WO2023239229A1 - 보툴리눔 독소 안정화 조성물, 이를 포함하는 보툴리눔 독소 제제 및 이에 사용하기 위한 폴리펩티드 - Google Patents

보툴리눔 독소 안정화 조성물, 이를 포함하는 보툴리눔 독소 제제 및 이에 사용하기 위한 폴리펩티드 Download PDF

Info

Publication number
WO2023239229A1
WO2023239229A1 PCT/KR2023/008066 KR2023008066W WO2023239229A1 WO 2023239229 A1 WO2023239229 A1 WO 2023239229A1 KR 2023008066 W KR2023008066 W KR 2023008066W WO 2023239229 A1 WO2023239229 A1 WO 2023239229A1
Authority
WO
WIPO (PCT)
Prior art keywords
botulinum toxin
seq
bont
muscle
administration
Prior art date
Application number
PCT/KR2023/008066
Other languages
English (en)
French (fr)
Inventor
김수혁
이동규
곽성성
Original Assignee
(주)메디톡스
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by (주)메디톡스 filed Critical (주)메디톡스
Publication of WO2023239229A1 publication Critical patent/WO2023239229A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43—Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46—Hydrolases (3)
    • A61K38/48—Hydrolases (3) acting on peptide bonds (3.4)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43—Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46—Hydrolases (3)
    • A61K38/48—Hydrolases (3) acting on peptide bonds (3.4)
    • A61K38/4886—Metalloendopeptidases (3.4.24), e.g. collagenase
    • A61K38/4893—Botulinum neurotoxin (3.4.24.69)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/16—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
    • A61K47/18—Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/16—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
    • A61K47/18—Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
    • A61K47/183—Amino acids, e.g. glycine, EDTA or aspartame
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/22—Heterocyclic compounds, e.g. ascorbic acid, tocopherol or pyrrolidones
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
    • A61K47/42—Proteins; Polypeptides; Degradation products thereof; Derivatives thereof, e.g. albumin, gelatin or zein
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/001—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis

Definitions

  • the present disclosure relates to botulinum toxin stabilizing compositions, botulinum toxin preparations comprising the same, and polypeptides for use therewith.
  • Botulinum neurotoxin is a polypeptide product of the anaerobic bacterium Clostridium botulinum and is a toxic substance that acts specifically on nerve cells.
  • Botulinum toxin is a toxic substance that inherently causes death, but it also causes cervical dystonia (CD), blepharospasm, hyperhidrosis, strabismus, achalasia, neurogenic bladder, It is used to treat urologic diseases, migraines, etc.
  • WO2008/082889 discloses a method and composition for stabilizing botulinum toxin using a polypeptide that is an HIV-TAT fragment or an HIV-TAT fragment derivative.
  • WO2010/078242 discloses an injectable composition in which a positively charged carrier containing a specific amino acid sequence and botulinum toxin are bound by a non-covalent bond.
  • One object is to provide a botulinum toxin stabilizing composition comprising a polypeptide that inhibits diffusion of botulinum toxin in vivo.
  • Another object is to provide a botulinum toxin preparation comprising botulinum toxin and the botulinum toxin stabilizing composition.
  • Another object is to provide polypeptides for use in the compositions or formulations.
  • botulinum toxin stabilizing composition comprising a polypeptide of Formula 1 below, which inhibits the spread of botulinum toxin in vivo.
  • C represents a moiety that interacts with the cell membrane of a nerve cell
  • V represents a moiety that interacts with the botulinum toxin while interacting with the cell membrane of a nerve cell
  • n is an integer of 0 or 1.
  • botulinum toxin preparation comprising botulinum toxin and the botulinum toxin stabilizing composition.
  • polypeptide consisting of the amino acid sequence of SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, or SEQ ID NO: 20.
  • a botulinum toxin stabilizing composition that improves safety by preventing the spread of botulinum toxin in vivo, a botulinum toxin preparation containing the same, and a polypeptide that can be used therefor are provided.
  • Botulinum toxin preparations according to the present disclosure may exhibit one or more advantages over conventional botulinum toxin preparations, including reduced unwanted spread after injection, increased duration of clinical efficacy, improved safety, reduced antigenicity, etc.
  • Figure 1 shows placebo, botulinum toxin type A (BoNT/A, Coretox), and botulinum toxin type A + TSP11 (BoNT/A + TSP11) in the mice described in Example 1 at 7 and 14 days after administration to the right calf muscle.
