WO2024080932A1 - A microcarrier, a method of making a microcarrier, a system for producing a cell cultured food product and a method of producing a cell cultured food product - Google Patents

A microcarrier, a method of making a microcarrier, a system for producing a cell cultured food product and a method of producing a cell cultured food product Download PDF

Info

Publication number
WO2024080932A1
WO2024080932A1 PCT/SG2023/050688 SG2023050688W WO2024080932A1 WO 2024080932 A1 WO2024080932 A1 WO 2024080932A1 SG 2023050688 W SG2023050688 W SG 2023050688W WO 2024080932 A1 WO2024080932 A1 WO 2024080932A1
Authority
WO
WIPO (PCT)
Prior art keywords
protein
cells
microbeads
microcarrier
various embodiments
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/SG2023/050688
Other languages
French (fr)
Inventor
Yan Kong
Dejian Huang
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
National University of Singapore
Original Assignee
National University of Singapore
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by National University of Singapore filed Critical National University of Singapore
Publication of WO2024080932A1 publication Critical patent/WO2024080932A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0652Cells of skeletal and connective tissues; Mesenchyme
    • C12N5/0658Skeletal muscle cells, e.g. myocytes, myotubes, myoblasts
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES, NOT OTHERWISE PROVIDED FOR; PREPARATION OR TREATMENT THEREOF
    • A23L13/00Meat products; Meat meal; Preparation or treatment thereof
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES, NOT OTHERWISE PROVIDED FOR; PREPARATION OR TREATMENT THEREOF
    • A23L29/00Foods or foodstuffs containing additives; Preparation or treatment thereof
    • A23L29/20Foods or foodstuffs containing additives; Preparation or treatment thereof containing gelling or thickening agents
    • A23L29/206Foods or foodstuffs containing additives; Preparation or treatment thereof containing gelling or thickening agents of vegetable origin
    • A23L29/256Foods or foodstuffs containing additives; Preparation or treatment thereof containing gelling or thickening agents of vegetable origin from seaweeds, e.g. alginates, agar or carrageenan
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/0068General culture methods using substrates
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/0068General culture methods using substrates
    • C12N5/0075General culture methods using substrates using microcarriers
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2500/00Specific components of cell culture medium
    • C12N2500/70Undefined extracts
    • C12N2500/76Undefined extracts from plants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2533/00Supports or coatings for cell culture, characterised by material
    • C12N2533/70Polysaccharides
    • C12N2533/74Alginate
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2533/00Supports or coatings for cell culture, characterised by material
    • C12N2533/90Substrates of biological origin, e.g. extracellular matrix, decellularised tissue

