sites.
- EpCAM is also defined as a cancer stem cell marker as it is found to be expressed on cancer progenitor cells and cancer stem cells as well. Secretion of anti-EpCAM BiTE by CAR T cells will concomitantly contribute to the prevention of cancer relapse and recurrence by eliminating cancer stem cells and progenitor cells.
- EpCAM has the highest expression level as compared to other epithelial tumour markers in the multiple HER2 positive tumour cells that were stained. Therefore, EpCAM is chosen as the BiTE target due to its wide coverage of cancer cells of epithelial origin. The much higher expression of EpCAM on cancerous cells compared to normal epithelial cells will provide a wider therapeutic window as compared to other targets. Furthermore, anti- EpCAM BiTE could be injected into tumour sites for targeted treatment.
- the anti-EpCAM BiTE of the present disclosure which is secreted by the CAR T cells only locally at the tumour site (and not administered systematically) restricts its potential toxicity. This turns an undruggable (or a difficult) target into a druggable target.
- a multi-specific antigen binding protein, variant or binding fragment thereof that binds one or more target comprising a first antigen binding protein, variant or binding fragment thereof that binds to EpCAM (epithelial cell adhesion molecule) and a second antigen binding protein, variant or binding fragment thereof that binds to an immune cell marker, wherein the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region and/or a light chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (2C4, hu2C4, 1A5, 1 B8, 2B7, and 2D10) a CDR-H1 comprising: • GSIFSGND (SEQ ID NO: 25 - 2C4, hu2C4, 1A5, 2B7, and 2D10), or
- ITSGGST SEQ ID NO: 26 - 2C4, hu2C4, 1A5, 2B7, and 2D10), or
- ITNGGST SEQ ID NO: 30 - 1 B8
- CDR-H3 comprising:
- TNGRWSGDTYYAHH SEQ ID NO: 27 -2C4, hu2C4, 1A5, and 2D10
- a heavy chain variable region comprising: (1 B6, 101 , 1011 , 1 D4 and 1 H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3)
- a heavy chain variable region comprising: (1 E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7)
- a light chain variable region comprising: (1 B6, 1C1 , 1C11 , 1D4, 1 E4 and 1 H6) a CDR-L1 comprising:
- LGS SEQ ID NO: 10 -1 B6, 101 , 1C11 , 1 D4 and 1 H6, or
- AAS SEQ ID NO: 20 - 1E4
- CDR-L3 comprising:
- MQGLQTPYT SEQ ID NO: 23 - 1 H6; and or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region comprising: (2C4, hu2C4, 1A5, 1B8, 2B7, and 2D10 ) a CDR-H1 comprising:
- GSIFSGND SEQ ID NO: 25 - 2C4, hu2C4, 1A5, 2B7, and 2D10), or
- ITSGGST SEQ ID NO: 26 - 2C4, hu2C4, 1A5, 2B7, and 2D10), or
- ITNGGST SEQ ID NO: 30 - 1 B8; and a CDR-H3 comprising:
- TNGRWSGDTYYAHL SEQ ID NO: 33 - 2B7 or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (2C4-VHH, hu2C4-VHH, 1A5-VHH, and 2D10-VHH) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHH (SEQ ID NO: 27)
- a heavy chain variable region comprising: (1 B8-VHH) a CDR-H1 comprising GSSERFTS (SEQ ID NO: 29), a CDR-H2 comprising ITNGGST (SEQ ID NO: 30), and a CDR-H3 comprising MAGTS (SEQ ID NO: 31); and
- a heavy chain variable region comprising: (2B7-VHH) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHL (SEQ ID NO: 33) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region and/or a light chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (2C4, hu2C4, 1A5, and 2D10) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHH (SEQ ID NO: 27)
- a heavy chain variable region comprising: (1 B6, 1C1 , 1C11 , 1 D4, 1 H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3)
- a heavy chain variable region comprising: (1E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7)
- a light chain variable region comprising: (1 B6 and 1C1) a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a light chain variable region comprising: (1C11) a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQGLQSPWT (SEQ ID NO: 15)
- a light chain variable region comprising: (1 D4) a CDR-L1 comprising QSLLHSNRYNY (SEQ ID NO: 17), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a light chain variable region comprising: (1 E4) a CDR-L1 comprising QSISDF (SEQ ID NO: 19), a CDR-L2 comprising AAS (SEQ ID NO: 20), and a CDR-L3 comprising QQSYIMPDT (SEQ ID NO: 21)
- a light chain variable region comprising: (1 H6) a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQGLQTPYT (SEQ ID NO: 23)
- a heavy chain variable region comprising: (1 B8-VHH) a CDR-H1 comprising GSSERFTS (SEQ ID NO: 29), a CDR-H2 comprising ITNGGST (SEQ ID NO: 30), and a CDR-H3 comprising MAGTS (SEQ ID NO: 31); and
- (x) a heavy chain variable region comprising: (2B7-VHH) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHL (SEQ ID NO: 33) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- (2B7-VHH) a CDR-H1 comprising GSIFSGND (SEQ ID NO: 25), a CDR-H2 comprising ITSGGST (SEQ ID NO: 26), and a CDR-H3 comprising TNGRWSGDTYYAHL (SEQ ID NO: 33) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain and/or a light chain variable domain selected from the group consisting of:
- a heavy chain variable domain comprising QVQLVESGGGLVQAGGSLRLSCAASGSIFSGNDMSWYRQAPGKGLE LVAVITSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYY CTNGRWSGDTYYAHHWGQGTL (SEQ ID NO: 37 - hu2C4-VHH)
- CTNGRWSGDTYYAHHWGQGTQ (SEQ ID NO: 36 - 2D10-VHH); and or fragment or variant or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical thereto and/or having two or three amino acids substitutions.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain selected from the group consisting of:
- a heavy chain variable domain comprising QVQLVESGGGLVQAGGSLRLSCAASGSIFSGNDMSWYRQAPGKGLE LVAVITSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYY CTNGRWSGDTYYAHHWGQGTL (SEQ ID NO: 37 - hu2C4-VHH)
- a heavy chain variable domain comprising EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLE WMGGIIPIFGTANYAQNFQGRVTMTADTSISTAYMELSSLRSEDTAVY YCARSLGGRFRYWGQGTL (SEQ ID NO: 4 - 1 B6, 1C1 , 1C11 , 1 D4 and 1 H6)
- a heavy chain variable domain comprising QVQLQESGGGLVQPGGSLRLSCADSGSIFSGNDMAWYRRAPGVERE LVAVITSGGSTHYADSVKGRFTISRDNAQKTVYLQTNDLKPEDTAVYY CTNGRWSGDTYYAHLWGQGTQ (SEQ ID NO: 34 - 2B7-VHH)
- a heavy chain variable domain comprising QVQLQESGGGLVQAGDSLRLSCADSGSIFSGNDMAWYRRAPGVERE LVAVITSGGSTHYADSVKGRFTISRDNAQKTVYLQTNDLKPEDTAVYY CTNGRWSGDTYYAHHWGQGTQ (SEQ ID NO: 36 - 2D10-VHH); and or fragment or variant or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical thereto and/or having two or three amino acids substitutions.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a single domain heavy chain variable domain having a sequence:
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region selected from the group consisting of: (i) a heavy chain variable region comprising: (1 B6, 1C1 , 1C11 , 1D4 and 1 H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3)