  • This is a graph showing CMAP levels for the muscle at the administered site (A) and the muscle at the contralateral non-administered site (B). CMAP values were analyzed using a two-tailed t-test (*p ⁇ 0.05, ***p ⁇ 0.001).
  • Figure 3 shows placebo, botulinum toxin type A (BoNT/A, Coretox), botulinum toxin type A + TSP17 (BoNT/A + TSP17), botulinum toxin type A + TSP19 (BoNT/A) in the mice described in Example 5.
  • CMAP values were analyzed using a two-tailed t-test (*p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001).
  • FIG 4 shows placebo, botulinum toxin type A (BoNT/A, Coretox), botulinum toxin type A + TSP11 (BoNT/A + TSP11), botulinum toxin type A + TSP28 (BoNT/A) in the mice described in Example 6.
  • This is a graph showing the CMAP levels for the muscle at the administered site (A) and the muscle at the contralateral non-administered site (B) at 7 and 14 days after administration of + TSP28) to the right calf muscle.
  • CMAP values were analyzed using a two-tailed t-test (*p ⁇ 0.05, **p ⁇ 0.01).
  • FIG 6 shows placebo, botulinum toxin type A (BoNT/A, Coretox), botulinum toxin type A + TSP1 (BoNT/A + TSP1), and botulinum toxin type A + TSP2 (BoNT/A) in the mice described in Example 8.
  • This is a graph showing the CMAP levels for the muscle at the administered site (A) and the muscle at the contralateral non-administered site (B) at 7 and 14 days after administration of A + TSP2) to the right calf muscle.
  • CMAP values were analyzed using a two-tailed t-test (**p ⁇ 0.01, ***p ⁇ 0.001).
  • FIG. 7 shows placebo, botulinum toxin type A (BoNT/A, Coretox), botulinum toxin type A + TSP11 (BoNT/A + TSP11), and botulinum toxin type A + TSP23 (BoNT/A) in the mice described in Example 9.
  • This is a graph showing the CMAP levels for the muscle at the administered site (A) and the muscle at the contralateral non-administered site (B) at 7 and 14 days after administration of A + TSP23) to the right calf muscle.
  • CMAP values were analyzed using a two-tailed t-test (**p ⁇ 0.01, ***p ⁇ 0.001, ns; not significant).
  • Figure 8 shows placebo, botulinum toxin type A (BoNT/A, Coretox), botulinum toxin type A + TSP11 (BoNT/A + TSP11), and botulinum toxin type A + TSP35 (BoNT/A) in the mice described in Example 10.
  • This is a graph showing the CMAP levels for the muscle at the administered site (A) and the muscle at the contralateral non-administered site (B) at 7 and 14 days after administration of A + TSP35) to the right calf muscle.
  • CMAP values were analyzed using a two-tailed t-test (*p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001, ns; not significant).
  • Figure 9 shows the mice described in Example 11 after administration of placebo, 6 U/kg botulinum toxin type A (BoNT/A), and 12 U/kg botulinum toxin type A + TSP11 (BoNT/A + TSP11) to the right gastrocnemius muscle. This is a graph showing the average DAS value over time.
  • Figure 10 shows placebo, botulinum toxin type A (BoNT/A, Coretox), botulinum toxin type A + TSP47 (BoNT/A + TSP47), and botulinum toxin type A + TSP48 (BoNT/A) in the mice described in Example 12.
  • This is a graph showing the CMAP levels for the muscle at the administered site (A) and the muscle at the contralateral non-administered site (B) at 7 and 14 days after administration of A + TSP48) to the right calf muscle.
  • CMAP values were analyzed using a two-tailed t-test (*p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001, ns; not significant).
  • Botulinum toxin may be any polypeptide or fragment of botulinum toxin.
  • the botulinum toxin is a botulinum toxin derivative, i.e., having botulinum toxin activity but comprising one or more chemical or functional modifications at any part or on any chain relative to the natural botulinum toxin or recombinant native botulinum toxin. It may refer to a botulinum toxin derivative, which is a compound that does.
  • the botulinum toxin may be a modified neurotoxin, which is a neurotoxin that has one or more amino acids deleted, modified or substituted compared to the original, or the modified neurotoxin may be a neurotoxin or a derivative thereof produced by recombinant techniques. Or it could be his fragment.