Definitions

  • a MICROCARRIER A METHOD OF MAKING A MICROCARRIER, A SYSTEM FOR PRODUCING A CELL CULTURED FOOD PRODUCT AND A METHOD OF PRODUCING A CELL CULTURED FOOD PRODUCT
  • the present disclosure relates broadly to a microcarrier, a method of making a microcarrier, a system for producing a cell cultured food product and a method of producing a cell cultured food product.
  • CBM Cell-based meat
  • CBM also termed cultured meat
  • CBM is an emerging technology which aims to manufacture meat at commercial scale directly from cell culture in a controlled environment.
  • CBM may provide a sustainable and ethical alternative to traditional meat production. It has the potential to address many of the environmental and ethical concerns associated with conventional animal agriculture while providing consumers with a familiar and nutritious source of protein.
  • CBM can be economically competitive with conventional meat to make an impact to the food supply.
  • Two-dimensional (2D) systems have been used to produce cultured meat in laboratories.
  • tissue culture flasks or petri dishes are used as an adherent mechanical support for cells.
  • a major drawback of a 2D culture is the limited space for proliferation.
  • cells that are randomly grown on a 2D surface hardly communicate with one another and there is barely any cell-matrix interactions, resulting in slower proliferation, limited differentiation, and failure to form cohesive tissue features, such as tubular and cyst structures, typically found in epithelial tissues.
  • microcarriers may be used to provide anchorage for cells to adhere to and proliferate in a 3D environment.
  • the large surface to volume ratio in microcarriers may facilitate scaling up for industrial production.
  • one of the difficulties faced in designing microcarriers is the lack of functional groups with high cytoaffinity and recognition.
  • Microcarriers have been coated with RGD-containing materials such as gelatin to promote cell attachment and proliferation.
  • RGD-containing materials such as gelatin
  • a microcarrier comprising, a core particle; and a coating layer disposed on a surface of the core particle; wherein the core particle and coating layer comprise one or more materials derived from plantbased sources.
  • the core particle is a hydrogel-based particle.
  • the core particle comprises one or more materials selected from the group consisting of alginate, cellulose, chitosan, gum, hemicellulose, lignin, pectin, soy, starch, and zein.
  • the coating layer comprises a protein or a protein hydrolysate.
  • the protein hydrolysate has a degree of hydrolysis of from 1 % to 30%.
  • the coating layer comprises at least 3 amino acids selected from the group consisting of arginine, histidine, aspartic acid, glutamic acid, proline, serine, glycine, and alanine.
  • the coating layer comprises amino acid sequences selected from the group consisting of RGD (SEQ ID NO: 1 ), IKVAV (SEQ ID NO: 6), YIGSR (SEQ ID NO: 7), DGEA (SEQ ID NO: 8), PHRSN (SEQ ID NO: 9), PRARI (SEQ ID NO: 10), permutations thereof or sequence order variations thereof.
  • the coating layer is coupled to the core particle via a cross-linker.
  • the cross-linker comprises a natural cross-linker selected from the group consisting of flavanones, genipin, quercetin, tannic acid and transglutaminase.
  • the coating layer exhibits self-fluorescence.
  • the plantbased sources include one or more selected from the group consisting of broad bean, chickpea, chia seed, com, lentil, mung bean, oat, pea, pumpkin seed, rapeseed, rice, soybean, wheat, and winter squash.
  • a method of making a microcarrier comprising, providing a core particle; and forming a coating layer on a surface of the core particle to obtain the microcarrier, wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.
  • providing the core particle comprises electrospraying a precursor solution to form the core particle in the form of a microbead.
  • forming the coating layer comprises immersing the core particle in a coating solution comprising a protein or a protein hydrolysate.
  • the method prior to forming the coating layer, further comprises preparing the coating solution comprising the protein hydrolysate.
  • the protein hydrolysate has a degree of hydrolysis of from 1 % to 30%.
  • preparing the coating solution comprising the protein hydrolysate comprises hydrolyzing a protein using an enzyme-substrate concentration (E/S%) of from 0.1 % to 50%.
  • the method further comprises immersing the core particle coated with the coating layer in a crosslinking solution.
  • the cross-linker comprises a natural cross-linker selected from the group consisting of flavanones, genipin, quercetin, tannic acid, and transglutaminase.
  • a system for producing a cell cultured food product comprising, a population of cells; and a plurality of microcarriers configured to allow the population of cells to be grown thereon; wherein the microcarrier comprises a core particle and a coating layer disposed on a surface of the core particle; and wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.
  • microcarrier as used herein is to be interpreted broadly to refer to a discrete particle with physical dimensions in the order of micrometers, which is suitable for carrying a target agent, e.g., cells.
  • the microcarrier may be suitable for use in culturing cells by providing a substrate or scaffold onto which cells may attach.
  • Microcarriers may be in any suitable shape, such as a sphere, hemisphere, ellipsoid, rod, disk and the like.
  • the physical dimensions include but are not limited to length, width, thickness, diameter and the like.
  • the micrometer order of magnitude is defined as not more than about 1000 pm, not more than about 950 pm, not more than about 900 pm, not more than about 850 pm, not more than about 800 pm, not more than about 750 pm, not more than about 700 pm, not more than about 650 pm, not more than about 600 pm, not more than about 550 pm, not more than about 500 pm, not more than about 450 pm, not more than about 400 pm, not more than about 350 pm, not more than about 300 pm, not more than about 250 pm, not more than about 200 pm, not more than about 150 pm, not more than about 100 pm, not more than about 50 pm, not more than about 40 pm, not more than about 30 pm, not more than about 20 pm, or not more than about 10 pm.
  • core particle as used herein is to be interpreted broadly to encompass both solid and semi-solid particles e.g., gel-like particles.
  • the core particle may be in any suitable shape, such as a sphere, hemisphere, ellipsoid, rod, disk and the like.
  • coating layer as used herein is to be interpreted broadly to encompass a layer of material that is at least partially covering a target surface e.g., surface of the core particle or part thereof.
  • hydrogel as used herein is to be interpreted broadly to refer to three-dimensional cross-linked polymer networks, which can absorb and retain a relatively large amount of water.
  • microbead as used herein is to be interpreted broadly to refer to a bead or particle of any material having dimensions of from about 1 pm to about 1000 pm.
  • substrate as used herein is to be interpreted broadly to refer to any supporting structure.
  • layer when used to describe a first material is to be interpreted broadly to refer to a first depth of the first material that is distinguishable from a second depth of a second material.
  • the first material of the layer may be present as a continuous film, as discontinuous structures or as a mixture of both.
  • the layer may also be of a substantially uniform depth throughout or varying depths. Accordingly, when the layer is formed by individual structures, the dimensions of each of individual structure may be different.
  • the first material and the second material may be same or different and the first depth and second depth may be same or different.
  • continuous when used to describe a film or a layer is to be interpreted broadly to refer to a film or a layer that is substantially without gaps or holes or voids across the film or layer.
  • a continuous film or a continuous layer is also intended to include a film or a layer that may have trivial gaps or holes or voids that may not appreciably affect the desired properties of the film or the layer.
  • biocompatible as used herein is to be interpreted broadly to refer to the ability of a material to perform its intended function without inducing significant inflammatory response, immunogenicity, or cytotoxicity to native cells, tissues, or organs.
  • biodegradable as used herein is to be interpreted broadly to refer to a material that is capable of being broken down physically and/or chemically within the body of a subject by the action of living things (such as microorganisms), e.g., by hydrolysis under physiological conditions, by natural biological processes such as the action of enzymes present within the body, etc., to form smaller chemical species which can be metabolized and/or excreted.
  • living things such as microorganisms
  • cytoaffinity is to be interpreted broadly as an affinity to cells, e.g., an affinity of a material or structure to cells.
  • cytotoxic as used herein is to be interpreted broadly to refer to the ability of a compound or process to disrupt the normal metabolism, function and/or structure of a cell.
  • food grade as used herein is to be interpreted broadly to refer to any substance that is approved for human consumption by a relevant authority in a jurisdiction, e.g., the Food and Drug Administration (FDA) in the U.S. and the Singapore Food Agency in Singapore.
  • FDA Food and Drug Administration
  • micro as used herein is to be interpreted broadly to include dimensions from about 1 micron to about 1000 microns.
  • nano as used herein is to be interpreted broadly to include dimensions less than about 1000 nm.
  • the term “particle” as used herein broadly refers to a discrete entity or a discrete body.
  • the particle described herein can include an organic, an inorganic or a biological particle.
  • the particle used described herein may also be a macroparticle that is formed by an aggregate of a plurality of sub-particles or a fragment of a small object.
  • the particle of the present disclosure may be spherical, substantially spherical, or non-spherical, such as irregularly shaped particles or ellipsoidally shaped particles.
  • size when used to refer to the particle broadly refers to the largest dimension of the particle. For example, when the particle is substantially spherical, the term “size” can refer to the diameter of the particle; or when the particle is substantially non-spherical, the term “size” can refer to the largest length of the particle.
  • Coupled or “connected” as used in this description are intended to cover both directly connected or connected through one or more intermediate means, unless otherwise stated.
  • the term “associated with”, used herein when referring to two elements refers to a broad relationship between the two elements. The relationship includes, but is not limited to a physical, a chemical or a biological relationship. For example, when element A is associated with element B, elements A and B may be directly or indirectly attached to each other or element A may contain element B or vice versa.
  • adjacent refers to one element being in close proximity to another element and may be but is not limited to the elements contacting each other or may further include the elements being separated by one or more further elements disposed therebetween.
  • the word “substantially” whenever used is understood to include, but not restricted to, “entirely” or “completely” and the like.
  • terms such as “comprising”, “comprise”, and the like whenever used are intended to be non-restricting descriptive language in that they broadly include elements/components recited after such terms, in addition to other components not explicitly recited.
  • reference to a “one” feature is also intended to be a reference to “at least one” of that feature.
  • Terms such as “consisting”, “consist”, and the like may in the appropriate context, be considered as a subset of terms such as “comprising”, “comprise”, and the like.
  • the individual numerical values within the range also include integers, fractions and decimals. Furthermore, whenever a range has been described, it is also intended that the range covers and teaches values of up to 2 additional decimal places or significant figures (where appropriate) from the shown numerical end points. For example, a description of a range of 1 % to 5% is intended to have specifically disclosed the ranges 1.00% to 5.00% and also 1.0% to 5.0% and all their intermediate values (such as 1.01 %, 1.02% ... 4.98%, 4.99%, 5.00% and 1.1 %, 1.2% ... 4.8%, 4.9%, 5.0% etc.,) spanning the ranges. The intention of the above specific disclosure is applicable to any depth/breadth of a range.
  • the disclosure may have disclosed a method and/or process as a particular sequence of steps. However, unless otherwise required, it will be appreciated that the method or process should not be limited to the particular sequence of steps disclosed. Other sequences of steps may be possible. The particular order of the steps disclosed herein should not be construed as undue limitations. Unless otherwise required, a method and/or process disclosed herein should not be limited to the steps being carried out in the order written. The sequence of steps may be varied and still remain within the scope of the disclosure.
  • Exemplary, non-limiting embodiments of a microcarrier, a method of making a microcarrier, a system for producing a cell cultured food product and a method of producing a cell cultured food product are disclosed hereinafter.
  • a microcarrier comprising, a core particle; and a coating layer disposed on a surface of the core particle; wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.
  • the microcarrier may have a core-shell structure wherein the core particle forms the core, and the coating layer forms the shell.
  • the core particle and the coating layer may be made from the same or different materials.
  • the surface of the core particle may be partially or completely coated by the coating layer.
  • the core particle may be encapsulated/ encompassed/ covered by the coating layer.
  • the core particle may be functionalized by the coating layer disposed/ formed/ deposited/coated thereon.
  • the microcarrier is manufactured using materials that are derived from natural sources.
  • the materials that are derived from natural sources e.g., plant sources, may undergo processing into one or more forms that are suitable for making the microcarrier.
  • processing may include extraction, purification, solubilization, drying, hydrolysis, and the like.
  • the microcarrier may be substantially devoid of any synthetic substance(s).
  • the microcarrier is manufactured using materials that are derived from plant sources.
  • the microcarrier may be a plant-based microcarrier.
  • the microcarrier may comprise plant proteins, e.g., purified plant protein.
  • the microcarrier may be substantially devoid of any substance(s) derived from animal source(s).
  • materials that are derived from plant sources are advantageously more cost effective as compared to materials that are derived from animal sources.
  • materials that are derived from plant sources advantageously obviate the concerns associated with animal derived substances, e.g., animal derived proteins, such as spreading of infectious diseases, growth factor contamination, and batch to batch variations.
  • the plant-based sources include but are not limited to broad bean, chickpea, chia seed, com, lentil, mung bean, oat, pea, pumpkin seed, rapeseed, rice, soybean, wheat, and winter squash.
  • the plantbased sources include one or more selected from the group consisting of broad bean, chickpea, chia seed, corn, lentil, mung bean, oat, pea, pumpkin seed, rapeseed, rice, soybean, wheat, and winter squash.
  • the microcarrier is edible. In various embodiments, the microcarrier may be safe for human and/or animal consumption. In various embodiments, the microcarrier may be manufactured using food-grade materials. In various embodiments, the microcarrier may be manufactured in a food processing facility. In various embodiments therefore, the microcarrier may be used or may be present, e.g., embedded, in a food and/or beverage product without food safety concerns. In various embodiments, the microcarrier is substantially free of pathogens. In various embodiments therefore, there is no need to detach cells from the microcarrier when the microcarrier is used for cell culture of a food product. In various embodiments therefore, there is no need to remove the microcarrier from the cell cultured food product.
  • the microcarrier is biocompatible. In various embodiments, the biocompatibility of the microcarrier may depend on its surface properties, such as stiffness, surface charge, chemical functionalities, roughness, and wettability. In various embodiments, the microcarrier is substantially non- cytotoxic to cells. In various embodiments, the microcarrier is biodegradable. In various embodiments, degradation by-products of the microcarrier is substantially non-cytotoxic to cells. In various embodiments, the microcarrier is manufactured using a fabrication process that is non-toxic.
  • the microcarrier is sterilizable.
  • the microcarrier may remain stable under heat.
  • the diameter of the microcarrier may not substantially change before and after the application of heat.
  • cross-linking of the coating layer may impart stability to the microcarrier.
  • the microcarrier may be sterilized using the autoclave process.
  • the microcarrier may be provided in a sterile form.
  • the microcarrier or the core particle has a diameter of from about 50 pm to about 1000 pm. In various embodiments, the microcarrier or the core particle has a diameter falling in a range with approximate start and end points selected from the following group of numbers: 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400,
  • the microcarrier or the core particle has a diameter of from about 150 pm to about 200 pm.
  • the microcarrier or the core particle has a size (e.g., diameter) which is compatible with the dimensions of a cell to be cultured thereon.
  • a microcarrier or the core particle of an appropriate size would enable the cells to attach and proliferate thereon.
  • a larger microbead may result in a lower growth surface area to volume ratio.
  • a larger microbead may require a higher energy input in order to achieve complete microcarrier suspension in culture.
  • a smaller microbead may increase the difficulty of cell adhesion and harvesting, resulting in a lower final cell yield and higher costs incurred.
  • the size of the microcarrier or the core particle may be controllable.
  • a plurality of microcarriers or core particles have a substantially uniform size or diameter.
  • the plurality of microcarriers have a coefficient of variation of the diameter of less than about 20%, less than about 19%, less than about 18%, less than about 17%, less than about 16%, less than about 15%, less than about 14%, less than about 13%, less than about 12%, less than about 11 %, less than about 10%, less than about 9%, less than about 8%, less than about 7%, less than about 6%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, or less than about 1 %.
  • cells that are cultured on microcarriers having a substantially uniform size or diameter reach confluence at approximately the same time.
  • the plurality of microcarriers or core particles may have a particle size distribution calculated by (d90-d10)/d50, where d10 is defined as the diameter of a microcarrier at which 10% of the microcarriers are smaller than this diameter, d50 is defined as the diameter of a microcarrier at which 50% of the microcarriers are smaller than this diameter, d90 is defined as the diameter of a microcarrier at which 90% of the microcarriers are smaller than this diameter.
  • the microcarrier has a density of from about 0.9 g/cm 3 to about 1 .3 g/cm 3 .
  • the microcarrier has a density falling in a range with approximate start and end points selected from the following group of numbers: 0.9, 0.91 , 0.92, 0.93, 0.94, 0.95, 0.96, 0.97, 0.98, 0.99, 1 , 1.01 , 1.02, 1.03, 1.04, 1.05, 1.06, 1.07, 1.08, 1.09, 1.1 , 1.11 , 1.12, 1.13, 1.14, 1.15, 1.16, 1.17, 1.18, 1 ,19, 1.20, 1.21 , 1.22, 1.23, 1.24, 1.25, 1.25, 1.27, 1.28, 1.29, and 1.3 g/cm 3 .
  • the microcarrier may have a density for allowing suspension of the microcarrier in a suspension cell culture.
  • the core particle is a microbead. In various embodiments, the core particle is a solid or semi-solid particle. In various embodiments, the core particle is a semi-solid particle, e.g., gel particle.
  • the core particle is a hydrogel-based particle.
  • a hydrogel when used in cell culture applications, a hydrogel may advantageously allow the cells to be placed in a more physiological three- dimensional environment as compared to the classical, flat two-dimensional cell culture.
  • hydrogels may provide a hydrophilic and bioinert microenvironment for cell culture.
  • hydrogels may be customized to better mimic the natural environment of the cells to be cultured. For example, the stiffness/rigidity of the environment may be adjusted to match with the natural stiffness of the cells/tissue of origin.
  • a hydrogel-based microcarrier i.e., a microcarrier comprising a hydrogel-based core particle
  • the core particle may be fabricated using materials derived from natural sources, e g., natural polymers for fabricating hydrogels.
  • the core particle may be fabricated using materials derived from plant sources.
  • the use of materials derived from plant sources may advantageously obviate the drawbacks of using materials derived from animal sources (e.g., gelatin). Such drawbacks include, for example, difficulty in industrial scale operation due to high costs, risk of microbial contamination, and batch to batch variations.
  • the use of materials derived from plant sources may advantageously obviate the drawbacks of using synthetic materials.
  • drawbacks include, for example, the use of enzymatic digestion to separate cells from the microcarrier during cell harvest, cytotoxicity of chemical cross-linking agents, difficulty in removing chemical cross-linking agents, degradation of the microcarrier when exposed to high temperatures required for sterilization, changes in pH during degradation of the microcarrier leading to cell death, low biodegradability, inedibility, and relatively high prices.
  • the core particle is a plant-based hydrogel.
  • the plant-based hydrogel may be a plant lignocellulose materials-based hydrogel (e.g., cellulose-based hydrogel, hemicellulose-based hydrogel, lignin-based hydrogel), a plant polysaccharide-based hydrogel (e.g., starch-based hydrogel, pectin-based hydrogel, plant gum-based hydrogel), a plant protein-based hydrogel (e.g., soy protein-based hydrogel, zein-based hydrogel), or a combination thereof.
  • a plant lignocellulose materials-based hydrogel e.g., cellulose-based hydrogel, hemicellulose-based hydrogel, lignin-based hydrogel
  • a plant polysaccharide-based hydrogel e.g., starch-based hydrogel, pectin-based hydrogel, plant gum-based hydrogel
  • a plant protein-based hydrogel e.g., soy protein-based hydrogel,
  • the core particle comprises one or more materials selected from the group consisting of alginate, cellulose, chitosan, gum, hemicellulose, lignin, pectin, soy, starch, and zein.
  • polysaccharides such as alginate and pectin may possess ionic gelation capabilities.
  • mushroom carboxymethyl chitosan may be capable of forming porous microspheres for chondrocyte cultures.
  • the core particle may be an alginate hydrogel microbead, e.g., sodium alginate hydrogel microbead, calcium alginate hydrogel microbead.
  • a core particle made of an alginate hydrogel may provide one or more of the following advantages: good mechanical integrity, cell compatibility, simple preparation method, abundance of raw material sources, ease of controlling the properties of the alginate hydrogel within a large range (e.g., physicochemical property, mechanical strength, degradation rate and surface property).
  • the coating layer is coupled to the core particle.
  • the coating layer may be coupled to the core particle via physical adsorption.
  • the coating layer may further be coupled to the core particle via cross-linking.
  • the surface of the core particle and the coating layer may have opposite electrical charges. The opposite electrical charges may advantageously encourage adsorption of the coating layer on the core particle. For example, where the core particle comprises sodium alginate, the surface of the core particle would have a net negative charge, thereby encouraging the adsorption of a coating layer with a net positive charge, e.g., a coating layer comprising amino acids with a positive charge.
  • the microcarrier may comprise more than one coating layer. In various embodiments, the microcarrier may comprise multiple coating layers. Each coating layer may have a composition that is different from the other (e.g., adjacent) coating layer(s). Each coating layer may impart a specific set of one or more properties to the microcarrier.
  • the coating layer comprises one or more materials derived from plant source(s). In various embodiments, the coating layer may be partially or completely made of one or more materials derived from plant source(s). In various embodiments, the plant source may comprise seeds, fruits, vegetables. Examples of materials derived from plant sources include but are not limited to chickpea, mung bean, soybean, lentil e.g., red lentil, broad bean, pumpkin seed, rapeseed, oat, chia seed, pea, garden pea, winter squash, wheat, rice, corn, or combinations thereof. Food grade plant proteins are abundant and can be upcycled from oil seed processing by-products such as chickpea, pumpkin seed meal, rapeseed meal, and sunflower seed meal.
  • the coating layer comprising one or more plantbased material may be capable of supporting growth of cells, for example, by promoting better adhesion of cells to, proliferation and/or differentiation of cells on the microcarrier.
  • plant proteins may contain active domains that can be used to replace the animalbased ECM for meat culture applications.
  • plant proteins may be capable of mimicking ECM proteins.
  • the plant-based material may be used in place of extracellular matrix (ECM) components e.g., ECM proteins.
  • ECM components may include, for example, collagen, fibronectin, laminin, poly-L-lysine, gelatin, keratin, vitronectin, elastin, heparan sulphate, dextran, dextran sulphate, chondroitin sulphate, heparan sulfate proteoglycans, and derivatives or fragment thereof.
  • the coating layer comprises one or more types of cyto-adhesive functional molecules.
  • the coating layer comprises one or more compatible, biologically relevant, or physiologically relevant substance, e.g., cyto-adhesive functional molecules, capable of supporting growth of cells.
  • the presence of cyto- adhesive functional molecules bonded to the surface of the core particle may advantageously improve cyto-affinity of the microcarrier.
  • the coating layer comprises a protein or a protein hydrolysate.
  • the coating layer is a protein coating layer.
  • the coating layer is a protein hydrolysate coating layer.
  • the coating layer comprising a protein, or a protein hydrolysate may provide improved cytoaffinity to the microcarrier.
  • the protein may be a plant-based protein.
  • the protein hydrolysate may be a hydrolysate of the plant-based protein.
  • the protein hydrolysate may be obtained by subjecting a protein to enzymatic hydrolysis using a suitable enzyme.
  • enzymes such as proteinase/protease/proteolytic enzyme may be used to digest the protein to form protein hydrolysate. Examples of enzymes may include but are not limited to trypsin, papain, alcalase, and flavorzyme.
  • the proteinase/ protease/ proteolytic enzyme has an optimal working pH of more than 7.
  • the proteinase/protease/proteolytic enzyme is an enzyme found in the gut e g., or the small intestine of a mammalian subject.
  • enzymatic hydrolysis may advantageously generate bioactive peptides.
  • plant proteins may be rich in cell adhesion peptides such as Arg-Gly-Asp (RGD)-containing peptide.
  • selective enzyme hydrolysis may be used to improve the bioactivity of plant proteins.
  • the enzyme may be configured to cleave a peptide at sites to expose arginine and/or lysine residues.
  • Enzymatic hydrolysis may be employed in food and pharmaceutical industries because the process is typically conducted under mild controlled conditions (e g., pH, temperature, substrate concentration, and enzyme activity), provides high specificity and the absence of residual organic solvents and toxic chemicals in the final peptide composition.
  • the protein hydrolysate has a degree of hydrolysis of from about 1 % to about 30%. In various embodiments, the degree of hydrolysis of the protein hydrolysate may fall in a range with approximate start and end points selected from the following group of numbers: 1 , 1.5, 2, 2.5, 3,
  • the degree of hydrolysis is defined as the proportion of the number of peptide bonds being broken in protein hydrolysis, or the proportion of cleaved peptide bonds in a protein hydrolysate. For example, if a starting protein containing one hundred peptide bonds is hydrolyzed until ten of the peptide bonds are cleaved, then the DH of the resulting hydrolysate is 10%.
  • the degree of hydrolysis may be determined using techniques known in the art such as the trinitrobenzene sulfonic (TNBS) colorimetric method or the ortho- phthaldialdehye (OPA) method.
  • the degree of hydrolysis the greater the extent of protein hydrolysis.
  • the molecular weight of the peptide fragments decreases, the peptide profile changes accordingly.
  • a lower DH may result in longer peptides which could lead to stronger forces of attraction between the core particles, e.g., beads, and the cells due to the larger molecular weight.
  • An increase in DH may result in a higher number of peptide bonds being cleaved but it may not equate to higher bioavailability.
  • the degree of hydrolysis of the protein hydrolysate may be from about 2.75% to about 6.0%. In some embodiments, the degree of hydrolysis of the protein hydrolysate may be about 3.5%.
  • the coating layer comprises a protein source which has been selectively hydrolyzed.
  • a protein source which has been selectively hydrolyzed.
  • Common hydrolysis by alkaline can break down the cross-link in disulfide of cereal proteins and render proteins more soluble by the ionization of acidic and neutral amino acids.
  • Enzymes such as papain, alcalase, and flavourzyme also have a very broad specificity of cleavage sites.
  • the selective hydrolysis of the enzyme describes the cleavage of specific types of amino acid after which the enzyme can hydrolyze a peptide bond (e g., Lys and Arg for trypsin).
  • the enzyme for hydrolyzing the protein may be trypsin.
  • trypsin hydrolysis may result in desirable peptides that support cell growth and improve cytoaffinity. As trypsin has two cleavage sites - Arginine and Lysine, enzymatic hydrolysis with trypsin may lead to longer chain peptides as compared to an enzyme with broader specificity and more cleavage sites, which may lead to shorter chain peptides.
  • a protein hydrolysate coating may advantageously provide better cyto-affinity as compared to a protein coating of the same material.
  • chickpea protein may be selectively hydrolyzed using protease to obtain a chickpea protein hydrolysate for coating and crosslinking to a core particle.
  • the cyto-affinity of the chickpea protein hydrolysate may be significantly enhanced relative to the chickpea protein.
  • the coating layer comprises amino acids.
  • the amino acids may include alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, valine or combinations thereof.
  • the coating layer comprises at least 3 amino acids selected from the group consisting of arginine, histidine, aspartic acid, glutamic acid and alanine.
  • the coating layer comprises at least 3 amino acids selected from the group consisting of arginine, histidine, aspartic acid, glutamic acid, proline, serine, glycine, and alanine.
  • the coating layer comprises amino acid sequences selected from the group consisting of RGD (SEQ ID NO: 1 ), IKVAV (SEQ ID NO: 6), YIGSR (SEQ ID NO: 7), DGEA (SEQ ID NO: 8), PHRSN (SEQ ID NO: 9), PRARI (SEQ ID NO: 10), permutations thereof or sequence order variations thereof (e g., GRD (SEQ ID NO: 2), DGR (SEQ ID NO: 3) etc.).
  • the coating layer comprises amino acid sequences which advantageously have cell adhesion properties.
  • the coating layer comprises peptide fragments having an arginine residue and/or peptide fragments having a lysine residue.
  • the arginine and lysine residues may be found at the amino terminal and/or carboxyl terminal of the peptide/polypeptide fragments.
  • hydrolysis of a protein may advantageously expose peptide fragments that promote cell adhesion, e.g., peptide fragments having an arginine or lysine residue.
  • the coating layer comprises one or more cell adhesion peptides.
  • the coating layer is configured to bind to a cell receptor responsible for cell adhesion.
  • the presence of cell adhesion peptides in the coating layer may advantageously improve cytoaffi nity.
  • cell adhesion peptides may include but are not limited to peptides with the following amino acid sequences: RGD (SEQ ID NO: 1 ), RGN (SEQ ID NO: 4), DGR (SEQ ID NO: 3), NGR (SEQ ID NO: 5), DGEA (SEQ ID NO: 8), IKVAV (SEQ ID NO: 6), YIGSR (SEQ ID NO: 7), PHRSN (SEQ ID NO: 9), and PRARI (SEQ ID NO: 10).
  • cell adhesion peptides may be found in plants including but not limited to mung bean, soybean, lentil, broad bean, chickpea, garden pea, pumpkin, winter squash and rapeseed.
  • the coating layer may comprise DGR- containing peptides.
  • the coating layer may comprise peptides found in chickpea protein with the following amino acid sequences RQSHFANAQP (SEQ ID NO: 11 ) and GAGAGS (SEQ ID NO: 12).
  • the coating layer is coupled/attached to the core particle via a cross-linker.
  • the coating layer may be immobilized/fixed to the core particle by a cross-linker/ cross-linking reagent.
  • the cross-linker may be formaldehyde.
  • the cross-linker may be glutaraldehyde.
  • the cross-linker may be derived from natural sources.
  • the cross-linker may be a natural food grade compound.
  • the cross-linker comprises a natural cross-linker including but not limited to flavanones, genipin, quercetin, tannic acid and transglutaminase.
  • the cross-linker comprises a natural cross-linker selected from the group consisting of flavanones, genipin, quercetin, tannic acid and transglutaminase.
  • the cross-linker may be transglutaminase, which is an enzyme that can catalyze the acyl-transfer reaction between the y-carboxyamide group of peptide-bound glutamine residues and various primary amines. The formation of this cross-link does not reduce the nutritional quality of the food as the lysine residue remains available for digestion.
  • the cross-linker may be genipin, which is a chemical compound found in Genipa americana fruit extract (i.e., a natural protein crosslinking agent isolated from an edible plant).
  • Genipin is an aglycone derived from an iridoid glycoside called geniposide which is also present in fruit of Gardenia jasminoides.
  • Genipin is an excellent natural cross-linker for proteins, collagen, gelatin, and chitosan cross-linking. It has a low acute toxicity, as compared to glutaraldehyde and many other commonly used synthetic cross-linking reagents.
  • the coating layer is fluorescent.
  • the coating layer is configured to exhibit self-fluorescence.
  • the presence of fluorescence in the coating layer may be utilized, for example, to monitor the degree of coating of the coating layer on the core particle, to ensure the uniformity of the coating layer, to monitor the microcarrier during cell culture, by using a microscope e.g., fluorescent microscope.
  • Microcarriers with fluorescence is an indication of successful coating of the protein or protein hydrolysate. Intensity of the fluorescence may be correlated to the amount of proteins or protein hydrolysate being coated on the surface of the core particle.
  • cross-linker is genipin
  • cross-linking of the protein or protein hydrolysate with genipin produces blue- colored fluorescent coating layer, due to the chromophore or fluorophore group formed between genipin and the cross-linked proteins.
  • a method of making a microcarrier comprising, providing a core particle; and forming a coating layer on a surface of the core particle to obtain the microcarrier, wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.
  • the method includes forming a plurality of core particles and forming a coating layer on surfaces of the plurality of core particles.
  • providing the core particle comprises forming/fabricating the core particle from its raw material.
  • the raw material may be sodium alginate for forming an alginate core particle.
  • the raw material may include but is not limited to pectin, chitosan, zein, and cellulose.
  • the raw material may be selected from the group consisting of pectin, chitosan, zein, cellulose, and combinations thereof.
  • providing the core particle comprises electrospraying a precursor solution to form the core particle in the form of a microbead.
  • the technique of making microbeads may be based on emulsification.
  • the technique of making microbeads may be based on microfluidics.
  • the technique of making microbeads may be based on extrusion.
  • the technique of making microbeads may be based on a phaseinversion method.
  • forming the coating layer comprises immersing the core particle in a coating solution.
  • the coating solution may comprise a protein or a protein hydrolysate.
  • the core particles may be immersed into the coating solution at a percent weight/volume (% w/v) of from about 10% w/v to about 50% w/v.
  • the percent weight/volume (% w/v) of the core particles relative to the coating solution may fall in a range with approximate start and end points selected from the following group of numbers: 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, and 50% w/v.
  • a percent weight/volume of 10% means that 10 grams of the core particles is immersed in every 100 ml_ of the coating solution.
  • the coating solution may have a concentration of from about 0.1 % to about 30% by weight of a coating substance, e.g., protein or protein hydrolysate.
  • concentration of the coating solution may fall in a range with approximate start and end points selected from the following group of numbers: 0.1 , 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, and 30% by weight.
  • a percent weight of 10% means that 10 g of the coating substance is dissolved in 100 g of solution.
  • the size of the core particle may be altered depending on the concentration of the coating substance e.g., protein. For example, as protein concentration increases, q (%) may decrease, where q (%) refers to the volume at each particle size (i.e. , frequency distribution). Without wishing to be bound by theory, it is believed that moisture may have diffused out of the beads due to differences in osmotic pressure between the beads and protein solution.
  • the coating process may be carried out at a pH from about 5.0 to about 10.0. In various embodiments, the coating process may be carried out at a pH falling in a range with approximate start and end points selected from the following group of numbers: 5.0, 5.1 , 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1 , 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1 , 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1 , 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9.0, 9.1 , 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, and 10.0.
  • the coating process may be carried out at a temperature of from about 4°C to about 60°C, which is below the protein denaturation temperature to prevent the destruction of the functional properties of peptides. In various embodiments, the coating process may be carried out at a temperature falling in a range with approximate start and end points selected from the following group of numbers: 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16,
  • protein adsorption on solid surfaces generally increases with temperature, and the thickness of protein layers is enhanced with elevated temperature.
  • the method further comprises extracting a protein for making a protein coating solution.
  • the protein for making the protein coating solution may be extracted using an isoelectric point precipitation method.
  • extracting the protein may comprise grounding one or more raw materials into powder form. The raw materials may be obtained from plant sources and may include but are not limited to chickpea, mung bean, soybean, lentil e.g., red lentil, broad bean, pumpkin seed, rapeseed, oat, chia seed, pea, garden pea, winter squash, wheat, rice, corn, or combinations thereof.
  • extracting the protein may further comprise dispersing the one or more powders of raw materials in a suitable liquid (e.g., deionized water) to obtain a protein mixture/dispersion.
  • a suitable liquid e.g., deionized water
  • the one or more powders of raw materials may be dispersed at a percent weight/volume (% w/v) of from about 1 % w/v to about 50% w/v.
  • the percent weight/volume (% w/v) of the powder relative to the liquid may fall in a range with approximate start and end points selected from the following group of numbers: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, and 50% w/v.
  • extracting the protein may further comprise solubilizing the protein in the protein mixture.
  • solubilizing the protein may further comprise adjusting the pH of the protein mixture such that the protein is dissolved.
  • the pH of the protein mixture may be adjusted using a suitable acid or base.
  • extracting the protein may further comprise removing insoluble non-protein components from the protein mixture.
  • extracting the protein may further comprise precipitating the dissolved protein by adjusting the pH of the protein mixture to obtain a solid form of the protein.
  • extracting the protein may further comprise dissolving the solid form of the protein in a suitable solvent by adjusting the pH to obtain a protein solution.
  • the pH of the protein mixture may be adjusted using a suitable acid or base.
  • extracting the protein may further comprise freezing the protein solution and lyophilizing the frozen protein solution to obtain a lyophilized protein. It will be appreciated that the various steps of extracting the protein may further involve mixing (e.g., using a vortex or shaker machine) and washing steps (e.g., washing with deionized water).
  • the step of extracting the protein may have a protein extraction yield of from about 1 % to about 20%, depending on the type of raw material. In various embodiments, the step of extracting the protein may have a protein extraction yield falling in a range with approximate start and end points selected from the following group of numbers: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, and 20%.
  • the method prior to forming the coating layer, further comprises preparing the coating solution comprising the protein hydrolysate. In various embodiments, the method further comprises hydrolyzing a protein source with an enzyme to produce protein hydrolysate, prior to coating the core particles with the protein hydrolysate. In various embodiments, the method further comprises selectively hydrolyzing a protein source. This may include using a suitable enzyme with cleavage sites that specifically expose amino acid residue(s) and/or peptide fragment(s) with bioactive effects, prior to coating the core particles with the protein hydrolysate.
  • the protein hydrolysate may be obtained by digesting a protein using an enzyme, e.g., proteinase/protease/proteolytic enzyme.
  • the protein hydrolysate may have a degree of hydrolysis determined by factors such as the concentration of the protein, type of enzyme used, concentration of the enzyme used, and duration of exposure to the enzyme or duration of hydrolysis.
  • the protein may be subjected to hydrolysis by more than one type of enzyme. For example, the protein may be subjected to sequential hydrolysis, i.e.
  • treating the protein with a first enzyme to obtain a first protein hydrolysate, deactivating the first enzyme, treating the first protein hydrolysate with a second enzyme to obtain a second protein hydrolysate, and deactivating the second enzyme (repeating the steps of treating with other enzymes and deactivating them may also be further carried out).
  • the protein hydrolysate solution has a degree of hydrolysis of from about 1 % to about 30%.
  • the degree of hydrolysis of the protein hydrolysate solution may fall in a range with approximate start and end points selected from the following group of numbers: 1 , 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11 , 11.5, 12, 12.5, 13, 13.5, 14, 14.5, 15, 15.5, 16, 16.5, 17, 17.5, 18, 18.5, 19, 19.5, 20, 20.5, 21 , 21.5, 22, 22.5, 23, 23.5, 24, 24.5, 25, 25.5, 26, 26.5, 27, 27.5, 28, 28.5, 29, 29.5, and 30%.
  • the hydrolysis of the protein may be carried out over a period of from about 10 minutes to about 240 minutes. In various embodiments, the hydrolysis of the protein may be carried out over a period falling in a range with approximate start and end points selected from the following group of numbers: 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, and 240 minutes.
  • preparing the coating solution comprising the protein hydrolysate comprises hydrolyzing a protein using an enzyme-substrate concentration (E/S%) of from about 0.1 % to about 50%.
  • the hydrolysis of the protein may be carried out using an enzyme-substrate concentration (E/S%) falling in a range with approximate start and end points selected from the following group of numbers: 0.1 , 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, and 50%.
  • the hydrolysis of the protein may be carried out at a protein dispersion of from about 0.1 % to about 30% w/v. In various embodiments, the hydrolysis of the protein may be carried out at a protein dispersion falling in a range with approximate start and end points selected from the following group of numbers: 0.1 , 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, and 30% w/v.
  • forming the coating layer further comprises mixing the core particles immersed in the coating solution.
  • the core particles immersed in the coating solution may be mixed using mechanical means, such as vortexing or shaking.
  • mixing may improve contact between the core particles and the coating solution such that the surfaces of the core particles are coated with the coating solution. It will be appreciated that the mixing step is performed at a level of intensity such that the core particles are not substantially damaged.
  • forming the coating layer further comprises immersing the core particle coated with the coating layer in a cross-linking solution.
  • the cross-linker solution may comprise a crosslinker that is derived from natural sources.
  • the crosslinker solution may comprise a cross-linker that is a natural food grade compound.
  • the cross-linker comprises a natural cross-linker selected from the group consisting of flavanones, genipin, quercetin, tannic acid and transglutaminase.
  • the cross-linker solution may comprise genipin.
  • the cross-linker solution may comprise transglutaminase.
  • the core particles may be immersed into the cross-linker solution at a percent weight/volume (% w/v) of from about 5% w/v to about 50% w/v.
  • the percent weight/volume (% w/v) of the core particles relative to the cross-linker solution may fall in a range with approximate start and end points selected from the following group of numbers: 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, and 50% w/v.
  • a percent weight/volume of 10% means that 10 grams of the core particles is immersed in every 100 mL of the cross-linker solution.
  • the cross-linker solution may have a concentration of from about 0.1 mg/ml_ to about 10 mg/mL.
  • the concentration of the cross-linker solution may fall in a range with approximate start and end points selected from the following group of numbers: 0.1 , 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1 , 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, and 10 mg/mL.
  • the method may comprise washing the coated core particles prior to and after immersing the coated core particles in the cross- linker solution.
  • the coated core particles may be washed using a suitable solvent such as deionized water.
  • a system for producing a cell cultured food product comprising, a population of cells; and a plurality of microcarriers configured to allow the population of cells to be grown thereon; wherein the microcarrier comprises a core particle and a coating layer disposed on a surface of the core particle; and wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.
  • a method of producing a cell cultured food product comprising, seeding a population of cells onto a plurality of microcarriers configured to allow the population of cells to be grown thereon, wherein the microcarrier comprises a core particle and a coating layer disposed on a surface of the core particle; and wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.
  • the microcarrier is a microcarrier for cells.
  • the coating layer of the microcarrier may provide a substrate for cells to attach/adhere thereon.
  • the coating layer of the microcarrier may advantageously enhance cell attachment, proliferation and differentiation.
  • the microcarrier may be used to upscale anchorage-dependent cells such as mammalian cells.
  • a plurality of microcarriers may advantageously provide a relatively large surface area to volume ratio for cell culture as compared to, for example, two-dimensional cell culture.
  • the cells may be stem cells or somatic cells.
  • the stem cells may be pluripotent (e.g., embryonic stem cells or induced pluripotent stem cells) or multipotent (e g., adult stem cells).
  • the stem cells may be mesenchymal stem cells (MSCs), embryonic stem cells (ESCs) or induced pluripotent stem cells (iPS).
  • the somatic cells may include but are not limited to muscle cells (e.g., myoblasts) and fat cells (e.g., adipocytes).
  • the cells may be cells of a non-human organism including but not limited to poultry (e.g., chicken, duck, turkey, goose, fowl), pig, cattle (e.g., cow), sheep, goat, horse, fish and shrimp.
  • the microcarrier may be used for producing cultured meat (e.g., red meat or white meat or seafood) or cell-based meat (CBM).
  • the microcarrier or a plurality of microcarriers may be used in cell culture.
  • the microcarrier may remain substantially stable in culture media.
  • the diameter of the microcarrier may not substantially change over the duration of the cell culture.
  • the cell culture may include static cell culture or dynamic cell culture. In a static cell culture, the culture or culture media is not actively agitated.
  • aggregates of cells and/or microcarriers may be allowed to form under reduced agitation of the culture or culture media.
  • a dynamic cell culture the culture or culture media is actively agitated to promote exchange of nutrients and waste to and from the cells attached on the microcarriers.
  • Dynamic cell culture may include, for example, stirred spinner and bioreactor culture.
  • the cells may be seeded onto the microcarriers at a seeding density of from about 10 3 to about 10 4 cells/mL for every 0.01 gram (g) of the microcarriers. In various embodiments, the cells may be seeded onto the microcarriers at a seeding density falling in a range with approximate start and end points selected from the following group of numbers: 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, and 10000 cells/mL for every 0.01 g of the microcarriers.
  • the system may further comprise a cell culture device for holding the cells and microcarriers.
  • the cell culture device may be a well plate, e g., 24-well plate.
  • the well plate may be a low attachment well-plate, i.e., the surfaces of the well plate are treated to minimize/prevent cell attachment onto the surface of the well plate. This would promote the attachment of cells onto the microcarriers.
  • the cell culture device may be a spinner flask or bioreactor.
  • the system may further comprise one or more equipment for providing a controlled environment for the growth and cultivation of cells.
  • the equipment is configured to provide a stable and regulated environment in terms of temperature (e.g., 37°C), humidity, carbon dioxide (CO2) levels (e.g., 5%), oxygen (O2) concentration to support the optimal growth and proliferation of cells on the microcarriers.
  • temperature e.g., 37°C
  • CO2 carbon dioxide
  • O2 oxygen
  • the equipment may be a commercially available cell incubator or a custom-built system for industrial scale production.
  • a microcarrier-based system and method of cell culture may provide advantages such as ease of downstream processing in many applications.
  • the use of microcarriers for cell attachment facilitates the use of stirred tank and related reactors for growth of anchoragedependent cells.
  • the cells attach to the readily suspended microcarriers.
  • the requirement for microcarriers to be suspended may limit the physical parameters of the microcarriers themselves such as the size of the microcarriers.
  • the size of the microcarriers should be large enough to accommodate many anchoragedependent cells, while small enough to form suspensions with properties suitable for use in bioreactors.
  • the cells remain viable when cultured on the microcarrier over a period of time.
  • the cells may remain viable when cultured on the microcarrier over a period of time from about 1 to about 28 days.
  • the cells remain viable when cultured on the microcarrier over a period of time falling in a range with approximate start and end points selected from the following group of numbers: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, and 28 days
  • the number of cells cultured on the microcarrier may increase by about 1 -fold to about 20-fold, about 2-fold to about 19-fold, about 3-fold to about 18-fold, about 4-fold to about 17-fold, about 5-fold to about 16- fold, about 6-fold to about 15-fold, about 7-fold to about 14-fold, about 8-fold to about 13-fold, about 9-fold to about 12-fold, or about 10-fold to about 11 -fold from the time when the cells are
  • a cell cultured food product comprising, a population of cells; and a plurality of microcarriers configured to allow the population of cells to be grown thereon; wherein the microcarrier comprises a core particle and a coating layer disposed on a surface of the core particle; and wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.
  • the cells may be muscle cells (e.g., myoblasts) and fat cells (e.g., adipocytes).
  • the cells may be cells of a non-human organism including but not limited to poultry (e.g., chicken, duck, turkey, goose, fowl), pig, cattle (e.g., cow), sheep, goat, horse, seafood (e.g., fish and shrimp).
  • cell cultured food product is cultured meat I cell-based meat.
  • the culture meat may be white and/or red cultured meat.
  • FIG. 2A to 2C are charts showing the effect of (A) different coating pH, (B) different coating protein concentration (1 to 20%), and (C) different coating protein concentration (4 to 10%), on the content of coated protein and fluorescence intensity of genipin cross-linked plant protein-alginate microbeads.
  • FIG. 2D to 2F are particle size distribution diagrams of the microbeads formed at (D) different coating pH, (E) different coating protein concentration (1 to 20%), and (F) different coating protein concentration (4 to 10%).
  • FIG. 3A is a chart showing fold changes of C2C12 seeding on microbeads with different protein coating during a 3-day culture.
  • FIG. 3B to 3D are graphs showing correlation between (B) the content of soluble protein, (C) the content of arginine in plant protein, and (D) the content of lysine in plant protein, with respect to fold changes in cell number.
  • FIG. 4A and 4B are microscope images of (A) C2C12 and (B) 3T3 cells proliferation on plant-based protein coated microbeads during a 13-day culture and graphs showing fold changes in cell number over the incubation period.
  • FIG. 6A to 6D are charts showing gene expression and differentiation of C2C12 cells grown on microbeads and on 2D plates.
  • A Relative expression of integrin p1 and M-cadherin on 6-well plate and microbeads cultured C2C12 (before differentiation);
  • B relative expression of MyoD1 , C) Myf5 and D) Myh7 on 6-well plate and microbeads cultured C2C12 during differentiation.
  • FIG. 6E and 6F are confocal laser scanning microscope (CLSM) images of C2C12 cells on (E) 6-well plate during a 7-day differentiation, and (F) pumpkin seed protein coated microbeads during a 7-day differentiation.
  • CLSM confocal laser scanning microscope
  • FIG. 7 is a photograph showing SDS-PAGE profiles of 11 types of plant proteins.
  • FIG. 8B is a chart showing fold changes in primary porcine myoblasts seeded on microbeads with different protein coating during a 7-day culture.
  • FIG. 8C is a chart showing fold change in C2C12 cells seeded on microbeads with different protein coating during a 3-day culture.
  • FIG. 9A is a photograph showing microbeads in PBS solution.
  • FIG. 9B is a set of fluorescent microscope images of 9 types of protein-coated microbeads (1 , mung bean protein hydrolysate coated microbeads; 2, soybean protein hydrolysate coated microbeads; 3, red lentil protein hydrolysate coated microbeads; 4, broad bean protein hydrolysate coated microbeads; 5, chickpea protein hydrolysate coated microbeads; 6, pea protein hydrolysate coated microbeads; 7, pumpkin seed protein hydrolysate coated microbeads; 8, rapeseed 1 protein hydrolysate coated microbeads; 9, rapeseed 2 protein hydrolysate coated microbeads; 10, alginate microbeads).
  • FIG. 10A is a 3D chart showing fold changes in C2C12 seeding on microbeads coated with different protein hydrolysates after a 3-day culture. Each number represents a different type of plant protein (1 -mung bean, 2-soybean, 3- red lentil, 4-broad bean, 5-chickpea. 6-pea, 7-pumpkin seed, 8-rapeseed 1 , 9- rapeseed 2).
  • FIG. 10B and 10C are charts showing the degrees of hydrolysis for (C) different E/S% ratio and (D) different hydrolysis duration.
  • FIG. 10D is a chart showing a comparison of C2C12 cell adhesion with different degrees of hydrolysis.
  • FIG. 10E and 10F are charts showing (E) fold changes in C2C12 cell numbers and (F) fold changes in 3T3 cell numbers with different degrees of hydrolysis.
  • FIG. 11 is a chart showing fold changes in primary porcine myoblasts seeded on microbeads with different protein hydrolysis during a 7-day culture. Left and right bars for each plant protein represent hydrolysis by trypsin and papain, respectively.
  • FIG. 13A is a chart showing the effect of different E/S concentrations on the degree of hydrolysis and coated protein on microbeads.
  • FIG. 13B is a chart showing the effect of different hydrolysis durations on the degree of hydrolysis and coated protein on microbeads.
  • FIG. 14 is a chart showing fold changes in primary porcine myoblasts seeded on microbeads with different degree of hydrolysis during a 7-day culture.
  • FIG. 16A is a chart showing the coated protein content achieved on microbeads under loading conditions at different pH.
  • FIG. 16B is a chart showing the coated protein content achieved on microbeads under loading conditions at different temperatures.
  • FIG. 16C is a chart showing the coated protein content achieved on microbeads under loading conditions with coating solutions at different protein concentrations.
  • FIG. 16D is a chart showing the frequency distribution of particle sizes achieved under loading conditions with coating solutions at different protein concentrations.
  • FIG. 17 is a chart showing primary porcine myoblasts proliferation on microbeads coated with different protein hydrolysis.
  • FIG. 18A is a set of confocal microscope images of C2C12 cells on CPH coated microbeads.
  • FIG. 18B is a set of confocal microscope images of primary porcine myoblasts on CPH coated microbeads.