- a heavy chain variable region comprising: (1 E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7); and/or comprises a light chain variable region comprising: (1 B6, 1C1, 1C11 , 1 D4, 1E4 and 1 H6) a CDR-L1 comprising:
- LGS SEQ ID NO: 10 -1 B6, 1C1 , 1C11 , 1 D4 and 1 H6, or
- AAS SEQ ID NO: 20 - 1 E4
- CDR-L3 comprising:
- MQGLQTPYT SEQ ID NO: 23 - 1 H6 or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable region and/or a light chain variable region selected from the group consisting of:
- a heavy chain variable region comprising: (1 B6 and 1C1) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and/or a light chain variable region comprising: a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a heavy chain variable region comprising: (1C11) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and/or a light chain variable region comprising
- a heavy chain variable region comprising: (1 D4) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and/or a light chain variable region comprising: a CDR-L1 comprising QSLLHSNRYNY (SEQ ID NO: 17), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQALQTPYT (SEQ ID NO: 11)
- a heavy chain variable region comprising: (1 H6) a CDR-H1 comprising GGTFSSYA (SEQ ID NO: 1), a CDR-H2 comprising IIPIFGTA (SEQ ID NO: 2), and a CDR-H3 comprising ARSLGGRFRY (SEQ ID NO: 3); and/or a light chain variable region comprising: a CDR-L1 comprising QSLLHSNGYNY (SEQ ID NO: 9), a CDR-L2 comprising LGS (SEQ ID NO: 10), and a CDR-L3 comprising MQGLQTPYT (SEQ ID NO: 23); and
- a heavy chain variable region comprising: (1 E4) a CDR-H1 comprising GDSISSNSVA (SEQ ID NO: 5), a CDR-H2 comprising TYYRSKWYS (SEQ ID NO: 6), and a CDR-H3 comprising AREVEGSSYDAFDI (SEQ ID NO: 7); and/or a light chain variable region comprising: (1 E4) a CDR-L1 comprising QSISDF (SEQ ID NO: 19), a CDR-L2 comprising AAS (SEQ ID NO: 20), and a CDR-L3 comprising QQSYIMPDT (SEQ ID NO: 21) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain and/or a light chain variable domain selected from the group consisting of:
- a heavy chain variable domain comprising: (1 B6 and 1C1) EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWM GGIIPIFGTANYAQNFQGRVTMTADTSISTAYMELSSLRSEDTAVYYCARS LGGRFRYWGQGTL (SEQ ID NO: 4), and/or a light chain variable domain comprising DVVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSP QLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQT PYTFGQGTK (SEQ ID NO: 12)
- a heavy chain variable domain comprising: (1C11) EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWM GGIIPIFGTANYAQNFQGRVTMTADTSISTAYMELSSLRSEDTAVYYCARS LGGRFRYWGQGTL (SEQ ID NO: 4), and/or a light chain variable domain comprising EIVLTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQ LLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQSP WTFGQGTK (SEQ ID NO: 16)
- a heavy chain variable domain comprising: (1 D4) EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWM GGIIPIFGTANYAQNFQGRVTMTADTSISTAYMELSSLRSEDTAVYYCARS LGGRFRYWGQGTL (SEQ ID NO: 4), and/or a light chain variable domain comprising DVVMTQSPLSLPVTPGESASISCRSSQSLLHSNRYNYLDWYLQKPGQSP QLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQT PYTFGQGTK (SEQ ID NO: 18)
- a heavy chain variable domain comprising: (1 H6) EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWM GGIIPIFGTANYAQNFQGRVTMTADTSISTAYMELSSLRSEDTAVYYCARS LGGRFRYWGQGTL (SEQ ID NO: 4), and/or a light chain variable domain DVVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSP QLLIYLGSNRASGVPDRFSGSGSGTDFTLQISRVEAEDAGVYYCMQGLQT PYTFGQGTK (SEQ ID NO: 24), or fragment or variant or a sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical thereto and/or having two or three amino acids substitutions.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a light chain constant domain having a sequence:
- RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTK SFSRGEC SEQ ID NO: 14 clone 1C1 - light chain constant domain
- fragment or variant or a sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical thereto and/or having two or three amino acids substitutions.
- the antigen binding protein, variant or fragment thereof comprises a heavy chain variable region and/or a light chain variable region encoded by nucleic acid sequences selected from the group consisting of:
- a heavy chain variable region comprising: (1 B6 and 1C1) a CDR-H1 comprising GGAGGCACCTTCAGCAGCTATGCT (SEQ ID NO:
- a CDR-H3 comprising GCGAGATCGTTGGGTGGGAGATTTCGCTAC (SEQ ID NO: 40); and/or a light chain variable region comprising: a CDR-L1 comprising
- CAGAGCCTCCTGCATAGTAATGGATACAACTAT (SEQ ID NO: 46)
- CDR-L2 comprising TTGGGTTCT
- CDR-L3 comprising ATGCAAGCTCTACAAACTCCGTACACT (SEQ ID NO: 48)
- a heavy chain variable region comprising: (1C11) a CDR-H1 comprising GGAGGCACCTTCAGCAGCTATGCT (SEQ ID NO: 38), a CDR-H2 comprising ATCATCCCTATCTTTGGTACAGCA (SEQ ID NO: 39), and a CDR-H3 comprising GCGAGATCGTTGGGTGGGAGATTTCGCTAC (SEQ ID NO: 40); and/or a light chain variable region comprising: a CDR-L1 comprising
- CAGAGCCTCCTGCATAGTAATGGATACAACTAT (SEQ ID NO: 46)
- CDR-L2 comprising TTGGGTTCT
- CDR-L3 comprising ATGCAAGGTCTACAAAGTCCCTGGACG (SEQ ID NO: 52)
- a heavy chain variable region comprising: (1 D4) a CDR-H1 comprising GGAGGCACCTTCAGCAGCTATGCT (SEQ ID NO: 38), a CDR-H2 comprising ATCATCCCTATCTTTGGTACAGCA (SEQ ID NO: 39), and a CDR-H3 comprising GCGAGATCGTTGGGTGGGAGATTTCGCTAC (SEQ ID NO: 40); and/or a light chain variable region comprising: a CDR-L1 comprising
- CAGAGCCTCCTGCATAGTAATAGATACAACTAT (SEQ ID NO: 54)
- CDR-L2 comprising TTGGGTTCT
- CDR-L3 comprising ATGCAAGCTCTACAAACTCCGTACACT (SEQ ID NO: 48)
- a heavy chain variable region comprising: (1 H6) a CDR-H1 comprising GGAGGCACCTTCAGCAGCTATGCT (SEQ ID NO:
- CAGAGCCTCCTGCATAGTAATGGATACAACTAT (SEQ ID NO: 46)
- CDR-L2 comprising TTGGGTTCT
- CDR-L3 comprising ATGCAAGGTCTACAGACTCCGTACACT
- a heavy chain variable region comprising: (1 E4) a CDR-H1 comprising GGGGACAGTATCTCTAGTAACAGTGTTGCT
- GCAAGAGAAGTTGAGGGCAGCAGCTATGATGCTTTTGATATC (SEQ ID NO: 44); and/or a light chain variable region comprising: (1 E4) a CDR-L1 comprising CAGAGTATTAGCGACTTT (SEQ ID NO: 56), a CDR-L2 comprising GCTGCATCG (SEQ ID NO: 57), and a CDR-L3 comprising TTACATTATGCCCGACACT (SEQ ID NO: 58) or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the antigen binding protein, variant or fragment thereof comprises a heavy chain variable region encoded by nucleic acid sequences selected from the group consisting of:
- a heavy chain variable region comprising: (2C4-VHH, 1A5-VHH, 2D10-VHH and hu2C4-VHH) a CDR-H1 comprising GGAAGCATCTTCAGTGGCAATGAC (SEQ ID NO:
- a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO: 62), a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO: 62), a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO: 62), a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO: 62), a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO:
- a heavy chain variable region comprising: (1 B8-VHH) a CDR-H1 comprising GGAAGCTCCGAAAGATTCACATCA (SEQ ID NO: 66), a CDR-H2 comprising ATTACTAATGGTGGTAGCACA (SEQ ID NO: 67), and a CDR-H3 comprising ATGGCGGGTACGTCC (SEQ ID NO: 68); and
- a heavy chain variable region comprising: (2B7-VHH) a CDR-H1 comprising GGAAGCATCTTCAGTGGCAATGAC (SEQ ID NO: 62), a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO: 63), and a CDR-H3 comprising ACAAACGGAAGATGGTCAGGCGATACTTACTATGCCCATCTC (SEQ ID NO: 62), a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO: 63), and a CDR-H3 comprising ACAAACGGAAGATGGTCAGGCGATACTTACTATGCCCATCTC (SEQ ID NO: 62), a CDR-H2 comprising ATTACTAGCGGTGGTAGTACA (SEQ ID NO: 63), and a CDR-H3 comprising ACAAACGGAAGATGGTCAGGCGATACTTACTATGCCCATCTC (SEQ ID NO: 62),
- ID NO: 70 or fragment or variation or sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity thereto.
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises a heavy chain variable domain encoded by a nucleotide sequence comprising:
- CTACTGGGGCCAGGGAACCCTG (SEQ ID NO: 41 - for clones 1B6, 101, 1011 , 1 D4, 1 H6), or
- CAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATGCCC AGAAGACCGTATATCTGCAAACGAACGACTTGAAACCTGAGGACAC GGCCGTGTATTACTGCACAAACGGAAGATGGTCAGGCGATACTTA
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises
- the first antigen binding protein, variant or binding fragment thereof that binds to EpCAM comprises heavy chain and/or light chain variable domains encoded by nucleotide sequences selected from the group consisting of:
- ACCAAG (SEQ ID NO: 49)
- a heavy chain variable domain encoded by the nucleotide sequence comprising: (1C11) GAGGTCCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGG GTCCTCGGTGAAGGTCTCCTGCAAGGCTTCTGGAGGCACCTTCAG CAGCTATGCTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCT TGAGTGGATGGGAGGGATCATCCCTATCTTTGGTACAGCAAACTA
- a light chain variable domain encoded by the nucleotide sequence comprising: GAAATTGTGCTGACTCAGTCTCCACTCTCCCTGCCCGTCACC
- CTACTGGGGCCAGGGAACCCTG (SEQ ID NO: 41), and/or a light chain variable domain encoded by the nucleotide sequence comprising:
- the antigen binding protein, variant or fragment thereof comprises comprises a light chain constant domain encoded by the nucleotide sequence comprising CGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCA GTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCC CAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTA ACTCCCAGGAGAGTGTCGCAGAGCAGGACAGCAAGGACAGCACCTACAG CCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAC TCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAG AGCTTCAACAGGGGAGAGTGT (SEQ ID NO: 50 - clone 1B6 - light chain constant domain), or CGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCA GTTGAAATCTGGAACTGCCTCTGTTG
- the multi-specific antigen binding protein may comprise an amino acid sequence having one or more amino acid mutations with respect to any one of the sequences disclosed herein.
- the antigen binding protein comprises an amino acid sequence having one, or two, or three, or four, or five, or six, or seen, or eight, or nine, or ten, or fifteen, or twenty amino acid mutations with respect to any one of the sequences disclosed herein.
- the one or more amino acid mutations may be independently selected from substitutions, insertions, deletions, and truncations.
- the amino acid mutations are amino acid substitutions, and may include conservative and/or non-conservative substitutions.
- the mutations do not substantially reduce the antigen binding protein’s capability to specifically bind to a target. In some examples, the mutations do not substantially reduce the antigen binding protein’s capability to specifically bind to a target and without functionally modulating (e.g., partially or fully neutralizing) the target.
- the multi-specific antigen binding protein may be a bispecific, a tri-specific, a tetra-specific antigen binding protein, and the like. In some examples, the multi-specific antigen binding protein is a bispecific antigen binding protein. In some examples, the multi-specific antigen binding protein, variant or fragment thereof is a bispecific antibody. In some examples, the multi-specific antigen binding protein may be provided as a nanobody. In some examples, the multi-specific antigen binding protein may be provided as a Fc region. In some examples, the multispecific antigen binding protein is an inducible bispecific T cell engager comprising a heavy chain antibody variable region (i.e. VHH) and/or a single chain variable fragment (scFv). In some embodiments, the bispecific T cell engager (BiTE) is a nanobody with a heavy chain only (VHH).
- VHH heavy chain antibody variable region
- scFv single chain variable fragment
- the bispecific T cell engager (BiTE) is a nanobody with
- the multi-specific antigen binding protein, variant or fragment thereof is an inducible bispecific immune cell engager. In some examples, the multispecific antigen binding protein is secreted by the cell, optionally an immune cell. In some examples, the multi-specific antigen binding protein, variant or fragment thereof is a bispecific T cell engager (BiTE).
- BiTE bispecific T cell engager
- a bispecific T cell engager refers to a class of artificial bispecific monoclonal antibodies that direct a host’s immune system, such as the T cells’ cytotoxic activity against target cells (such as cancer cells).
- BiTEs are fusion proteins consisting of two single-chain variable fragments (scFvs) of different antibodies, or amino acid sequences from four different genes, on a single peptide chain of about 55 kDa.
- scFvs single-chain variable fragments
- One of the scFvs binds to T cells via the CD3 receptor, and the other to a target of interest (e g. a tumour cell via a tumour specific molecule).
- target of interest e g. a tumour cell via a tumour specific molecule
- BiTEs form a link between T cells and target cells (such as tumour cells). This causes T cells to exert cytotoxic activity on the target cells (such as tumour cells) by producing proteins like perforin and granzymes that enter tumour cells and initiate the cell’
- BiTE may refer to the BiTE® immune-oncology platform that was developed by Amgen® Oncology. In some examples, BiTE may also refer to the bispecific T-cell engager platform as known in the art that refers to recombinant proteins that simultaneously bind two different antigens and have the ability to engage an immune cell (such as T cell).