  • the botulinum toxin is a botulinum toxin (one of botulinum toxin serotypes A-G), with or without an endogenous non-toxin protein (hemagglutinin protein produced by Clostridium botulinum and non-toxin non-hemagglutinin protein). It may be a botulinum toxin protein molecule of about 150 kD).
  • the botulinum toxin is divided into seven serotypes (botulinum toxin type A, botulinum toxin type B, botulinum toxin type C, botulinum toxin type D, botulinum toxin type E, botulinum toxin type F and botulinum toxin type G), which have amino acid sequences Based on the variation, it is further subdivided into subtypes.
  • Each serotype of botulinum toxin varies in the animal species it affects and the severity and duration of paralysis it causes.
  • amino acid refers to natural and non-natural amino acids, as well as amino acids such as proline, amino acid analogs, and amino acid mimetics that function in a similar manner to natural amino acids.
  • amino acid mimetic has a structure that is different from the general chemical structure of natural amino acids, but functions in a similar manner to natural amino acids.
  • polypeptide and “peptide” are used interchangeably herein and refer to a polymer composed of amino acid residues.
  • identity refers to the relationship between the sequences of two or more polypeptides or polynucleotides as determined by comparing the sequences.
  • the identity refers to the degree of sequence relatedness determined by the number of matches between two or more strings of amino acid residues or nucleotide residues. Identity of related polypeptides or polynucleotides can be calculated by known methods. “% identity,” as applied to a polypeptide or polynucleotide, refers to a candidate amino acid sequence or nucleotide sequence that is identical to residues of the second sequence after aligning and, if necessary, introducing gaps, to achieve maximum percent identity with the second sequence. It is defined as the percentage of residues in the candidate sequence. Methods and programs for the above alignment are known. The program may be, for example, BLAST, Smith-Waterman algorithm, or Needleman-Wunsch algorithm.
  • One aspect provides a botulinum toxin stabilizing composition comprising a polypeptide of Formula 1 below that inhibits the spread of botulinum toxin in vivo.
  • C represents a moiety that interacts with the cell membrane of a nerve cell
  • V represents a moiety that interacts with the botulinum toxin while interacting with the cell membrane of a nerve cell
  • n is an integer of 0 or 1.
  • V may be vesicle associated membrane protein (VAMP), brain-derived neurotrophic factor (BDNF), fragments thereof, or variants thereof.
  • VAMP vesicle associated membrane protein
  • BDNF brain-derived neurotrophic factor
  • the VAMP may be VAMP1, VAMP2, or VAMP3, for example VAMP2.
  • V may be VAMP2, a fragment thereof, or a variant thereof.
  • V may be VpN of VAMP2, a fragment thereof, or a variant thereof.
  • V may be comprising the amino acid sequence of SEQ ID NO: 1.
  • V is the amino acid sequence of SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10; Alternatively, it may be a sequence in which one amino acid is substituted in the amino acid sequence of SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, or 8.
  • the amino acid of SEQ ID NO: 8 is VpN, the amino acids of SEQ ID NO: 1 to 7 are fragments of VpN, and SEQ ID NOs: 9 and 10 are variants of VpN.
  • V is the amino acid sequence of SEQ ID NOs: 1, 2, 3, 4, 5, 6, 7, and 8; and amino acid sequences in which one amino acid is substituted in the amino acid sequences of SEQ ID NOs: 1, 2, 3, 4, 5, 6, 7, and 8.
  • a sequence in which one of the amino acids of SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, or 8 is substituted may have reduced hydrophobic interaction compared to the sequence before the substitution.
  • methionine and/or threonine may be substituted with alanine.
  • it may be the M47A or T36A mutation of the amino acid sequence of SEQ ID NO: 8.
  • C may be a cell penetrating peptide or a cationic peptide.
  • the cationic amino acid may be selected from lysine, arginine, and histidine.
  • the cationic amino acid may be arginine.
  • C may be an arginine-rich peptide.
  • more than 3/5 or more than 2/3 of the total amino acids of C may be composed of arginine.
  • C may further include an aromatic amino acid.
  • the aromatic amino acid may be selected from tryptophan, phenylalanine, and tyrosine.
  • the aromatic amino acid can be tryptophan.
  • C may be an amino acid of the same sequence repeated up to three times.
  • C may have a three-dimensional structure in which arginine and tryptophan are biased to one side.
  • C may consist of the amino acid sequence of SEQ ID NO: 11, SEQ ID NO: 12, or SEQ ID NO: 13.