  • FIG. 18C is a set of confocal microscope images of chicken muscle satellite cells on CPH coated microbeads.
  • FIG. 18D is a chart showing cell proliferation of C2C12 cells, primary porcine myoblasts and chicken muscle satellite cells on microbeads during a 15-day culture.
  • FIG. 18A is a set of confocal microscope images of C2C12 cells on CPH coated microbeads.
  • FIG. 18B is a set of confocal microscope images of primary porcine myoblasts on CPH coated microbeads.
  • FIG. 18C is a set of confocal microscope images of chicken muscle satellite cells on CPH coated microbeads.
  • FIG. 18D is a chart
  • 18E is a set of confocal microscope images of 3T3 cells on CPH coated microbeads and a chart showing cell proliferation of 3T3 cells on microbeads during a 15-day culture.
  • FIG. 19A to 19E are confocal microscope images of cells differentiation on microbeads and on 2D plates.
  • A C2C12 cultured on 2D plate
  • B C2C12 cultured on gelatin coated microbeads
  • C C2C12 cultured on CPH coated microbeads
  • D primary porcine myoblasts cultured on CPH coated microbeads
  • E chicken muscle satellite cells cultured on CPH coated microbeads. Samples were stained with anti-desmin (green) with the addition of Hoechst 33342 (Blue), and observed under a confocal microscope.
  • FIG. 1 C2C12 cultured on 2D plate
  • B C2C12 cultured on gelatin coated microbeads
  • C C2C12 cultured on CPH coated microbeads
  • D primary porcine myoblasts cultured on CPH coated microbeads
  • E chicken muscle satellite cells cultured on CPH coated microbeads.
  • Samples were stained with anti
  • FIG. 20A is a chart showing the content of free lysine and arginine in protein solutions with different treatments (CP, 5% chickpea solution; CP+C, 5% chickpea solution treated by carboxypeptidase B; CP+T, 5% chickpea solution treated by trypsin; CP+T+C, 5% chickpea solution treated by sequential hydrolysis (combination of trypsin and carboxypeptidase B treatment).
  • CP 5% chickpea solution
  • CP+C 5% chickpea solution treated by carboxypeptidase B
  • CP+T 5% chickpea solution treated by trypsin
  • CP+T+C 5% chickpea solution treated by sequential hydrolysis (combination of trypsin and carboxypeptidase B treatment).
  • FIG. 20B is a chart showing fold changes of C2C12 on microbeads with different coating materials (Cytodex, cells cultured on Cytodex-1 microcarriers).
  • FIG. 20C is a chart comparing fold changes of C2C12 and 3T3 cells on different microbeads.
  • FIG. 21 A to 21 D are charts showing the protein content of pumpkin seed protein-alginate microbeads with cross-linking agents (A) diacteyl, (B) flavonone, (C) quercetin, and (D) Tgase, as determined by BOA assay conducted one day after cross-linking.
  • the X-axis represents the alginate group without any coating (A), the protein coated group without cross-linking (B), and the cross-linked group (C). Significance of differences between results represented by different lowercase letters (p ⁇ 0.05).
  • FIG. 22A and 22B are charts showing the effect of varied TGase concentrations on cross-linked pumpkin seed protein-sodium alginate microbeads during four days of storage.
  • FIG. 22A and 22B are comparisons between days and samples, respectively. Significant differences between results from the same day's BCA assay are denoted by distinct lowercase letters among columns (p ⁇ 0.05).
  • FIG. 23A to 23C are optical microscope images of sodium alginate microbeads that have been cross-linked by TGase at different concentrations.
  • TGase concentration is 1 U/mL
  • B 3 U/mL
  • C 10 U/mL.
  • Example embodiments of the disclosure will be better understood and readily apparent to one of ordinary skill in the art from the following discussions and if applicable, in conjunction with the figures. It should be appreciated that other modifications related to structural, chemical and material changes may be made without deviating from the scope of the invention.
  • Example embodiments are not necessarily mutually exclusive as some may be combined with one or more embodiments to form new exemplary embodiments. The example embodiments should not be construed as limiting the scope of the disclosure.
  • Sodium alginate was obtained from Shanghai Ruizheng Chemical Technology Co., Ltd.
  • Calcium chloride, hydrochloric acid, and bovine gelatin were obtained from Sigma-Aldrich Pte. Ltd (Singapore).
  • Oil Red 0 powder was obtained from Sigma-Aldrich for lipid droplets staining.
  • Genipin was obtained from Challenge Bioproducts (Taiwan). Mung bean, soybean, red lentil, broad bean, pumpkin seed, rapeseed, oat, and chia seed were obtained from Origins Healthcare Pte Ltd for protein extraction.
  • Commercial chickpea, mung bean, soybean and pea protein were obtained from Yantai T. Full Biotech Co., Ltd.
  • Cell Counting Kit-8 (CCK8) was obtained from Scientific Resources Pte Ltd. (Singapore).
  • Primary porcine myoblasts, C2C12 myogenic, 3T3 cell line and chicken muscle satellite cells were used.
  • Electrospraying technique was applied to form alginate beads having a narrow size distribution around 200 pm.
  • alginate solution was prepared by adding sodium alginate in water and was stirred continuously until fully dissolved.
  • the alginate solution was transferred to a 20 mL syringe capped with a blunted stainless-steel needle.
  • a high voltage electric field was applied to the polymer solution (i. e. , alginate solution), which was fed at a substantially constant flow rate using a syringe pump to draw alginate beads toward a beaker containing calcium chloride solution (as the gelation bath) placed on a magnetic stirrer.
  • the needle and a ring were connected to positive and negative electrodes of high voltage supplies, respectively. Uniformity in the size of the microbeads was realized by performing electrospraying in the cone-jet mode, and also stabilized by an additional ring-shape electrode placed on the beaker containing the gelation bath. The collected beads were cross-linked and hardened in the gelation bath for a defined period and Ca-alginate beads were then collected by a cell strainer for further analysis.
  • Grains and oil seeds (soybean, mung bean, red lentil, rapeseeds, pea, chickpea, pumpkin seeds, oat, broad bean, and chia seeds) were ground into powder (Rong Tsong Precision Technology Co., China) for protein extraction.
  • 150 g of the grounded powder/flour was dispersed in 1 .5 L deionized water (10% w/v) and mixed for 2 minutes on a shaker (Rotamax 120, Heidolph instruments GmbH & Co. KG, Germany) at a speed of 150 rpm.
  • pH was adjusted to 9.0 using 0.5 M NaOH before the dispersion was mixed for another 30 minutes at 150 rpm.
  • Insoluble non-protein components were removed via centrifuging at 12857xg at 23 °C for 5 min (Centrifuge 5810R, Eppendorf AG, Germany). To precipitate proteins, 0.5 M HCI was added to adjust pH of the supernatant to 5.2. The precipitated protein was recovered by centrifugation via the same procedure and washed in deionized water via centrifugation at 12857*g at 23 °C for 1 min. Proteins collected from centrifuge tubes were resuspended in 1 .5 L of centrifuge tubes’ rinses, via mixing by shaker at a speed of 150 rpm for 5 min.
  • the suspension was adjusted to pH 7.4 to resolubilize proteins followed by freezing at -20 °C at least 24 h prior to lyophilization using VirTis benchtop freeze dryer (SP Industries; Warminster, PA, USA).
  • SP Industries Warminster, PA, USA
  • the lyophilization process took 1 week to completely dry the samples.
  • the protein extraction yield ranged from 1 % to 20%, depending on the types of grains.
  • the purities of the proteins were determined by the Dumas method. Chickpea and pea proteins were dissolved in water and used directly. All protein isolate powder obtained was stored at -26 °C until further application.
  • Plant protein was dissolved in water to prepare 4% protein mixture and insoluble components were removed via centrifuging at 12857xg at 23 °C for 5 min (Centrifuge 5810R, Eppendorf AG, Germany). Soluble protein in supernatant was quantified using the PierceTM BCA Protein Assay Kit (Thermo Scientific), according to manufacturer instructions for the microplate procedure. Six replicates were quantified for each sample. Sample concentration was determined by applying a linear fit to the albumin and using the resulting equation to determine each sample concentration from its absorbance measurement.
  • Protein samples were denatured for 5 min at 100 °C, loaded onto a polyacrylamide gel made of 10% running gel and 4% stacking gel, and subjected to electrophoresis at a constant current of 15 mA per gel, using a Mini Protein II unit (Bio-Rad Laboratories, Inc., Richmond, CA, USA).
  • the proteins were stained with 0.02% (w/v) Coomassie Brilliant Blue R-250 in 50% (v/v) methanol and 7.5% (v/v) acetic acid and destained with 50% methanol (v/v) and 7.5% (v/v) acetic acid, followed by 5% methanol (v/v) and 7.5% (v/v) acetic acid.
  • Wide range molecular weight markers including 180, 130, 100, 70, 55, 40, 35, 25, 15, and 10 kDa were used for estimation of molecular weight of proteins. Protein bands were imaged with a ChemiDocTM gel imaging system from Bio-Rad (Bio-Rad Laboratories, Mississauga, ON, Canada).
  • Plant proteins were subjected to enzymatic hydrolysis. Hydrolysis using trypsin (T4799, Sigma-Aldrich Pte. Ltd, Singapore) was carried out in a shaking water bath at 50 °C, pH 8, over 120 minutes with 1 % enzyme-substrate concentration (E/S%) in 5% protein dispersion. After hydrolysis, the enzymes were deactivated via heating at 95 °C for 15 minutes. The hydrolysates were centrifuged twice at 10000 g for 15 minutes, and the supernatants were collected and stored at 4 °C.
  • trypsin T4799, Sigma-Aldrich Pte. Ltd, Singapore
  • the degree of hydrolysis (DH) of the hydrolysates was determined via formol titration. For every 2 mL of 5% protein hydrolysate, 68 mL of DI water was added. It was then subjected to titration using 0.05 M NaOH to pH 8.2, 10 mL of formaldehyde solution was added subsequently and titrated using 0.05 M NaOH to pH 9.2. The amount of NaOH used to reach pH 9.2 was recorded down to calculate the DH. The procedure was conducted in triplicate for all hydrolysates. Free nitrogen was first calculated based on the formula shown in Equation 1 and DH was calculated based on Equation 2. The total nitrogen content of different proteins was determined using the Kjeldahl method and each protein was conducted in duplicate.
  • Free Nitrogen 100 (1 ) where Vi is volume of NaOH used in titration of sample (ml_); V2 is volume of NaOH used to titrate the blank (mL); c is concentration of NaOH used (0.05 M); 0.014 is the content of nitrogen equivalent to 1 mL of NaOH, and is the volume of sample (mL). where free nitrogen is obtained from equation 1 ; total nitrogen content of individual plant protein was determined using the Kjeldahl method, and 20 is the dilution factor.
  • Chickpea protein solution, chickpea carboxypeptidase B hydrolysate, chickpea trypsin hydrolysate, and chickpea protein hydrolysate (CPH) by sequential hydrolysis (combination of trypsin and carboxypeptidase B treatment) were prepared for free amino acid analysis.
  • sulfosalicylic acid 200 pL was added to the sample (800 pL) and incubated at 4 °C for 60 minutes. After centrifuging at 14500 rpm for 15 minutes, the supernatant was passed through a 0.22 pm syringe filter and the filtrate was centrifuged at 10000 g for 5 minutes. The supernatant was transferred into an injection vial with a dilution ratio of 1 :4 or 1 :16. The samples were analysed using an ARACUS amino acid analyzer (Membrane Pure, Germany).
  • Alginate microbeads were coated by plant proteins and plant protein hydrolysates, respectively.
  • freeze dried plant proteins were used to prepare 4% protein solution by dissolving in water.
  • protein hydrolysate coating proteins were firstly digested by proteinase under different conditions to obtain protein hydrolysates with different degree of hydrolysis. The protein hydrolysis was freeze dried and then used to prepare coating solution with 4% dried powder and water.
  • the alginate microbeads immersed into the coating solution were immediately vortexed and then agitated using a shaker (Rotamax 120, Heidolph instruments GmbH & Co. KG, Germany) at a speed of 150 rpm. After coating for 2 hours, microbeads were collected by a 70 pm cell strainer (SPL Lifesciences, Korea) followed by 3 rounds of rinsing with water.
  • the coated alginate microbeads were cross-linked by immersing in a 1 mg/mL genipin solution with a ratio of 1 :4 (beads: genipin solution, w/v) and shaking at 150 rpm in a 60 °C water bath (SW22, Julabo USA Inc., Allentown, PA, USA), then collected and washed with DI water 3 times after cross-linking.
  • the coated microbeads were stored in 0.1 M CaCl2 solution with a concentration of 0.2 g beads/mL, before being autoclaved and collected by a cell strainer for cell culture.
  • the coated microbeads can be stored for at least about 3 months. The sterilized beads were used for different physical tests and cell seeding.
  • Particle size was measured by microscopy images of the microbeads (Olympus Corporation, Tokyo, Japan) and cellSens Standard software (Olympus corporation) which can assess the diameter of beads.
  • the mean diameter of microbeads was calculated by the average data of 3 batches of microbeads with 15 randomly selected beads from each batch.
  • Particle size and distribution of microbeads were also measured by LA- 960 laser particle size analyzer (Horiba, Ltd., Tokyo, Japan). The characteristic diameters were obtained along with the diagram: mean diameter, median diameter, d (10% of the particles smaller than this diameter), dso (50% of the particles smaller than this diameter), and dgo (90% of the particles smaller than this diameter). The particle size distribution was calculated by (d9o-dio)/dso.
  • microbeads and degree of cross-linking were investigated by an Olympus BX51 fluorescence microscope (Olympus corporation, Tokyo, Japan). A total of 3 batches of microbeads were analyzed on 15 randomly selected beads from each batch.
  • microbeads were quantified using the PierceTM BCA Protein Assay Kit (Thermo Scientific), according to manufacturer instructions. Microbeads were quantified after a 20x dilution. Six replicates were quantified for each sample. Sample concentration was determined by applying a linear fit to albumin and using the resulting equation to determine each sample concentration from its absorbance measurement.
  • C2C12 cells were cultured in Growth Medium (GM) containing Dulbecco’s Modified Eagle’s Medium (DMEM)-High Glucose (Hyclone Laboratories, Inc., Logan, UT, USA) supplemented with 10% fetal bovine serum, and 1% penicillinstreptomycin in 75 cm 2 flasks to get the required amount of cells.
  • GM Growth Medium
  • DMEM Modified Eagle’s Medium
  • Glucose Hyclone Laboratories, Inc., Logan, UT, USA
  • CCK-8 assay For protein screening, 10 4 cells/mL cells were seeded onto 0.01 g of microbeads in low attachment 24-well plate on day 0. CCK-8 assay and microscope images were performed on day 1 and 3 (with cells being seeded at day 0) to measure cell metabolic activity. C2C12 proliferation on pumpkin protein coated microbeads and chickpea hydrolysate coated microbeads were determined by seeding the cells onto the 0.01 g microbeads at 3x10 3 cells/mL in each well of low attachment 24-well plate. The number of cells seeded were estimated by CCK-8 assay on day 1 , 3, 5, 7, 9, 11 , and 13 (with cells being seeded at day 0). Half of the cell culture medium was changed every two days.
  • C2C12 differentiation was induced to 80% confluence by replacing the GM with differentiation medium (DM) containing DMEM-High Glucose supplemented with 2% horse serum (Hyclone Laboratories, Inc., Logan, UT, USA) and 1 % antibiotic-antimycotic.
  • Day 0 (DO) indicates the day on which the cells were switched from GM to DM.
  • the protocol of 3T3 cells proliferation was same with C2C12 cells.
  • Primary porcine myoblasts were cultured according to a procedure described in “Ding, S., Wang, F., Liu, Y. et al. Characterization and isolation of highly purified porcine satellite cells. Cell Death Discov. 3, 17003 (2017).’’ to obtain the required amounts.
  • Chicken muscle satellite cells were cultured according to the AcceGen protocol.
  • muscle cells were fixed by adding 4% paraformaldehyde in phosphate buffered saline (PBS) pH 7.4 for 10 minutes at room temperature followed by incubation for 10 minutes in PBS containing 0.1 % Triton X-100 for permeabilization.
  • PBS phosphate buffered saline
  • For blocking cells were incubated with 1% BSA, 22.52 mg/mL glycine in PBST (PBS + 0.1 % Tween 20) for 30 minutes to block unspecific binding of antibodies.
  • PBST PBS + 0.1 % Tween 20
  • cells were incubated in the diluted antibody in 1 % BSA in PBST in a humidified chamber for 1 hour at room temperature, followed by a second incubation with the secondary antibody in 1 % BSA for 1 hour at room temperature in the dark.
  • cells were incubated in 0.1 pg/mL Hoechst for 1 minute for DNA staining. After each step, cells were washed 3
  • Oil Red O stock solution was prepared by dissolving Oil Red O (0.1 g) in isopropanol (200 mL) to give stock solution, which was diluted to working solution by mixing 3 parts of Oil Red O stock solution with 2 parts of water.
  • the Oil Red 0 Working Solution is stable for 2 hours and were prepared 15 minutes before use.
  • 3T3 differentiation was induced by differentiation media (GM) containing 0.5 mM IBMX (Isobutylmethylxanthine, 1 -Methyl-3-lsobutylxanthine), 0.25 pM dexamethasone, 1 pg/mL insulin, and 2 pm rosiglitazone) for 2 days postconfluence, followed by 2 days of maintenance media containing 1 pg/mL insulin, and finally, back to GM with media replacement every 2 days.
  • GM differentiation media
  • IBMX Isobutylmethylxanthine, 1 -Methyl-3-lsobutylxanthine
  • dexamethasone 1 pg/mL insulin
  • 2 pm rosiglitazone 2 days postconfluence
  • cells ready to be stained were washed twice with PBS and fixed with 10% formalin to the cells and incubated for 30 minutes at room temperature. The formalin was discarded and the cells were washed twice with water. To the cells, isopropanol (60%) was added and incubated for 5 minutes. The solvent was removed, and the cells covered evenly with Oil Red O working solution. The plates were rotated and incubated for 10 to 20 minutes. The Oil Red O solution was removed, and the cells washed 12 to 5 times with water until no residual stain was observed under a microscope.
  • RNA extraction and RT-qPCR Total RNA was isolated from 80 % confluent cells grown in 6-well tissue culture plate or on microbeads using a PureNA biospin total RNA extraction kit (Research instruments Pte Ltd), quantified using the Nano Drop (BioDrop pLITE, BioDrop co., UK). The mRNA was converted to complementary DNA (cDNA) with an RNA PCR Kit. A single stranded cDNA equivalent was then subjected to PCR using primers p-actin, integrin 1 , M-cadherin, MyoD1 , Myf5 and Myh7 which were derived from previously published sequences. The PCR mixture, a total volume of 20pl, contained 1 *Go Tag PCR Master Mix, and 0.2 pM of forward and reverse primer and 250 ng/mL cDNA.
  • Proteins separated by SDS-PAGE were analyzed by TripleTOF 5600, and identified using ProteinPilot, searching against a combined database of cRAP protein sequences and UniProt Cucurbita maxima reference proteome. False discovery rate (FDR) analysis was performed on all searches, applying an FDR cut-off of 1 % to remove low quality measurements.
  • FDR False discovery rate
  • SPSS 25 SPSS Inc., Chicago, IL
  • the Duncan test was used for the comparison of mean values among treatments, and to identify significant differences (p ⁇ 0.05) among treatments. Data were expressed as means ⁇ standard deviations of triplicate determinations.
  • Example 1 Characterization of alginate microbeads with plant protein coating
  • Tissue engineering approaches typically involve the transplantation of cells or the induction of host cell migration, with synthetic or natural matrices such as type I collagen, ceramics, and poly(lactide-co-glycolide).
  • synthetic or natural matrices such as type I collagen, ceramics, and poly(lactide-co-glycolide).
  • these materials frequently do not adhere cells in a specific and defined manner and may be incapable of tightly regulating the phenotype of contacting cells during tissue development.
  • Cell adhesion to ligands in the surrounding extracellular matrix (ECM) plays an important role in tissue morphogenesis and cell fusion and thus are often used to promote myoblasts adhesion through their interaction with cell-surface receptors of the integrin family.
  • ECM tissue sources
  • ECM animal gelatins
  • bovine, goat, and rat have been used as tissue sources as ECM.
  • ECM also have been made from human issues such as cadavers.
  • the most common source of ECM is porcine gelatin.
  • animal derived proteins suffer from drawbacks such as high costs for industrial scale operation, risk of viral contamination, and batch to batch variations.
  • Alginate-based microbeads may be used as microcarriers in tissue engineering. Alginate-based microbeads are hydrophilic and have been proven to be effective in encapsulating cells. However, alginate-based microbeads alone may not be suitable for culturing a food product, e.g., cultured meat, due to its poor cytoaffinity arising from a lack of functional groups for interaction with cells, e.g., functional groups that can serve as specific cues for cell adhesion, or functional groups possessed by connective tissues with specific peptides sequences.
  • plant proteins have structural and composition diversity and may contain functional groups to enhance cytoaffinity, e.g., peptide sequences for attachment of cells.
  • Plant proteins may possess bioactive molecules similar to ECM proteins and may function as ECM material to support cell culture.
  • alginate microbeads were functionalized by coating with plant proteins.
  • plant proteins were extracted by isoelectric point precipitation methods and their purities and amino acid profiles were characterized (Table 1 ).
  • the plant proteins studied include soybean, mung bean, red lentil, rapeseeds, pea, chickpea, pumpkin seeds, oat, broad bean, and chia seed.
  • the proteins were extracted such that they are not denatured and have good water solubility needed for coating of the microbeads.
  • the alginate microbeads made by electrospraying were functionalized by coating with plant proteins by physical absorption and cross-linked by genipin, a natural protein cross-linking agent isolated from an edible plant. The coated beads were evaluated for their performance for muscle cell cultures.
  • Table 1 Protein content of 11 types of plant protein.
  • Rapeseed 1 9.39 5.53 51.93 121 80 ⁇ 5.61
  • Rapeseed 2 11.00 5.53 60.83 113.61 ⁇ 0.94 de
  • Alginate microbeads used for coating had clean and smooth surfaces and a diameter of about 200 pm. As shown in FIG. 1 A, plant protein mung bean and soybean coating do not appear even because some black blocks were observed among the beads. Other plant protein coated beads were clearer on their surfaces, suggesting that proteins were coated more evenly on the microbeads.
  • the coatings of proteins were accomplished by impregnating the microbeads in respective solutions of the proteins and fixed by a cross-linking reagent. As a result, the successfully coated microbeads have self-fluorescence due to the fluorophore group formed between genipin and the cross-linked proteins.
  • the beads with fluorescence are an indication of successful coating of the proteins and the intensity of the fluorescence is correlated to the amount of protein being coated on the surface of the microbeads.
  • the self-fluorescence of protein cross-linking by genipin allows the microbeads to be easily distinguished from cells under the fluorescent microscope.
  • pea, oat, chia seed protein coated microbeads have lower amounts of proteins coated.
  • Some protein such as chickpea protein, soy protein and rapeseed protein 2 are evenly distributed on the whole microbeads, while other proteins (mung bean, lentil, rapeseed 1 , pumpkin seed, and broad bean) can only be coated on the surface of the microbeads. Uneven surfaces were observed on mung bean, broad bean and pumpkin protein coated microbeads (FIG. 1 B), and some black spots were found on the microbeads (FIG. 1A). Chickpea, rapeseed, and lentil coated microbeads were similar to that of gelatin coated ones (FIG.
  • the original pH during the coating process was 5.7.
  • the value was adjusted to 5.0, 6.0 and 7.0 to investigate the effect of coating pH on gelatin loading (FIG. 2A and 2D).
  • Coating at the original pH showed the highest protein concentration and fluorescence intensity with little change in size distribution compared with other pH conditions.
  • the naked alginate microbeads had a mean size of 188.7 ⁇ 74.0 pm. Coating led to a smaller size of 159.5 ⁇ 39.8 pm.
  • 10% (w/v) protein led to the highest amount of coating at 293.2 ⁇ 38.4 mg/g, while protein concentrations higher than 10% (w/v) did not lead to any increase of coated protein.
  • a higher coating concentration of 20% (w/v) can lead to a larger size of microbeads and a size distribution width of 0.74 (alginate microbeads is 0.60) (FIG. 2E).
  • 10% (w/v) protein led to a significantly high fluorescent intensity of 721.7 ⁇ 10.8 mg/g.
  • Lowering the coating protein solution concentration to 4% (w/v) led to a decrease of coated protein and fluorescent intensity.
  • 1% (w/v) coating protein can result in a much lower coated protein, protein fluorescent intensity and a smaller beads size of 148.2 ⁇ 37.2 pm.
  • the coating solution was adjusted to 8% (w/v) protein, and it was found that the amount of coated protein, protein fluorescent intensity and beads size can be kept constant with a coating solution of 10% (w/v) protein (FIG. 20 and 2F). However, when the concentration of coating protein solution was lower than 6% (w/v), the coated protein decreased significantly. Therefore, this suggests that the sizes of the beads and the coated protein were mainly due to the amount of protein used.
  • M ice-derived C2C12 is a good model to evaluate the performance of the microbeads.
  • C2C12 cells were seeded on plant protein-coated microbeads to investigate the cytoaffinity of coated plant proteins.
  • C2C12 cells were seeded on microbeads to investigate the cyto-affinities of different plant protein coatings.
  • Cells were grown inside a sterile, ultra-low attachment 24-wel I plate.
  • DMEM complete medium containing serum-free DMEM with 10% fetal bovine serum, and 1 % penicillin-streptomycin was used.
  • Each well contained approximately 0.03 g of coated beads that has a measured density of approximately 0.87 g/cm 3
  • the beads are added together with 0.5 mL of medium.
  • 0.5 mL of medium with a myoblast cell concentration of 2 x 10 4 /mL was inoculated into each well which resulted in a final count of 10 4 /well.
  • the plate was left to incubate at 37 °C in 5% CO2.
  • the concentration of cells was prepared after determining the number of cells in the stock solution via the hemocytometer. Cells were stained with trypan blue for cell counting. For routine maintenance, media were changed every two days by resuspension in fresh medium. Cell morphology was observed using the ECLIPSE Ts2 inverted microscope (Nikon, Tokyo, Japan), at 10 times magnification.
  • FIG. 1A The morphologies of cells on plant-based microbeads were shown in FIG. 1A. After cell seeding, C2C12 cells were attached on mung bean, red lentil, and pumpkin seed protein coated beads and formed clusters on day 1 and grew rapidly and formed larger clusters with beads on day 3. Less C2C12 cells were attached on soybean protein and oat protein coated beads and only several individual cells on microbeads were observed on day 1 , and cell clusters were found on day 3. Nearly no cells were attached on protein broad bean, rapeseed 1 , rapeseed 2, chia seed coated beads on day 1 , and the status was the same for these 4 protein coated beads on day 3.
  • Cell counting was conducted a day after cell seeding after the cells have attached themselves to the microbeads and over the entire duration of its growth at appropriate time intervals. Cell growth and cell counting analysis during the 3- day incubation were done using the CCK-8 in triplicates. Wells are first drained off the remaining medium before the addition of 10 pL of CCK-8 solution and 100 pL of the medium. The wells are then incubated at 37°C for an hour before transferring the CCK-8 solution into a 96 well plate for absorbance reading at 450 nm.
  • FIG. 3A Fold changes of cells during the 3-day culture on microbeads was shown in FIG. 3A.
  • the change was the highest on pumpkin seed protein coated microbeads, followed by red lentil protein, which was similar to the morphology of cells in the brightfield image.
  • the number of cells grown on pumpkin seed protein and gelatin coated microbeads was significantly higher than on other plant protein coated beads (FIG. 3A and 1A).
  • Cells on pumpkin seed protein coated microbeads increased 6.8 folds within 3 days, which is comparable to gelatin coated microbeads (6.6 folds).
  • the beads coated with broad bean, mung bean, lentil, rapeseed 1 and 2 only led to 4-5 folds cell increase, while the beads coated with soybean and pea protein performed the worse with only about 2-fold increase.
  • Chickpea, oat, and chia seed protein coating led to no observable cytoaffinity.
  • Example 4 Correlation between characterization of coated protein and cytoaffinity Proteins extracted from 11 different plant seeds had different protein composition and property (Table 1 ). The protein content was the highest in mung bean protein (93.75%), followed by red lentil, pumpkin seed, soybean, pea, chickpea, broad bean protein. Protein content in rapeseed, oat and chia seed protein were low, ranging from 46.12 to 60.83%. Soluble protein in mung bean, soybean, red lentil, and broad bean protein were significantly higher, more than 320 mg/mL in 4% (w/v) protein solution.
  • soluble proteins were in small variation, ranged from 98.22 ⁇ 14.71 to 162.36 ⁇ 10.16 mg/mL, except for chia seed soluble protein which was 264.00 ⁇ 15.52 mg/mL. However, it was found that the solubility of protein and cytoaffinity has no relationship from FIG. 3B.
  • the content of positively charged amino acid arginine and lysine having a high cell-penetrating ability is shown in Table 2.
  • the content of arginine varies with different plant proteins, and number having a strong relationship with the increase of cell number (FIG. 3C). Lysine contents in all plant protein were almost same, except for oat and chia seed proteins (FIG. 3D).
  • the content of lysine had a weak correlation with cytoaffinity of the beads.
  • the BCA and fluorescence intensity results showed that the pumpkin seed protein was successfully coated on alginate microbeads, and when the coating protein solution was 8% (w/v), a significantly high amount of coated protein content was observed.
  • Example 5 Cell proliferation on microbeads coated with pumpkin proteins
  • the cells on pumpkin seed protein coated microbeads were able to fully cover the beads and the cells connected the adjacent beads forming a cluster on day 5. From day 7 onwards, there were larger cell and microbeads clusters observed. The cell numbers experienced a slightly slower increase from day 5 and reached the max value of 17.2 folds increase on day 7. The cessation of cell growth was observed from day 7 and the cell numbers gradually decreased and stabilized until day 13. The reason for growth arrest is unclear. One possible reason could be that the cells might need some stimulation to keep growing.
  • adipocyte 3T3 cells can also attach on pumpkin seed protein coated microbeads and achieve 8.7-fold increase in cell number, making pumpkin protein coating comparable with gelatin (9-fold increase of 3T3) for culturing adipose tissue.
  • chicken and porcine cells were different when they attached on microbeads. As shown by the arrows, the chicken muscle satellite cells appeared round shape which is a typical characteristic of most satellite cells during the duplicative phase, and the porcine myoblasts typically appeared spindle-shaped, and can cross the adjacent microbeads and fuse into adjacent fibers.
  • microbeads with pumpkin seed protein coating have good cytoaffinity and could be used as a microcarrier for different cell types.
  • tissues grown from C2C12 and 3T3 cells may not be accepted by consumers because of its origin from mice, they are good model cells to evaluate the performance of microbeads due to its fast-growing rates.
  • chicken and porcine cell-based meat may have better acceptance.
  • the results showed that primary porcine myoblasts and chicken muscle satellite cells both had better attachment on the coated microbeads as compared with the cells seeded on naked alginate microbeads.
  • integrin 1 , M-cadherin, MyoD1 , Myf5 and Myh7 in C2C12 were determined by RT-qPCR (FIG. 6A-D). Relative expression levels of integrin 01 and M-cadherin were both significantly higher in C2C12 cells seeded on pumpkin seed protein coated microbeads than the cells grown on a 2D plate. After differentiation, the expressions of MyoD1 and Myf5 in C2C12 cells seeded on pumpkin seed protein coated microbeads were the highest on day 4. The expressions of MyoD1 and Myf5 on microbeads were also significantly higher on day 4 of differentiation than that on a 2D cultured C2C12 cells.
  • the expression level of Myh7 on microbeads was the highest on day 7 and exceeded that of the cells grown on a 2D plate.
  • the confocal images (FIG. 6E) showed that C2C12 cells on 2D plates can fuse during differentiation and some myotubes containing more than one cell nuclei can be observed on day 4 and day 7 of differentiation.
  • C2C12 cells on microbeads can fuse and form fibers during 7 -day differentiation (FIG. 6F).
  • pumpkin seed protein has 4 bands in 20, 37, 40, and 55 kDa, of which the first two bands (P1 20 kDa and P2, 37 kDa) have much higher concentrations (FIG. 7). These two bands and one broad bean band from SDS-page named B1 were subjected to tryptic digestion for proteomic analysis (LC-MS), which detected 18406 fragments from P1 , 19672 spectra for P2, and 26449 for B1 hydrolysates.
  • LC-MS proteomic analysis
  • the identified pumpkin proteins were derived from 11 S globulin, vicilin-like seed storage protein, superoxide dismutase and aspartic proteinase. Most of the peptides were from 11 S globulin with minor variation in sequences. It was suggested that cell adhesion peptides RGD (SEQ ID NO: 1 ) and DGEA (SEQ ID NO: 8) may be responsible for the high cytoaffinity of proteins. Therefore, a search was conducted for peptide fragments in pumpkin seed protein and it was found that a few peptides containing cell adhesion peptides were identified from P1 (nine) and P2 (ten), respectively. For example, the four peptide sequences containing such units:
  • LVYWDGEANFQISDDYGNQVFNER (SEQ ID NO: 16) are found in both P1 and P2.
  • the identified broad bean proteins were derived from elongation factor 1 - alpha, ATP synthase subunit alpha, glucose-1 -phosphate adenylyltransferase, convicilin and others.
  • Two peptides containing cell adhesion peptides RGD were from ATP synthase subunit alpha.
  • the two peptides WDALGVPIDGR (SEQ ID NO: 18) and ELIIGDR (SEQ ID NO: 19) may have contributed to the cyto-affinity of broad bean protein as well because both RGD (SEQ ID NO: 1 )- and DGR (SEQ ID NO: 3)-containing peptides have been demonstrated to compete with adhesive proteins for integrin interaction.
  • most identified peptides from broad bean containing arginine were located in the C-terminal of peptides.
  • VICFA subunit alpha SEQ ID NO: 18
  • Table 4 Broad bean protein containing arginine.
  • VICFA subunit alpha SEQ ID NO: 56
  • pumpkin seed proteins have relatively poor solubility as compared to other proteins, it is sufficient to achieve coating of microbeads that exhibited the best performance as ECM materials for cell culture.
  • SDS- PAGE bands the isolated pumpkin seed proteins showed two major bands in 20 and 37 kDa, which are characteristic 11 S proteins consisting of an acidic polypeptide (27-37 kDa) and a basic polypeptide (20-24 kDa) linked by a disulfide bond.
  • Some fibroblast growth factors such as ECGF, aFGF, and (HBGF)-1 are acidic polypeptide, the band around 37 kDa might be an important part for cell growth.
  • transduction domains or membrane translocation signals contain positively charged amino acid residues such as arginine and lysine, which may have a high cell-penetrating ability.
  • Lysine content in pumpkin seed protein was close to that of other plant proteins, the high arginine content is a prerequisite for its superior cytoaffinity.
  • Arginine is a positively charged amino acid, and is the initial amino acid of cell adhesion tripeptide RGD (SEQ ID NO: 1).
  • RGD cell adhesion property
  • IKVAV SEQ ID NO: 6
  • YIGSR SEQ ID NO: 7
  • DGEA SEQ ID NO: 8
  • PHRSN SEQ ID NO: 9
  • PRARI SEQ ID NO: 10
  • the RGD and DGEA sequences were found in pumpkin seed proteins. These cell-binding peptide sequences could couple with integrin receptors and activate on osteoblast gene expression. The higher cell attachment ability of pumpkin seed protein might be caused by higher peptide sequences containing RGD units.
  • gelatin also contains good amount of RGD peptides.
  • broad bean protein coated microbeads had poor cytoaffinity.
  • DGR DGR
  • plant proteins (chickpea, mung bean, soybean, and pea protein) powders were purchased from Yantai T. Full Biotech Co., Ltd. These plant proteins were used to prepared 4% (w/v) protein solution by dissolving in water as coating solution using the protocol described in the Methods section.
  • pea protein coating was not even because some black blocks were observed among the microbeads. Other plant protein coated beads were much clearer on the surface, suggesting that proteins were coated more evenly on the microbeads.
  • the fold change in cell number based on Cell Counting Kit-8 was around 2.5 on plant protein chickpea, mung bean and pea protein coated microbeads (FIG. 8B).
  • the cells number was nearly not changed after 7-day culture on soy protein coated microbeads. Similar to the result in the brightfield microscope image, the cells displayed little growth after seven days.
  • C2C12 cells with a density of 10 4 /mL were seeded on microbeads to investigate the cytoaffinity of different plant protein coating by referring to the above method.
  • the fold change of cells during 3-day culture on microbeads is shown in FIG. 8C. Similar to the primary porcine myoblasts seeding results, there was little change in the cell number.
  • Alginate microbeads have clean and smooth surfaces without any fluorescence. Coating was accomplished by impregnating the microbeads in the respective protein hydrolysates and fixed by a cross-linking reagent genipin. Well coated microbeads will display a dark blue color due to the chromophore formed by the cross-linking agent and amino acid residue of proteins.
  • the blue color indicates that proteins were successfully coated onto the microbeads.
  • beads were shown to be coated with evenly distributed proteins coatings on the outer layer.
  • broad bean protein hydrolysate not only coated onto the beads but also formed big protein aggregates by themselves.
  • the morphology of beads may differ according to the variety of protein hydrolysate coated.
  • alginate microbeads were about 200 pm in diameter. After coating with the protein hydrolysates, the diameter of microbeads decreased to 160 to 170 pm (Table 5).
  • the autoclaved microbeads were incubated in cell culture media at 60 °C for 3 days to determine the stability of the beads. Uncoated alginate microbeads swelled a little after immersing into media initially, but they shrunk significantly after 3 days. Other microbeads with unstable or thin coating exhibited the same behavior as well. As shown in Table 5, soybean, chickpea, pumpkin, rapeseed protein hydrolysis coated microbeads have no significant difference in size after the 3-day incubation in culture media, indicating that the beads are physically stable.
  • Rapeseed 2 162.41 ⁇ 8.87 a 185.17 ⁇ 9.30 b 181 .32 ⁇ 13.70 b
  • No treatment means microbeads kept in storage solution; DO means microbeads immersed in media at room temperature within 1h; D3 means microbeads immersed in media at 60°C for 3 days. Data are expressed as means ⁇ standard deviation of samples. Different lowercase letters in same row represent significant differences (p ⁇ 0.05).
  • C2C12 cells were seeded on plant protein coated microbeads to investigate the cytoaffinity of 9 types of plant proteins.
  • Cell growth during a 3-day incubation was monitored by CCK8. After the 3-day culture, the number of cells grown on chickpea hydrolysate was significantly higher than on other hydrolysates coated beads (FIG. 10A-F).
  • cells on chickpea protein hydrolysate coated microbeads have the highest increase of 8.5 folds, followed by 7.4 folds on red lentil hydrolysate, both were higher than that of pumpkin seed protein coated microbeads (6.6 folds).
  • soybean and rapeseed 1 protein hydrolysates displayed only slight improvements in cytoaffinity after hydrolysis, while the hydrolysis of the other proteins led to lower cell proliferation.
  • the results demonstrate that chickpea protein hydrolysate outperformed the rest and therefore was selected to carry out in-depth study to understand the reason behind its superior cytoaffinity.
  • FIG. 10A showed that the cytoaffinity of chickpea protein was improved as CPH coating has helped to enhance cell proliferation to a considerable extent.
  • Hydrolysis helps to expose arginine to cells and, therefore, enhanced the cytoaffinity of chickpea protein coating on microbeads. Positively charged lysine is also exposed during trypsin hydrolysis. However, the lysine content only has a weak correlation with cytoaffinity.
  • the cytoaffinity of other protein hydrolysis did observe the same correlation after trypsin treatment. Therefore, the enhanced cytoaffinity observed may not only be attributed to the increase in positively charged amino acids, but also other factors as well.
  • RGD-containing peptides having cell adhesion motif can be exposed during trypsin treatment.
  • arginine is the initial amino acid of cell adhesion peptide RGD.
  • a search on UniProt was conducted to find RGD- containing peptides in the 9 plant proteins (Table 6), respectively. It was found that rapeseed has the maximum number of RGD-containing peptides of 7066 in types, although most are hypothetical peptides. Soybean has 4122 RGD- containing peptides, of which 17 having been reported.
  • Vigna radiata var. radiata (Mung RGD 2051 0 bean) (SEQ ID NO: 1)
  • Glycine max Soybean
  • RGD 4105 17 Lens culinaris (Lentil) (Cicer lens')
  • Vicia faba (Broad bean) (Faba RGD 17 3 vulgaris)
  • Cicer arietinum (Chickpea) RQSHFANAQP 3
  • Example 11 Correlation between degree of hydrolysis and cytoaffinity The results in Example 10 suggest that enzymatic hydrolysis of chickpea protein could release its potential for cytoaffinity. It is believed that the degree of hydrolysis could affect the performance of the resulting protein hydrolysates.
  • hydrolysis of the proteins was conducted with different trypsin and protein ratios to achieve different DH. The hydrolysis was firstly carried out with varying E/S% of 0.1 %, 0.5%, 1 %, 3%, and 5% with the duration being fixed at 120 minutes.
  • DH which is defined as the proportion of the number of peptide bonds being broken in protein hydrolysis was determined after the completion of hydrolysis. Based on the result of DH analysis (FIG. 10B), it was observed that when
  • E/S% increased from 0.1 % to 5%
  • DH increased from 3.5 ⁇ 0.1 to 7.0 ⁇ 0.2 %.
  • the hydrolysis was conducted with an E/S% of 0.5% and the rest of the conditions were held constant. At the 5-, 15-, 30-, 60-, and 120-min mark, the hydrolysate was withdrawn to deactivate the enzymes and to determine the DH. It was established that DH only increased from 1.5 ⁇ 0.2 for 5 minutes hydrolysis to 4.5 ⁇ 0.1 % for a 60-minute hydrolysis and entered a stationary phase beyond 60 minutes as the DH did not vary significantly with longer durations of hydrolysis (FIG. 10C), indicating the trypsin has completed the hydrolysis with selected peptide bonds that contain positive a ino acid residues (Arg and Lys).
  • adipose cells 3T3-L1 were seeded on microbeads with hydrolysates of differing DH as well.
  • 3T3 cell proliferation increment rose from 2.3-folds to 7.1 -folds when DH is increased from 1 .5 to 3.5%.
  • DH is increased to 4.5 % and above
  • cell proliferation reduced to around 3.4-folds, and did not increase further.
  • Example 12 Alginate microbeads with plant protein hydrolysate coating
  • the resultant hydrolysates were centrifuged to remove the insoluble peptides and the supernatant was used for coating.
  • the alginate beads immersed into the coating solution (w/v of 1/3) were immediately vortexed and then agitated using a shaker (Rotamax 120, Heidolph instruments GmbH & Co. KG, Germany) at a speed of 150 rpm. After coating for 2 h, microbeads were collected by a cell strainer then washed with water for 3 times.
  • the coated alginate microbeads were cross-linked by immersing in a 1 mg/mL genipin solution with a ratio of 1 :4 (beads: genipin solution, w/v) and shaken at 150 rpm in a 60 °C water bath (SW22, Julabo USA Inc., Allentown, PA, USA) for 3 h, then collected and washed with DI water for 3 times after cross-linking.
  • the modified microbeads were stored in 0.1 M CaCl2 solution at a concentration of 0.2 g beads/mL, before being autoclaved and collected by the cell strainer for cell culture.
  • BCA protein assay was also conducted for microbeads coated with different hydrolysis duration. Based on FIG. 13B, the protein adhered to the microbeads was the highest for 2 hours of hydrolysis which gave a value of 17.52 ⁇ 1.25 mg/g. However, it decreased significantly to 4.22 ⁇ 1.00 mg/g when hydrolysis was beyond 8 hours. This shows that the optimum DH to achieve the highest amount of protein coated on beads could be 5.61 ⁇ 0.18 %, any DH above this may have a negative correlation with protein concentration coated on the beads.
  • Microscope images of cell morphology correspond with the results shown in FIG. 14 as cell growth was the highest on microbeads coated by protein hydrolysis with DH of 5.61 %. DH beyond 6%, led to a negative correlation with cell growth. This can be observed in FIG. 15 at day seven, where cells are completely detached from the beads. This shows that the desorption of protein from the beads discourages cell adhesion.
  • Example 11 Optimization of coating process
  • Protein adsorption on solid surfaces generally increases with temperature, and the thickness of protein layers is enhanced with elevated temperature. Hence, the coating was determined to take place over the temperature range of 4 °C to 60 °C which is below the protein denaturation temperature to prevent the destruction of the functional properties of peptides.
  • the amount of protein (2.53 ⁇ 0.74 mg/g) coated on the beads is significantly lower when compared to coating at 60 °C (16.23 ⁇ 0.36 mg/g). Therefore, the BCA results were in line with the study and 60 °C was found to encourage protein adsorption on the alginate beads (FIG. 16B).
  • FIG. 16D shows that as protein concentration increases, q(%) decreases. Since q% refers to the volume at each particle size (frequency distribution), this reduction means that there will be fewer beads in the desired particle size intervals for cell seeding, which is not optimal.
  • the median diameter ranged from 124.5 ⁇ 0.95 pm to 111 .5 ⁇ 0.4 pm for beads coated with 5% to 20% protein. However, it decreased to 54.5 ⁇ 2.30 pm for beads coated with 30% protein.
  • Example 12 Cell proliferation on microbeads with chickpea hydrolysate (CPH)
  • a density of 3x10 3 /mL C2C12 cell were seeded on CPH with DH 3.5% coated microbeads.
  • the cell growth during a 15-day incubation was monitored by CCK8 and confocal imaging.
  • the confocal images showed that there were only a few cells attached on the microbeads on day 1 (FIG. 18A).
  • the self-fluorescent microbeads were hard to observe due to the weak fluorescence.
  • On day 3 more cells were found on the surface of the coated microbeads, with some connected to the adjacent microbeads together forming small clusters. From day 5 onwards, it was observed that there were larger clusters formed by cells and microbeads.
  • the center of the clusters has less F-actin stain though many blue colored nuclei were observed. This may be due to the limited space in the center of the clusters for the cells to expand.
  • the cell numbers experienced a sharp increase in the first 3 days, followed by a period of slower growth from day 3 to day 7 before a rapid increase to reach the maximum value of 15.3-folds on day 9 (FIG. 18D).
  • a decrease in cell number was observed from day 9 until day 15.
  • Primary porcine myoblasts and chicken muscle satellite cells were seeded on CPH coated microbeads as well. The porcine cell numbers were almost constant during the first 3 days before experiencing a rapid increase (FIG. 18D).
  • CPH coated microbeads To expand the scope of the CPH coated microbeads on other types of cells, 3x10 3 /mL 3T3 cells were seeded on the beads. Cell growth during a 15- day incubation was monitored by CCK8 and confocal imaging. Few 3T3 cells were observed on day 1 and day 3. On day 5, more cells were found on the surface of the coated microbeads (FIG. 18E). The cell growth was observed on the entire surface of the microbeads, which also extended to the adjacent beads, forming clusters since day 5. A sharp increase in cell number was observed from day 3 to day 7, consistent with the cell status in confocal images (FIG. 18E). Cessation of cell growth was observed from day 7 when the cell number increased to the maximal value of 15.7 folds. Therefore, CPH coated microbeads not only can be used in the culture of muscle cells but also adipocyte cells and may potentially be applied in cell-based meat containing muscle and fat tissues.
  • Example 13 Cell differentiation on chickpea protein hydrolysate coated microbeads
  • Desmin is a subunit protein of intermediate filaments in muscle tissue known to be at low concentration within replicating myoblasts and satellite cells while high in differentiated myotubes. Expression of desmin in cells on microbeads was detected by immunostaining to determine cell differentiation.
  • the confocal images in FIG. 19A showed that during cell differentiation on a 2D plate, C2C12 cells can fuse together to form myotubes.
  • the green fluorescence of stained desmin was the highest on day 4, and some myotubes containing more than one cell nucleus can be observed on day 7 of differentiation.
  • C2C12 cells on microbeads can fuse and form fibers during a 7- day differentiation period as well.
  • gelatin coated microbeads are promising microcarriers for muscle cells proliferation and differentiation, as gelatin coated material retains cell-binding motifs such as RGD and MMP-sensitive degradation sites, which are important in successful cell adhesion.
  • C2C12 cells on gelatin coated microbeads can start differentiating even on day 1 and are concentrated in the outer layers of the clusters (FIG. 19B).
  • C2C12 cells on CPH coated microbeads achieved the greatest degree of differentiation on day 4 (FIG. 19C).
  • Primary porcine myoblasts (FIG. 19D) and chicken muscle satellite cells (FIG. 19E) also started to differentiate on day 4 as confirmed by the presence of desmin.
  • CPH coated microbeads could potentially be used as a substrate in supporting several types of cell differentiation.
  • CPH is edible and biodegradable, thus CPH-based microcarriers or scaffolds can be embedded in the final product or dissolved during the bioprocess.
  • Using CPH to replace animal derived gelatin can eliminate concerns of zoonotic infections, growth factor contamination as well as batch -to-batch variation.
  • Example 14 Amino acid analysis of chickpea protein hydrolysates
  • Chickpea proteins and three treated hydrolysates were subjected to free amino acid analysis.
  • chickpea proteins CP
  • chickpea proteins treated with carboxypeptidase B CP + C
  • chickpea protein treated with trypsin CP+T
  • only a few amino acids, histidine, lysine, and arginine were detected at low concentrations for lysine and arginine ranging from 56.58 to 226.48 pM.
  • carboxypeptidase B treatment lysin and arginine dramatically increased to 2040 and 3502 pM, respectively (FIG. 20A).
  • the four protein solutions were subsequently used for microbeads coating, after which, the coated microbeads were seeded with C2C12 cells to compare the cytoaffinity with commercial microcarriers Cytodex-1.
  • CP+T showed significantly higher cell fold change than other coatings and Cytodex-1 , indicating the high cytoaffinity of CPH and is able to outweigh Cytodex-1 .
  • the results showed that commercial microcamers and scaffolds may have limited cytoaffinity for muscle cells (FIG. 20B).
  • the results demonstrated the importance of peptides containing lysine/arginine/histidine terminal units for cytoaffinity of the chickpea protein hydrolysates.
  • carboxypeptidase B was used to further hydrolyse the trypsin hydrolysates.
  • Carboxypeptidase B can release C- terminal lysine and arginine which are exposed by trypsin treatment.
  • the results of the amino acid analysis proved that the trypsin hydrolysis released plenty of C-terminal lysine and arginine.
  • the cell proliferation result showed that the high proliferation of C2C12 is due to the increased in cytoaffinity of CPH treated by trypsin alone which is related to the exposure of lysine or arginine.
  • 3T3 cells were able to attach on CPH coated microbeads and achieved a 15.6-fold increase in cell number, which is higher than cell growth achieved by the gelatin coating (9-fold increase of 3T3).
  • CP+T+C and the positively charged Cytodex-1 both had the comparable cell proliferation as well as CP+T (FIG. 20C).
  • the cytoaffinity of adipocyte cells may not be solely related to the C-terminal lysine and arginine released by trypsin. It has been reported that a higher 3T3 cell proliferation rate can be achieved after treatment with silk fibroin hexapeptide GAGAGS (SEQ ID NO: 12).
  • Some selected plant proteins were subjected to enzymatic hydrolysis.
  • the resultant hydrolysates were centrifuged to remove the insoluble peptides and the supernatant was used for coating.
  • the resultant cell growths using the respective coated beads are as shown in FIG. 11 .
  • CPC Chickpea cystatin
  • PPI pea protein isolate
  • plant proteins may not be accessible to interact with cells on the microbeads.
  • enzymatic hydrolysis is practised in food and pharmaceutical industries because it can be conducted under mild controlled conditions (pH, temperature, substrate concentration, and enzyme activity), high specificity and the absence of residual organic solvents and toxic chemicals in the final peptide composition.
  • Some common enzymes such as papain, alcalase, and flavorzyme, have a broad specificity, hence they could have led to the production of shorter chain peptides and free amino acids (Table 7).
  • trypsin has only two cleavage sites- Arg and Lys.
  • the results in FIG. 11 and 12 showed that trypsin hydrolysis led to a higher growth of primary porcine cells.
  • there is negligible growth for microbeads coated with hydrolysates produced via hydrolysis with papain (FIG. 11 ). Therefore, the results showed that selective hydrolysis with trypsin could release the RGD unit due to its high selectivity.
  • Protein coating on microbeads was achieved through immersion in protein solutions followed by immobilization using cross-linking agents.
  • cross-linking agents such as glutaraldehyde and diacetyl, which are not derived from plants, possess two aldehyde groups capable of forming Schiff's bases with amino groups of proteins, resulting in protein cross-linking through carbon atoms in the middle.
  • Plant-based cross-linker genipin which is a commonly used biomaterial, could bring unpleasant blue color in products, and may not be desirable in cultured meat application.
  • Duration and temperature of the coating exhibited minimal influence on protein loading. Higher amounts of coated protein were achieved at elevated temperatures ranging from 50 °C to 60 °C. Hence, a coating temperature of 50 °C was chosen, which also corresponds to the optimal temperature for TGase enzyme activity.
  • TGase when utilized as a protein cross-linking agent, demonstrates the ability to effectively cross-link proteins on microspheres, resulting in a relatively high preservation rate, according to the result.
  • Example 17 Effect of TGase concentration on protein retention
  • cross-linkers such as TGase
  • TGase is advantageous for the long-term storage of pumpkin seed protein-alginate microbeads.
  • excessive use of cross-linkers can result in over-crosslinking, leading to protein modification or deformation of the beads. Therefore, the impact of varying TGase concentrations on the cross-linking ability of the microbeads was investigated (FIG. 22A), and subsequent BCA assays were performed to assess protein retention rates during different storage durations (FIG. 22B).
  • the protein content on the surface of microbeads in the uncross-linked sample decreased by nearly a half, from 1.04 ⁇ 0.03 mg/mL to 0.72 ⁇ 0.08 mg/mL.
  • the protein retention rate of microbeads did not decrease significantly, remaining at 1.42 ⁇ 0.06 mg/mL and 1.41 ⁇ 0.03 mg/mL.
  • Increasing the concentration of TGase did not significantly increase the amount of protein retention.
  • the protein content was still 1 .29 ⁇ 0.05 mg/mL, which was not significantly different from the values obtained at 10 U/mL (1.28 ⁇ 0.22 mg/mL) and 3 U/mL (1 .37 ⁇ 0.06 mg/mL).
  • Example 18 Effect of concentration of cross-linker on the size and morphology of microbeads Upon microscopic examination, it was observed that the pumpkin seed protein has undergone successful cross-linking with the sodium alginate microspheres, as manifested by a darker and opaque appearance (FIG. 23B) compared to the uncross-linked microbeads (FIG. 23A), due to the attachment of proteins to its surface. It was observed that as the amount of cross-linking agent increases, some microspheres exhibited an excessive accumulation of crosslinked proteins, and are not in a uniform distribution (FIG. 23C). This uneven protein distribution may potentially exert unfavorable effects on cell culture and growth in these microspheres. A smaller amount of cross-linker may facilitate the cross-linking of an optimal amount of protein to the microspheres, sufficient to support cell growth while avoiding the overloading of proteins on the microspheres.
  • Alginate microbeads used for coating had clean and smooth surfaces and diameter and an initial diameter of about 200 pm. Intuitively, the microbeads are expected to become larger after the pumpkin seed protein coating. However, in this example, it was observed that the mean diameters of pumpkin seed protein- coated beads became smaller using different concentrations of TGase as crosslinker.
  • Embodiments of the disclosure provide a microcarrier, a method of making a microcarrier, a system for producing a cell cultured food product and a method of producing a cell cultured food product.
  • the microcarrier may provide a cost-effective alternative to commercial microcarriers.
  • Commercial microcarriers or scaffolds for cell culture are fabricated by synthetic and inedible plastics and not ideal for commercial production of cell-based meat.
  • the application of food grade (or edible) microbeads with plant protein coatings are attractive as microcarriers because there is no need to separate the grown cells from the carriers.
  • the use of plant-based materials in place of animal-derived materials may help to reduce the concern of spreading infectious diseases, growth factor contamination as well as batch -to-batch variation.
  • cultured meat may be identical to real meat both in nutritional composition and appearance.
  • Using food grade material for microbeads fabrication can lower the cost, and upscale anchorage-dependent mammalian cells.
  • embodiments of the microcarrier may have the potential to be used in different meat culture for culturing cells from pig, chicken, cows and even shrimps.