- the bispecific T cell engager (BiTE) binds to two antigens; wherein the first antigen is EpCAM; and wherein the second antigen is an immune cell marker.
- the second antigen binding protein, variant or binding fragment thereof binds to the immune marker selected from the group consisting of CD3, NKG2D, CD4, CD8, CD16, CD64, and the like.
- the multi-specific antigen binding protein is an inducible bispecific T cell engager comprising a Heavy chain antibody variable region (i.e. VHH) and/or a single chain variable fragment (scFv).
- VHH Heavy chain antibody variable region
- scFv single chain variable fragment
- the bispecific T cell engager binds to two antigens; wherein the first antigen is an Epithelial Cellular Adhesion Molecule (EpCAM); and wherein the second antigen is CD3.
- the CD3 may include CD3£, CD3E, CD3y, CD36, and the like.
- the modified/engineered immune cell may be but is not limited to a macrophage, a dendritic cell, a T cell, a B cell, an eosinophil, a basophil, a neutrophil, a mast cell, a natural killer T cell (NKT cell), a natural killer cell (NK cell), a macrophage, a monocyte, and the like.
- the modified/engineered immune cell is a T cell, an NK cell, or a macrophage.
- the modified/engineered immune cell is a T cell.
- the immune cell binds to HER2 and secretes an inducible bispecific T cell engager that targets EpCAM and CD3 (HE CAR-BiTE T).
- the anti-EpCAM BiTEs exert their cytotoxicity by recruiting the immune cells (such as T cells) nearby.
- T cells immune cells
- bystander T cells are physically directed to the proximity of tumours and at the same time being activated and help the clearance of tumour cells.
- anti-EpCAM BITE By applying local secretion of anti-EpCAM BITE by CAR T cells, it converts a non-druggable target into a druggable target as it diminishes the on-target, off-tumour toxicity that might be brought by systematic delivery.
- EpCAM is also defined as a cancer stem cell marker expressed on cancer progenitor cells and cancer stem cells
- secretion of anti-EpCAM BiTE by CAR cells will concomitantly contribute to the prevention of cancer relapse and recurrence by eliminating cancer stem cells and progenitor cells.
- HER2 targeting CAR T cells secreting anti-EpCAM BiTE exerted superior efficacy in killing human tumours originating from gastric carcinomas or breast cancers in vitro as compared to HE CAR-T alone (FIGURE 1 D and Figure 1 E).
- Both clones 4D5 and F5 of HE CAR-BiTE T show higher % of cytolysis of AGS (HER2 High , EpCAM High ) and MDA-MB468 (HER2 VeryLow , EpCAM High ) cells as compared to HE CAR-T alone.
- clone F5 and clone 4D5 showed minimal or reduced cytolysis of the MDA-MB468 as compared to their respective HE CAR-BiTE T. This suggests that the main cytotoxic function in MDA-MB468 cells is contributed by the anti-EpCAM BiTE. These results further highlight that the HE CAR-BiTE T cells of the present invention only targets the host cells when the expression levels of EpCAM is high to avoid targeting cells with low EpCAM expression.
- Clone 4D5 of HE CAR-T cells could not initiate efficient killing of AGS cells (FIG.1D) with low level of interferon y secretion (FIGURE 1 F), suggesting that the cytotoxic function of HE CAR-BiTE T cells for clone 4D5 was mainly contributed by the secreted anti-EpCAM BiTE.
- the present disclosure has also shown that the modified cell as disclosed herein achieved a more efficient and prolonged tumour controls than treatment with anti-HER2 CAR T cells alone (see Figure 2).
- cell as disclosed herein may engage immune cells in the target environment that include, but is not limited to macrophage, a dendritic cell, a T cell, a B cell, an eosinophil, a basophil, a neutrophil, a mast cell, a natural killer T cell (NKT cell), a natural killer cell (NKcell), a macrophage, a monocyte, and the like.
- the immune cell is a T cell or a macrophage or a monocyte or an NK cell.
- the immune cell is a T cell.
- the cell binds to HER2 and secretes a multispecific antigen binding protein that binds to both EpCAM and CD3 (e.g. HE CAR-BiTE T).
- a multispecific antigen binding protein that binds to both EpCAM and CD3 (e.g. HE CAR-BiTE T).
- polypeptide comprising a multispecific antigen binding protein.
- the multispecific antigen binding protein is a bi-specific antibody.
- the polypeptide comprises a multispecific antigen binding protein that binds to EpCAM (epithelial cell adhesion molecule) and an immune cell.
- the multispecific antigen binding protein is a bispecific cell engager that is capable of engaging both an antigen and an immune cell.
- the polypeptide comprises an anti-EpCAM antigen binding protein. In some examples, the polypeptide comprises a single domain anti-EpCAM antibody, optionally an anti-EpCAM H-chain antibody variable region (i.e., VHH).
- VHH anti-EpCAM H-chain antibody variable region
- the polypeptide comprises an anti-immune cell antigen binding protein. In some examples, the polypeptide comprises an anti-immune cell antigen binding protein that binds to an immune cell activation marker. In some examples, the immune cell activation marker is CD3, NKG2D, CD4, CD8, CD16, CD64, and the like. In some examples, the polypeptide binds to CD3. In some examples, the CD3 may include CD3£, CD3E, CD3y, CD36, and the like.
- the polypeptide comprises an anti-CD3 antigen binding protein. In some examples, the polypeptide comprises a single-chain variable fragment of an anti-CD3 antibody (anti-CD3 scFv).
- the immune cell is a T cell, an NK cell, a macrophage, or a monocyte. In some examples, the immune cell is a T cell.
- the polypeptide is a bispecific antibody/antigen binding protein.
- the bispecific antibody/antigen binding protein is a bispecific T cell engager (BiTE), such as an inducible BiTE, a non-inducible BiTE or a constitutive expression BiTE.
- the bispecific T cell engager (BiTE) binds to two antigens, wherein the first antigen is EpCAM and wherein the second antigen is an immune cell marker.
- the second antigen is an immune cell marker that is involved in the activation of the immune cell.
- the second antigen targeted by the bispecific T cell engager may include but is not limited to CD3, NKG2D, CD28, CD16, CD64, and the like.
- the polypeptide comprises a BiTE that bi-specifically binds to EpCAM and a T cell.
- the polypeptide comprises a BiTE that bi-specifically binds to EpCAM and CD3.
- the EpCAM targeted by the BiTE is modified with an anti-EpCAM VHH paired with an anti-CD3 scFv.
- the anti-EpCAM VHH pairs with an anti-CD3 scFv that may include a clone Okt3 (Nb01-013A).
- polynucleotide encoding the cell and/or the polypeptide and/or multispecific antigen binding protein as described herein.
- a polynucleotide comprising a sequence encoding an immune cell engager and a chimeric antigen receptor (CAR), wherein the immune cell engager is capable of bi-specifically binding to EpCAM (epithelial cell adhesion molecule) and an immune cell, and wherein the CAR is capable of binding to a first antigen.