  • the polypeptide has 10-50, 10-40, 15-40, or 15-35, such as 17-32 or 25-32, such as 17, 25, or 26 polypeptides. , may consist of 31 or 32 amino acids.
  • the polypeptide is SEQ ID NO: 8 (TSP19), SEQ ID NO: 14 (TSP11), SEQ ID NO: 15 (TSP28), SEQ ID NO: 16 (TSP17), SEQ ID NO: 17 (TSP35), or SEQ ID NO: 18 (TSP23). It may consist of the amino acid sequence of SEQ ID NO: 19 (TSP2), SEQ ID NO: 20 (TSP56), or SEQ ID NO: 21 (TSP61).
  • the polypeptide may be a variant of the disclosed amino acid sequence.
  • the variant may be a polypeptide having at least 80% sequence identity with the disclosed amino acid sequence. For example, it may have a sequence identity of at least 82.5%, at least 85%, at least 90%, at least 95%, or at least 98% with the disclosed amino acid sequence.
  • the N-terminus may be protected with a protecting group.
  • the N-terminus is a protecting group, such as acetyl group, fluorenylmethoxycarbonyl group, formyl group, palmitoyl group, myristyl group, and stearyl group. It may be bonded to a stearyl group, butoxycarbonyl group, allyloxycarbonyl group, or polyethylene glycol (PEG).
  • the C-terminus of the polypeptide may be protected with a protecting group.
  • the C-terminus may be bonded to an amino group (-NH 2 ), a tertiary alkyl group, or azide (-NHNH 2 ) as a protecting group.
  • the alkyl group may have 4 to 20, 4 to 16, 4 to 12, 4 to 8, 5 to 20, 5 to 16, 5 to 12, or 5 to 8 carbon atoms.
  • Another aspect provides a method of inhibiting the spread of botulinum toxin in vivo by providing the polypeptide of Formula 1 to botulinum toxin or an agent containing the same.
  • Another aspect provides a method of stabilizing botulinum toxin by providing the polypeptide of Formula 1 to the botulinum toxin or an agent containing the same.
  • Another aspect provides the use of the polypeptide of formula 1 above for inhibiting the spread of botulinum toxin in vivo.
  • Another aspect provides use of the polypeptide of formula 1 above for stabilizing botulinum toxin.
  • Another aspect provides use of a polypeptide of formula 1 above for use as a botulinum toxin excipient.
  • botulinum toxin preparation comprising botulinum toxin, and the botulinum toxin stabilizing composition.
  • Another aspect provides a polypeptide of Formula 1 above for inhibiting the spread of botulinum toxin in vivo.
  • Another aspect provides a polypeptide of Formula 1 above for stabilizing botulinum toxin.
  • Another aspect provides a polypeptide of Formula 1 above for use as a botulinum toxin excipient.
  • the botulinum toxin may be type A, B, C, D, E, F or G.
  • the botulinum toxin may be a natural or recombinant toxin.
  • the recombinant toxin may be one disclosed in Korean Application No. 10-2021-0083930 (the disclosure of which is incorporated herein by reference in its entirety), wherein the recombinant toxin is a botulinum toxin type A light chain other than botulinum toxin type A4.
  • the sequence of the third domain among the first, second, third, and fourth domains may include a recombinant botulinum toxin type A light chain substituted with the sequence of the third domain of botulinum toxin type A4 or a variant thereof.
  • the sequence of the fourth domain among the first, second, third, and fourth domains of the recombinant botulinum toxin type A light chain may be further substituted with the sequence of the fourth domain of botulinum toxin type A4 or a variant thereof.
  • the botulinum toxin type A light chain may be botulinum toxin type A1, A2, A3, A5, A6, A7 or A8, such as botulinum toxin type A1.
  • the recombinant botulinum toxin type A light chain may include A1-A1-A4-A4 as the first, second, third, and fourth domains.
  • the recombinant botulinum toxin type A light chain may consist of the amino acid sequence of SEQ ID NO: 23.
  • the recombinant toxin may be one disclosed in Korean Application No. 10-2021-0083950 (the disclosure of which is incorporated herein by reference in its entirety), wherein the recombinant toxin is a botulinum toxin type A light chain other than botulinum toxin type A1. It may contain a recombinant botulinum toxin type A light chain, wherein the sequence of the second domain among the first, 2, 3, and 4 domains is substituted with the sequence of the second domain of botulinum toxin type A1 or a variant thereof. .