Landscapes

  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Biomedical Technology (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Cell Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Rheumatology (AREA)
  • Nutrition Science (AREA)
  • Food Science & Technology (AREA)
  • Polymers & Plastics (AREA)
  • Dispersion Chemistry (AREA)
  • Apparatus Associated With Microorganisms And Enzymes (AREA)

Abstract

There is provided a microcarrier, a method of making a microcarrier, a system for producing a cell cultured food product and a method of producing a cell cultured food product, the microcarrier comprising, a core particle; and a coating layer disposed on a surface of the core particle; wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.

Description

A MICROCARRIER, A METHOD OF MAKING A MICROCARRIER, A SYSTEM FOR PRODUCING A CELL CULTURED FOOD PRODUCT AND A METHOD OF PRODUCING A CELL CULTURED FOOD PRODUCT
TECHNICAL FIELD
The present disclosure relates broadly to a microcarrier, a method of making a microcarrier, a system for producing a cell cultured food product and a method of producing a cell cultured food product.
BACKGROUND
Conventional animal-based farming practices have raised significant sustainability and global warming concerns due to their carbon footprint, environmental, social, and economic impacts. Some of the concerns associated with conventional animal-based farming practices include animal welfare, greenhouse gas emissions, land use and deforestation, water usage, food security and safety, energy consumption and the associated carbon footprint. To address these sustainability and global warming concerns, there is a growing interest in alternative food production methods.
Cell-based meat (CBM), also termed cultured meat, is an emerging technology which aims to manufacture meat at commercial scale directly from cell culture in a controlled environment. CBM may provide a sustainable and ethical alternative to traditional meat production. It has the potential to address many of the environmental and ethical concerns associated with conventional animal agriculture while providing consumers with a familiar and nutritious source of protein. However, there are many technological hurdles to overcome before CBM can be economically competitive with conventional meat to make an impact to the food supply.
Two-dimensional (2D) systems have been used to produce cultured meat in laboratories. In 2D systems, tissue culture flasks or petri dishes are used as an adherent mechanical support for cells. However, a major drawback of a 2D culture is the limited space for proliferation. In addition, cells that are randomly grown on a 2D surface hardly communicate with one another and there is barely any cell-matrix interactions, resulting in slower proliferation, limited differentiation, and failure to form cohesive tissue features, such as tubular and cyst structures, typically found in epithelial tissues.
Three-dimensional (3D) systems have also been used to produce cultured meat in laboratories. For example, microcarriers may be used to provide anchorage for cells to adhere to and proliferate in a 3D environment. The large surface to volume ratio in microcarriers may facilitate scaling up for industrial production. However, one of the difficulties faced in designing microcarriers is the lack of functional groups with high cytoaffinity and recognition. Microcarriers have been coated with RGD-containing materials such as gelatin to promote cell attachment and proliferation. However, the use of animal derived proteins for cellbased meat culture is not feasible for industrial scale operation because of their high costs, risk of viral contamination, and batch to batch variations.
Thus, there is a need for a microcarrier, a method of making a microcarrier, a system for producing a cell cultured food product and a method of producing a cell cultured food product, which seek to address or at least ameliorate one of the above problems. SUMMARY
In one aspect, there is provided a microcarrier comprising, a core particle; and a coating layer disposed on a surface of the core particle; wherein the core particle and coating layer comprise one or more materials derived from plantbased sources.
In one embodiment of the microcarrier as disclosed herein, the core particle is a hydrogel-based particle.
In one embodiment of the microcarrier as disclosed herein, the core particle comprises one or more materials selected from the group consisting of alginate, cellulose, chitosan, gum, hemicellulose, lignin, pectin, soy, starch, and zein.
In one embodiment of the microcarrier as disclosed herein, the coating layer comprises a protein or a protein hydrolysate.
In one embodiment of the microcarrier as disclosed herein, the protein hydrolysate has a degree of hydrolysis of from 1 % to 30%.
In one embodiment of the microcarrier as disclosed herein, the coating layer comprises at least 3 amino acids selected from the group consisting of arginine, histidine, aspartic acid, glutamic acid, proline, serine, glycine, and alanine.
In one embodiment of the microcarrier as disclosed herein, the coating layer comprises amino acid sequences selected from the group consisting of RGD (SEQ ID NO: 1 ), IKVAV (SEQ ID NO: 6), YIGSR (SEQ ID NO: 7), DGEA (SEQ ID NO: 8), PHRSN (SEQ ID NO: 9), PRARI (SEQ ID NO: 10), permutations thereof or sequence order variations thereof. In one embodiment of the microcarrier as disclosed herein, the coating layer is coupled to the core particle via a cross-linker.
In one embodiment of the microcarrier as disclosed herein, the cross-linker comprises a natural cross-linker selected from the group consisting of flavanones, genipin, quercetin, tannic acid and transglutaminase.
In one embodiment of the microcarrier as disclosed herein, the coating layer exhibits self-fluorescence.
In one embodiment of the microcarrier as disclosed herein, the plantbased sources include one or more selected from the group consisting of broad bean, chickpea, chia seed, com, lentil, mung bean, oat, pea, pumpkin seed, rapeseed, rice, soybean, wheat, and winter squash.
In another aspect, there is provided a method of making a microcarrier, the method comprising, providing a core particle; and forming a coating layer on a surface of the core particle to obtain the microcarrier, wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.
In one embodiment of the method as disclosed herein, providing the core particle comprises electrospraying a precursor solution to form the core particle in the form of a microbead.
In one embodiment of the method as disclosed herein, forming the coating layer comprises immersing the core particle in a coating solution comprising a protein or a protein hydrolysate.
In one embodiment of the method as disclosed herein, prior to forming the coating layer, the method further comprises preparing the coating solution comprising the protein hydrolysate. In one embodiment of the method as disclosed herein, the protein hydrolysate has a degree of hydrolysis of from 1 % to 30%.
In one embodiment of the method as disclosed herein, preparing the coating solution comprising the protein hydrolysate comprises hydrolyzing a protein using an enzyme-substrate concentration (E/S%) of from 0.1 % to 50%.
In one embodiment of the method as disclosed herein, the method further comprises immersing the core particle coated with the coating layer in a crosslinking solution.
In one embodiment of the method as disclosed herein, the cross-linker comprises a natural cross-linker selected from the group consisting of flavanones, genipin, quercetin, tannic acid, and transglutaminase.
In another aspect, there is provided a system for producing a cell cultured food product, the system comprising, a population of cells; and a plurality of microcarriers configured to allow the population of cells to be grown thereon; wherein the microcarrier comprises a core particle and a coating layer disposed on a surface of the core particle; and wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.
DEFINITIONS
The term “microcarrier” as used herein is to be interpreted broadly to refer to a discrete particle with physical dimensions in the order of micrometers, which is suitable for carrying a target agent, e.g., cells. For example, the microcarrier may be suitable for use in culturing cells by providing a substrate or scaffold onto which cells may attach. Microcarriers may be in any suitable shape, such as a sphere, hemisphere, ellipsoid, rod, disk and the like. In various embodiments, the physical dimensions include but are not limited to length, width, thickness, diameter and the like. In various embodiments, the micrometer order of magnitude is defined as not more than about 1000 pm, not more than about 950 pm, not more than about 900 pm, not more than about 850 pm, not more than about 800 pm, not more than about 750 pm, not more than about 700 pm, not more than about 650 pm, not more than about 600 pm, not more than about 550 pm, not more than about 500 pm, not more than about 450 pm, not more than about 400 pm, not more than about 350 pm, not more than about 300 pm, not more than about 250 pm, not more than about 200 pm, not more than about 150 pm, not more than about 100 pm, not more than about 50 pm, not more than about 40 pm, not more than about 30 pm, not more than about 20 pm, or not more than about 10 pm.
The term “core particle” as used herein is to be interpreted broadly to encompass both solid and semi-solid particles e.g., gel-like particles. The core particle may be in any suitable shape, such as a sphere, hemisphere, ellipsoid, rod, disk and the like.
The term “coating layer” as used herein is to be interpreted broadly to encompass a layer of material that is at least partially covering a target surface e.g., surface of the core particle or part thereof.
The term “hydrogel" as used herein is to be interpreted broadly to refer to three-dimensional cross-linked polymer networks, which can absorb and retain a relatively large amount of water.
The term “microbead” as used herein is to be interpreted broadly to refer to a bead or particle of any material having dimensions of from about 1 pm to about 1000 pm.
The term “substrate” as used herein is to be interpreted broadly to refer to any supporting structure. The term “layer” when used to describe a first material is to be interpreted broadly to refer to a first depth of the first material that is distinguishable from a second depth of a second material. The first material of the layer may be present as a continuous film, as discontinuous structures or as a mixture of both. The layer may also be of a substantially uniform depth throughout or varying depths. Accordingly, when the layer is formed by individual structures, the dimensions of each of individual structure may be different. The first material and the second material may be same or different and the first depth and second depth may be same or different.
The term “continuous” when used to describe a film or a layer is to be interpreted broadly to refer to a film or a layer that is substantially without gaps or holes or voids across the film or layer. In this regard, a continuous film or a continuous layer is also intended to include a film or a layer that may have trivial gaps or holes or voids that may not appreciably affect the desired properties of the film or the layer.
The term “biocompatible” as used herein is to be interpreted broadly to refer to the ability of a material to perform its intended function without inducing significant inflammatory response, immunogenicity, or cytotoxicity to native cells, tissues, or organs.
The term “biodegradable” as used herein is to be interpreted broadly to refer to a material that is capable of being broken down physically and/or chemically within the body of a subject by the action of living things (such as microorganisms), e.g., by hydrolysis under physiological conditions, by natural biological processes such as the action of enzymes present within the body, etc., to form smaller chemical species which can be metabolized and/or excreted.
The term “cytoaffinity” is to be interpreted broadly as an affinity to cells, e.g., an affinity of a material or structure to cells. The term “cytotoxic” as used herein is to be interpreted broadly to refer to the ability of a compound or process to disrupt the normal metabolism, function and/or structure of a cell.
The term “food grade" as used herein is to be interpreted broadly to refer to any substance that is approved for human consumption by a relevant authority in a jurisdiction, e.g., the Food and Drug Administration (FDA) in the U.S. and the Singapore Food Agency in Singapore.
The term “micro" as used herein is to be interpreted broadly to include dimensions from about 1 micron to about 1000 microns.
The term “nano" as used herein is to be interpreted broadly to include dimensions less than about 1000 nm.
The term “particle” as used herein broadly refers to a discrete entity or a discrete body. The particle described herein can include an organic, an inorganic or a biological particle. The particle used described herein may also be a macroparticle that is formed by an aggregate of a plurality of sub-particles or a fragment of a small object. The particle of the present disclosure may be spherical, substantially spherical, or non-spherical, such as irregularly shaped particles or ellipsoidally shaped particles. The term “size” when used to refer to the particle broadly refers to the largest dimension of the particle. For example, when the particle is substantially spherical, the term “size” can refer to the diameter of the particle; or when the particle is substantially non-spherical, the term “size” can refer to the largest length of the particle.
The terms “coupled” or “connected” as used in this description are intended to cover both directly connected or connected through one or more intermediate means, unless otherwise stated. The term “associated with”, used herein when referring to two elements refers to a broad relationship between the two elements. The relationship includes, but is not limited to a physical, a chemical or a biological relationship. For example, when element A is associated with element B, elements A and B may be directly or indirectly attached to each other or element A may contain element B or vice versa.
The term “adjacent” used herein when referring to two elements refers to one element being in close proximity to another element and may be but is not limited to the elements contacting each other or may further include the elements being separated by one or more further elements disposed therebetween.
The term “and/or”, e.g., “X and/or Y” is understood to mean either “X and Y” or “X or Y” and should be taken to provide explicit support for both meanings or for either meaning.
It will be appreciated that for use of substantially any singular and/or plural terms herein, those skilled in the art will be able to interpret the plural in the singular and/or the singular in the plural as appropriate to the context and/or application. Various singular/plural alterations may be expressly set forth herein for clarity. The singular (“a” or “an”) does not exclude the plural.
Further, in the description herein, the word “substantially” whenever used is understood to include, but not restricted to, “entirely” or “completely” and the like. In addition, terms such as “comprising", “comprise”, and the like whenever used, are intended to be non-restricting descriptive language in that they broadly include elements/components recited after such terms, in addition to other components not explicitly recited. For example, when “comprising” is used, reference to a “one” feature is also intended to be a reference to “at least one” of that feature. Terms such as “consisting”, “consist”, and the like, may in the appropriate context, be considered as a subset of terms such as “comprising”, “comprise”, and the like. Therefore, in embodiments disclosed herein using the terms such as “comprising”, “comprise", and the like, it will be appreciated that these embodiments provide teaching for corresponding embodiments using terms such as “consisting”, “consist”, and the like. Further, terms such as “about”, “approximately” and the like whenever used, typically means a reasonable variation, for example a variation of +/- 5% of the disclosed value, or a variance of 4% of the disclosed value, or a variance of 3% of the disclosed value, a variance of 2% of the disclosed value or a variance of 1 % of the disclosed value.
Furthermore, in the description herein, certain values may be disclosed in a range. The values showing the end points of a range are intended to illustrate a preferred range. Whenever a range has been described, it is intended that the range covers and teaches all possible sub-ranges as well as individual numerical values within that range. That is, the end points of a range should not be interpreted as inflexible limitations. For example, a description of a range of 1% to 5% is intended to have specifically disclosed sub-ranges 1 % to 2%, 1 % to 3%, 1 % to 4%, 2% to 3% etc., as well as individually, values within that range such as 1 %, 2%, 3%, 4% and 5%. It is to be appreciated that the individual numerical values within the range also include integers, fractions and decimals. Furthermore, whenever a range has been described, it is also intended that the range covers and teaches values of up to 2 additional decimal places or significant figures (where appropriate) from the shown numerical end points. For example, a description of a range of 1 % to 5% is intended to have specifically disclosed the ranges 1.00% to 5.00% and also 1.0% to 5.0% and all their intermediate values (such as 1.01 %, 1.02% ... 4.98%, 4.99%, 5.00% and 1.1 %, 1.2% ... 4.8%, 4.9%, 5.0% etc.,) spanning the ranges. The intention of the above specific disclosure is applicable to any depth/breadth of a range.
Additionally, when describing some embodiments, the disclosure may have disclosed a method and/or process as a particular sequence of steps. However, unless otherwise required, it will be appreciated that the method or process should not be limited to the particular sequence of steps disclosed. Other sequences of steps may be possible. The particular order of the steps disclosed herein should not be construed as undue limitations. Unless otherwise required, a method and/or process disclosed herein should not be limited to the steps being carried out in the order written. The sequence of steps may be varied and still remain within the scope of the disclosure.
Furthermore, it will be appreciated that while the present disclosure provides embodiments having one or more of the features/characteristics discussed herein, one or more of these features/characteristics may also be disclaimed in other alternative embodiments and the present disclosure provides support for such disclaimers and these associated alternative embodiments.
DESCRIPTION OF EMBODIMENTS
Exemplary, non-limiting embodiments of a microcarrier, a method of making a microcarrier, a system for producing a cell cultured food product and a method of producing a cell cultured food product are disclosed hereinafter.
MICROCARRIER
In various embodiments, there is provided a microcarrier comprising, a core particle; and a coating layer disposed on a surface of the core particle; wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.
In various embodiments, the microcarrier may have a core-shell structure wherein the core particle forms the core, and the coating layer forms the shell. In various embodiments, the core particle and the coating layer may be made from the same or different materials. In various embodiments, the surface of the core particle may be partially or completely coated by the coating layer. In various embodiments, the core particle may be encapsulated/ encompassed/ covered by the coating layer. In various embodiments, the core particle may be functionalized by the coating layer disposed/ formed/ deposited/coated thereon.
In various embodiments, the microcarrier is manufactured using materials that are derived from natural sources. In various embodiments, it will be appreciated that the materials that are derived from natural sources e.g., plant sources, may undergo processing into one or more forms that are suitable for making the microcarrier. In various embodiments, processing may include extraction, purification, solubilization, drying, hydrolysis, and the like. In various embodiments, the microcarrier may be substantially devoid of any synthetic substance(s).
In various embodiments, the microcarrier is manufactured using materials that are derived from plant sources. In various embodiments, the microcarrier may be a plant-based microcarrier. In various embodiments, the microcarrier may comprise plant proteins, e.g., purified plant protein. In various embodiments, the microcarrier may be substantially devoid of any substance(s) derived from animal source(s). In various embodiments, materials that are derived from plant sources are advantageously more cost effective as compared to materials that are derived from animal sources. In various embodiments, materials that are derived from plant sources advantageously obviate the concerns associated with animal derived substances, e.g., animal derived proteins, such as spreading of infectious diseases, growth factor contamination, and batch to batch variations. In various embodiments, the plant-based sources include but are not limited to broad bean, chickpea, chia seed, com, lentil, mung bean, oat, pea, pumpkin seed, rapeseed, rice, soybean, wheat, and winter squash. In various embodiments, the plantbased sources include one or more selected from the group consisting of broad bean, chickpea, chia seed, corn, lentil, mung bean, oat, pea, pumpkin seed, rapeseed, rice, soybean, wheat, and winter squash.
In various embodiments, the microcarrier is edible. In various embodiments, the microcarrier may be safe for human and/or animal consumption. In various embodiments, the microcarrier may be manufactured using food-grade materials. In various embodiments, the microcarrier may be manufactured in a food processing facility. In various embodiments therefore, the microcarrier may be used or may be present, e.g., embedded, in a food and/or beverage product without food safety concerns. In various embodiments, the microcarrier is substantially free of pathogens. In various embodiments therefore, there is no need to detach cells from the microcarrier when the microcarrier is used for cell culture of a food product. In various embodiments therefore, there is no need to remove the microcarrier from the cell cultured food product.
In various embodiments, the microcarrier is biocompatible. In various embodiments, the biocompatibility of the microcarrier may depend on its surface properties, such as stiffness, surface charge, chemical functionalities, roughness, and wettability. In various embodiments, the microcarrier is substantially non- cytotoxic to cells. In various embodiments, the microcarrier is biodegradable. In various embodiments, degradation by-products of the microcarrier is substantially non-cytotoxic to cells. In various embodiments, the microcarrier is manufactured using a fabrication process that is non-toxic.
In various embodiments, the microcarrier is sterilizable. In various embodiments, the microcarrier may remain stable under heat. For example, the diameter of the microcarrier may not substantially change before and after the application of heat. In various embodiments, cross-linking of the coating layer may impart stability to the microcarrier. In various embodiments therefore, the microcarrier may be sterilized using the autoclave process. In various embodiments, the microcarrier may be provided in a sterile form.
In various embodiments, the microcarrier or the core particle has a diameter of from about 50 pm to about 1000 pm. In various embodiments, the microcarrier or the core particle has a diameter falling in a range with approximate start and end points selected from the following group of numbers: 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400,
410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560,
570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720,
730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840, 850, 860, 870, 880,
890, 900, 910, 920, 930, 940, 950, 960, 970, 980, 990, and 1000 pm. In some embodiments, the microcarrier or the core particle has a diameter of from about 150 pm to about 200 pm. In various embodiments, the microcarrier or the core particle has a size (e.g., diameter) which is compatible with the dimensions of a cell to be cultured thereon. A microcarrier or the core particle of an appropriate size would enable the cells to attach and proliferate thereon. In various embodiments, a larger microbead may result in a lower growth surface area to volume ratio. In various embodiments, a larger microbead may require a higher energy input in order to achieve complete microcarrier suspension in culture. In various embodiments, a smaller microbead may increase the difficulty of cell adhesion and harvesting, resulting in a lower final cell yield and higher costs incurred. In various embodiments, the size of the microcarrier or the core particle may be controllable.
In various embodiments, a plurality of microcarriers or core particles have a substantially uniform size or diameter. In various embodiments, the plurality of microcarriers have a coefficient of variation of the diameter of less than about 20%, less than about 19%, less than about 18%, less than about 17%, less than about 16%, less than about 15%, less than about 14%, less than about 13%, less than about 12%, less than about 11 %, less than about 10%, less than about 9%, less than about 8%, less than about 7%, less than about 6%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, or less than about 1 %. Advantageously, cells that are cultured on microcarriers having a substantially uniform size or diameter reach confluence at approximately the same time.
In various embodiments, the plurality of microcarriers or core particles may have a particle size distribution calculated by (d90-d10)/d50, where d10 is defined as the diameter of a microcarrier at which 10% of the microcarriers are smaller than this diameter, d50 is defined as the diameter of a microcarrier at which 50% of the microcarriers are smaller than this diameter, d90 is defined as the diameter of a microcarrier at which 90% of the microcarriers are smaller than this diameter.
In various embodiments, the microcarrier has a density of from about 0.9 g/cm3 to about 1 .3 g/cm3. In various embodiments, the microcarrier has a density falling in a range with approximate start and end points selected from the following group of numbers: 0.9, 0.91 , 0.92, 0.93, 0.94, 0.95, 0.96, 0.97, 0.98, 0.99, 1 , 1.01 , 1.02, 1.03, 1.04, 1.05, 1.06, 1.07, 1.08, 1.09, 1.1 , 1.11 , 1.12, 1.13, 1.14, 1.15, 1.16, 1.17, 1.18, 1 ,19, 1.20, 1.21 , 1.22, 1.23, 1.24, 1.25, 1.25, 1.27, 1.28, 1.29, and 1.3 g/cm3. In various embodiments, the microcarrier may have a density for allowing suspension of the microcarrier in a suspension cell culture.
CORE PARTICLE
In various embodiments, the core particle is a microbead. In various embodiments, the core particle is a solid or semi-solid particle. In various embodiments, the core particle is a semi-solid particle, e.g., gel particle.
In various embodiments, the core particle is a hydrogel-based particle. In various embodiments, when used in cell culture applications, a hydrogel may advantageously allow the cells to be placed in a more physiological three- dimensional environment as compared to the classical, flat two-dimensional cell culture. In various embodiments, hydrogels may provide a hydrophilic and bioinert microenvironment for cell culture. In various embodiments, hydrogels may be customized to better mimic the natural environment of the cells to be cultured. For example, the stiffness/rigidity of the environment may be adjusted to match with the natural stiffness of the cells/tissue of origin. In various embodiments, a hydrogel-based microcarrier (i.e., a microcarrier comprising a hydrogel-based core particle) may be configured with specific water retention capacity at high temperatures for enhancing juiciness of a cooked food product. In various embodiments, the core particle may be fabricated using materials derived from natural sources, e g., natural polymers for fabricating hydrogels. In various embodiments, the core particle may be fabricated using materials derived from plant sources. In various embodiments, the use of materials derived from plant sources may advantageously obviate the drawbacks of using materials derived from animal sources (e.g., gelatin). Such drawbacks include, for example, difficulty in industrial scale operation due to high costs, risk of microbial contamination, and batch to batch variations. In various embodiments, the use of materials derived from plant sources may advantageously obviate the drawbacks of using synthetic materials. Such drawbacks include, for example, the use of enzymatic digestion to separate cells from the microcarrier during cell harvest, cytotoxicity of chemical cross-linking agents, difficulty in removing chemical cross-linking agents, degradation of the microcarrier when exposed to high temperatures required for sterilization, changes in pH during degradation of the microcarrier leading to cell death, low biodegradability, inedibility, and relatively high prices.
In various embodiments, the core particle is a plant-based hydrogel. In various embodiments, the plant-based hydrogel may be a plant lignocellulose materials-based hydrogel (e.g., cellulose-based hydrogel, hemicellulose-based hydrogel, lignin-based hydrogel), a plant polysaccharide-based hydrogel (e.g., starch-based hydrogel, pectin-based hydrogel, plant gum-based hydrogel), a plant protein-based hydrogel (e.g., soy protein-based hydrogel, zein-based hydrogel), or a combination thereof. In various embodiments, the core particle comprises one or more materials selected from the group consisting of alginate, cellulose, chitosan, gum, hemicellulose, lignin, pectin, soy, starch, and zein. For example, polysaccharides such as alginate and pectin may possess ionic gelation capabilities. For example, mushroom carboxymethyl chitosan may be capable of forming porous microspheres for chondrocyte cultures. In various embodiments, the core particle may be an alginate hydrogel microbead, e.g., sodium alginate hydrogel microbead, calcium alginate hydrogel microbead. In various embodiments, a core particle made of an alginate hydrogel may provide one or more of the following advantages: good mechanical integrity, cell compatibility, simple preparation method, abundance of raw material sources, ease of controlling the properties of the alginate hydrogel within a large range (e.g., physicochemical property, mechanical strength, degradation rate and surface property).
COATING LAYER
In various embodiments, the coating layer is coupled to the core particle. In various embodiments, the coating layer may be coupled to the core particle via physical adsorption. In various embodiments, the coating layer may further be coupled to the core particle via cross-linking. In various embodiments, the surface of the core particle and the coating layer may have opposite electrical charges. The opposite electrical charges may advantageously encourage adsorption of the coating layer on the core particle. For example, where the core particle comprises sodium alginate, the surface of the core particle would have a net negative charge, thereby encouraging the adsorption of a coating layer with a net positive charge, e.g., a coating layer comprising amino acids with a positive charge.
In various embodiments, the microcarrier may comprise more than one coating layer. In various embodiments, the microcarrier may comprise multiple coating layers. Each coating layer may have a composition that is different from the other (e.g., adjacent) coating layer(s). Each coating layer may impart a specific set of one or more properties to the microcarrier.
In various embodiments, the coating layer comprises one or more materials derived from plant source(s). In various embodiments, the coating layer may be partially or completely made of one or more materials derived from plant source(s). In various embodiments, the plant source may comprise seeds, fruits, vegetables. Examples of materials derived from plant sources include but are not limited to chickpea, mung bean, soybean, lentil e.g., red lentil, broad bean, pumpkin seed, rapeseed, oat, chia seed, pea, garden pea, winter squash, wheat, rice, corn, or combinations thereof. Food grade plant proteins are abundant and can be upcycled from oil seed processing by-products such as chickpea, pumpkin seed meal, rapeseed meal, and sunflower seed meal.
In various embodiments, the coating layer comprising one or more plantbased material may be capable of supporting growth of cells, for example, by promoting better adhesion of cells to, proliferation and/or differentiation of cells on the microcarrier. Without wishing to be bound by theory, it is believed that plant proteins may contain active domains that can be used to replace the animalbased ECM for meat culture applications. In various embodiments, plant proteins may be capable of mimicking ECM proteins. Advantageously, the plant-based material may be used in place of extracellular matrix (ECM) components e.g., ECM proteins. ECM components may include, for example, collagen, fibronectin, laminin, poly-L-lysine, gelatin, keratin, vitronectin, elastin, heparan sulphate, dextran, dextran sulphate, chondroitin sulphate, heparan sulfate proteoglycans, and derivatives or fragment thereof.
In various embodiments, the coating layer comprises one or more types of cyto-adhesive functional molecules. In various embodiments, the coating layer comprises one or more compatible, biologically relevant, or physiologically relevant substance, e.g., cyto-adhesive functional molecules, capable of supporting growth of cells. In various embodiments, the presence of cyto- adhesive functional molecules bonded to the surface of the core particle may advantageously improve cyto-affinity of the microcarrier.
In various embodiments, the coating layer comprises a protein or a protein hydrolysate. In various embodiments, the coating layer is a protein coating layer. In various embodiments, the coating layer is a protein hydrolysate coating layer. In various embodiments, the coating layer comprising a protein, or a protein hydrolysate may provide improved cytoaffinity to the microcarrier. In various embodiments, the protein may be a plant-based protein. In various embodiments, the protein hydrolysate may be a hydrolysate of the plant-based protein.
In various embodiments, the protein hydrolysate may be obtained by subjecting a protein to enzymatic hydrolysis using a suitable enzyme. In various embodiments, enzymes such as proteinase/protease/proteolytic enzyme may be used to digest the protein to form protein hydrolysate. Examples of enzymes may include but are not limited to trypsin, papain, alcalase, and flavorzyme. In various embodiments, the proteinase/ protease/ proteolytic enzyme has an optimal working pH of more than 7. In various embodiments, the proteinase/protease/proteolytic enzyme is an enzyme found in the gut e g., or the small intestine of a mammalian subject.
In various embodiments, enzymatic hydrolysis may advantageously generate bioactive peptides. For example, plant proteins may be rich in cell adhesion peptides such as Arg-Gly-Asp (RGD)-containing peptide. In various embodiments therefore, selective enzyme hydrolysis may be used to improve the bioactivity of plant proteins. In various embodiments, the enzyme may be configured to cleave a peptide at sites to expose arginine and/or lysine residues. Enzymatic hydrolysis may be employed in food and pharmaceutical industries because the process is typically conducted under mild controlled conditions (e g., pH, temperature, substrate concentration, and enzyme activity), provides high specificity and the absence of residual organic solvents and toxic chemicals in the final peptide composition.
In various embodiments, the protein hydrolysate has a degree of hydrolysis of from about 1 % to about 30%. In various embodiments, the degree of hydrolysis of the protein hydrolysate may fall in a range with approximate start and end points selected from the following group of numbers: 1 , 1.5, 2, 2.5, 3,
3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11 , 11.5, 12, 12.5, 13,
13.5, 14, 14.5, 15, 15.5, 16, 16.5, 17, 17.5, 18, 18.5, 19, 19.5, 20, 20.5. 21 , 21.5, 22, 22.5, 23, 23.5, 24, 24.5, 25, 25.5, 26, 26.5, 27, 27.5, 28, 28.5, 29, 29.5, and 30%. In various embodiments, the degree of hydrolysis (DH) is defined as the proportion of the number of peptide bonds being broken in protein hydrolysis, or the proportion of cleaved peptide bonds in a protein hydrolysate. For example, if a starting protein containing one hundred peptide bonds is hydrolyzed until ten of the peptide bonds are cleaved, then the DH of the resulting hydrolysate is 10%. The degree of hydrolysis may be determined using techniques known in the art such as the trinitrobenzene sulfonic (TNBS) colorimetric method or the ortho- phthaldialdehye (OPA) method.
In various embodiments, it will be appreciated that the higher the degree of hydrolysis, the greater the extent of protein hydrolysis. Typically, as the protein is further hydrolyzed (i.e., the higher the DH), the molecular weight of the peptide fragments decreases, the peptide profile changes accordingly. A lower DH may result in longer peptides which could lead to stronger forces of attraction between the core particles, e.g., beads, and the cells due to the larger molecular weight. An increase in DH may result in a higher number of peptide bonds being cleaved but it may not equate to higher bioavailability. In some embodiments, the degree of hydrolysis of the protein hydrolysate may be from about 2.75% to about 6.0%. In some embodiments, the degree of hydrolysis of the protein hydrolysate may be about 3.5%.
In various embodiments, the coating layer comprises a protein source which has been selectively hydrolyzed. Common hydrolysis by alkaline can break down the cross-link in disulfide of cereal proteins and render proteins more soluble by the ionization of acidic and neutral amino acids. Enzymes such as papain, alcalase, and flavourzyme also have a very broad specificity of cleavage sites. The selective hydrolysis of the enzyme describes the cleavage of specific types of amino acid after which the enzyme can hydrolyze a peptide bond (e g., Lys and Arg for trypsin). This may include using a suitable enzyme with cleavage sites that specifically expose amino acid residue(s) and/or peptide fragment(s) with bioactive effects, prior to coating the core particles with the protein hydrolysate. In various embodiments, the enzyme for hydrolyzing the protein may be trypsin. In various embodiments, trypsin hydrolysis may result in desirable peptides that support cell growth and improve cytoaffinity. As trypsin has two cleavage sites - Arginine and Lysine, enzymatic hydrolysis with trypsin may lead to longer chain peptides as compared to an enzyme with broader specificity and more cleavage sites, which may lead to shorter chain peptides. Without wishing to be bound by theory, it is hypothesized that the adhesion of shorter chain peptides on beads may not be as strong as longer chain peptides, leading to the loss of protein during cell growing stages. Thus, even when shorter chains may be favored for cell growth, the inability to adhere to the beads would mitigate the positive effects on cell proliferation.
In various embodiments, a protein hydrolysate coating may advantageously provide better cyto-affinity as compared to a protein coating of the same material. For example, chickpea protein may be selectively hydrolyzed using protease to obtain a chickpea protein hydrolysate for coating and crosslinking to a core particle. By doing so, the cyto-affinity of the chickpea protein hydrolysate may be significantly enhanced relative to the chickpea protein.
In various embodiments, the coating layer comprises amino acids. The amino acids may include alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, valine or combinations thereof. In various embodiments, the coating layer comprises at least 3 amino acids selected from the group consisting of arginine, histidine, aspartic acid, glutamic acid and alanine. In various embodiments, the coating layer comprises at least 3 amino acids selected from the group consisting of arginine, histidine, aspartic acid, glutamic acid, proline, serine, glycine, and alanine. In various embodiments, the coating layer comprises amino acid sequences selected from the group consisting of RGD (SEQ ID NO: 1 ), IKVAV (SEQ ID NO: 6), YIGSR (SEQ ID NO: 7), DGEA (SEQ ID NO: 8), PHRSN (SEQ ID NO: 9), PRARI (SEQ ID NO: 10), permutations thereof or sequence order variations thereof (e g., GRD (SEQ ID NO: 2), DGR (SEQ ID NO: 3) etc.). In various embodiments, the coating layer comprises amino acid sequences which advantageously have cell adhesion properties.
In various embodiments, the coating layer comprises peptide fragments having an arginine residue and/or peptide fragments having a lysine residue. In various embodiments, the arginine and lysine residues may be found at the amino terminal and/or carboxyl terminal of the peptide/polypeptide fragments. In various embodiments, hydrolysis of a protein may advantageously expose peptide fragments that promote cell adhesion, e.g., peptide fragments having an arginine or lysine residue.