- CAR chimeric antigen receptor
- a polynucleotide comprising a sequence encoding a chimeric antigen receptor capable of recognizing, binding, and engaging a HER2 positive cell.
- the first antigen is HER2. Therefore, in some examples, the CAR is capable of binding to HER2.
- the polynucleotide further comprises sequences encoding one or more co-stimulatory domain, a signal peptide, a hinge, and/or a signaling domain.
- the co-stimulatory domain may include, but is not limited to 4-1 BB, CD28, CD27, OX-40, and the like.
- the signal peptide may be, but is not limited to, a IgH signal peptide, a IgK signal peptide, a CD8 signal peptide, and the like.
- the hinge may be, but is not limited to, an IgH hinge, a hinge and / or transmembrane domain of an immunoglobulin-like protein (such as IgA, IgD, IgE, IgG, IgM, and the like), CD28, CD8, 4-1 BB, and the like.
- an immunoglobulin-like protein such as IgA, IgD, IgE, IgG, IgM, and the like
- CD28 CD8, 4-1 BB, and the like.
- the sequence encoding CAR encodes for an antigen binding protein capable of binding HER2 (or anti- HER2 antigen binding protein), or fragment, or variant thereof. In some examples, the sequence encoding CAR encodes for a singlechain variable fragment. In some examples, the sequence encoding CAR encodes for an anti- HER2 scFv.
- the sequence encoding CAR further encodes for an immune cell signaling domain.
- the signaling domain may include, but is not limited to, a CD3, a TCF£, a FcRy, a FcRp, a CD3y, a CD30, a CD3E, a CD3r
- the CD3 intracellular domain may be one or more of CD3£, CD3E, CD3y, CD36, and the like.
- the sequence encoding CAR further encodes for a CD3 intracellular domain (signaling domain).
- the sequence encoding CAR encodes for an anti- HER2 scFv, a CD28 costimulatory domain, a 4-1 BB co-stimulatory domain, an I g H signal peptide, an IgH hinge, and a CD3 signaling domain.
- the sequence encoding the immune cell engager encodes for a multi-specific antigen binding protein.
- the multi-specific antigen binding protein is a bi-specific antibody.
- the sequence encoding the immune cell engager encodes for an antigen binding protein capable of binding EpCAM (anti-EpCAM antigen binding protein), or fragment, or variant thereof, and an anti- immune cell antigen binding protein.
- the sequence encoding the immune cell engager encodes for a single chain variable fragment (scFv) or a single variable domain located on a heavy chain (VHH).
- the sequence encoding the immune cell engager encodes for an anti-EpCAM scFv or an anti-EpCAM VHH.
- the sequence encoding the immune cell engager encodes for an anti-immune cell antigen binding protein that binds to an immune cell activation marker.
- the immune cell activation marker may include but is not limited to CD3, NKG2D, CD4, CD8, CD16, CD64, and the like.
- the immune activation marker may be in VHH form or scFv form.
- the sequence encoding the immune cell engager encodes for an antigen binding protein capable of binding CD3 (anti-CD3 antigen binding protein), or fragment, or variant thereof.
- the sequence encoding the immune cell engager encodes for a single chain variable fragment (scFv) or a VHH form.
- the sequence encoding the immune cell engager encodes for an anti-CD3 scFv or an anti-CD3 single domain VHH.
- the immune cell engager may include a His-tag.
- the immune cell engager comprises an anti-EpCAM antigen binding protein, a linker, an anti-CD3 scFv or an anti-CD3 single domain VHH, and a His- tag.
- the linker is a cleavable linker, which may include but is not limited to, P2A, T2A, F2A, and the like.
- the immune cell is a T cell, an NK cell, a macrophage, or a monocyte. In some examples, the immune cell is a T cell.
- the polynucleotide comprises the sequence encoding an immune cell engager is a sequence encoding a bispecific T cell engager (BITE), such as an inducible BiTE, a non-inducible BiTE or a constitutive expression BiTE.
- BITE bispecific T cell engager
- the polynucleotide comprises the sequence encoding BiTE that bi-specifically binds to EpCAM and a T cell.
- the polynucleotide comprises the sequence encoding for an anti-HER2 scFv CAR with CD3 intracellular domain, and the sequence encoding for a BiTE that binds to EpCAM and a T cell.
- a vector expressing the polynucleotide or polypeptide as described herein is selected from the group consisting of a plasmid, a viral particle, a phage, a baculovirus, a yeast plasmid, a lipid based vehicle, a polymer microsphere, a liposome, and a cell based vehicle, a colloidal gold particle, lipopolysaccharide, polypeptide, polysaccharide, a viral vehicle, an adenovirus, a retrovirus, a lentivirus, an adeno-associated viruses, a herpesvirus, a vaccinia virus, a foamy virus, a cytomegalovirus, a Semliki forest virus, a poxvirus, a pseudorabies virus, an RNA virus vector, a DNA virus vector and a vector derived from a combination of a plasmid and a phage DNA, further
- the vector is a lentiviral vector.
- the host cell comprises cloning or expression vectors as described above and/or nucleic acid sequences encoding for the antigen binding protein, antibodies and binding fragments thereof as described above.
- the host cell can be any type of cell capable of being transformed or transfected with the nucleic acid or vector so as to produce an antigen binding protein or binding fragment/protein thereof encoded thereby.
- the host cell comprising the nucleic acid or vector can be used to produce the antigen binding protein or binding fragment/protein thereof, or a portion thereof (e.g., a heavy chain sequence, or a light chain sequence encoded by the nucleic acid or vector).
- the cell After introducing the nucleic acid or vector into the cell, the cell is cultured under conditions suitable for expression of the encoded sequence.
- the antibody, antigen binding protein, or fragment, or portion of the antibody then can be isolated from the cell.
- the host cells may be prokaryotic host cells (such as E. coli) or eukaryotic host cells (such as a yeast cell, an insect cell, or a vertebrate cell).
- the host cell when cultured under appropriate conditions, expresses an antibody or binding fragment thereof which can subsequently be collected from the culture medium (if the host cell secretes it into the medium) or directly from the host cell producing it (if it is not secreted). Selection of an appropriate host cell will depend upon various factors, such as desired expression levels, polypeptide modifications that are desirable or necessary for activity, such as glycosylation or phosphorylation, and ease of folding into a biologically active molecule.
- the host cell may comprise a bacterial cell, a yeast cell, an animal cell e.g., a mammalian cell and/or a plant cell.
- Suitable mammalian host cells include CHO, myeloma or hybridoma cells. Many are available from the American Type Culture Collection (ATCC), Manassas, Va. Examples include mammalian cells, such as Chinese hamster ovary cells (CHO) (ATCC No. CCL61), human embryonic kidney (HEK) 293 or 293T cells (ATCC No. CRL1573), 3T3 cells (ATCC No. CCL92), or PER.C6 cells. Other cell types of use in expressing antibodies include lymphocytic cell lines, e.g., NSO myeloma cells and SP2 cells, COS cells.