  • the sequence of the fourth domain among the first, second, third, and fourth domains of the recombinant botulinum toxin type A light chain is further substituted with the sequence of the fourth domain of botulinum toxin type A1 or a variant thereof.
  • the botulinum toxin type A light chain may be botulinum toxin type A2, A3, A4, A5, A6, A7 or A8, for example botulinum toxin type A4.
  • the recombinant botulinum toxin type A light chain may include A4-A1-A4-A1 as the first, second, third, and fourth domains.
  • the botulinum toxin may be in the 7S (150 kD) or 19S (900 kD) form.
  • the amount of the polypeptide used is not particularly limited as long as it exhibits activity to inhibit the spread of botulinum toxin but does not inhibit the desired clinical efficacy of botulinum toxin, but for example, 10 to 1 mole of botulinum toxin. It can be used in an amount of 10 10 times, 10 2 to 10 9 times, 10 3 to 10 8 times, 10 3 to 10 7 times, 10 3 to 10 6 times, or 3 ⁇ 10 3 to 10 6 times.
  • the botulinum toxin preparation may further include a pharmaceutically acceptable excipient or carrier.
  • botulinum toxin stabilized composition or ingredients are suitable for use in contact with tissues or for use in patients without excessive toxicity, instability, allergic reactions, etc. If pharmaceutically or cosmetically typical and acceptable, the botulinum toxin preparations of the present disclosure may include any ingredients commonly used in the pharmaceutical and dermatological fields.
  • the botulinum toxin formulation of the present disclosure can be prepared by mixing with one or more additional pharmaceutically acceptable excipients or additives.
  • it may contain simple aqueous pharmaceutically acceptable excipients or additives such as buffered saline.
  • the botulinum toxin preparation of the present disclosure can be applied by injection.
  • Pharmaceutically acceptable excipients or additives include stabilizers, ionic compounds, surfactants, buffers, lyophilization protectants, or combinations thereof, such as amino acids (e.g. methionine), salts (e.g. NaCl ), buffers, nonionic surfactants (e.g. polysorbates, e.g. polysorbate 20), sugars (e.g. disaccharides such as white sugar), sugar alcohols (e.g. sorbitol), or these It can be a combination.
  • amino acids e.g. methionine
  • salts e.g. NaCl
  • nonionic surfactants e.
  • the botulinum toxin preparation may not contain albumin, animal-derived ingredients, or polysaccharides.
  • the botulinum toxin preparation may be formulated in any form, such as solid or liquid preparation, for example, lyophilized powder, liquid, or pre-filled syringe preparation.
  • the botulinum toxin preparations of the present disclosure may be used as solutions, emulsions (including microemulsions), suspensions, creams, lotions, gels, powders, or other preparations used for application to the skin or other tissues in which the botulinum toxin preparations of the present disclosure may be used.
  • Typical solid or liquid compositions may be included.
  • compositions may contain, in addition to botulinum toxin and stabilizing peptides, other commonly used ingredients, such as antimicrobial agents, moisturizing and hydrating agents, penetration agents, preservatives, emulsifiers, natural or Synthetic oils, solvents, surfactants, detergents, gelling agents, emollients, antioxidants, fragrances, fillers, thickeners, waxes, odor absorbers, dyes, colorants, powders, viscosity regulators and water, optionally anesthetics, anti-itch actives, plant extracts, conditioning agents, darkening or lightening agents, glitter, humectants. It may include humectant, mica, minerals, polyphenols, siliton or its derivatives, sunblock, vitamins, and phytomedicinal.
  • other commonly used ingredients such as antimicrobial agents, moisturizing and hydrating agents, penetration agents, preservatives, emulsifiers, natural or Synthetic oils, solvents, surfactants, detergents,
  • Another aspect provides a polypeptide consisting of the amino acid sequence of SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, or SEQ ID NO: 18 for use in the botulinum toxin stabilizing compositions and formulations.
  • Another aspect is to provide a use for improving or treating a disease by administering the botulinum toxin preparation to a subject.
  • administering means the step of providing a pharmaceutical composition or active ingredient to a subject.
  • Pharmaceutical compositions can be administered via a variety of suitable routes.
  • “Pharmaceutical composition” means a preparation in which the active ingredient may be botulinum toxin.
  • formulation means that in addition to the botulinum neurotoxin active ingredient, at least one additional ingredient, such as albumin (human serum albumin or recombinant human albumin) and/or sodium chloride, is present in the pharmaceutical composition.