In various embodiments, the coating layer comprises one or more cell adhesion peptides. In various embodiments, the coating layer is configured to bind to a cell receptor responsible for cell adhesion. In various embodiments, the presence of cell adhesion peptides in the coating layer may advantageously improve cytoaffi nity. In various embodiments, cell adhesion peptides may include but are not limited to peptides with the following amino acid sequences: RGD (SEQ ID NO: 1 ), RGN (SEQ ID NO: 4), DGR (SEQ ID NO: 3), NGR (SEQ ID NO: 5), DGEA (SEQ ID NO: 8), IKVAV (SEQ ID NO: 6), YIGSR (SEQ ID NO: 7), PHRSN (SEQ ID NO: 9), and PRARI (SEQ ID NO: 10). In various embodiments, cell adhesion peptides may be found in plants including but not limited to mung bean, soybean, lentil, broad bean, chickpea, garden pea, pumpkin, winter squash and rapeseed. In various embodiments, the coating layer may comprise DGR- containing peptides. In various embodiments, the coating layer may comprise peptides found in chickpea protein with the following amino acid sequences RQSHFANAQP (SEQ ID NO: 11 ) and GAGAGS (SEQ ID NO: 12).
In various embodiments, the coating layer is coupled/attached to the core particle via a cross-linker. In various embodiments, the coating layer may be immobilized/fixed to the core particle by a cross-linker/ cross-linking reagent. In various embodiments, the cross-linker may be formaldehyde. In various embodiments, the cross-linker may be glutaraldehyde. In various embodiments, the cross-linker may be derived from natural sources. In various embodiments, the cross-linker may be a natural food grade compound. In various embodiments, the cross-linker comprises a natural cross-linker including but not limited to flavanones, genipin, quercetin, tannic acid and transglutaminase. In various embodiments, the cross-linker comprises a natural cross-linker selected from the group consisting of flavanones, genipin, quercetin, tannic acid and transglutaminase. In various embodiments, the cross-linker may be transglutaminase, which is an enzyme that can catalyze the acyl-transfer reaction between the y-carboxyamide group of peptide-bound glutamine residues and various primary amines. The formation of this cross-link does not reduce the nutritional quality of the food as the lysine residue remains available for digestion. In various embodiment, the cross-linker may be genipin, which is a chemical compound found in Genipa americana fruit extract (i.e., a natural protein crosslinking agent isolated from an edible plant). Genipin is an aglycone derived from an iridoid glycoside called geniposide which is also present in fruit of Gardenia jasminoides. Genipin is an excellent natural cross-linker for proteins, collagen, gelatin, and chitosan cross-linking. It has a low acute toxicity, as compared to glutaraldehyde and many other commonly used synthetic cross-linking reagents.
In various embodiments, the coating layer is fluorescent. In various embodiments, the coating layer is configured to exhibit self-fluorescence. Advantageously, the presence of fluorescence in the coating layer may be utilized, for example, to monitor the degree of coating of the coating layer on the core particle, to ensure the uniformity of the coating layer, to monitor the microcarrier during cell culture, by using a microscope e.g., fluorescent microscope. Microcarriers with fluorescence is an indication of successful coating of the protein or protein hydrolysate. Intensity of the fluorescence may be correlated to the amount of proteins or protein hydrolysate being coated on the surface of the core particle. In one example, where the cross-linker is genipin, cross-linking of the protein or protein hydrolysate with genipin produces blue- colored fluorescent coating layer, due to the chromophore or fluorophore group formed between genipin and the cross-linked proteins.
METHOD OF MAKING A MICROCARRIER
In various embodiments, there is provided a method of making a microcarrier, the method comprising, providing a core particle; and forming a coating layer on a surface of the core particle to obtain the microcarrier, wherein the core particle and coating layer comprise one or more materials derived from plant-based sources. In various embodiments, the method includes forming a plurality of core particles and forming a coating layer on surfaces of the plurality of core particles.
In various embodiments, providing the core particle comprises forming/fabricating the core particle from its raw material. In various embodiments, the raw material may be sodium alginate for forming an alginate core particle. In various embodiments, the raw material may include but is not limited to pectin, chitosan, zein, and cellulose. In various embodiments, the raw material may be selected from the group consisting of pectin, chitosan, zein, cellulose, and combinations thereof.
In various embodiments, providing the core particle comprises electrospraying a precursor solution to form the core particle in the form of a microbead. In various embodiments, the technique of making microbeads may be based on emulsification. In various embodiments, the technique of making microbeads may be based on microfluidics. In various embodiments, the technique of making microbeads may be based on extrusion. In various embodiments, the technique of making microbeads may be based on a phaseinversion method.
In various embodiments, forming the coating layer comprises immersing the core particle in a coating solution. In various embodiments, the coating solution may comprise a protein or a protein hydrolysate. In various embodiments, the core particles may be immersed into the coating solution at a percent weight/volume (% w/v) of from about 10% w/v to about 50% w/v. In various embodiments, the percent weight/volume (% w/v) of the core particles relative to the coating solution may fall in a range with approximate start and end points selected from the following group of numbers: 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, and 50% w/v. For example, a percent weight/volume of 10% means that 10 grams of the core particles is immersed in every 100 ml_ of the coating solution.
In various embodiments, the coating solution may have a concentration of from about 0.1 % to about 30% by weight of a coating substance, e.g., protein or protein hydrolysate. In various embodiments, the concentration of the coating solution may fall in a range with approximate start and end points selected from the following group of numbers: 0.1 , 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, and 30% by weight. For example, a percent weight of 10% means that 10 g of the coating substance is dissolved in 100 g of solution. In various embodiments, the size of the core particle, e.g., bead size, may be altered depending on the concentration of the coating substance e.g., protein. For example, as protein concentration increases, q (%) may decrease, where q (%) refers to the volume at each particle size (i.e. , frequency distribution). Without wishing to be bound by theory, it is believed that moisture may have diffused out of the beads due to differences in osmotic pressure between the beads and protein solution.
In various embodiments, the coating process may be carried out at a pH from about 5.0 to about 10.0. In various embodiments, the coating process may be carried out at a pH falling in a range with approximate start and end points selected from the following group of numbers: 5.0, 5.1 , 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1 , 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1 , 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1 , 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9.0, 9.1 , 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, and 10.0.
In various embodiments, the coating process may be carried out at a temperature of from about 4°C to about 60°C, which is below the protein denaturation temperature to prevent the destruction of the functional properties of peptides. In various embodiments, the coating process may be carried out at a temperature falling in a range with approximate start and end points selected from the following group of numbers: 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16,
17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37,
38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, 50, 51 , 52, 53, 54, 55, 56, 57, 58,
59, and 60°C. In various embodiments, protein adsorption on solid surfaces generally increases with temperature, and the thickness of protein layers is enhanced with elevated temperature.
In various embodiments, prior to forming the coating layer, the method further comprises extracting a protein for making a protein coating solution. In various embodiments, the protein for making the protein coating solution may be extracted using an isoelectric point precipitation method. In various embodiments, extracting the protein may comprise grounding one or more raw materials into powder form. The raw materials may be obtained from plant sources and may include but are not limited to chickpea, mung bean, soybean, lentil e.g., red lentil, broad bean, pumpkin seed, rapeseed, oat, chia seed, pea, garden pea, winter squash, wheat, rice, corn, or combinations thereof.
In various embodiments, extracting the protein may further comprise dispersing the one or more powders of raw materials in a suitable liquid (e.g., deionized water) to obtain a protein mixture/dispersion. In various embodiments, the one or more powders of raw materials may be dispersed at a percent weight/volume (% w/v) of from about 1 % w/v to about 50% w/v. In various embodiments, the percent weight/volume (% w/v) of the powder relative to the liquid may fall in a range with approximate start and end points selected from the following group of numbers: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, and 50% w/v.
In various embodiments, extracting the protein may further comprise solubilizing the protein in the protein mixture. In various embodiments, solubilizing the protein may further comprise adjusting the pH of the protein mixture such that the protein is dissolved. The pH of the protein mixture may be adjusted using a suitable acid or base. In various embodiments, extracting the protein may further comprise removing insoluble non-protein components from the protein mixture. In various embodiments, extracting the protein may further comprise precipitating the dissolved protein by adjusting the pH of the protein mixture to obtain a solid form of the protein. In various embodiments, extracting the protein may further comprise dissolving the solid form of the protein in a suitable solvent by adjusting the pH to obtain a protein solution. The pH of the protein mixture may be adjusted using a suitable acid or base. In various embodiments, extracting the protein may further comprise freezing the protein solution and lyophilizing the frozen protein solution to obtain a lyophilized protein. It will be appreciated that the various steps of extracting the protein may further involve mixing (e.g., using a vortex or shaker machine) and washing steps (e.g., washing with deionized water).
In various embodiments, the step of extracting the protein may have a protein extraction yield of from about 1 % to about 20%, depending on the type of raw material. In various embodiments, the step of extracting the protein may have a protein extraction yield falling in a range with approximate start and end points selected from the following group of numbers: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, and 20%.
In various embodiments, prior to forming the coating layer, the method further comprises preparing the coating solution comprising the protein hydrolysate. In various embodiments, the method further comprises hydrolyzing a protein source with an enzyme to produce protein hydrolysate, prior to coating the core particles with the protein hydrolysate. In various embodiments, the method further comprises selectively hydrolyzing a protein source. This may include using a suitable enzyme with cleavage sites that specifically expose amino acid residue(s) and/or peptide fragment(s) with bioactive effects, prior to coating the core particles with the protein hydrolysate.
In various embodiments, the protein hydrolysate may be obtained by digesting a protein using an enzyme, e.g., proteinase/protease/proteolytic enzyme. In various embodiments, the protein hydrolysate may have a degree of hydrolysis determined by factors such as the concentration of the protein, type of enzyme used, concentration of the enzyme used, and duration of exposure to the enzyme or duration of hydrolysis. In various embodiments, the protein may be subjected to hydrolysis by more than one type of enzyme. For example, the protein may be subjected to sequential hydrolysis, i.e. , treating the protein with a first enzyme to obtain a first protein hydrolysate, deactivating the first enzyme, treating the first protein hydrolysate with a second enzyme to obtain a second protein hydrolysate, and deactivating the second enzyme (repeating the steps of treating with other enzymes and deactivating them may also be further carried out).
In various embodiments, the protein hydrolysate solution has a degree of hydrolysis of from about 1 % to about 30%. In various embodiments, the degree of hydrolysis of the protein hydrolysate solution may fall in a range with approximate start and end points selected from the following group of numbers: 1 , 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11 , 11.5, 12, 12.5, 13, 13.5, 14, 14.5, 15, 15.5, 16, 16.5, 17, 17.5, 18, 18.5, 19, 19.5, 20, 20.5, 21 , 21.5, 22, 22.5, 23, 23.5, 24, 24.5, 25, 25.5, 26, 26.5, 27, 27.5, 28, 28.5, 29, 29.5, and 30%.
In various embodiments, the hydrolysis of the protein may be carried out over a period of from about 10 minutes to about 240 minutes. In various embodiments, the hydrolysis of the protein may be carried out over a period falling in a range with approximate start and end points selected from the following group of numbers: 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, and 240 minutes.
In various embodiments, preparing the coating solution comprising the protein hydrolysate comprises hydrolyzing a protein using an enzyme-substrate concentration (E/S%) of from about 0.1 % to about 50%. In various embodiments, the hydrolysis of the protein may be carried out using an enzyme-substrate concentration (E/S%) falling in a range with approximate start and end points selected from the following group of numbers: 0.1 , 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, and 50%.
In various embodiments, the hydrolysis of the protein may be carried out at a protein dispersion of from about 0.1 % to about 30% w/v. In various embodiments, the hydrolysis of the protein may be carried out at a protein dispersion falling in a range with approximate start and end points selected from the following group of numbers: 0.1 , 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, and 30% w/v.
In various embodiments, forming the coating layer further comprises mixing the core particles immersed in the coating solution. In various embodiments, the core particles immersed in the coating solution may be mixed using mechanical means, such as vortexing or shaking. In various embodiments, mixing may improve contact between the core particles and the coating solution such that the surfaces of the core particles are coated with the coating solution. It will be appreciated that the mixing step is performed at a level of intensity such that the core particles are not substantially damaged. In various embodiments, forming the coating layer further comprises immersing the core particle coated with the coating layer in a cross-linking solution. In various embodiments, the cross-linker solution may comprise a crosslinker that is derived from natural sources. In various embodiments, the crosslinker solution may comprise a cross-linker that is a natural food grade compound. In various embodiments, the cross-linker comprises a natural cross-linker selected from the group consisting of flavanones, genipin, quercetin, tannic acid and transglutaminase. In various embodiment, the cross-linker solution may comprise genipin. In various embodiment, the cross-linker solution may comprise transglutaminase.
In various embodiments, the core particles may be immersed into the cross-linker solution at a percent weight/volume (% w/v) of from about 5% w/v to about 50% w/v. In various embodiments, the percent weight/volume (% w/v) of the core particles relative to the cross-linker solution may fall in a range with approximate start and end points selected from the following group of numbers: 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, and 50% w/v. For example, a percent weight/volume of 10% means that 10 grams of the core particles is immersed in every 100 mL of the cross-linker solution.
In various embodiments, the cross-linker solution may have a concentration of from about 0.1 mg/ml_ to about 10 mg/mL. In various embodiments, the concentration of the cross-linker solution may fall in a range with approximate start and end points selected from the following group of numbers: 0.1 , 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1 , 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, and 10 mg/mL.
In various embodiments, the method may comprise washing the coated core particles prior to and after immersing the coated core particles in the cross- linker solution. In various embodiments, the coated core particles may be washed using a suitable solvent such as deionized water.
SYSTEM AND METHOD OF PRODUCING A CELL CULTURED FOOD PRODUCT
In various embodiments, there is provided a system for producing a cell cultured food product, the system comprising, a population of cells; and a plurality of microcarriers configured to allow the population of cells to be grown thereon; wherein the microcarrier comprises a core particle and a coating layer disposed on a surface of the core particle; and wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.
In various embodiments, there is provided a method of producing a cell cultured food product, the method comprising, seeding a population of cells onto a plurality of microcarriers configured to allow the population of cells to be grown thereon, wherein the microcarrier comprises a core particle and a coating layer disposed on a surface of the core particle; and wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.
In various embodiments, the microcarrier is a microcarrier for cells. In various embodiments, the coating layer of the microcarrier may provide a substrate for cells to attach/adhere thereon. In various embodiments, the coating layer of the microcarrier may advantageously enhance cell attachment, proliferation and differentiation. In various embodiments, the microcarrier may be used to upscale anchorage-dependent cells such as mammalian cells. In various embodiments, a plurality of microcarriers may advantageously provide a relatively large surface area to volume ratio for cell culture as compared to, for example, two-dimensional cell culture.
In various embodiments, the cells may be stem cells or somatic cells. The stem cells may be pluripotent (e.g., embryonic stem cells or induced pluripotent stem cells) or multipotent (e g., adult stem cells). The stem cells may be mesenchymal stem cells (MSCs), embryonic stem cells (ESCs) or induced pluripotent stem cells (iPS). In various embodiments, the somatic cells may include but are not limited to muscle cells (e.g., myoblasts) and fat cells (e.g., adipocytes). In various embodiments, the cells may be cells of a non-human organism including but not limited to poultry (e.g., chicken, duck, turkey, goose, fowl), pig, cattle (e.g., cow), sheep, goat, horse, fish and shrimp. In various embodiments, the microcarrier may be used for producing cultured meat (e.g., red meat or white meat or seafood) or cell-based meat (CBM).
In various embodiments, the microcarrier or a plurality of microcarriers may be used in cell culture. In various embodiments, the microcarrier may remain substantially stable in culture media. For example, the diameter of the microcarrier may not substantially change over the duration of the cell culture. The cell culture may include static cell culture or dynamic cell culture. In a static cell culture, the culture or culture media is not actively agitated. Advantageously, aggregates of cells and/or microcarriers may be allowed to form under reduced agitation of the culture or culture media. In a dynamic cell culture, the culture or culture media is actively agitated to promote exchange of nutrients and waste to and from the cells attached on the microcarriers. Dynamic cell culture may include, for example, stirred spinner and bioreactor culture.
In various embodiments, the cells may be seeded onto the microcarriers at a seeding density of from about 103 to about 104 cells/mL for every 0.01 gram (g) of the microcarriers. In various embodiments, the cells may be seeded onto the microcarriers at a seeding density falling in a range with approximate start and end points selected from the following group of numbers: 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, and 10000 cells/mL for every 0.01 g of the microcarriers.
In various embodiments, the system may further comprise a cell culture device for holding the cells and microcarriers. In various embodiments, the cell culture device may be a well plate, e g., 24-well plate. The well plate may be a low attachment well-plate, i.e., the surfaces of the well plate are treated to minimize/prevent cell attachment onto the surface of the well plate. This would promote the attachment of cells onto the microcarriers. In various embodiments, the cell culture device may be a spinner flask or bioreactor. In various embodiments, the system may further comprise one or more equipment for providing a controlled environment for the growth and cultivation of cells. In various embodiments, the equipment is configured to provide a stable and regulated environment in terms of temperature (e.g., 37°C), humidity, carbon dioxide (CO2) levels (e.g., 5%), oxygen (O2) concentration to support the optimal growth and proliferation of cells on the microcarriers. For example, the equipment may be a commercially available cell incubator or a custom-built system for industrial scale production.
In various embodiments, a microcarrier-based system and method of cell culture may provide advantages such as ease of downstream processing in many applications. In various embodiments, the use of microcarriers for cell attachment facilitates the use of stirred tank and related reactors for growth of anchoragedependent cells. The cells attach to the readily suspended microcarriers. The requirement for microcarriers to be suspended may limit the physical parameters of the microcarriers themselves such as the size of the microcarriers. The size of the microcarriers should be large enough to accommodate many anchoragedependent cells, while small enough to form suspensions with properties suitable for use in bioreactors.
In various embodiments, the cells remain viable when cultured on the microcarrier over a period of time. In various embodiments, the cells may remain viable when cultured on the microcarrier over a period of time from about 1 to about 28 days. In various embodiments, the cells remain viable when cultured on the microcarrier over a period of time falling in a range with approximate start and end points selected from the following group of numbers: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, and 28 days In various embodiments, the number of cells cultured on the microcarrier may increase by about 1 -fold to about 20-fold, about 2-fold to about 19-fold, about 3-fold to about 18-fold, about 4-fold to about 17-fold, about 5-fold to about 16- fold, about 6-fold to about 15-fold, about 7-fold to about 14-fold, about 8-fold to about 13-fold, about 9-fold to about 12-fold, or about 10-fold to about 11 -fold from the time when the cells are seeded on the microcarrier to the time the cells are harvested from the microcarrier for cell counting.
In various embodiments, there is provided a cell cultured food product comprising, a population of cells; and a plurality of microcarriers configured to allow the population of cells to be grown thereon; wherein the microcarrier comprises a core particle and a coating layer disposed on a surface of the core particle; and wherein the core particle and coating layer comprise one or more materials derived from plant-based sources. In various embodiments, the cells may be muscle cells (e.g., myoblasts) and fat cells (e.g., adipocytes). In various embodiments, the cells may be cells of a non-human organism including but not limited to poultry (e.g., chicken, duck, turkey, goose, fowl), pig, cattle (e.g., cow), sheep, goat, horse, seafood (e.g., fish and shrimp). In various embodiments, cell cultured food product is cultured meat I cell-based meat. In various embodiments, the culture meat may be white and/or red cultured meat.
BRIEF DESCRIPTION OF FIGURES
FIG. 1A is a set of brightfield microscope images of C2C12 seeding on microbeads with different protein coating during a 3-day culture. Scale bar = 100 pm. FIG. 1 B is a set of fluorescent microscope images of microbeads coated with plant proteins. Scale bar = 100 pm.
FIG. 2A to 2C are charts showing the effect of (A) different coating pH, (B) different coating protein concentration (1 to 20%), and (C) different coating protein concentration (4 to 10%), on the content of coated protein and fluorescence intensity of genipin cross-linked plant protein-alginate microbeads. FIG. 2D to 2F are particle size distribution diagrams of the microbeads formed at (D) different coating pH, (E) different coating protein concentration (1 to 20%), and (F) different coating protein concentration (4 to 10%).
FIG. 3A is a chart showing fold changes of C2C12 seeding on microbeads with different protein coating during a 3-day culture. FIG. 3B to 3D are graphs showing correlation between (B) the content of soluble protein, (C) the content of arginine in plant protein, and (D) the content of lysine in plant protein, with respect to fold changes in cell number. Different numbers represent different types of plant proteins (1 -mung bean, 2-soybean, 3-red lentil, 4-broad bean, 5-chickpea, 6-pea, 7-pumpkin seed, 8-rapeseed 1 , 9-rapeseed 2, 10-oat, 11 -chia seed, 12- gelatin); different lowercase letters between columns represent significant differences between tested results (p < 0.05).
FIG. 4A and 4B are microscope images of (A) C2C12 and (B) 3T3 cells proliferation on plant-based protein coated microbeads during a 13-day culture and graphs showing fold changes in cell number over the incubation period. Cell nuclei and scaffolds were stained by Hoechst 33342 and F-actin staining kit. Scale bar = 200 pm.
FIG. 5A to 5C are bright-field microscope images of chicken muscle satellite cells cultured on (A) pumpkin seed protein coated microbeads (scale bar = 10 pm), (B) pumpkin seed protein coated microbeads (scale bar = 100 pm), and (C) alginate microbeads (scale bar = 100 pm). FIG. 5D to 5F are bright-field microscope images of primary porcine cells cultured on (D) pumpkin seed protein coated microbeads (scale bar = 10 pm), (E) pumpkin seed protein coated microbeads (scale bar = 100 pm), and (F) alginate microbeads (scale bar = 100 pm). Cells were attached on microbeads on day 3 of culture (see arrows). FIG. 6A to 6D are charts showing gene expression and differentiation of C2C12 cells grown on microbeads and on 2D plates. (A) Relative expression of integrin p1 and M-cadherin on 6-well plate and microbeads cultured C2C12 (before differentiation); (B) relative expression of MyoD1 , C) Myf5 and D) Myh7 on 6-well plate and microbeads cultured C2C12 during differentiation. FIG. 6E and 6F are confocal laser scanning microscope (CLSM) images of C2C12 cells on (E) 6-well plate during a 7-day differentiation, and (F) pumpkin seed protein coated microbeads during a 7-day differentiation.
FIG. 7 is a photograph showing SDS-PAGE profiles of 11 types of plant proteins.
FIG. 8A are brightfield microscope images of primary porcine myoblasts seeded on microbeads with different protein coating at day 7 of culture. Scale bar = 100 pm. FIG. 8B is a chart showing fold changes in primary porcine myoblasts seeded on microbeads with different protein coating during a 7-day culture. FIG. 8C is a chart showing fold change in C2C12 cells seeded on microbeads with different protein coating during a 3-day culture.
FIG. 9A is a photograph showing microbeads in PBS solution. FIG. 9B is a set of fluorescent microscope images of 9 types of protein-coated microbeads (1 , mung bean protein hydrolysate coated microbeads; 2, soybean protein hydrolysate coated microbeads; 3, red lentil protein hydrolysate coated microbeads; 4, broad bean protein hydrolysate coated microbeads; 5, chickpea protein hydrolysate coated microbeads; 6, pea protein hydrolysate coated microbeads; 7, pumpkin seed protein hydrolysate coated microbeads; 8, rapeseed 1 protein hydrolysate coated microbeads; 9, rapeseed 2 protein hydrolysate coated microbeads; 10, alginate microbeads).
FIG. 10A is a 3D chart showing fold changes in C2C12 seeding on microbeads coated with different protein hydrolysates after a 3-day culture. Each number represents a different type of plant protein (1 -mung bean, 2-soybean, 3- red lentil, 4-broad bean, 5-chickpea. 6-pea, 7-pumpkin seed, 8-rapeseed 1 , 9- rapeseed 2). FIG. 10B and 10C are charts showing the degrees of hydrolysis for (C) different E/S% ratio and (D) different hydrolysis duration. FIG. 10D is a chart showing a comparison of C2C12 cell adhesion with different degrees of hydrolysis. FIG. 10E and 10F are charts showing (E) fold changes in C2C12 cell numbers and (F) fold changes in 3T3 cell numbers with different degrees of hydrolysis.
FIG. 11 is a chart showing fold changes in primary porcine myoblasts seeded on microbeads with different protein hydrolysis during a 7-day culture. Left and right bars for each plant protein represent hydrolysis by trypsin and papain, respectively.
FIG. 12 is a set of brightfield microscope images of primary porcine myoblasts seeded on microbeads with different protein hydrolysate coating during a 7-day culture. Scale bar = 100 pm.
FIG. 13A is a chart showing the effect of different E/S concentrations on the degree of hydrolysis and coated protein on microbeads. FIG. 13B is a chart showing the effect of different hydrolysis durations on the degree of hydrolysis and coated protein on microbeads.
FIG. 14 is a chart showing fold changes in primary porcine myoblasts seeded on microbeads with different degree of hydrolysis during a 7-day culture.
FIG. 15 is a set of brightfield microscope images of primary porcine myoblasts seeded on microbeads with different protein hydrolysis at day 1 and day 7 of culture. Scale bar = 100 pm.
FIG. 16A is a chart showing the coated protein content achieved on microbeads under loading conditions at different pH. FIG. 16B is a chart showing the coated protein content achieved on microbeads under loading conditions at different temperatures. FIG. 16C is a chart showing the coated protein content achieved on microbeads under loading conditions with coating solutions at different protein concentrations. FIG. 16D is a chart showing the frequency distribution of particle sizes achieved under loading conditions with coating solutions at different protein concentrations.
FIG. 17 is a chart showing primary porcine myoblasts proliferation on microbeads coated with different protein hydrolysis.
FIG. 18A is a set of confocal microscope images of C2C12 cells on CPH coated microbeads. FIG. 18B is a set of confocal microscope images of primary porcine myoblasts on CPH coated microbeads. FIG. 18C is a set of confocal microscope images of chicken muscle satellite cells on CPH coated microbeads. FIG. 18D is a chart showing cell proliferation of C2C12 cells, primary porcine myoblasts and chicken muscle satellite cells on microbeads during a 15-day culture. FIG. 18E is a set of confocal microscope images of 3T3 cells on CPH coated microbeads and a chart showing cell proliferation of 3T3 cells on microbeads during a 15-day culture. Cell nucleus and scaffolds were stained by Hoechst 33342 and F-actin staining kit, shown in blue and red color. Scale bar = 200 pm.
FIG. 19A to 19E are confocal microscope images of cells differentiation on microbeads and on 2D plates. (A) C2C12 cultured on 2D plate, (B) C2C12 cultured on gelatin coated microbeads, (C) C2C12 cultured on CPH coated microbeads, (D) primary porcine myoblasts cultured on CPH coated microbeads, (E) chicken muscle satellite cells cultured on CPH coated microbeads. Samples were stained with anti-desmin (green) with the addition of Hoechst 33342 (Blue), and observed under a confocal microscope. FIG. 19F are brightfield microscope images of 3T3 cells cultured on CPH coated microbeads (left, before Oil Red O staining; right, after staining). Scale bar = 200 pm. FIG. 20A is a chart showing the content of free lysine and arginine in protein solutions with different treatments (CP, 5% chickpea solution; CP+C, 5% chickpea solution treated by carboxypeptidase B; CP+T, 5% chickpea solution treated by trypsin; CP+T+C, 5% chickpea solution treated by sequential hydrolysis (combination of trypsin and carboxypeptidase B treatment). FIG. 20B is a chart showing fold changes of C2C12 on microbeads with different coating materials (Cytodex, cells cultured on Cytodex-1 microcarriers). FIG. 20C is a chart comparing fold changes of C2C12 and 3T3 cells on different microbeads.
FIG. 21 A to 21 D are charts showing the protein content of pumpkin seed protein-alginate microbeads with cross-linking agents (A) diacteyl, (B) flavonone, (C) quercetin, and (D) Tgase, as determined by BOA assay conducted one day after cross-linking. The X-axis represents the alginate group without any coating (A), the protein coated group without cross-linking (B), and the cross-linked group (C). Significance of differences between results represented by different lowercase letters (p < 0.05).
FIG. 22A and 22B are charts showing the effect of varied TGase concentrations on cross-linked pumpkin seed protein-sodium alginate microbeads during four days of storage. FIG. 22A and 22B are comparisons between days and samples, respectively. Significant differences between results from the same day's BCA assay are denoted by distinct lowercase letters among columns (p < 0.05).
FIG. 23A to 23C are optical microscope images of sodium alginate microbeads that have been cross-linked by TGase at different concentrations. (A) TGase concentration is 1 U/mL, (B) 3 U/mL, and (C) 10 U/mL.
EXAMPLES
Example embodiments of the disclosure will be better understood and readily apparent to one of ordinary skill in the art from the following discussions and if applicable, in conjunction with the figures. It should be appreciated that other modifications related to structural, chemical and material changes may be made without deviating from the scope of the invention. Example embodiments are not necessarily mutually exclusive as some may be combined with one or more embodiments to form new exemplary embodiments. The example embodiments should not be construed as limiting the scope of the disclosure.
MATERIALS
Sodium alginate was obtained from Shanghai Ruizheng Chemical Technology Co., Ltd. Calcium chloride, hydrochloric acid, and bovine gelatin were obtained from Sigma-Aldrich Pte. Ltd (Singapore). Oil Red 0 powder was obtained from Sigma-Aldrich for lipid droplets staining. Genipin was obtained from Challenge Bioproducts (Taiwan). Mung bean, soybean, red lentil, broad bean, pumpkin seed, rapeseed, oat, and chia seed were obtained from Origins Healthcare Pte Ltd for protein extraction. Commercial chickpea, mung bean, soybean and pea protein were obtained from Yantai T. Full Biotech Co., Ltd. Cell Counting Kit-8 (CCK8) was obtained from Scientific Resources Pte Ltd. (Singapore). Primary porcine myoblasts, C2C12 myogenic, 3T3 cell line and chicken muscle satellite cells were used.
METHODS
Production of core particles / microbeads
Electrospraying technique was applied to form alginate beads having a narrow size distribution around 200 pm. First, alginate solution was prepared by adding sodium alginate in water and was stirred continuously until fully dissolved. The alginate solution was transferred to a 20 mL syringe capped with a blunted stainless-steel needle. Then, a high voltage electric field was applied to the polymer solution (i. e. , alginate solution), which was fed at a substantially constant flow rate using a syringe pump to draw alginate beads toward a beaker containing calcium chloride solution (as the gelation bath) placed on a magnetic stirrer. To form the electric field, the needle and a ring were connected to positive and negative electrodes of high voltage supplies, respectively. Uniformity in the size of the microbeads was realized by performing electrospraying in the cone-jet mode, and also stabilized by an additional ring-shape electrode placed on the beaker containing the gelation bath. The collected beads were cross-linked and hardened in the gelation bath for a defined period and Ca-alginate beads were then collected by a cell strainer for further analysis.
Extraction of plant proteins
Grains and oil seeds (soybean, mung bean, red lentil, rapeseeds, pea, chickpea, pumpkin seeds, oat, broad bean, and chia seeds) were ground into powder (Rong Tsong Precision Technology Co., China) for protein extraction. During protein extraction, 150 g of the grounded powder/flour was dispersed in 1 .5 L deionized water (10% w/v) and mixed for 2 minutes on a shaker (Rotamax 120, Heidolph instruments GmbH & Co. KG, Germany) at a speed of 150 rpm. For solubilizing proteins, pH was adjusted to 9.0 using 0.5 M NaOH before the dispersion was mixed for another 30 minutes at 150 rpm. Insoluble non-protein components were removed via centrifuging at 12857xg at 23 °C for 5 min (Centrifuge 5810R, Eppendorf AG, Germany). To precipitate proteins, 0.5 M HCI was added to adjust pH of the supernatant to 5.2. The precipitated protein was recovered by centrifugation via the same procedure and washed in deionized water via centrifugation at 12857*g at 23 °C for 1 min. Proteins collected from centrifuge tubes were resuspended in 1 .5 L of centrifuge tubes’ rinses, via mixing by shaker at a speed of 150 rpm for 5 min. The suspension was adjusted to pH 7.4 to resolubilize proteins followed by freezing at -20 °C at least 24 h prior to lyophilization using VirTis benchtop freeze dryer (SP Industries; Warminster, PA, USA). The lyophilization process took 1 week to completely dry the samples. The protein extraction yield ranged from 1 % to 20%, depending on the types of grains. The purities of the proteins were determined by the Dumas method. Chickpea and pea proteins were dissolved in water and used directly. All protein isolate powder obtained was stored at -26 °C until further application.
Determination of soluble protein concentrations
Plant protein was dissolved in water to prepare 4% protein mixture and insoluble components were removed via centrifuging at 12857xg at 23 °C for 5 min (Centrifuge 5810R, Eppendorf AG, Germany). Soluble protein in supernatant was quantified using the PierceTM BCA Protein Assay Kit (Thermo Scientific), according to manufacturer instructions for the microplate procedure. Six replicates were quantified for each sample. Sample concentration was determined by applying a linear fit to the albumin and using the resulting equation to determine each sample concentration from its absorbance measurement.
Determination of protein molecular weights
Molecular weights of plant proteins were determined by SDS-PAGE. Protein was dissolved at 2 mg/mL to 10 mg/mL in distilled water before a fivefold-concentrated loading buffer was added. Protein samples were denatured for 5 min at 100 °C, loaded onto a polyacrylamide gel made of 10% running gel and 4% stacking gel, and subjected to electrophoresis at a constant current of 15 mA per gel, using a Mini Protein II unit (Bio-Rad Laboratories, Inc., Richmond, CA, USA). After separation, the proteins were stained with 0.02% (w/v) Coomassie Brilliant Blue R-250 in 50% (v/v) methanol and 7.5% (v/v) acetic acid and destained with 50% methanol (v/v) and 7.5% (v/v) acetic acid, followed by 5% methanol (v/v) and 7.5% (v/v) acetic acid. Wide range molecular weight markers including 180, 130, 100, 70, 55, 40, 35, 25, 15, and 10 kDa were used for estimation of molecular weight of proteins. Protein bands were imaged with a ChemiDocTM gel imaging system from Bio-Rad (Bio-Rad Laboratories, Mississauga, ON, Canada).
Preparation of plant protein hydrolysis
Plant proteins were subjected to enzymatic hydrolysis. Hydrolysis using trypsin (T4799, Sigma-Aldrich Pte. Ltd, Singapore) was carried out in a shaking water bath at 50 °C, pH 8, over 120 minutes with 1 % enzyme-substrate concentration (E/S%) in 5% protein dispersion. After hydrolysis, the enzymes were deactivated via heating at 95 °C for 15 minutes. The hydrolysates were centrifuged twice at 10000 g for 15 minutes, and the supernatants were collected and stored at 4 °C.
Sequential hydrolysis was conducted on chickpea protein. After trypsin hydrolysis, the deactivated hydrolysate was treated by carboxypeptidase B (C9584, Sigma-Aldrich Pte. Ltd, Singapore) at 37 °C, pH 7.5, over 120 minutes with 0.2% enzyme-substrate concentration (E/S%) in protein dispersion. After hydrolysis, the enzymes were deactivated via heating at 95 °C for 15 minutes.
Determination of degree of hydrolysis