- lymphocytic cell lines e.g., NSO myeloma cells and SP2 cells, COS cells.
- the host cell expresses/secretes the antigen binding protein, variant or fragment thereof as disclosed herein.
- a cell that expresses/secretes an immune cell engager that is specific to EpCAM.
- the cell is a stem cell, for example selected from the group comprising a mesenchymal stem cell, neural stem cell and a pluripotent stem cell, such as an induced pluripotent stem cell (iPSC).
- a mesenchymal stem cell a mesenchymal stem cell.
- the stem cell is a neural stem cell.
- the stem cell is a pluripotent stem cell, such as an iPSC.
- the cell is an immune cell.
- the immune cell expresses/secretes an immune cell engager which is specific to EpCAM.
- the immune cell engager is selected from the group comprising a T cell engager, an NK cell engager, a monocyte engager and a macrophage engager.
- the immune cell expresses/secretes a bispecific T cell engager (BiTE) which is specific to EpCAM.
- BiTE bispecific T cell engager
- the immune cell expresses/secretes a bispecific T cell engager (BiTE), such as an inducible, non-inducible or constitutive expression BiTE comprising the antigen binding protein, variant or fragment thereof as disclosed herein.
- BiTE bispecific T cell engager
- the present inventors have established that immune cells, such as CAR T-cells, are able to secrete EpCAM BiTEs. It was not previously known that this was possible.
- immune cells such as CAR T-cells
- this allows the EpCAM immune engagers to be be secreted at the target site (for example at the site of a solid tumour), thereby minimising toxicity and/or side effects.
- the immune cell may include but is not limited to a macrophage, a dendritic cell, a T cell, a B cell, an eosinophil, a basophil, a neutrophil, a mast cell, a natural killer T cell (NKT cell), natural killer cell (NK cell), a macrophage, a monocyte, and the like.
- the immune cell is a NK cell.
- the immune cell is a macrophage.
- the immune cell is a dendritic cell.
- the immune cell is a monocyte.
- the immune cell is a T-cell.
- the immune cell is a CAR T-cell, such as an anti-GPC3, anti-HER2 or anti-CD19 CAR T-cell.
- the CAR T-cell is an anti-GPC3 CAR T-cell.
- the CAR T-cell is an anti-HER2 CAR T-cell.
- the CAR T-cell is an anti- CD19 CAR T-cell.
- the immune cell is a CAR T-, CAR NK-, CAR macrophage-, or CAR monocyte-cell,
- the immune cell may bind to more than one host cell antigen. Therefore, in some examples, the immune cell may further bind to one host cell antigen, two host cell antigens, three host cell antigens, four host cell antigens, and the like.
- a method of producing / generating the cell as described herein comprising introducing the polynucleotide as described herein into the cell.
- the cell is an immune cell.
- a linker such as P2A cleavable linker
- the culture supernatant of the host cell transformed or transfected with the vector is harvested.
- the method comprises introducing into the cell a vector as described herein.
- the vector is introduced via viral transduction.
- composition comprising the cell or the supernatant of the cell as described herein.
- composition comprising the (engineered) cell or the supernatant of the cell as described herein and suitable pharmaceutical composition thereof.
- the composition is a prophylactic and/or therapeutic composition.
- Pharmaceutically acceptable agents for use in the present pharmaceutical compositions include carriers, excipients, diluents, antioxidants, preservatives, colouring, flavouring and diluting agents, emulsifying agents, suspending agents, solvents, fillers, bulking agents, buffers, delivery vehicles, tonicity agents, cosolvents, wetting agents, complexing agents, buffering agents, antimicrobials, and surfactants.
- compositions or pharmaceutical composition as described herein for use in therapy/medicine/vaccine optionally the composition may further include an excipient and/or stabilizers.
- a method of treating a disease in a subject in need thereof comprises administering to the subject the cell of as described herein, optionally the disease is a proliferative disease.
- the cell or composition or pharmaceutical composition is to be administered to the subject through one or more routes of administration including, but not limited to, topical, intravascular, intravenous, oral, subcutaneous, intraarterial, intrathecal, intraperitoneal, intranasal, intradermal, intramuscular, and the like. Also disclosed is the use of the cell as described herein in the manufacture of a medicament for preventing and/or treating a disease.
- polynucleotide an antibody, a bi-specific T cell engager, an engineered cell, an engineered immune cell, a method, a composition, or a pharmaceutical composition as described herein.
- the disease is a proliferative disease.
- the disease is tumour or cancer.
- the disease is a carcinoma and may include but is not limited to liver cancer (such as hepatocellular carcinoma), lung cancer (such as lung squamous cell carcinoma), stomach cancer (such as gastric adenocarcinoma), breast cancer, skin cancer (such as melanoma), ovary cancer (such as ovarian clear cell carcinoma), kidney cancer, pancreas cancer, head and neck cancer, prostate gland cancer, esophagus cancer, bladder cancer, colon cancer, childhood cancers (such as hepatoblastomas, nephroblastomas, yolk sac tumours, and the like), and the like.
- liver cancer such as hepatocellular carcinoma
- lung cancer such as lung squamous cell carcinoma
- stomach cancer such as gastric adenocarcinoma
- breast cancer such as melanoma
- ovary cancer such as ovarian clear cell carcinoma
- kidney cancer pancreas cancer, head and neck cancer
- the disclosure may have disclosed a method and/or process as a particular sequence of steps. However, unless otherwise required, it will be appreciated that the method or process should not be limited to the particular sequence of steps disclosed. Other sequences of steps may be possible. The particular order of the steps disclosed herein should not be construed as undue limitations. Unless otherwise required, a method and/or process disclosed herein should not be limited to the steps being carried out in the order written. The sequence of steps may be varied and still remain within the scope of the disclosure.
- CDRs are in bold (CDR1);in bold and in italics (CDR2); or in bold, in italics and underlined (CDR3Y Highlighted residues/bases show differences between the 1 B6 and 1C1 light chain constant domains.
- Example embodiments of the disclosure will be better understood and readily apparent to one of ordinary skill in the art from the following discussions and if applicable, in conjunction with the figures. It should be appreciated that other modifications may be made without deviating from the scope of the invention.
- Example embodiments are not necessarily mutually exclusive as some may be combined with one or more embodiments to form new exemplary embodiments. The example embodiments should not be construed as limiting the scope of the disclosure.
- Figure 1A shows the construction and structure map of HE CAR-BiTE T (clone 4D5 or F5) using anti-EpCAM VHH BiTE (Nb01-013A).
- Figure 1B shows the FACS analysis of tumour markers (HER2 and EpCAM) expressed on AGS and MDA-MB468 cells.
- Figure 1C shows the percentage of CAR expression on anti-HER2 CAR T (4D5 or F5) and HE CAR- BiTE T (4D5 or F5) cells detected by flow cytometry analysis.
- Figure 1F shows bar graphs of ELISA measurement of Interferon-r and IL-2 as measured using culture supernatant collected at 36 hours post co-culture effector CAR T cells with AGS cells.