  • Pharmaceutical compositions are preparations suitable for administration to subjects such as human patients.
  • the pharmaceutical composition may be in lyophilized form, for example, a solution formed after reconstitution of the lyophilized pharmaceutical composition with saline or water, or in the form of a solution that does not require reconstitution.
  • Pharmaceutical compositions may be liquid or solid.
  • the present disclosure applies to administering an effective amount of a botulinum toxin preparation.
  • the term “effective amount” refers to an amount of botulinum toxin preparation sufficient to produce the desired effect, but safe, that is, sufficient to prevent serious side effects.
  • the desired effects include, for example, reducing fine wrinkles, especially facial fine wrinkles, adjusting the appearance of the face, or relaxing specific muscles for the purpose of general relief of muscle tension. General relief of muscle tension may occur in the face or other areas.
  • Treating means, for example, healing of injured or damaged tissue, or altering, changing, strengthening, improving, ameliorating and/or treating a pre-existing or recognized disease, disorder or abnormality.
  • beautifying means alleviating or reducing (including partial reduction, significant reduction, almost complete reduction and complete reduction), resolving or preventing (temporarily or permanently) a disease, disorder or condition so as to achieve a desired therapeutic outcome. do.
  • treatment is a concept that includes prevention.
  • Prevention means delaying the onset of a disease, disorder or condition. Prevention may be considered complete if the onset of the disease, disorder or condition is delayed for a predetermined period of time.
  • Another aspect is to provide a use for improving or treating a disease by administering the botulinum toxin preparation to a subject.
  • the “individual” refers to a subject in need of treatment for a disease.
  • the subject may be, for example, a mammal such as a human, mouse, cat, horse, and cow.
  • the present disclosure is intended to improve or treat disease by administering the botulinum toxin preparation to a patient.
  • the stabilized botulinum toxin stabilized composition is applied in an effective amount to an individual or patient in need of treatment of a disease, for example, alleviating muscle paralysis, hypersecretion or sweating, treating nervous system pain or migraine, muscle spasms. It may include alleviating, preventing or alleviating acne, alleviating or enhancing immune responses, reducing wrinkles, or preventing or treating various other diseases.
  • the botulinum toxin preparation is administered by parenteral injection, such as subcutaneous injection.
  • Administration can be, for example, the legs, shoulders, lower back, palms, feet, neck, groin, backs of hands, tops of feet, elbows, upper arms, knees, upper extremities, buttocks, torso, pelvis, or any body part where administration of the botulinum toxin composition is desired. there is.
  • the present disclosure also includes transdermal delivery devices for delivering the botulinum toxin stabilizing compositions described herein through the skin.
  • Such devices may also be simple structures such as skin patches, or may include means for dispensing the composition and monitoring the dispensing of the composition, and means including monitoring the subject's response to the pharmaceutical composition being dispensed. It could be a device.
  • the botulinum toxin formulation of the present disclosure may have a pH suitable for use in a physiological environment having a pH ranging from about 4.5 to about 6.3.
  • Botulinum toxin preparations according to the present disclosure can be stored at room temperature or under refrigerated conditions.
  • the therapeutically effective amount of botulinum toxin is about 0.01 U/kg to about 100 U/kg, about 0.1 U/kg to about 100 U/kg, about 0.2 U/kg to about 100 U/kg, about 0.2 U/kg to about 50 U/kg. U/kg, about 0.2 U/kg to about 30 U/kg, about 0.2 U/kg to about 10 U/kg, about 0.2 U/kg to about 1 U/kg.
  • based on a 60 kg adult from about 1 U to about 10,000 U, from about 1 U to about 5,000 U, from about 1 U to about 2,500 U, from about 1 U to about 1,000 U, from about 1 U to about 500 U, It may be about 1 U to about 300 U, about 1 U to about 200 U, about 10 U to about 200 U, about 10 U to about 100 U, about 10 U to about 50 U.
  • unit refers to the LD 50 dose, defined as the amount of botulinum toxin that kills 50% of the mice that received the botulinum toxin injection. Therefore, they are used interchangeably.
  • Another aspect is to provide a method of stabilizing botulinum toxin by administering the botulinum toxin preparation to a subject.
  • stabilization refers to minimizing the formation of aggregates (insoluble and/or soluble) or chemical degradation during storage or production of a pharmaceutical composition and maintaining the pH and native structure of the protein, thereby substantially retaining biological activity and protein stability. means maintaining. Additionally, this means that the spread of botulinum toxin to other tissues is prevented, thereby reducing the risk of side effects.