The degree of hydrolysis (DH) of the hydrolysates was determined via formol titration. For every 2 mL of 5% protein hydrolysate, 68 mL of DI water was added. It was then subjected to titration using 0.05 M NaOH to pH 8.2, 10 mL of formaldehyde solution was added subsequently and titrated using 0.05 M NaOH to pH 9.2. The amount of NaOH used to reach pH 9.2 was recorded down to calculate the DH. The procedure was conducted in triplicate for all hydrolysates. Free nitrogen was first calculated based on the formula shown in Equation 1 and DH was calculated based on Equation 2. The total nitrogen content of different proteins was determined using the Kjeldahl method and each protein was conducted in duplicate. Free Nitrogen
Figure imgf000046_0001
100 (1 ) where Vi is volume of NaOH used in titration of sample (ml_); V2 is volume of NaOH used to titrate the blank (mL); c is concentration of NaOH used (0.05 M); 0.014 is the content of nitrogen equivalent to 1 mL of NaOH, and is the volume of sample (mL).
Figure imgf000046_0002
where free nitrogen is obtained from equation 1 ; total nitrogen content of individual plant protein was determined using the Kjeldahl method, and 20 is the dilution factor.
Determination of amino acids
Chickpea protein solution, chickpea carboxypeptidase B hydrolysate, chickpea trypsin hydrolysate, and chickpea protein hydrolysate (CPH) by sequential hydrolysis (combination of trypsin and carboxypeptidase B treatment) were prepared for free amino acid analysis. For precipitation, sulfosalicylic acid (200 pL) was added to the sample (800 pL) and incubated at 4 °C for 60 minutes. After centrifuging at 14500 rpm for 15 minutes, the supernatant was passed through a 0.22 pm syringe filter and the filtrate was centrifuged at 10000 g for 5 minutes. The supernatant was transferred into an injection vial with a dilution ratio of 1 :4 or 1 :16. The samples were analysed using an ARACUS amino acid analyzer (Membrane Pure, Germany).
Coating of microbeads with plant proteins and plant protein hydrolysate
Alginate microbeads were coated by plant proteins and plant protein hydrolysates, respectively. For the plant protein coating, freeze dried plant proteins were used to prepare 4% protein solution by dissolving in water. For the plant protein hydrolysate coating, proteins were firstly digested by proteinase under different conditions to obtain protein hydrolysates with different degree of hydrolysis. The protein hydrolysis was freeze dried and then used to prepare coating solution with 4% dried powder and water.
The alginate microbeads immersed into the coating solution (w/v of 1/3) were immediately vortexed and then agitated using a shaker (Rotamax 120, Heidolph instruments GmbH & Co. KG, Germany) at a speed of 150 rpm. After coating for 2 hours, microbeads were collected by a 70 pm cell strainer (SPL Lifesciences, Korea) followed by 3 rounds of rinsing with water.
The coated alginate microbeads were cross-linked by immersing in a 1 mg/mL genipin solution with a ratio of 1 :4 (beads: genipin solution, w/v) and shaking at 150 rpm in a 60 °C water bath (SW22, Julabo USA Inc., Allentown, PA, USA), then collected and washed with DI water 3 times after cross-linking.
After coating the alginate microbeads and cross-linking by genipin, the coated microbeads were stored in 0.1 M CaCl2 solution with a concentration of 0.2 g beads/mL, before being autoclaved and collected by a cell strainer for cell culture. The coated microbeads can be stored for at least about 3 months. The sterilized beads were used for different physical tests and cell seeding.
Determination of sizes and size distribution of microbeads
Particle size was measured by microscopy images of the microbeads (Olympus Corporation, Tokyo, Japan) and cellSens Standard software (Olympus corporation) which can assess the diameter of beads. The mean diameter of microbeads was calculated by the average data of 3 batches of microbeads with 15 randomly selected beads from each batch.
Particle size and distribution of microbeads were also measured by LA- 960 laser particle size analyzer (Horiba, Ltd., Tokyo, Japan). The characteristic diameters were obtained along with the diagram: mean diameter, median diameter, d (10% of the particles smaller than this diameter), dso (50% of the particles smaller than this diameter), and dgo (90% of the particles smaller than this diameter). The particle size distribution was calculated by (d9o-dio)/dso.
Microscope imaging and fluorescence analysis of the microbeads
The appearance of microbeads and degree of cross-linking were investigated by an Olympus BX51 fluorescence microscope (Olympus corporation, Tokyo, Japan). A total of 3 batches of microbeads were analyzed on 15 randomly selected beads from each batch.
Determination of coated proteins
The coated proteins on microbeads were quantified using the PierceTM BCA Protein Assay Kit (Thermo Scientific), according to manufacturer instructions. Microbeads were quantified after a 20x dilution. Six replicates were quantified for each sample. Sample concentration was determined by applying a linear fit to albumin and using the resulting equation to determine each sample concentration from its absorbance measurement.
Cell seeding on microbeads
C2C12 cells were cultured in Growth Medium (GM) containing Dulbecco’s Modified Eagle’s Medium (DMEM)-High Glucose (Hyclone Laboratories, Inc., Logan, UT, USA) supplemented with 10% fetal bovine serum, and 1% penicillinstreptomycin in 75 cm2 flasks to get the required amount of cells.
For protein screening, 104 cells/mL cells were seeded onto 0.01 g of microbeads in low attachment 24-well plate on day 0. CCK-8 assay and microscope images were performed on day 1 and 3 (with cells being seeded at day 0) to measure cell metabolic activity. C2C12 proliferation on pumpkin protein coated microbeads and chickpea hydrolysate coated microbeads were determined by seeding the cells onto the 0.01 g microbeads at 3x103 cells/mL in each well of low attachment 24-well plate. The number of cells seeded were estimated by CCK-8 assay on day 1 , 3, 5, 7, 9, 11 , and 13 (with cells being seeded at day 0). Half of the cell culture medium was changed every two days. After being incubated at 37 °C and 5.0% CO2 for 1 to 13 days, cells were taken out every 2 days and stained by Hoechst 33342 and F- actin. Morphology of stained cells were observed by a Zeiss LSM710 confocal microscope (Carl Zeiss, Oberkochen, Germany).
C2C12 differentiation was induced to 80% confluence by replacing the GM with differentiation medium (DM) containing DMEM-High Glucose supplemented with 2% horse serum (Hyclone Laboratories, Inc., Logan, UT, USA) and 1 % antibiotic-antimycotic. Day 0 (DO) indicates the day on which the cells were switched from GM to DM.
The protocol of 3T3 cells proliferation was same with C2C12 cells. Primary porcine myoblasts were cultured according to a procedure described in “Ding, S., Wang, F., Liu, Y. et al. Characterization and isolation of highly purified porcine satellite cells. Cell Death Discov. 3, 17003 (2017).’’ to obtain the required amounts. Chicken muscle satellite cells were cultured according to the AcceGen protocol.
Immunofluorescence staining of muscle cells
After differentiation, muscle cells were fixed by adding 4% paraformaldehyde in phosphate buffered saline (PBS) pH 7.4 for 10 minutes at room temperature followed by incubation for 10 minutes in PBS containing 0.1 % Triton X-100 for permeabilization. For blocking, cells were incubated with 1% BSA, 22.52 mg/mL glycine in PBST (PBS + 0.1 % Tween 20) for 30 minutes to block unspecific binding of antibodies. After blocking, cells were incubated in the diluted antibody in 1 % BSA in PBST in a humidified chamber for 1 hour at room temperature, followed by a second incubation with the secondary antibody in 1 % BSA for 1 hour at room temperature in the dark. Finally, cells were incubated in 0.1 pg/mL Hoechst for 1 minute for DNA staining. After each step, cells were washed 3 times in cold PBS, for 5 minutes per wash.
Oil Red 0 staining of 3T3
Oil Red O stock solution was prepared by dissolving Oil Red O (0.1 g) in isopropanol (200 mL) to give stock solution, which was diluted to working solution by mixing 3 parts of Oil Red O stock solution with 2 parts of water. The Oil Red 0 Working Solution is stable for 2 hours and were prepared 15 minutes before use.
3T3 differentiation was induced by differentiation media (GM) containing 0.5 mM IBMX (Isobutylmethylxanthine, 1 -Methyl-3-lsobutylxanthine), 0.25 pM dexamethasone, 1 pg/mL insulin, and 2 pm rosiglitazone) for 2 days postconfluence, followed by 2 days of maintenance media containing 1 pg/mL insulin, and finally, back to GM with media replacement every 2 days.
After removing the spent media from the culture plates, cells ready to be stained were washed twice with PBS and fixed with 10% formalin to the cells and incubated for 30 minutes at room temperature. The formalin was discarded and the cells were washed twice with water. To the cells, isopropanol (60%) was added and incubated for 5 minutes. The solvent was removed, and the cells covered evenly with Oil Red O working solution. The plates were rotated and incubated for 10 to 20 minutes. The Oil Red O solution was removed, and the cells washed 12 to 5 times with water until no residual stain was observed under a microscope.
RNA extraction and RT-qPCR Total RNA was isolated from 80 % confluent cells grown in 6-well tissue culture plate or on microbeads using a PureNA biospin total RNA extraction kit (Research instruments Pte Ltd), quantified using the Nano Drop (BioDrop pLITE, BioDrop co., UK). The mRNA was converted to complementary DNA (cDNA) with an RNA PCR Kit. A single stranded cDNA equivalent was then subjected to PCR using primers p-actin, integrin 1 , M-cadherin, MyoD1 , Myf5 and Myh7 which were derived from previously published sequences. The PCR mixture, a total volume of 20pl, contained 1 *Go Tag PCR Master Mix, and 0.2 pM of forward and reverse primer and 250 ng/mL cDNA.
Mass spectrometric determination of protein amino sequences
Proteins separated by SDS-PAGE were analyzed by TripleTOF 5600, and identified using ProteinPilot, searching against a combined database of cRAP protein sequences and UniProt Cucurbita maxima reference proteome. False discovery rate (FDR) analysis was performed on all searches, applying an FDR cut-off of 1 % to remove low quality measurements.
Statistical analysis
Data processing was performed by the statistical package SPSS 25 (SPSS Inc., Chicago, IL) for one-way ANOVA. The Duncan test was used for the comparison of mean values among treatments, and to identify significant differences (p < 0.05) among treatments. Data were expressed as means ± standard deviations of triplicate determinations.
RESULTS AND DISCUSSION
Example 1 : Characterization of alginate microbeads with plant protein coating Tissue engineering approaches typically involve the transplantation of cells or the induction of host cell migration, with synthetic or natural matrices such as type I collagen, ceramics, and poly(lactide-co-glycolide). However, these materials frequently do not adhere cells in a specific and defined manner and may be incapable of tightly regulating the phenotype of contacting cells during tissue development. Cell adhesion to ligands in the surrounding extracellular matrix (ECM) plays an important role in tissue morphogenesis and cell fusion and thus are often used to promote myoblasts adhesion through their interaction with cell-surface receptors of the integrin family.
Many animal gelatins, including those isolated from porcine, bovine, goat, and rat, have been used as tissue sources as ECM. ECM also have been made from human issues such as cadavers. The most common source of ECM is porcine gelatin. However, animal derived proteins suffer from drawbacks such as high costs for industrial scale operation, risk of viral contamination, and batch to batch variations.
Alginate-based microbeads may be used as microcarriers in tissue engineering. Alginate-based microbeads are hydrophilic and have been proven to be effective in encapsulating cells. However, alginate-based microbeads alone may not be suitable for culturing a food product, e.g., cultured meat, due to its poor cytoaffinity arising from a lack of functional groups for interaction with cells, e.g., functional groups that can serve as specific cues for cell adhesion, or functional groups possessed by connective tissues with specific peptides sequences.
Without wishing to be bound by theory, it is believed that plant proteins have structural and composition diversity and may contain functional groups to enhance cytoaffinity, e.g., peptide sequences for attachment of cells. Plant proteins may possess bioactive molecules similar to ECM proteins and may function as ECM material to support cell culture. Hence, alginate microbeads were functionalized by coating with plant proteins. In the present disclosure, plant proteins were extracted by isoelectric point precipitation methods and their purities and amino acid profiles were characterized (Table 1 ). The plant proteins studied include soybean, mung bean, red lentil, rapeseeds, pea, chickpea, pumpkin seeds, oat, broad bean, and chia seed. The proteins were extracted such that they are not denatured and have good water solubility needed for coating of the microbeads. The alginate microbeads made by electrospraying were functionalized by coating with plant proteins by physical absorption and cross-linked by genipin, a natural protein cross-linking agent isolated from an edible plant. The coated beads were evaluated for their performance for muscle cell cultures.
Table 1 : Protein content of 11 types of plant protein.
N% Nitrogen-to-protein Protein content (%) Soluble conversion factor protein (mg/mL)
Soybean 14.08 5.66 79.69 352.87±46.99 a
Mung bean 15.00 6.25 93.75 335.07±42.63 a
Red lentil 13.78 6.25 86.13 330.92±21.04 a
Rapeseed 1 9.39 5.53 51.93 121 80±5.61
Rapeseed 2 11.00 5.53 60.83 113.61 ±0.94 de
Pea 12.73 6.25 79.56 151 ,65±23.92 cd
Chickpea 11.73 6.25 73.31 162.36±10.16 c
Pumpkin seed 15.24 5.30 80.77 105.53±7.36 e
Oat 7.91 5.83 46.12 98.22±14.71 e
Broad bean 11.62 6.25 72.63 320.39±26.53 a
Chia seed 8.74 5.71 49.91 264.00±15.52 b
Alginate microbeads used for coating had clean and smooth surfaces and a diameter of about 200 pm. As shown in FIG. 1 A, plant protein mung bean and soybean coating do not appear even because some black blocks were observed among the beads. Other plant protein coated beads were clearer on their surfaces, suggesting that proteins were coated more evenly on the microbeads.
The coatings of proteins were accomplished by impregnating the microbeads in respective solutions of the proteins and fixed by a cross-linking reagent. As a result, the successfully coated microbeads have self-fluorescence due to the fluorophore group formed between genipin and the cross-linked proteins.
As shown from the fluorescent microscope images of the coated beads (FIG. 1 B), the beads with fluorescence are an indication of successful coating of the proteins and the intensity of the fluorescence is correlated to the amount of protein being coated on the surface of the microbeads. The self-fluorescence of protein cross-linking by genipin allows the microbeads to be easily distinguished from cells under the fluorescent microscope.
It is apparent that pea, oat, chia seed protein coated microbeads have lower amounts of proteins coated. Some protein such as chickpea protein, soy protein and rapeseed protein 2 are evenly distributed on the whole microbeads, while other proteins (mung bean, lentil, rapeseed 1 , pumpkin seed, and broad bean) can only be coated on the surface of the microbeads. Uneven surfaces were observed on mung bean, broad bean and pumpkin protein coated microbeads (FIG. 1 B), and some black spots were found on the microbeads (FIG. 1A). Chickpea, rapeseed, and lentil coated microbeads were similar to that of gelatin coated ones (FIG. 1 B), which have smooth surfaces as non-coated alginate microbeads. This suggests that the roughness of surface on beads may not be dependent on the content of loaded protein and may instead be related to protein origin. After coating of the proteins, the microbeads were treated with cell culture media and no significant difference in size and shape was observed, suggesting that the microbeads are physically stable in cell culture media tor meat culture applications. Example 2: Effect of loading conditions on protein loading
Pumpkin protein coated on alginate microbeads was determined by BCA kit. The degree of protein loading was reflected by the fluorescent intensity due to the self-fluorescence of genipin derivatives formed in the cross-linking reaction. The BCA results along with the fluorescent intensity can conveniently reflect the amount of coated protein.
For pumpkin seed protein, the original pH during the coating process was 5.7. The value was adjusted to 5.0, 6.0 and 7.0 to investigate the effect of coating pH on gelatin loading (FIG. 2A and 2D). Coating at the original pH showed the highest protein concentration and fluorescence intensity with little change in size distribution compared with other pH conditions.
The naked alginate microbeads had a mean size of 188.7 ± 74.0 pm. Coating led to a smaller size of 159.5 ± 39.8 pm. For the pumpkin seed protein solution used for coating (FIG. 2B), 10% (w/v) protein led to the highest amount of coating at 293.2 ± 38.4 mg/g, while protein concentrations higher than 10% (w/v) did not lead to any increase of coated protein. However, a higher coating concentration of 20% (w/v) can lead to a larger size of microbeads and a size distribution width of 0.74 (alginate microbeads is 0.60) (FIG. 2E).
In addition, 10% (w/v) protein led to a significantly high fluorescent intensity of 721.7 ± 10.8 mg/g. Lowering the coating protein solution concentration to 4% (w/v) led to a decrease of coated protein and fluorescent intensity. In addition, 1% (w/v) coating protein can result in a much lower coated protein, protein fluorescent intensity and a smaller beads size of 148.2 ± 37.2 pm.
The coating solution was adjusted to 8% (w/v) protein, and it was found that the amount of coated protein, protein fluorescent intensity and beads size can be kept constant with a coating solution of 10% (w/v) protein (FIG. 20 and 2F). However, when the concentration of coating protein solution was lower than 6% (w/v), the coated protein decreased significantly. Therefore, this suggests that the sizes of the beads and the coated protein were mainly due to the amount of protein used.
Example 3: Cytoaffinity of plant protein coated microbeads
M ice-derived C2C12 is a good model to evaluate the performance of the microbeads. C2C12 cells were seeded on plant protein-coated microbeads to investigate the cytoaffinity of coated plant proteins.
C2C12 cells were seeded on microbeads to investigate the cyto-affinities of different plant protein coatings. Cells were grown inside a sterile, ultra-low attachment 24-wel I plate. DMEM complete medium containing serum-free DMEM with 10% fetal bovine serum, and 1 % penicillin-streptomycin was used. Each well contained approximately 0.03 g of coated beads that has a measured density of approximately 0.87 g/cm3 The beads are added together with 0.5 mL of medium. 0.5 mL of medium with a myoblast cell concentration of 2 x 104 /mL was inoculated into each well which resulted in a final count of 104 /well. The plate was left to incubate at 37 °C in 5% CO2. The concentration of cells was prepared after determining the number of cells in the stock solution via the hemocytometer. Cells were stained with trypan blue for cell counting. For routine maintenance, media were changed every two days by resuspension in fresh medium. Cell morphology was observed using the ECLIPSE Ts2 inverted microscope (Nikon, Tokyo, Japan), at 10 times magnification.
The morphologies of cells on plant-based microbeads were shown in FIG. 1A. After cell seeding, C2C12 cells were attached on mung bean, red lentil, and pumpkin seed protein coated beads and formed clusters on day 1 and grew rapidly and formed larger clusters with beads on day 3. Less C2C12 cells were attached on soybean protein and oat protein coated beads and only several individual cells on microbeads were observed on day 1 , and cell clusters were found on day 3. Nearly no cells were attached on protein broad bean, rapeseed 1 , rapeseed 2, chia seed coated beads on day 1 , and the status was the same for these 4 protein coated beads on day 3.
Cell counting was conducted a day after cell seeding after the cells have attached themselves to the microbeads and over the entire duration of its growth at appropriate time intervals. Cell growth and cell counting analysis during the 3- day incubation were done using the CCK-8 in triplicates. Wells are first drained off the remaining medium before the addition of 10 pL of CCK-8 solution and 100 pL of the medium. The wells are then incubated at 37°C for an hour before transferring the CCK-8 solution into a 96 well plate for absorbance reading at 450 nm.
Fold changes of cells during the 3-day culture on microbeads was shown in FIG. 3A. The change was the highest on pumpkin seed protein coated microbeads, followed by red lentil protein, which was similar to the morphology of cells in the brightfield image. The number of cells grown on pumpkin seed protein and gelatin coated microbeads was significantly higher than on other plant protein coated beads (FIG. 3A and 1A). Cells on pumpkin seed protein coated microbeads increased 6.8 folds within 3 days, which is comparable to gelatin coated microbeads (6.6 folds). The beads coated with broad bean, mung bean, lentil, rapeseed 1 and 2 only led to 4-5 folds cell increase, while the beads coated with soybean and pea protein performed the worse with only about 2-fold increase. Chickpea, oat, and chia seed protein coating led to no observable cytoaffinity.
The results of the cell seeding test demonstrated that pumpkin seed protein coated microbeads having the most concentrated size distribution of 160 pm had comparable cytoaffinity as gelatin coated microbeads.
Example 4: Correlation between characterization of coated protein and cytoaffinity Proteins extracted from 11 different plant seeds had different protein composition and property (Table 1 ). The protein content was the highest in mung bean protein (93.75%), followed by red lentil, pumpkin seed, soybean, pea, chickpea, broad bean protein. Protein content in rapeseed, oat and chia seed protein were low, ranging from 46.12 to 60.83%. Soluble protein in mung bean, soybean, red lentil, and broad bean protein were significantly higher, more than 320 mg/mL in 4% (w/v) protein solution. Other soluble proteins were in small variation, ranged from 98.22 ± 14.71 to 162.36 ± 10.16 mg/mL, except for chia seed soluble protein which was 264.00 ± 15.52 mg/mL. However, it was found that the solubility of protein and cytoaffinity has no relationship from FIG. 3B.
The content of positively charged amino acid arginine and lysine having a high cell-penetrating ability is shown in Table 2. The content of arginine varies with different plant proteins, and number having a strong relationship with the increase of cell number (FIG. 3C). Lysine contents in all plant protein were almost same, except for oat and chia seed proteins (FIG. 3D). The content of lysine had a weak correlation with cytoaffinity of the beads.
Table 2: Content of positive charged amino acid in plant proteins
Lysine (g/100g protein) Arginine (g/100g protein)
Soybean 6.40 7.40
Mung bean 6.24 6.40
Red lentil 6.70 7.80
Rapeseed 4.70 9.70
Pea 7.60 8.20
Chickpea 6.50 9.00
Pumpkin seed 4.66 14.00
Oat 2.85 5.79
Broad bean 6.40 10.20 Chia seed 2.99 4.23
The BCA and fluorescence intensity results showed that the pumpkin seed protein was successfully coated on alginate microbeads, and when the coating protein solution was 8% (w/v), a significantly high amount of coated protein content was observed.
Example 5: Cell proliferation on microbeads coated with pumpkin proteins
Pumpkin seed protein was selected for further study and the amount of coated protein was maximized to 8% (w/v). The resulting microbead was used for evaluation of their performance on cell culture. To investigate the proliferation of C2C12 cells in longer incubation period, 3x103/mL C2C12 cell were seeded on the coated beads and the cell growth during the 13-day incubation were monitored by CCK8 and confocal microscope. The confocal microscope image showed a few cells attached on the self-fluorescent microbeads on day 1 (FIG. 4A). On day 3, more cells were found evenly distributed on the surface of coated microbeads. The cells on pumpkin seed protein coated microbeads were able to fully cover the beads and the cells connected the adjacent beads forming a cluster on day 5. From day 7 onwards, there were larger cell and microbeads clusters observed. The cell numbers experienced a slightly slower increase from day 5 and reached the max value of 17.2 folds increase on day 7. The cessation of cell growth was observed from day 7 and the cell numbers gradually decreased and stabilized until day 13. The reason for growth arrest is unclear. One possible reason could be that the cells might need some stimulation to keep growing.
To expand the scope of the pumpkin seed protein coated microbeads on other cells, 3x103/mL 3T3 cell were seeded on the microbeads. The cell growth during the 15-day incubation was monitored by CCK8 and confocal imaging which showed a few cells attached on the self-fluorescent microbeads on day 1 (FIG. 4B). On day 3, more cells were found on the surface of some coated microbeads. The cells on the microbeads were able to fully cover the beads and the cells connected the adjacent beads together forming a cluster since day 5. A sharp increase in cell numbers was observed from day 3 to day 5, consistent with the confocal images. Cell numbers experienced a slightly slower increase from day 5 and reached the maximum value of 8.7 folds on day 7. The cessation of cell growth was observed from day 7. Cell numbers gradually reduced from day 7 and stabilized from day 9 to 13. However, a decrease of cell number was observed from day 13. The results showed that besides muscle cells C2C12, adipocyte 3T3 cells can also attach on pumpkin seed protein coated microbeads and achieve 8.7-fold increase in cell number, making pumpkin protein coating comparable with gelatin (9-fold increase of 3T3) for culturing adipose tissue.
To further explore the utility of the microbeads for meat culture, primary porcine myoblasts and chicken muscle satellite cells were seeded on pumpkin seed protein-coated microbeads and alginate microbeads. The cell growth was monitored by bright-field microscope. For alginate beads, no chicken and porcine cells attached on the microbeads, and the suspended cells formed clusters by themselves because of the low cyto-affinity of alginate (FIG. 5C and 5F). In contrast, it was observed that cells attached on the protein coated microbeads. Some clusters can be observed in FIG. 5A and 5D, and the magnified images (FIG. 5B and 5E) showed these clusters were formed by cells connected to adjacent microbeads. The morphology of chicken and porcine cells were different when they attached on microbeads. As shown by the arrows, the chicken muscle satellite cells appeared round shape which is a typical characteristic of most satellite cells during the duplicative phase, and the porcine myoblasts typically appeared spindle-shaped, and can cross the adjacent microbeads and fuse into adjacent fibers.
Taken together, the results showed that microbeads with pumpkin seed protein coating have good cytoaffinity and could be used as a microcarrier for different cell types. Although tissues grown from C2C12 and 3T3 cells may not be accepted by consumers because of its origin from mice, they are good model cells to evaluate the performance of microbeads due to its fast-growing rates. In contrast, chicken and porcine cell-based meat may have better acceptance. The results showed that primary porcine myoblasts and chicken muscle satellite cells both had better attachment on the coated microbeads as compared with the cells seeded on naked alginate microbeads. These results further proved that the pumpkin seed protein coating have high cytoaffinity for different cell types.
Example 6: C2C12 cell differentiation on pumpkin seed protein coated microbeads
The expression levels of integrin 1 , M-cadherin, MyoD1 , Myf5 and Myh7 in C2C12 were determined by RT-qPCR (FIG. 6A-D). Relative expression levels of integrin 01 and M-cadherin were both significantly higher in C2C12 cells seeded on pumpkin seed protein coated microbeads than the cells grown on a 2D plate. After differentiation, the expressions of MyoD1 and Myf5 in C2C12 cells seeded on pumpkin seed protein coated microbeads were the highest on day 4. The expressions of MyoD1 and Myf5 on microbeads were also significantly higher on day 4 of differentiation than that on a 2D cultured C2C12 cells. The expression level of Myh7 on microbeads was the highest on day 7 and exceeded that of the cells grown on a 2D plate. The confocal images (FIG. 6E) showed that C2C12 cells on 2D plates can fuse during differentiation and some myotubes containing more than one cell nuclei can be observed on day 4 and day 7 of differentiation. On the other hand, C2C12 cells on microbeads can fuse and form fibers during 7 -day differentiation (FIG. 6F).
Example 7: Characterization of pumpkin seed proteins
An analysis of the proteins was conducted in order to understand the high cytoaffinity and activity for cell proliferation of pumpkin seed coated proteins. Pumpkin seed protein has 4 bands in 20, 37, 40, and 55 kDa, of which the first two bands (P1 20 kDa and P2, 37 kDa) have much higher concentrations (FIG. 7). These two bands and one broad bean band from SDS-page named B1 were subjected to tryptic digestion for proteomic analysis (LC-MS), which detected 18406 fragments from P1 , 19672 spectra for P2, and 26449 for B1 hydrolysates. After a strict cut-off for unused protein score > 2.0 (99% confidence), 21 proteins (1634 peptides) for P1 , 28 proteins (1825 peptides) for P2, and 13 proteins for B1 (131 peptides) were identified from mass spectra by sequence by similarity searching.
The identified pumpkin proteins were derived from 11 S globulin, vicilin-like seed storage protein, superoxide dismutase and aspartic proteinase. Most of the peptides were from 11 S globulin with minor variation in sequences. It was suggested that cell adhesion peptides RGD (SEQ ID NO: 1 ) and DGEA (SEQ ID NO: 8) may be responsible for the high cytoaffinity of proteins. Therefore, a search was conducted for peptide fragments in pumpkin seed protein and it was found that a few peptides containing cell adhesion peptides were identified from P1 (nine) and P2 (ten), respectively. For example, the four peptide sequences containing such units:
RGDMIWPAGTVQWCHNDGGQDLIAIAFLDLNNEDNQLDLR (SEQ ID NO: 13),
RGDMIWPA (SEQ ID NO: 14),
RGDMIWPAGTVK (SEQ ID NO: 15),
LVYWDGEANFQISDDYGNQVFNER (SEQ ID NO: 16) are found in both P1 and P2.
Other peptides presented in Table 3 have similar sequence with these 4 peptides, except for GGQRGDEQQWEEEQEEEQER (SEQ ID NO: 17) in P1.
The identified broad bean proteins were derived from elongation factor 1 - alpha, ATP synthase subunit alpha, glucose-1 -phosphate adenylyltransferase, convicilin and others. Two peptides containing cell adhesion peptides RGD were from ATP synthase subunit alpha. The two peptides WDALGVPIDGR (SEQ ID NO: 18) and ELIIGDR (SEQ ID NO: 19), may have contributed to the cyto-affinity of broad bean protein as well because both RGD (SEQ ID NO: 1 )- and DGR (SEQ ID NO: 3)-containing peptides have been demonstrated to compete with adhesive proteins for integrin interaction. In contrast, most identified peptides from broad bean containing arginine (Table 4) were located in the C-terminal of peptides.
Table 3. Pumpkin seed protein containing cell adhesion peptides.
Origin %Cov(95) Accessions Name Conf Sequence
P1 66.7 tr|A0A6J1 HXD8 11 S globulin subunit 99.0 GGQRGDEQQWEEEQEEE
_CUCMA beta QER (SEQ ID NO: 17)
P1 56.9 tr|A0A6J1 HV45 11 S globulin seed 99.0 RGDMIWPAGTVQWCHND
_CUCMA storage protein GGQDLIAIAFLDLNNEDNQ
LDLR (SEQ ID NO: 13)
P1 56.9 tr|A0A6J1 HV45 11 S globulin seed 99.0 RGDMIWPAGTVQ
_CUCMA storage protein (SEQ ID NO: 20)
P1 56.9 tr|A0A6J1 HV45 11 S globulin seed 70.0 RGDMIWPA
_CUCMA storage protein (SEQ ID NO: 14)
P1 56.9 tr|A0A6J1 HV45 11 S globulin seed 99.0 RGDMIWPAGTVQWCHND
_CUCMA storage protein GGQDLIAIAFLDLNNEDNQ
LDLR (SEQ ID NO: 13)
P1 53.0 tr|A0A6J1 K8H1 11 S globulin seed 99.0 RGDMIWPAGTVK
_CUCMA storage protein (SEQ ID NO: 15)
P1 53.0 tr|A0A6J1 K8H1 11 S globulin seed 99.0 RGDMIWPAGTVKWCHND
_CUCMA storage protein GGQDLVIVSFLDLNNEDNQ
LDLR (SEQ ID NO: 21)
P1 53.0 tr|A0A6J1 K8H1 11 S globulin seed 70.0 RGDMIWPA
_CUCMA storage protein (SEQ ID NO: 14)
P1 56.9 tr|A0A6J1 HV45 11 S globulin seed 99.0 LVYVVDGEANFQISDDYG
_CUCMA storage protein NQVFNER (SEQ ID NO: 16)
P2 73.5 tr|A0A6J1 HV45 11 S globulin seed 99.0 RGDMIWPAGTVQWCHND
_CUCMA storage protein GGQDLIAIAFLDLNNEDNQ
LDLR (SEQ ID NO: 13)
P2 73.5 tr|A0A6J1 HV45 11 S globulin seed 99.0 RGDMIWPAGTVQW
_CUCMA storage protein (SEQ ID NO: 22)
P2 73.5 tr|A0A6J1 HV45 11 S globulin seed 72.3 RGDMIWPA
_CUCMA storage protein (SEQ ID NO: 14) P2 67.1 tr|A0A6J1 K8H1 11 S globulin seed 99.0 RGDMIWPAGTVK
_CUCMA storage protein (SEQ ID NO: 15)
P2 67.1 tr|A0A6J1 K8H1 11 S globulin seed 72.3 RGDMIWPA
_CUCMA storage protein (SEQ ID NO: 14)
P2 73.5 tr|A0A6J1 HV45 11 S globulin seed 99.0 LVYVVDGEANFQIS
_CUCMA storage protein (SEQ ID NO: 23)
P2 73.5 tr|A0A6J1 HV45 11 S globulin seed 99.0 LVYVVDGEANFQISD
_CUCMA storage protein (SEQ ID NO: 24)
P2 73.5 tr|A0A6J1 HV45 11 S globulin seed 99.0 LVYVVDGEANFQISDDYG
_CUCMA storage protein NQVFNER (SEQ ID NO: 16)
P2 73.5 tr|A0A6J1 HV45 11 S globulin seed 99.0 VVDGEANFQISDDYGNQV
_CUCMA storage protein FNER (SEQ ID NO: 25)
P2 73.5 tr|A0A6J1 HV45 11 S globulin seed 59.5 LVYVVDGEANFQ
_CUCMA storage protein (SEQ ID NO: 26)
B1 2.0 tr|R4IV40_ ATP synthase 74.7 VVDALGVPIDGR
VICFA subunit alpha (SEQ ID NO: 18)
B1 2.0 tr|R4IV40_ ATP synthase 99.0 ELIIGDR (SEQ ID NO: 19)
VICFA subunit alpha
Table 4: Broad bean protein containing arginine.
Origin %Cov(95) Accessions Name Conf Sequence
B1 17.7 sp|O24534|EF1A Elongation factor 1 - 99.0 RGFVASNSKDDPAK
_VICFA alpha (SEQ ID NO: 27)
B1 2.0 tr|R4IV40 ATP synthase 74.7 VVDALGVPIDGR
_VICFA subunit alpha (SEQ ID NO: 18)
B1 2.0 tr|R4IV40 ATP synthase 99.0 ELIIGDR (SEQ ID NO: 19)
_VICFA subunit alpha
B1 17.7 sp|O24534|EF1A Elongation factor 44.0 LGGIDKR (SEQ ID NO: 28)
_VICFA 1 -alpha
B1 17.7 sp|O24534|EF1A Elongation factor 98.1 FEKEAAEMNKR
_VICFA 1-alpha (SEQ ID NO: 29)
B1 17.7 sp|O24534|EF1A Elongation factor 49.4 EAAEMNKR
_VICFA 1-alpha (SEQ ID NO: 30)
B1 17.7 sp|O24534|EF1A Elongation factor 99.0 YYCTVIDAPGHR
_VICFA 1-alpha (SEQ ID NO: 31) B1 8.2 sp|P52417|GLGS2 Glucose-1 -phosphate 97.8 AKPAVPLGANYR
VICFA adenylyltransferase (SEQ ID NO: 32)
B1 8.2 sp|P52417|GLGS2 Glucose- 1 -phosphate 36.2 SSPIYTQPR
VICFA adenylyltransferase (SEQ ID NO: 33)
B1 8.2 sp|P52417|GLGS2 Glucose- 1 -phosphate 99.0 IINSDNVQEAAR
_VICFA adenylyltransferase (SEQ ID NO: 34)
B1 2.0 sp|P53536|PHSL Alpha-1 ,4 glucan 99.0 DAWNITQR
_VICFA phosphorylase L (SEQ ID NO: 35) isozyme
B1 2.0 sp|P53536|PHSL Alpha-1 ,4 glucan 85.0 AREIVGLR
_VICFA phosphorylase L (SEQ ID NO: 36) isozyme
B1 2.7 tr|A0A059PAV5 Actin 99.0 AGFAGDDAPR
_VICFA (SEQ ID NO: 37)
B1 2.7 tr|A0A059PAV5 Actin 55.7 DAYVGDEAQSKR
_VICFA (SEQ ID NO: 38)
B1 2.7 tr|A0A059PAV5 Actin 71.1 WAPPER
_VICFA (SEQ ID NO: 39)
B1 2.5 tr|O04919_VICFA Lipoxygenase 99.0 DTMNINALAR
(SEQ ID NO: 40)
B1 2.3 tr|B0BCL7_VICFA Convicilin 65.4 NKNGYIR
(SEQ ID NO: 41)
B1 2.3 tr|B0BCL7_VICFA Convicilin 69.9 AILTVLSPNDR
(SEQ ID NO: 42)
B1 2.3 tr|B0BCL7_VICFA Convicilin 99.0 NSYNLER
(SEQ ID NO: 43)
B1 2.3 tr|B0BCL7_VICFA Convicilin 23.7 EDEQQERNKQVQR
(SEQ ID NO: 44)
B1 2.3 tr|B0BCL7_VICFA Convicilin 29.9 NKQVQR
(SEQ ID NO: 45)
B1 0.7 tr|A0A023l2W9_VI DNA-directed RNA 99.0 MLSLSPSR
CFA polymerase subunit (SEQ ID NO: 46)
B1 1.2 tr|Q43855_VICFA Beta- 72.8 GIQAIPR fructofuranosidase; (SEQ ID NO: 47) cell wall invertase I B1 2.0 sp|P53536|PHSL Alpha-1 ,4 glucan 99.0 EMNAAER
_VICFA phosphorylase L (SEQ ID NO: 48) isozyme
B1 2.7 tr|R4IUB4_VICFA Uncharacterized 99.0 IGLSIGGR protein (SEQ ID NO: 49)
B1 10.2 tr|R4ITZ7_VICFA NADH-ubiquinone 99.0 GPRYTVLICVGPR oxido reductase (SEQ ID NO: 50)
B1 6.6 tr|B6RPT3_VICFA Phosphogluconate 99.0 LPANLVQAQR dehydrogenase (SEQ ID NO: 51)
B1 7.3 RRRRRtr|R4IV20 REVERSED 99.0 TSGIMINR
_VICFA Uncharacterized (SEQ ID NO: 52) protein
B1 2.1 sp|Q06215|PPO Polyphenol oxidase 95.7 DPIFYSHHSNVDR
VICFA (SEQ ID NO: 53)
B1 7.3 RRRRRtr|R4IU44 REVERSED ATP 91 .4 IGLSLAR (SEQ ID NO: 54)
VICFA synthase
B1 5.4 tr|B0BCL8_VICFA Convicilin 72.8 NENGHIR (SEQ ID NO: 55)
B1 1.4 tr|A0A023l2L2 ATP synthase 65.4 LSADLFNAGIR
VICFA subunit alpha (SEQ ID NO: 56)
Although pumpkin seed proteins have relatively poor solubility as compared to other proteins, it is sufficient to achieve coating of microbeads that exhibited the best performance as ECM materials for cell culture. From the SDS- PAGE bands, the isolated pumpkin seed proteins showed two major bands in 20 and 37 kDa, which are characteristic 11 S proteins consisting of an acidic polypeptide (27-37 kDa) and a basic polypeptide (20-24 kDa) linked by a disulfide bond. Some fibroblast growth factors such as ECGF, aFGF, and (HBGF)-1 are acidic polypeptide, the band around 37 kDa might be an important part for cell growth. Moreover, some peptide sequences known as transduction domains or membrane translocation signals contain positively charged amino acid residues such as arginine and lysine, which may have a high cell-penetrating ability. Lysine content in pumpkin seed protein was close to that of other plant proteins, the high arginine content is a prerequisite for its superior cytoaffinity. Arginine is a positively charged amino acid, and is the initial amino acid of cell adhesion tripeptide RGD (SEQ ID NO: 1). Other peptides exhibiting cell adhesion property include RGD, IKVAV (SEQ ID NO: 6), YIGSR (SEQ ID NO: 7), DGEA (SEQ ID NO: 8), PHRSN (SEQ ID NO: 9), and PRARI (SEQ ID NO: 10). The RGD and DGEA sequences were found in pumpkin seed proteins. These cell-binding peptide sequences could couple with integrin receptors and activate on osteoblast gene expression. The higher cell attachment ability of pumpkin seed protein might be caused by higher peptide sequences containing RGD units. In agreement, gelatin also contains good amount of RGD peptides. In contrast, broad bean protein coated microbeads had poor cytoaffinity. Although there are many R-residues in broad bean peptides, there are only two DGR (SEQ ID NO: 3)-containing peptides identified from broad bean proteins.
Example 8: Characterization of alginate microbeads with commercial protein coating
Commercial plant proteins (chickpea, mung bean, soybean, and pea protein) powders were purchased from Yantai T. Full Biotech Co., Ltd. These plant proteins were used to prepared 4% (w/v) protein solution by dissolving in water as coating solution using the protocol described in the Methods section.
As shown in FIG. 8A, pea protein coating was not even because some black blocks were observed among the microbeads. Other plant protein coated beads were much clearer on the surface, suggesting that proteins were coated more evenly on the microbeads.
Primary porcine myoblasts were seeded on microbeads with a density of 3x104 /mL, grown inside a sterile, ultra-low attachment 24-well plate. Every 500 mL of complete medium contained 420 mL of F10 medium, 15% fetal bovine serum, 1 % penicillin-streptomycin, and 10 ng/mL FGF2. Each well contained approximately 0.03 g of coated beads that has a measured density of approximately 0.87 g/cm3. The beads were added together with 0.5 mL of medium. 0.5 mL of medium with a myoblast cell concentration of 6 x 104 cells/mL was then inoculated into each well which then resulted in a final count of 3 x 104 /well. The plate was then left to incubate at 37 °C in 5% CO2. The concentration of cells was prepared after determining the number of cells in the stock solution via the hemocytometer. Cells were stained with trypan blue to facilitate cell counting. For routine maintenance, media were changed every two days by resuspension in fresh medium. The morphology of cells on plant-based microbeads at day 7 is shown in FIG. 4. There was no cell growth or little growth displayed for non-hydrolysed plant proteins at day 7. The fold change in cell number based on Cell Counting Kit-8 (CCK8) was around 2.5 on plant protein chickpea, mung bean and pea protein coated microbeads (FIG. 8B). The cells number was nearly not changed after 7-day culture on soy protein coated microbeads. Similar to the result in the brightfield microscope image, the cells displayed little growth after seven days.
C2C12 cells with a density of 104 /mL were seeded on microbeads to investigate the cytoaffinity of different plant protein coating by referring to the above method. The fold change of cells during 3-day culture on microbeads is shown in FIG. 8C. Similar to the primary porcine myoblasts seeding results, there was little change in the cell number.
It was concluded that these commercial plant proteins may not be suitable for primary porcine myoblasts and C2C12 cell growth as the cells displayed little growth.
Example 9: Characterization of alginate microbeads with plant protein hydrolysate coating
Alginate microbeads have clean and smooth surfaces without any fluorescence. Coating was accomplished by impregnating the microbeads in the respective protein hydrolysates and fixed by a cross-linking reagent genipin. Well coated microbeads will display a dark blue color due to the chromophore formed by the cross-linking agent and amino acid residue of proteins.