- Figure 1G shows bar graphs of ELISA measurement of Interferon-r and IL-2 as measured using culture supernatant collected at 36 hours post co-culture effector CAR T cells with MDA-MB468 cells.
- FIG. 2 shows human HE CAR-BiTE T cells using anti-EpCAM VHH constructed BITEs showed superior tumour killing in in vivo AGS xenografts.
- 1.3 million AGS (Her2 High , EpCAM High ) cells were subcutaneously injected into the right flank of female NSG mice (Day -9).
- mice were re-grouped according to the measurable tumour size and five million CAR T (4D5) cells, CAR T (F5) cells, HE CAR- BiTE T (4D5) cells (“Nb01-013A” was used as BiTE), HE CAR-BiTE T (F5) cells (“Nb01- 013A” was used as BiTE), or mock T cells were intravenously injected into these mice via tail vein.
- Figure 2A shows tumour sizes of each mouse were measured and recorded every 3 to 7 days.
- Figure 2B shows tumour sizes of each individual mouse in each treatment group were measured and recorded every 3 to 7 days.
- Figure 2C shows weights of each mouse were measured and recorded every 3
- Figure 3 shows the detection of anti-EpCAM BiTE molecule Nb01-013A secreted from HE CAR-BiTE T cells by ELISA.
- Anti-HER2 CAR T (4D5 or F5) cells or anti-HER2 CAR T cells secreting anti-EpCAM BiTE (Nb01-013A) (named as “HE CAR-BiTE T (4D5 or F5)”) were cultured in T cell growth medium containing IL-7 (20 ng/ml) and IL-15 (5 ng/ml). The starting cell density was 1.5 million per ml and the percentages of CAR expression ranged from 36.8% to 57.2%.
- the inventors have constructed “HE CAR-BiTE T” by fusing the anti- EpCAM BiTE gene (sequence of “Nb01-013A” was used) to the anti-HER2 CAR (clone 4D5 from “Trastuzumab” or our in-house anti-HER2 clone F5) lentiviral construct via a P2A cleavable linker (Figure 1A). Following the lentiviral transduction and expansion (Figure 1C), both AGS (HER2 Hi0h , EpCAM Hi0h ) and MDA-MB468 (HER2 VeryLow , EpCAM High ) cells ( Figure 1 B) were used to test the in vitro killing efficacy of CAR T cells.
- the HE CAR-BiTE T cells were shown to be able to kill AGS cells at a much faster rate than the anti-HER2 CAR alone ( Figure 1 D), suggesting the participation of the BiTE in target cell killing.
- clone 4D5 constructed anti-HER2 CAR T cells could not initiate efficient killing of AGS cells ( Figure 1 D) with low level of Interferon-y secretion ( Figure 1 F), suggesting that the cytotoxic function of the HE CAR-BiTE T cells (clone 4D5) was mainly contributed by the secreted anti-EpCAM BiTE.
- anti- HER2 CAR T cells (clone 4D5) showed comparable level of killing of MDA-MB468 (HER2 VeryLow , EpCAM Hi0h ) cells, while the anti-HER2 CAR T cells constructed using our patented clone F5 showed high specificity by sparing the cells expressing very low level of HER2 ( Figure 1 E and 1G).
- HE CAR-BiTE have been demonstrated to work successfully, our technology is not limited to HER2- targeting CAR, but can be extended to many other tumour antigens which will be applied as a CAR target for various types of carcinomas happened in multiple organs.
- Human HE CAR-BiTE cells showed superior killing potency in mouse xenograft models.
- the anti-EpCAM BiTE “Nb01-013A” was constructed by pairing the anti-EpCAM VHH clone 2C4 and the anti-human CD3 agonist clone Okt3. After testing the in vitro killing potency of HE CAR-BiTE T (“Nb01-013A” was used as BiTE) cells using different CAR clones (4D5 or F5), we proceeded to test their tumour control potency using the in vivo AGS (Her2 High , EpCAM High ) xenograft models ( Figure 2). In line with the in vitro data, AGS appeared to be resistant to 4D5 CAR-T.
- CAR T (4D5) failed to control the tumour growth
- the other groups of CAR T (F5) or CAR-BiTE T cell treatments showed some in vivo tumour control efficacies (Figure 2A) without significant weight loss (Figure 2C).
- CAR T (F5) treatment showed effective control of tumour growth in all 5 mice. However, after 5-6 weeks of tumour shrinkage, the remaining tumours started to grow back and the tumour sizes reached more than 1000mm 3 , suggesting the tumour escape from the Her2 Negative cell populations.
- Anti-EpCAM llama VHH BiTE secreted by HE CAR-BiTE T cells can be detected from the cell cultures
- the Nb01-013A BiTE molecules can also be detected from HE CAR-BiTE T (4D5) and HE CAR-BiTE T (F5) cells from the in vitro cultures.
- Anti-HER2 CAR T (4D5 or F5) cells or HE CAR-BiTE T (4D5 or F5) cells were cultured in T cell growth medium containing IL-7 and IL-15 at the starting cell density of 1.5 million per ml. Cell culture supernatants were collected at 24h and 48h followed by an ELISA to detect the amount of secreted anti-EpCAM BiTE molecule Nb01-013A.
- Embodiments of modified cells as disclosed herein takes advantage of the following factors: 1) tumour- directed T cell expansion, and 2) tumour-restricted anti- EpCAM BiTE secretion, the latter being unachievable by the traditional approach of systemic delivery.
- the anti-EpCAM BiTE secreting CAR T cell as disclosed herein can be expanded to other cancer types to establish a broader scope of nextgeneration CAR T cell therapies.
- Anti-HER2 CAR T cells secreting anti-EpCAM BiTE can be used to treat HER2 expressing. These anti-EpCAM BiTE secreting CAR T cells can be used to target various solid cancers including liver, breast, head and neck, gastric, pancreas, lung, prostate, kidney, ovarian, esophagus, bladder, and colon cancers.
- Anti-EpCAM BiTE secreting CAR T cells may be configured to target other tumour specific antigens including but not limited to GPC3, Claudin18.2, ROR1, DLL3, CEA, MUC1, MUC16, CEACAM7, CD133, CD147, PSCA, PSMA, MSLN, c-Met, FRa, and the like.