  • the botulinum toxin preparation of the present disclosure may have reduced spread after administration to the human body. Accordingly, the botulinum toxin can be accurately delivered to the target tissue, thereby reducing unwanted side effects associated with the spread of the botulinum toxin.
  • the botulinum toxin formulation of the present disclosure can reduce unwanted side effects associated with the spread of botulinum toxin, thereby containing an increased amount of botulinum toxin in the formulation compared to the amount typically used (used in formulations that do not contain polypeptides). It can be included. In this case, it may indicate an increased duration of clinical efficacy of botulinum toxin compared to conventional botulinum toxin preparations. Accordingly, the administration cycle can be increased and the administration frequency can be lowered.
  • the botulinum toxin preparation may contain 1.5 times, 2 times, 3 times, 4 times, 5 times or more botulinum toxin than the amount commonly used.
  • the botulinum toxin formulation is administered in a cycle of administration that is 1.5 times, 2 times, 3 times, 4 or more times the typical cycle of administration, e.g., more than 3 months, 4 months, 5 months, 6 months, 7 months, 8 months. , can be administered in cycles of 9 months, 10 months, 11 months, or 12 months or more.
  • TSP35 SEQ ID NO: 17 RRRWRRWRRRRLQQTQAQVDEVVDIM-NH2 Replace one W sequence with R in the TSP28 sequence TSP47 SEQ ID NO: 14 RRWRRWNRFNRRRRCRRRLQQTQAQVDEVVDIM-NH2 C-term amidation in TSP11 sequence TSP48 SEQ ID NO: 15 RRWWRRWRRRRLQQTQAQVDEVVDIM No amidation in TSP28 sequence TSP56 SEQ ID NO: 20 RRWRRWNRFNRRRRCRRRLQQTQAQVDEVVDIA 1 amino acid replacement of VPN in TSP11 sequence (M47A) TSP61 SEQ ID NO: 21 RRWRRWNRFNRRRCRRRLQQAQAQVDEVVDIM 1 amino acid replacement of VPN in TSP11 sequence (T36A)
  • Example 1 Non-clinical efficacy test on botulinum toxin type A and TSP11 mixed formulation in mice
  • mice Female 5-week-old CD1 (ICR) mice were purchased from Orient Bio Co., Ltd., and after acclimatization and quarantine for 1 week, 6-week-old mice were used in the experiment.
  • the feed was sterilized solid feed for laboratory animals (R40-10, SAFE, France), and drinking water was supplied ad libitum using high-temperature, high-pressure sterilized tap water.
  • mice were kept at a temperature of 23 ⁇ 3°C, relative humidity of 55 ⁇ 15%, lighting time of 12 hours (8:00 AM to 8:00 PM), ventilation frequency of 15 times/hour, and illumination intensity of 150 to 300 Lux. Raised under specific-pathogen-free conditions. This study was conducted after review and approval (A-2020-016) by the Medytox Animal Experiment Ethics Committee.
  • TSP11 Toxin stabilizing peptide
  • each test substance was injected into the right calf of the mouse according to group composition Table 2. It was administered to the muscle at 0.2 mL/kg using a Hamilton syringe.
  • CMAP compound muscle action potential
  • the recording electrode and reference electrode were placed on the gastrocnemius muscle and Achilles tendon, respectively, and the ground electrode was placed on the rectus femoris muscle.
  • the level and duration of stimulation were 7 to 8 mA and 0.1 ms, and the filter range of the amplifier was set to 2 to 10 K at 60 Hz.
  • the height from the base of the waveform to the peak was converted into CMAP measurement data.
  • measurements were made on the calf muscle at the injection site and the calf muscle on the opposite leg.
  • Example 1 Female 5-week-old CD1 (ICR) mice were purchased from Orient Bio Co., Ltd., and after acclimatization and quarantine for 1 week, 6-week-old mice were used in the experiment. Feed, drinking water, and rearing conditions were the same as in Example 1. This study was conducted after review and approval (A-2020-016) by the Medytox Animal Experiment Ethics Committee.
  • ICR 5-week-old CD1
  • Recombinant botulinum toxin type A is a recombinant botulinum toxin whose light chain is a combination of the BoNT/A1 light chain and the BoNT/A4 light chain.