As shown from the images of microbeads (FIG. 9A and 9B), the blue color indicates that proteins were successfully coated onto the microbeads. From the microscope images, beads were shown to be coated with evenly distributed proteins coatings on the outer layer. However, broad bean protein hydrolysate not only coated onto the beads but also formed big protein aggregates by themselves. The morphology of beads may differ according to the variety of protein hydrolysate coated.
Before coating, alginate microbeads were about 200 pm in diameter. After coating with the protein hydrolysates, the diameter of microbeads decreased to 160 to 170 pm (Table 5). The autoclaved microbeads were incubated in cell culture media at 60 °C for 3 days to determine the stability of the beads. Uncoated alginate microbeads swelled a little after immersing into media initially, but they shrunk significantly after 3 days. Other microbeads with unstable or thin coating exhibited the same behavior as well. As shown in Table 5, soybean, chickpea, pumpkin, rapeseed protein hydrolysis coated microbeads have no significant difference in size after the 3-day incubation in culture media, indicating that the beads are physically stable.
Table 5: Size of plant protein hydrolysate coated microbeads with different treatment
Coated Mean diameter (pm) hydrolysate No treatment DO D3
Mung bean 164.91 ± 5.04 a 178.45 ± 10.10 b 169.90 ± 14.99 a
Soybean 167.12 ± 6.60 172.86 ± 15.19 169.04 ± 11.85
Lentil 165.53 ± 4.26a 181.69 ± 17.93 b 173.04 ± 9.40 a
Broad bean 166.22 ± 7.37a 188.48 ± 14.92 b 171 .21 ± 13.13 a chickpea 167.53 ± 6.84 a 191.88 ± 9.49 b 186.05 ± 11.74 b Pea 168.41 ± 9.01a 188.70 ± 20.88 b 169.10 ± 10.79 a
Pumpkin 169.02 ± 7.96 175.14 ± 12.99 168.89 ± 12.23
Rapeseed 1 166.81 ± 12.53 a 193.99 ± 16.68 b 184.34 ± 12.83 b
Rapeseed 2 162.41 ± 8.87 a 185.17 ± 9.30 b 181 .32 ± 13.70 b
Alginate 201.70 ± 11.11 b 204.17 ± 7.24 b 183.10 ± 11.69 a
No treatment means microbeads kept in storage solution; DO means microbeads immersed in media at room temperature within 1h; D3 means microbeads immersed in media at 60°C for 3 days. Data are expressed as means ± standard deviation of samples. Different lowercase letters in same row represent significant differences (p < 0.05).
Example 10: Cytoaffinity of functionalized microbeads coated with plant protein hydrolysate
C2C12 cells were seeded on plant protein coated microbeads to investigate the cytoaffinity of 9 types of plant proteins. Cell growth during a 3-day incubation was monitored by CCK8. After the 3-day culture, the number of cells grown on chickpea hydrolysate was significantly higher than on other hydrolysates coated beads (FIG. 10A-F). Before hydrolysis, cells on pumpkin seed protein coated microbeads used to have the highest increase of 6.8 folds within 3 days. After hydrolysis, cells on chickpea protein hydrolysate coated microbeads have the highest increase of 8.5 folds, followed by 7.4 folds on red lentil hydrolysate, both were higher than that of pumpkin seed protein coated microbeads (6.6 folds). Among the other 7 types of plant protein hydrolysate, soybean and rapeseed 1 protein hydrolysates displayed only slight improvements in cytoaffinity after hydrolysis, while the hydrolysis of the other proteins led to lower cell proliferation. The results demonstrate that chickpea protein hydrolysate outperformed the rest and therefore was selected to carry out in-depth study to understand the reason behind its superior cytoaffinity.
The result of FIG. 10A showed that the cytoaffinity of chickpea protein was improved as CPH coating has helped to enhance cell proliferation to a considerable extent. Hydrolysis helps to expose arginine to cells and, therefore, enhanced the cytoaffinity of chickpea protein coating on microbeads. Positively charged lysine is also exposed during trypsin hydrolysis. However, the lysine content only has a weak correlation with cytoaffinity. In addition, the cytoaffinity of other protein hydrolysis did observe the same correlation after trypsin treatment. Therefore, the enhanced cytoaffinity observed may not only be attributed to the increase in positively charged amino acids, but also other factors as well.
Peptides produced by trypsin hydrolysis may also contribute to improved cytoaffinity. RGD-containing peptides having cell adhesion motif can be exposed during trypsin treatment. Additionally, arginine is the initial amino acid of cell adhesion peptide RGD. A search on UniProt was conducted to find RGD- containing peptides in the 9 plant proteins (Table 6), respectively. It was found that rapeseed has the maximum number of RGD-containing peptides of 7066 in types, although most are hypothetical peptides. Soybean has 4122 RGD- containing peptides, of which 17 having been reported. A peptide from soybean, named lunasin, contains the sequence of RGDDDDDDDDD (SEQ ID NO: 57) and was reported to possess cell adhesion effects. Mung bean and pumpkin have relatively high amounts of RGD-containing peptides (2213 and 2051 peptides), followed by chickpea with 1706 peptides. These RGD-containing peptides may contribute cytoaffinity of these plant proteins with muscle cells. In addition, three (CPe)-lll (RQSHFANAQP) containing peptides were also identified only from chickpea protein (Table 6).
Table 6. RGD containing bioactive peptides found in plant proteins.
Organism Containing Matching sequence entries
Unreviewed1 Reviewed2
Vigna radiata var. radiata (Mung RGD 2051 0 bean) (SEQ ID NO: 1)
Glycine max (Soybean) RGD 4105 17 Lens culinaris (Lentil) (Cicer lens') RGD 9 2
Vicia faba (Broad bean) (Faba RGD 17 3 vulgaris)
Cicer arietinum (Chickpea) RGD 1704 2
(Garbanzo)
Pisum sativum (Garden pea) RGD 68 23
Cucurbita maxima (Pumpkin) RGD 2213 0
(Winter squash)
Brassica napus (Rape seed) RGD 7060 6
Cicer arietinum (Chickpea) RQSHFANAQP 3
(Garbanzo) (SEQ ID NO: 11)
Cicer arietinum (Chickpea) GAGAGS 13
(Garbanzo) (SEQ ID NO: 12)
1 Unreviewed means records that await full manual annotation. 2Reviewed means records with information extracted from literature and curator-evaluated computational analysis.
Example 11 : Correlation between degree of hydrolysis and cytoaffinity The results in Example 10 suggest that enzymatic hydrolysis of chickpea protein could release its potential for cytoaffinity. It is believed that the degree of hydrolysis could affect the performance of the resulting protein hydrolysates. To verify this, hydrolysis of the proteins was conducted with different trypsin and protein ratios to achieve different DH. The hydrolysis was firstly carried out with varying E/S% of 0.1 %, 0.5%, 1 %, 3%, and 5% with the duration being fixed at 120 minutes. DH, which is defined as the proportion of the number of peptide bonds being broken in protein hydrolysis was determined after the completion of hydrolysis. Based on the result of DH analysis (FIG. 10B), it was observed that when
E/S% increased from 0.1 % to 5%, DH increased from 3.5 ± 0.1 to 7.0 ± 0.2 %. However, it did not significantly increase further when E/S% is higher than 3%. To study the DH across varying durations, the hydrolysis was conducted with an E/S% of 0.5% and the rest of the conditions were held constant. At the 5-, 15-, 30-, 60-, and 120-min mark, the hydrolysate was withdrawn to deactivate the enzymes and to determine the DH. It was established that DH only increased from 1.5 ± 0.2 for 5 minutes hydrolysis to 4.5 ± 0.1 % for a 60-minute hydrolysis and entered a stationary phase beyond 60 minutes as the DH did not vary significantly with longer durations of hydrolysis (FIG. 10C), indicating the trypsin has completed the hydrolysis with selected peptide bonds that contain positive a ino acid residues (Arg and Lys).
Cell seeding was conducted to establish the correlation between degree of hydrolysis and cell growth. Protein hydrolysates, with five different DHs, formed via various hydrolysis conditions were used to conduct cell seeding for three days. As shown in FIG. 10D, the C2C12 cell adhesion at day 1 was significantly higher in DH 3.5% and 4.5% samples but did not increase with beads coated with protein hydrolysates with higher DH. After the 3-day cell culture, C2C12 proliferation increment rose from 2.1 -folds to 12.6-folds when DH is increased from 1.5 to 3.5%. However, when DH is increased to 4.5% and above, cell proliferation remained at 8.1 -folds, and did not increase further (FIG. 10E). Besides muscle cells C2C12, adipose cells 3T3-L1 were seeded on microbeads with hydrolysates of differing DH as well. As shown in FIG. 10F, 3T3 cell proliferation increment rose from 2.3-folds to 7.1 -folds when DH is increased from 1 .5 to 3.5%. However, when DH is increased to 4.5 % and above, cell proliferation reduced to around 3.4-folds, and did not increase further. These results show that there is an optimal degree of hydrolysis for cytoaffinity at around 3.5%.
Trypsin treatment under different conditions leads to various degrees of hydrolysis. Chickpea hydrolysates with different DH has different impacts on cell behavior on the coated microbeads. Lower DH resulted in longer peptides, which could lead to stronger forces of attraction between the beads and the cells due to the larger molecular weight. It has also been reported that peptide fraction of 3.5- 7 kDa showed the highest fibroblast growth-stimulating activity. It has also been reported that an increase in DH may result in a higher number of peptide bonds being cleaved but it does not equate to higher bioavailability. This can be observed in the example as well, partial hydrolysis is favorable, and it was determined that 3.5% is the optimal DH of CPH for cell growth.
Example 12: Alginate microbeads with plant protein hydrolysate coating
Commercial plant proteins were subjected to enzymatic hydrolysis. The hydrolysis using both enzymes was carried out over 120 minutes with 1 % E/S% in 5% protein dispersion. After hydrolysis, the enzymes were deactivated via heating at 95 °C for 15 minutes. The hydrolysates were centrifuged twice at 10000 g for 15 min, and the supernatant was collected and stored at 4 °C. Hydrolysis using papain was carried out in a shaking water bath at 60 °C at pH 7 while for trypsin the temperature was set at 50 °C at pH 8.
The resultant hydrolysates were centrifuged to remove the insoluble peptides and the supernatant was used for coating. The alginate beads immersed into the coating solution (w/v of 1/3) were immediately vortexed and then agitated using a shaker (Rotamax 120, Heidolph instruments GmbH & Co. KG, Germany) at a speed of 150 rpm. After coating for 2 h, microbeads were collected by a cell strainer then washed with water for 3 times. The coated alginate microbeads were cross-linked by immersing in a 1 mg/mL genipin solution with a ratio of 1 :4 (beads: genipin solution, w/v) and shaken at 150 rpm in a 60 °C water bath (SW22, Julabo USA Inc., Allentown, PA, USA) for 3 h, then collected and washed with DI water for 3 times after cross-linking. After coating alginate microbeads and cross-linking by genipin, the modified microbeads were stored in 0.1 M CaCl2 solution at a concentration of 0.2 g beads/mL, before being autoclaved and collected by the cell strainer for cell culture.
Primary porcine myoblasts were grown on the respective coated beads by referring to the previous method described in Example 8. Fold changes of cells during a 7-day culture are as shown in FIG. 11. It is evident that trypsin hydrolysis for all plant proteins, except for pea protein, resulted in more desirable peptides that support myoblast cell growth, of which chickpea hydrolysates led to the highest growth with a 3.15 ± 0.60 -fold increase. There is negligible growth for hydrolysates produced via hydrolysis with papain. As papain has a very broad specificity as compared to trypsin which has only two cleavage sites- Arg and Lys, it possibly could have led to the production of shorter chain peptides as compared to the hydrolysis by trypsin. It is hypothesised that the adhesion of shorter chain peptides on beads may not be as strong as longer chain peptides, leading to a loss of protein during cell growing stages. Additionally, as peptides produced via papain hydrolysis tend to be hydrophobic and precipitate as solids, they could have been lost after centrifugation. Thus, even when shorter chains are favoured for cell growth, the inability to adhere to the beads would mitigate the positive effects on cell proliferation.
Similar to the cell growth results shown above, the cell morphology observations in FIG. 12 also showed that protein hydrolysates produced using papain has no effect on cell growth while hydrolysates from trypsin were able to supplement better cell growth. Chickpea which is hydrolysed by trypsin has the highest cell growth on day seven under an inverted microscope followed by pea. No cell growth was observed on soy and mung bean protein coated beads even after hydrolysis by both enzymes, which meant that these two proteins are unsuitable to be used in this study. Chickpea hydrolyzed by trypsin was considered a coating material with better cytoaffinity.
Hydrolysis of chickpea was firstly carried out with varying E/S% of 1 %, 3%, 5%, 15%, 20%, 30%, and 50% with the duration being fixed at 120 minutes. DH, which is defined as the proportion of the number of peptide bonds being broken in protein hydrolysis, was determined after the completion of hydrolysis. Based on FIG. 13A, an E/S% of 1 % gave the lowest DH of 2.75 ± 0.18 % and it gradually increased to 5.61 ± 0.18 % at an E/S% of 15%. When E/S% continued to increase from 15% to 50%, the DH remained stagnant and did not increase further. Thus, the maximum DH attainable only required a E/S% of 15% for a 2-hour hydrolysis of 5% protein dispersion. Hydrolysis was conducted with an E/S% of 15% and the rest of the conditions were held constant over a period of 18 hours. At the 2, 4, 8, 13-hour mark, 60 mL of the hydrolysate was withdrawn to deactivate the enzymes and to determine DH. It was established that DH only increased from 5.61 ± 0.18 % for a two-hour hydrolysis to 6.88 ± 0.18 % for a four-hour hydrolysis, and entered a stationary phase beyond four hours as the DHs did not vary significantly with further hydrolysis. This shows that with an E/S% of 15% and 4-hours hydrolysis, it has reached the complete hydrolysis of lysine and arginine of the 5% protein dispersion. BCA protein assay was also conducted for microbeads coated with different hydrolysis duration. Based on FIG. 13B, the protein adhered to the microbeads was the highest for 2 hours of hydrolysis which gave a value of 17.52 ± 1.25 mg/g. However, it decreased significantly to 4.22 ± 1.00 mg/g when hydrolysis was beyond 8 hours. This shows that the optimum DH to achieve the highest amount of protein coated on beads could be 5.61 ± 0.18 %, any DH above this may have a negative correlation with protein concentration coated on the beads.
Based on the results, when DHs increased from 2.75 ± 0.18% to 5.61 ± 0.18% and cell proliferation increment rose from 3.01 ± 0.41 -fold to 4.07 ± 0.42 - fold. However, when DH is further increased to 6.88 ± 0.18% (4h hydrolysis), cell proliferation increment decreases to 1.44 ± 0.30-fold. Longer peptides produced by shorter hydrolysis duration are likely to have better adhesion on beads as compared to the shorter peptides or even amino acids that have been produced from longer hydrolysis duration.
Microscope images of cell morphology correspond with the results shown in FIG. 14 as cell growth was the highest on microbeads coated by protein hydrolysis with DH of 5.61 %. DH beyond 6%, led to a negative correlation with cell growth. This can be observed in FIG. 15 at day seven, where cells are completely detached from the beads. This shows that the desorption of protein from the beads discourages cell adhesion. Example 11 : Optimization of coating process
Coating was first done across pH values of 5 to 10, over 16 hours, and at room temperature. The isoelectric points (pl) of Arg and Lys are 10.76 and 9.47 respectively. Thus, the pH values below the pl of these amino acids were favoured, since the sodium alginate surfaces have a net negative charge, hence, at pH below the pl values, Arg and Lys would be positively charged. This would encourage the adsorption of these amino acids or peptides containing these amino acids onto the surface of the beads. However, BCA analysis showed that the amount of protein coated onto the beads did not vary significantly with changes in pH (FIG. 16A). Thus, it was determined that the pH of the protein solution for coating does not necessarily need to be adjusted.
Protein adsorption on solid surfaces generally increases with temperature, and the thickness of protein layers is enhanced with elevated temperature. Hence, the coating was determined to take place over the temperature range of 4 °C to 60 °C which is below the protein denaturation temperature to prevent the destruction of the functional properties of peptides. At 4 °C, the amount of protein (2.53 ± 0.74 mg/g) coated on the beads is significantly lower when compared to coating at 60 °C (16.23 ± 0.36 mg/g). Therefore, the BCA results were in line with the study and 60 °C was found to encourage protein adsorption on the alginate beads (FIG. 16B).
After hydrolysis, the hydrolysates were centrifuged, and the supernatant retained for freeze-drying. The freeze-dried powders allow for varying protein concentrations to be used for coating. Protein solutions of 5%, 10%, 15%, 20%, 30% and 40% were prepared using the freeze-dried protein. The resultant solutions are used for coating at 60 °C. BCA analysis was not conducted for beads coated with 40% protein solution as the beads have dissolved during the coating process. Similarly, for beads that were coated with 30% protein, the particle size has decreased to 54.5 ± 2.30 pm which is undesirable to be used in cell seeding (FIG. 16C). Upon BOA analysis, when protein concentration used is increased from 5% to 20%, the amount of protein coated on beads also increased from 9.25 ± 2.16 to 16.83 ± 1.56 mg/g (FIG. 16C). Even though 20% protein concentration led to the highest protein coated, it is not significantly different from 15%. Thus, 15% protein concentration was chosen as the final protein concentration to be used for coating.
Based on visual inspection under the microscope, beads size was altered depending on the concentration of protein, thus, particle size analysis was conducted. FIG. 16D shows that as protein concentration increases, q(%) decreases. Since q% refers to the volume at each particle size (frequency distribution), this reduction means that there will be fewer beads in the desired particle size intervals for cell seeding, which is not optimal. The median diameter ranged from 124.5 ± 0.95 pm to 111 .5 ± 0.4 pm for beads coated with 5% to 20% protein. However, it decreased to 54.5 ± 2.30 pm for beads coated with 30% protein. A possible explanation would be that moisture has diffused out of the beads due to the difference in osmotic pressure between the beads and protein solution.
Cell seeding was conducted with beads coated via improved coating conditions that have been established earlier (original pH, 60 °C coating temperature, and 15% protein concentration). It was also observed that the dark blue colouration of beads dissipates after cell seeding; protein desorption has occurred even though the initial BCA value is the highest after coating. As such, coating was repeated with 5% and 10% protein concentration to further investigate if the high protein concentration has an adverse effect on cell growth. However, only 10% protein concentration displayed a 3.59 ± 0.04 -fold increment on day 10 but cells start to die beyond that, little cell growth was observed for beads coated with 5% protein (FIG. 17).
Biomass calculation was conducted on cells coated with protein hydrolysate as it has the highest primary porcine myoblasts proliferation of 4.44- fold increment. Based on theoretical calculation, every bead would generate approximately 3.78 cells. A few assumptions were made for this calculation: I) all inoculated cells have attached to the beads and all beads were retained in the well when the medium was removed before the addition of CCK-8 solution; II) negligible cell growth from day zero to day one as fold increment was calculated from day one to the last day of the growth; III) cell growth is evenly distributed on every bead.
However, some cells might have been washed away while withdrawing the medium for CCK-8 analysis, not all cells have attached themselves to the beads and are still suspended in the medium. Additionally, there is some growth from day zero to day one when observed under an inverted microscope and cells tend to grow in clusters instead of individually on every bead.
Example 12: Cell proliferation on microbeads with chickpea hydrolysate (CPH)
A density of 3x103/mL C2C12 cell were seeded on CPH with DH 3.5% coated microbeads. The cell growth during a 15-day incubation was monitored by CCK8 and confocal imaging. The confocal images showed that there were only a few cells attached on the microbeads on day 1 (FIG. 18A). Furthermore, the self-fluorescent microbeads were hard to observe due to the weak fluorescence. On day 3, more cells were found on the surface of the coated microbeads, with some connected to the adjacent microbeads together forming small clusters. From day 5 onwards, it was observed that there were larger clusters formed by cells and microbeads. However, the center of the clusters has less F-actin stain though many blue colored nuclei were observed. This may be due to the limited space in the center of the clusters for the cells to expand. The cell numbers experienced a sharp increase in the first 3 days, followed by a period of slower growth from day 3 to day 7 before a rapid increase to reach the maximum value of 15.3-folds on day 9 (FIG. 18D). A decrease in cell number was observed from day 9 until day 15. Primary porcine myoblasts and chicken muscle satellite cells were seeded on CPH coated microbeads as well. The porcine cell numbers were almost constant during the first 3 days before experiencing a rapid increase (FIG. 18D). Similar to the C2C12 cell proliferation result, the highest fold change (13.8-fold) was observed on day 9 for the primary porcine myoblasts. A decrease in cell number was observed from day 9 to day 15. Clusters formed by adjacent beads and cells can be observed when the maximal cell number was reached on day 9 (FIG. 18B). A 11.7-fold change in chicken muscle satellite cell number was achieved during the 15-day incubation (FIG. 18D). The highest number of chicken cells was observed on day 7. The confocal image in FIG. 18C showed that cell clusters formed on day 7. It was noted that porcine and chicken cells were unable to reach the high density achieved by C2C12 cells. Considering all cell proliferation data across the 3 types of cells, CPH could potentially be used as a coating material on microcarriers for different muscle cell types.
To expand the scope of the CPH coated microbeads on other types of cells, 3x103/mL 3T3 cells were seeded on the beads. Cell growth during a 15- day incubation was monitored by CCK8 and confocal imaging. Few 3T3 cells were observed on day 1 and day 3. On day 5, more cells were found on the surface of the coated microbeads (FIG. 18E). The cell growth was observed on the entire surface of the microbeads, which also extended to the adjacent beads, forming clusters since day 5. A sharp increase in cell number was observed from day 3 to day 7, consistent with the cell status in confocal images (FIG. 18E). Cessation of cell growth was observed from day 7 when the cell number increased to the maximal value of 15.7 folds. Therefore, CPH coated microbeads not only can be used in the culture of muscle cells but also adipocyte cells and may potentially be applied in cell-based meat containing muscle and fat tissues.
Example 13: Cell differentiation on chickpea protein hydrolysate coated microbeads Desmin is a subunit protein of intermediate filaments in muscle tissue known to be at low concentration within replicating myoblasts and satellite cells while high in differentiated myotubes. Expression of desmin in cells on microbeads was detected by immunostaining to determine cell differentiation. The confocal images in FIG. 19A showed that during cell differentiation on a 2D plate, C2C12 cells can fuse together to form myotubes. The green fluorescence of stained desmin was the highest on day 4, and some myotubes containing more than one cell nucleus can be observed on day 7 of differentiation.
Similarly, C2C12 cells on microbeads can fuse and form fibers during a 7- day differentiation period as well. According to the inventors’ previous studies, gelatin coated microbeads are promising microcarriers for muscle cells proliferation and differentiation, as gelatin coated material retains cell-binding motifs such as RGD and MMP-sensitive degradation sites, which are important in successful cell adhesion. C2C12 cells on gelatin coated microbeads can start differentiating even on day 1 and are concentrated in the outer layers of the clusters (FIG. 19B). On the other hand, C2C12 cells on CPH coated microbeads achieved the greatest degree of differentiation on day 4 (FIG. 19C). Primary porcine myoblasts (FIG. 19D) and chicken muscle satellite cells (FIG. 19E) also started to differentiate on day 4 as confirmed by the presence of desmin.
For 3T3 cells seeded on CPH coated microbeads, the differentiated cell morphology under bright-field microscope was shown in the left picture of FIG. 19F. After Oil Red O staining, many red oil droplets can be observed in 3T3 cells.
The above results demonstrated that CPH coated microbeads could potentially be used as a substrate in supporting several types of cell differentiation. CPH is edible and biodegradable, thus CPH-based microcarriers or scaffolds can be embedded in the final product or dissolved during the bioprocess. Using CPH to replace animal derived gelatin can eliminate concerns of zoonotic infections, growth factor contamination as well as batch -to-batch variation. Example 14: Amino acid analysis of chickpea protein hydrolysates
Chickpea proteins and three treated hydrolysates were subjected to free amino acid analysis. For chickpea proteins (CP), chickpea proteins treated with carboxypeptidase B (CP + C) and chickpea protein treated with trypsin (CP+T), only a few amino acids, histidine, lysine, and arginine were detected at low concentrations for lysine and arginine ranging from 56.58 to 226.48 pM. After carboxypeptidase B treatment, lysin and arginine dramatically increased to 2040 and 3502 pM, respectively (FIG. 20A).
The four protein solutions were subsequently used for microbeads coating, after which, the coated microbeads were seeded with C2C12 cells to compare the cytoaffinity with commercial microcarriers Cytodex-1. Among these protein solutions, CP+T showed significantly higher cell fold change than other coatings and Cytodex-1 , indicating the high cytoaffinity of CPH and is able to outweigh Cytodex-1 . The results showed that commercial microcamers and scaffolds may have limited cytoaffinity for muscle cells (FIG. 20B). The results demonstrated the importance of peptides containing lysine/arginine/histidine terminal units for cytoaffinity of the chickpea protein hydrolysates.
To verify that the enhanced cytoaffinity of CPH coated microbeads is related to the peptides bonded on the microbeads, carboxypeptidase B was used to further hydrolyse the trypsin hydrolysates. Carboxypeptidase B can release C- terminal lysine and arginine which are exposed by trypsin treatment. The results of the amino acid analysis proved that the trypsin hydrolysis released plenty of C-terminal lysine and arginine. Meanwhile, the cell proliferation result showed that the high proliferation of C2C12 is due to the increased in cytoaffinity of CPH treated by trypsin alone which is related to the exposure of lysine or arginine.
Besides muscle cells, 3T3 cells were able to attach on CPH coated microbeads and achieved a 15.6-fold increase in cell number, which is higher than cell growth achieved by the gelatin coating (9-fold increase of 3T3). However, CP+T+C and the positively charged Cytodex-1 both had the comparable cell proliferation as well as CP+T (FIG. 20C). Thus, the cytoaffinity of adipocyte cells may not be solely related to the C-terminal lysine and arginine released by trypsin. It has been reported that a higher 3T3 cell proliferation rate can be achieved after treatment with silk fibroin hexapeptide GAGAGS (SEQ ID NO: 12). A search via UniProt found that 13 types of peptides containing the GAGAGS sequence existed in chickpea protein. Therefore, unlike C2C12, the 3T3 proliferation may rely more on the surface charge of microcarriers or other hydrolyzed peptides which have the functionality as growth factor.
Example 15: Enzymatic hydrolysis of protein with trypsin and papain
Some selected plant proteins were subjected to enzymatic hydrolysis. The resultant hydrolysates were centrifuged to remove the insoluble peptides and the supernatant was used for coating. The resultant cell growths using the respective coated beads are as shown in FIG. 11 .
It is evident that trypsin hydrolysis for all plant proteins, except for pea protein, resulted in more desirable peptides that support primary porcine myoblast growth, of which chickpea hydrolysates led to the highest growth with a 3.15 ± 0.60-fold increase.
There is negligible growth for hydrolysates produced via hydrolysis with papain. As papain has a very broad specificity as compared to trypsin which has only two cleavage sites- Arg and Lys, it possibly could have led to the production of shorter chain peptides as compared to the hydrolysis by trypsin. It is hypothesised that adhesion of shorter chain peptides on beads may not be as strong as longer chain peptides, leading to a loss of protein during cell growing stages. Additionally, as peptides produced via papain hydrolysis tend to be hydrophobic and precipitate as solids, they could have been lost after centrifugation. Thus, even when shorter chains are favoured for cell growth, the inability to adhere to the beads would mitigate the positive effects on cell proliferation. Trypsin, which cleaves only next to the positively charged amino acids Lys and Arg, would be better suited for this, as it does not disrupt patches of hydrophobic amino acids.
Similar to the cell growth results shown in FIG. 11 , the cell morphology observations in FIG. 12 also showed that protein hydrolysate produced using papain has no effect on cell growth while hydrolysate from trypsin were able to supplement better cell growth. Chickpea cystatin (CPC) which is hydrolysed by trypsin has the highest cell growth on day seven under an inverted microscope followed by pea protein isolate (PPI). No cell growth was observed on soy protein isolate (SPI) and mung bean protein isolate (MBPI) even after hydrolysis by both enzymes, which meant that these two proteins are unsuitable to be used in this example. Therefore, optimisation will be conducted with CPC and trypsin.
Although plant proteins contain RGD units, they may not be accessible to interact with cells on the microbeads. To generate bioactive peptides, enzymatic hydrolysis is practised in food and pharmaceutical industries because it can be conducted under mild controlled conditions (pH, temperature, substrate concentration, and enzyme activity), high specificity and the absence of residual organic solvents and toxic chemicals in the final peptide composition. Some common enzymes such as papain, alcalase, and flavorzyme, have a broad specificity, hence they could have led to the production of shorter chain peptides and free amino acids (Table 7).
Table 7: Optimum reaction condition of enzymes
Enzyme Cleavage Sites Optimum Optimum pH
Temperature
Trypsin Arg, Lys 50 8
Papain Ala, Leu, lie, Phe, Trp, Tyr, 60 7
Arg, Lys, His, Gly, Glu, Vai, Asp
Alcalase Glu, Met, Leu, Tyr, Lys, Gin, 50 7.5 lie, Gly, Vai, Ala, Phe, Trp
Flavourzyme Ala, lie, Glu, Lys, Leu, Pro 50 7
On the other hand, trypsin has only two cleavage sites- Arg and Lys. The inventors hypothesized that using trypsin can release RGD-containing and other positively charged peptides, while preserving most of the protein backbone for coating on alginate. The results in FIG. 11 and 12 showed that trypsin hydrolysis led to a higher growth of primary porcine cells. In contrast, there is negligible growth for microbeads coated with hydrolysates produced via hydrolysis with papain (FIG. 11 ). Therefore, the results showed that selective hydrolysis with trypsin could release the RGD unit due to its high selectivity.
Example 16: Effect of cross-linking agents on the coating of pumpkin seed proteins
Protein coating on microbeads was achieved through immersion in protein solutions followed by immobilization using cross-linking agents. Commonly used cross-linking agents such as glutaraldehyde and diacetyl, which are not derived from plants, possess two aldehyde groups capable of forming Schiff's bases with amino groups of proteins, resulting in protein cross-linking through carbon atoms in the middle. Plant-based cross-linker genipin, which is a commonly used biomaterial, could bring unpleasant blue color in products, and may not be desirable in cultured meat application.
In this example, several natural cross-linkers of food-grade guality, including quercetin, flavanones, and TGase, were tested and compared with these conventional cross-linking agents. The remaining protein content was determined using the BCA method after cross-linking with various cross-linking agents, and the dosages used were adopted from relevant references (the crosslinking agents used were Diacetyl 9.8%, flavanone 10mg/mL, quercetin 10mg/mL, and TGase 10U/mL).
Duration and temperature of the coating exhibited minimal influence on protein loading. Higher amounts of coated protein were achieved at elevated temperatures ranging from 50 °C to 60 °C. Hence, a coating temperature of 50 °C was chosen, which also corresponds to the optimal temperature for TGase enzyme activity.
As anticipated, the cross-linking of diacetyl led to a higher protein retention rate (2.87 ± 0.65 mg/mL) in comparison to the non-cross-linked group (1.42 ± 0.14 mg/mL) (FIG. 21A). The cross-linking effects of flavanone and quercetin in an aqueous solution were not significant, exhibiting retention amounts of 1.89 ± 0.34 mg/mL and 1 .57 ± 0.33 mg/mL, respectively, which did not differ significantly from the non-cross-linked group (FIG. 21 B and 21 C). Among the food-grade cross-linking agents examined, TGase displayed a relatively high protein retention rate of 1.67 ± 0.16 mg/mL in contrast to 1 .18 ± 0.2 mg/mL without crosslinking (FIG. 21 D).
The results obtained from the BCA assay provide a convenient means to determine the amount of coated pumpkin seed protein. TGase, when utilized as a protein cross-linking agent, demonstrates the ability to effectively cross-link proteins on microspheres, resulting in a relatively high preservation rate, according to the result.
Example 17: Effect of TGase concentration on protein retention
Although protein attachment to microbeads can be achieved without cross-linkers, the use of cross-linkers such as TGase is advantageous for the long-term storage of pumpkin seed protein-alginate microbeads. However, excessive use of cross-linkers can result in over-crosslinking, leading to protein modification or deformation of the beads. Therefore, the impact of varying TGase concentrations on the cross-linking ability of the microbeads was investigated (FIG. 22A), and subsequent BCA assays were performed to assess protein retention rates during different storage durations (FIG. 22B).
After a 4-day storage period, the protein content on the surface of microbeads in the uncross-linked sample decreased by nearly a half, from 1.04 ± 0.03 mg/mL to 0.72 ± 0.08 mg/mL. In samples cross-linked with TGase at a concentration of 1 U/mL, the protein retention rate of microbeads did not decrease significantly, remaining at 1.42 ± 0.06 mg/mL and 1.41 ± 0.03 mg/mL. Increasing the concentration of TGase did not significantly increase the amount of protein retention. At a concentration of 20 U/mL, the protein content was still 1 .29 ± 0.05 mg/mL, which was not significantly different from the values obtained at 10 U/mL (1.28 ± 0.22 mg/mL) and 3 U/mL (1 .37 ± 0.06 mg/mL).
From the results, it is evident that reducing the amount of TGase used in cross-linking of pumpkin seed protein-alginate microbeads did not lead to a significant difference between the protein content of the microbeads and the control group without cross-linking, if the BCA test is performed in a relatively shorter storage time. However, for a longer period of preservation, the content of uncross-linked proteins significantly decreased, while the protein content after cross-linking remained relatively stable, indicating effective retention on the microbeads. Moreover, it was observed that increasing the concentration of TGase does not have a noticeable effect on the protein retention rate after preservation. Therefore, in practical applications, an appropriate concentration of TGase can be used to optimize cost-effectiveness and prevent excessive crosslinking.
Example 18: Effect of concentration of cross-linker on the size and morphology of microbeads Upon microscopic examination, it was observed that the pumpkin seed protein has undergone successful cross-linking with the sodium alginate microspheres, as manifested by a darker and opaque appearance (FIG. 23B) compared to the uncross-linked microbeads (FIG. 23A), due to the attachment of proteins to its surface. It was observed that as the amount of cross-linking agent increases, some microspheres exhibited an excessive accumulation of crosslinked proteins, and are not in a uniform distribution (FIG. 23C). This uneven protein distribution may potentially exert unfavorable effects on cell culture and growth in these microspheres. A smaller amount of cross-linker may facilitate the cross-linking of an optimal amount of protein to the microspheres, sufficient to support cell growth while avoiding the overloading of proteins on the microspheres.
Alginate microbeads used for coating had clean and smooth surfaces and diameter and an initial diameter of about 200 pm. Intuitively, the microbeads are expected to become larger after the pumpkin seed protein coating. However, in this example, it was observed that the mean diameters of pumpkin seed protein- coated beads became smaller using different concentrations of TGase as crosslinker.
Table 8: Mean diameter and distribution width of coated microbeads
Concentration 1 U/mL 3 U/mL 10 U/mL
Mean diameter (pm) 159.81±7.21 156.23±7.76 156.17±6.00
Distribution width (pm) 0.124 0.123 0.123
Most of the uncoated microbeads had a diameter of around 200 pm. As shown in Table 8, coated microbeads all experienced some shrinkage, and their range of diameter was all below 200 pm. The result indicated that the diameter distribution of the final cross-linked beads was approximately 156 pm, with the narrowest size distribution of 0.123.
In Examples 16 to 18, natural cross-linking agents used for collagen crosslinking were selected to evaluate their effect on pumpkin seed protein. The relatively low efficacy of quercetin and flavanones may be attributed to their limited solubility in aqueous solutions. While quercetin may be solubilized in ethanol for cross-linking purposes, it may adversely affect cell growth or protein structure. TGase is a water-soluble cross-linker that is suitable for cell cultivation as food. Heat sterilization did not cause significant deformation or agglomeration of the cross-linked alginate microbeads, indicating the potential of pumpkin seed protein-sodium alginate microbeads cross-linked by TGase as a scaffold for cellular meat production.
APPLICATIONS
Embodiments of the disclosure provide a microcarrier, a method of making a microcarrier, a system for producing a cell cultured food product and a method of producing a cell cultured food product.
Advantageously, the microcarrier may provide a cost-effective alternative to commercial microcarriers. Commercial microcarriers or scaffolds for cell culture are fabricated by synthetic and inedible plastics and not ideal for commercial production of cell-based meat. The application of food grade (or edible) microbeads with plant protein coatings are attractive as microcarriers because there is no need to separate the grown cells from the carriers.
Even more advantageously, the use of plant-based materials in place of animal-derived materials may help to reduce the concern of spreading infectious diseases, growth factor contamination as well as batch -to-batch variation. Even more advantageously, cultured meat may be identical to real meat both in nutritional composition and appearance. Using food grade material for microbeads fabrication can lower the cost, and upscale anchorage-dependent mammalian cells. Thus, embodiments of the microcarrier may have the potential to be used in different meat culture for culturing cells from pig, chicken, cows and even shrimps.
It will be appreciated by a person skilled in the art that other variations and/or modifications may be made to the embodiments disclosed herein without departing from the spirit or scope of the disclosure as broadly described. For example, in the description herein, features of different exemplary embodiments may be mixed, combined, interchanged, incorporated, adopted, modified, included etc. or the like across different exemplary embodiments. The present embodiments are, therefore, to be considered in all respects to be illustrative and not restrictive.