- This present disclosure provides for an improvement to treatment efficacy of the current single targeting CAR T cells against solid tumours by advantageously overcoming the tumour heterogeneity and treatment associated tumour escape using anti-EpCAM BiTE. Also, by applying local secretion of anti-EpCAM BiTE by CAR T cells, it converts a non-druggable target into a druggable target as it diminishes the on-target, off-tumour toxicity that might be brought by systematic delivery. In addition, by targeting cancer progenitor and cancer stem cells that express EpCAM, it further contributes to complete tumour eradication and tumour relapse prevention.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Hematology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
Abstract
Description
Claims
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP24819699.0A EP4724573A1 (en) | 2023-06-07 | 2024-06-07 | Her2 chimeric antigen receptor secreting |
| CN202480037288.1A CN121241129A (en) | 2023-06-07 | 2024-06-07 | HER2 chimeric antigen receptor secretion |
| AU2024287027A AU2024287027A1 (en) | 2023-06-07 | 2024-06-07 | Her2 chimeric antigen receptor secreting |
| KR1020267000123A KR20260032990A (en) | 2023-06-07 | 2024-06-07 | HER2 chimeric antigen receptor secretion |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| SG10202301606S | 2023-06-07 | ||
| SG10202301606S | 2023-06-07 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2024253596A1 true WO2024253596A1 (en) | 2024-12-12 |
Family
ID=93794562
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/SG2024/050384 Ceased WO2024253596A1 (en) | 2023-06-07 | 2024-06-07 | Her2 chimeric antigen receptor secreting |
Country Status (5)
| Country | Link |
|---|---|
| EP (1) | EP4724573A1 (en) |
| KR (1) | KR20260032990A (en) |
| CN (1) | CN121241129A (en) |
| AU (1) | AU2024287027A1 (en) |
| WO (1) | WO2024253596A1 (en) |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021050591A1 (en) * | 2019-09-10 | 2021-03-18 | Cytoimmune Therapeutics, Inc. | Bispecific antibody car cell immunotherapy |
| CN113481165A (en) * | 2020-07-16 | 2021-10-08 | 山东博安生物技术股份有限公司 | CAR-T secreting bispecific T cell adaptors and uses for treating solid tumors |
| WO2022018262A1 (en) * | 2020-07-24 | 2022-01-27 | Cellectis S.A. | T-cells expressing immune cell engagers in allogenic settings |
| WO2022109611A1 (en) * | 2020-11-20 | 2022-05-27 | Simcere Innovation, Inc. | Armed dual car-t compositions and methods for cancer immunotherapy |
| US20220331416A1 (en) * | 2019-09-12 | 2022-10-20 | Biotheus (Suzhou) Co., Ltd. | Combined expression of a chimeric cd3 fusion protein and an anti-cd3-based bispecific t cell activating element |
-
2024
- 2024-06-07 KR KR1020267000123A patent/KR20260032990A/en active Pending
- 2024-06-07 CN CN202480037288.1A patent/CN121241129A/en active Pending
- 2024-06-07 EP EP24819699.0A patent/EP4724573A1/en active Pending
- 2024-06-07 AU AU2024287027A patent/AU2024287027A1/en active Pending
- 2024-06-07 WO PCT/SG2024/050384 patent/WO2024253596A1/en not_active Ceased
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021050591A1 (en) * | 2019-09-10 | 2021-03-18 | Cytoimmune Therapeutics, Inc. | Bispecific antibody car cell immunotherapy |
| US20220331416A1 (en) * | 2019-09-12 | 2022-10-20 | Biotheus (Suzhou) Co., Ltd. | Combined expression of a chimeric cd3 fusion protein and an anti-cd3-based bispecific t cell activating element |
| CN113481165A (en) * | 2020-07-16 | 2021-10-08 | 山东博安生物技术股份有限公司 | CAR-T secreting bispecific T cell adaptors and uses for treating solid tumors |
| WO2022018262A1 (en) * | 2020-07-24 | 2022-01-27 | Cellectis S.A. | T-cells expressing immune cell engagers in allogenic settings |
| WO2022109611A1 (en) * | 2020-11-20 | 2022-05-27 | Simcere Innovation, Inc. | Armed dual car-t compositions and methods for cancer immunotherapy |
Non-Patent Citations (1)
| Title |
|---|
| HOSKING MARTIN, SHRESTHA BISHWAS, BOYETT MEGAN, SHIRINBAK SOHEILA, GENTILE ANGELA, SUNG ERIC, PAN YIJIA, LEE TOM, OROURKE JASON, S: "116 Multi-antigen targeting of heterogenous solid tumors using CAR T cells secreting bi-specific T-cell engagers", REGULAR AND YOUNG INVESTIGATOR AWARD ABSTRACTS, BMJ PUBLISHING GROUP LTD, 1 November 2020 (2020-11-01), pages A71 - A72, XP093250150, DOI: 10.1136/jitc-2020-SITC2020.0116 * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN121241129A (en) | 2025-12-30 |
| AU2024287027A1 (en) | 2026-01-15 |
| KR20260032990A (en) | 2026-03-10 |
| EP4724573A1 (en) | 2026-04-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN112424441B (en) | Anti-CD24 compositions and uses thereof | |
| AU2010303142B2 (en) | Bispecific death receptor agonistic antibodies | |
| CN111971090B (en) | Bispecific EGFR/CD16 antigen-binding protein | |
| WO2017148424A1 (en) | Pdl-1 antibody, pharmaceutical composition thereof, and uses thereof | |
| KR20180030856A (en) | Human CD3 binding antibody | |
| HK1217958A1 (en) | Tetravalent bispecific antibodies | |
| KR20230042035A (en) | Antibodies capable of binding PSMA and the gamma-delta T cell receptor | |
| KR20240008345A (en) | Composition comprising a T cell re-induction therapeutic agent and an anti-CD44 therapeutic agent | |
| WO2023051727A1 (en) | Antibody binding to cd3, and use thereof | |
| WO2019047885A1 (en) | Immunoconjugates comprising signal regulatory protein alpha | |
| WO2023041065A1 (en) | Antibody targeting human ceacam5/6, preparation method and application | |
| CN113214402B (en) | Isolated antigen-binding proteins and their applications | |
| KR20250028265A (en) | Antibodies and their uses | |
| KR20240082411A (en) | Novel antibody-cytokine fusion protein, method of making the same and use thereof | |
| AU2024284754A1 (en) | MULTISPECIFIC ANTIGEN BINDING PROTEIN AGAINST EpCAM | |
| JP7811028B2 (en) | Human cxcl16 antibodies and uses thereof | |
| EP4714975A1 (en) | Antibody binding lilrb4 and cd3, and use thereof | |
| AU2024287027A1 (en) | Her2 chimeric antigen receptor secreting | |
| AU2024284712A1 (en) | Gpc3 chimeric antigen receptor secreting | |
| WO2022012559A1 (en) | Anti-cldn-18.2 antibody and use thereof | |
| KR20260038271A (en) | Anti-TROP2 antibody | |
| KR20250161096A (en) | Bispecific antibodies specifically binding to VISTA and MSLN and uses thereof | |
| WO2024131849A1 (en) | Cd38 monoclonal antibody and use thereof | |
| WO2022037582A1 (en) | Anti-cd3 and anti-cldn-18.2 bispecific antibody and use thereof | |
| CN118234511A (en) | Bispecific binding proteins that bind to CD137 and tumor-associated antigens |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 24819699 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2025571291 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2025571291 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: AU2024287027 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020267000123 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024819699 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2024287027 Country of ref document: AU Date of ref document: 20240607 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2024819699 Country of ref document: EP Effective date: 20260107 |
|
| ENP | Entry into the national phase |
Ref document number: 2024819699 Country of ref document: EP Effective date: 20260107 |
|
| ENP | Entry into the national phase |
Ref document number: 2024819699 Country of ref document: EP Effective date: 20260107 |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020267000123 Country of ref document: KR |
|
| WWP | Wipo information: published in national office |
Ref document number: 2024819699 Country of ref document: EP |