Claims

1 . A microcarrier comprising, a core particle; and a coating layer disposed on a surface of the core particle; wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.
2. The microcarrier according to claim 1 , wherein the core particle is a hydrogel-based particle.
3. The microcarrier according to claim 1 or 2, wherein the core particle comprises one or more materials selected from the group consisting of alginate, cellulose, chitosan, gum, hemicellulose, lignin, pectin, soy, starch, and zein.
4. The microcarrier according to any one of claims 1 to 3, wherein the coating layer comprises a protein or a protein hydrolysate.
5. The microcarrier according to claim 4, wherein the protein hydrolysate has a degree of hydrolysis of from 1 % to 30%.
6. The microcarrier according to any one of claims 1 to 5, wherein the coating layer comprises at least 3 amino acids selected from the group consisting of arginine, histidine, aspartic acid, glutamic acid, proline, serine, glycine, and alanine.
7. The microcarrier according to any one of claims 1 to 5, wherein the coating layer comprises amino acid sequences selected from the group consisting of RGD (SEQ ID NO: 1 ), IKVAV (SEQ ID NO: 6), YIGSR (SEQ ID NO: 7), DGEA (SEQ ID NO: 8), PHRSN (SEQ ID NO: 9), PRARI (SEQ ID NO: 10), permutations thereof or sequence order variations thereof.
8. The microcarrier according to any one of claims 1 to 7, wherein the coating layer is coupled to the core particle via a cross-linker.
9. The microcarrier according to claim 8, wherein the cross-linker comprises a natural cross-linker selected from the group consisting of flavanones, genipin, quercetin, tannic acid and transglutaminase.
10. The microcarrier according to any one of claims 1 to 9, wherein the coating layer exhibits self-fluorescence.
11. The microcarrier according to any one of claims 1 to 10, wherein the plant-based sources include one or more selected from the group consisting of broad bean, chickpea, chia seed, corn, lentil, mung bean, oat, pea, pumpkin seed, rapeseed, rice, soybean, wheat, and winter squash.
12. A method of making a microcarrier, the method comprising, providing a core particle; and forming a coating layer on a surface of the core particle to obtain the microcarrier, wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.
13. The method according to claim 12, wherein providing the core particle comprising electrospraying a precursor solution to form the core particle in the form of a microbead.
14. The method according to claim 12 or 13, wherein forming the coating layer comprises immersing the core particle in a coating solution comprising a protein or a protein hydrolysate.
15. The method according to claim 14, wherein prior to forming the coating layer, the method further comprises preparing the coating solution comprising the protein hydrolysate.
16. The method according to claim 15, wherein the protein hydrolysate has a degree of hydrolysis of from 1 % to 30%.
17. The method according to claim 15 or 16, wherein preparing the coating solution comprising the protein hydrolysate comprises hydrolyzing a protein using an enzyme-substrate concentration (E/S%) of from 0.1 % to 50%.
18. The method according to any one of claims 12 to 17, further comprising immersing the core particle coated with the coating layer in a crosslinking solution.
19. The method according to claim 18, wherein the cross-linker comprises a natural cross-linker selected from the group consisting of flavanones, genipin, quercetin, tannic acid, and transglutaminase.
20. A system for producing a cell cultured food product, the system comprising, a population of cells; and a plurality of microcarriers configured to allow the population of cells to be grown thereon; wherein the microcarrier comprises a core particle and a coating layer disposed on a surface of the core particle; and wherein the core particle and coating layer comprise one or more materials derived from plant-based sources.
PCT/SG2023/050688 2022-10-12 2023-10-12 A microcarrier, a method of making a microcarrier, a system for producing a cell cultured food product and a method of producing a cell cultured food product Ceased WO2024080932A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
SG10202251361N 2022-10-12
SG10202251361N 2022-10-12

Publications (1)

Publication Number Publication Date
WO2024080932A1 true WO2024080932A1 (en) 2024-04-18

Family

ID=90670388

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/SG2023/050688 Ceased WO2024080932A1 (en) 2022-10-12 2023-10-12 A microcarrier, a method of making a microcarrier, a system for producing a cell cultured food product and a method of producing a cell cultured food product

Country Status (1)

Country Link
WO (1) WO2024080932A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN118902114A (en) * 2024-07-22 2024-11-08 江南大学 Preparation of double-crosslinked zein-carboxymethyl chitosan nanoparticle for improving thermal stability of polyphenol

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015038988A1 (en) * 2013-09-13 2015-03-19 Modern Meadow, Inc. Edible and animal-product-free microcarriers for engineered meat
CN114317394A (en) * 2021-12-31 2022-04-12 上海食未生物科技有限公司 Microcarrier for three-dimensional cell culture and preparation method and application thereof

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015038988A1 (en) * 2013-09-13 2015-03-19 Modern Meadow, Inc. Edible and animal-product-free microcarriers for engineered meat
CN114317394A (en) * 2021-12-31 2022-04-12 上海食未生物科技有限公司 Microcarrier for three-dimensional cell culture and preparation method and application thereof

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
KONG YAN; ONG SHUJIAN; LIU MEI HUI; YU HANRY; HUANG DEJIAN: "Functional composite microbeads for cell-based meat culture: effect of animal gelatin coating on cell proliferation and differentiation", JOURNAL OF PHYSICS D: APPLIED PHYSICS, INSTITUTE OF PHYSICS PUBLISHING, BRISTOL, GB, vol. 55, no. 34, 9 June 2022 (2022-06-09), Bristol, GB, XP020459417, ISSN: 0022-3727, DOI: 10.1088/1361-6463/ac7011 *
KONG YAN; TOH NIEN PING; WU YUYAO; HUANG DEJIAN: "Trypsin-treated chickpea protein hydrolysate enhances the cytoaffinity of microbeads for cultured meat application", FOOD RESEARCH INTERNATIONAL, ELSEVIER, AMSTERDAM, NL, vol. 173, 27 July 2023 (2023-07-27), AMSTERDAM, NL , XP087410612, ISSN: 0963-9969, DOI: 10.1016/j.foodres.2023.113299 *
SAYAN DEB DUTTA: "Bioengineered Lab-Grown Meat-like Constructs through 3D Bioprinting of Antioxidative Protein Hydrolysates", APPLIED MATERIALS & INTERFACES, AMERICAN CHEMICAL SOCIETY, US, vol. 14, no. 30, 3 August 2022 (2022-08-03), US , pages 34513 - 34526, XP093163061, ISSN: 1944-8244, DOI: 10.1021/acsami.2c10620 *
YAN KONG: "Plant proteins as the functional building block of edible microcarriers for cell-based meat culture application", CRITICAL REVIEWS IN FOOD SCIENCE AND NUTRITION, TAYLOR & FRANCIS, USA, USA , pages 1 - 11, XP093163064, ISSN: 1040-8398, DOI: 10.1080/10408398.2022.2147144 *
YAN KONG: "Pumpkin seed proteins rival animal gelatin in increasing the cytoaffinity of edible microbeads for cell-based meat culture", FOOD RESEARCH INTERNATIONAL, ELSEVIER, AMSTERDAM, NL, vol. 168, 1 June 2023 (2023-06-01), AMSTERDAM, NL , pages 112750, XP093163068, ISSN: 0963-9969, DOI: 10.1016/j.foodres.2023.112750 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN118902114A (en) * 2024-07-22 2024-11-08 江南大学 Preparation of double-crosslinked zein-carboxymethyl chitosan nanoparticle for improving thermal stability of polyphenol

Similar Documents

Publication Publication Date Title
Chen et al. Gellan gum-gelatin scaffolds with Ca2+ crosslinking for constructing a structured cell cultured meat model
Zernov et al. Chitosan-collagen hydrogel microparticles as edible cell microcarriers for cultured meat
Chen et al. Programmable scaffolds with aligned porous structures for cell cultured meat
Kong et al. Trypsin-treated chickpea protein hydrolysate enhances the cytoaffinity of microbeads for cultured meat application
US8105629B2 (en) Collagen gel and process of producing the same
Kong et al. Pumpkin seed proteins rival animal gelatin in increasing the cytoaffinity of edible microbeads for cell-based meat culture
CN114317394A (en) Microcarrier for three-dimensional cell culture and preparation method and application thereof
Patil et al. Silk fibroin-alginate based beads for human mesenchymal stem cell differentiation in 3D
CN117511851B (en) Application of hydrogel scaffold in cell-cultured meat preparation
WO2022192426A1 (en) Constructs for meat cultivation and other applications
CN105079783B (en) Pharmaceutical composition and its preparation method and application
KR20230081976A (en) Hybrid cultured meat comprising grains and a cultured cell coating layer located on the surface of the grains and method for thereof
CN112251352A (en) Special culture device for 3D biological tissue and preparation method of blocky cultured meat
US20250049074A1 (en) Edible microcarrier for the preparation of cultured meat and method of producing same
CN120795125A (en) Collagen, collagen hydrogel, and preparation method and application thereof
CN114426944A (en) A silk protein biomimetic orientation bioscaffold for cell cultured meat
US20260107961A1 (en) Edible hydrogel microcarriers comprising cells, compositions comprising same and methods of producing and using same
WO2023026291A1 (en) Microparticles made of plant protein extracts and uses thereof as cell carriers for the preparation of food products
Kong Development of Functional Composite Plant-Based Microbeads for Cell-Based Meat Culture
KR20230104164A (en) Collagen and/or gelatin production, isolation and/or extraction from animal cell lines and/or tissue explants
Li et al. Edible bacterial cellulose with chitosan/plant protein-coated flocculant microcarriers for cultured fat production
CN114196042A (en) Composite hydrogel and preparation method and application thereof
JP7649016B2 (en) Porous scaffold for cell culture and method for producing same
CN117362403A (en) Concentrated fungal protein, preparation method thereof and application thereof in cell culture meat
Li et al. Biofabricated bacterial cellulose microcarriers for cultured meat applications

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23877814

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 23877814

Country of ref document: EP

Kind code of ref document: A1