  • the recombinant full-length botulinum toxin gene (SEQ ID NO: 24) is produced using the pMTL80000 vector system. It was cloned using the infusion method (infusion-HD, Takara) and produced using a detoxified hall A-hyper strain with the toxin gene inactivated.
  • each test substance was administered to the right calf of the mouse according to group composition Table 3. It was administered to the muscle at 0.2 mL/kg using a Hamilton syringe.
  • Six mice were used for each test substance in one test, and a total of 2 to 3 repeated tests were performed for each test substance.
  • the compound muscle action potential CMAP test method which measures the action potential of muscles responding to external electrical stimulation, was used. The specific evaluation method and statistical analysis were conducted in the same manner as in Example 1.
  • the average of the administered group was 125.3 U/kg, and the BoNT/A + TSP11 administered group was observed to have an average of 147.5 U/kg.
  • an increase of approximately 1.4-fold was observed in the BoNT/A + TSP28-administered group, and approximately 1.6-fold increased in the BoNT/A + TSP11-administered group (Table 5). From these results, the effect of improving safety through mixing botulinum toxin and toxin stabilizing peptides (TSP11, TSP28) was confirmed.
  • test substance Half-lethal dose administered intramuscularly (U/kg) eBoNT/A 63.8 eBoNT/A + TSP11 81.2
  • Example 7 Non-clinical efficacy test on botulinum toxin type A 19S and TSP11 mixed formulation in mice
  • Example 9 Non-clinical efficacy test on botulinum toxin type A and TSP11, TSP23 mixed formulation in mice
  • Example 1 Female 5-week-old CD1 (ICR) mice were purchased from Orient Bio Co., Ltd., and after acclimatization and quarantine for 1 week, 6-week-old mice were used in the experiment. Feed, drinking water, and rearing conditions were the same as in Example 1.
  • ICR 5-week-old CD1
  • the day on which the test substance was administered was designated as day 0, and anesthesia of the experimental animals and administration of the test substance were carried out in the same manner as in Example 1.
  • Example 1 For the evaluation, the compound muscle action potential CMAP test method, which measures the action potential of muscles responding to external electrical stimulation, was used. The specific evaluation method and statistical analysis were carried out in the same way as in Example 1.
  • BoNT/A + TSP11 and BoNT/A + TSP23 test substances which are a mixture of botulinum toxin type A (BoNT/A) and toxin stabilizing peptide
  • BoNT/A botulinum toxin type A
  • TSP11 and BoNT/A + TSP23 test substances which are a mixture of botulinum toxin type A (BoNT/A) and toxin stabilizing peptide
  • CMAP measurements were performed on the muscle and the muscle in the contralateral non-administered area. As a result, no significant difference was observed in the CMAP value of the muscle at the injection site between the BoNT/A-only group and the BoNT/A + TSP11-administered group, but a significant difference was confirmed between the BoNT/A-only group and the BoNT/A + TSP23-administered group.
  • the CMAP value in the contralateral muscle was observed to be significantly higher in the BoNT/A + TSP11 and BoNT/A +
  • Example 10 Non-clinical efficacy test on botulinum toxin type A and TSP11, TSP35 mixed formulation in mice
  • TSP11, TSP35 Toxin stabilizing peptides (TSP11, TSP35) were used in the experiment by mixing peptides at a ratio of 3 ⁇ 10 5 relative to 1 mole of botulinum toxin (Table 13). A mixture of botulinum toxin and toxin stabilizing peptide was diluted to a concentration of 120 U/mL and used in the experiment.
  • Example 1 For the evaluation, the compound muscle action potential CMAP test method, which measures the action potential of muscles responding to external electrical stimulation, was used. The specific evaluation method and statistical analysis were carried out in the same way as in Example 1.
  • Example 11 Non-clinical efficacy test for botulinum toxin type A and TSP11 mixed formulation in mice
  • Example 1 Female 5-week-old CD1 (ICR) mice were purchased from Orient Bio Co., Ltd., and after acclimatization and quarantine for 1 week, 6-week-old mice were used in the experiment. Feed, drinking water, and rearing conditions were the same as in Example 1.
  • ICR 5-week-old CD1
  • TSP11 Toxin stabilizing peptide
  • the day on which the test substance was administered was designated as day 0, and anesthesia of the experimental animals and administration of the test substance were carried out in the same manner as in Example 1.
  • the DAS value shown in Table 15 indicates the degree of muscle paralysis according to the toe shape on the administered side in the mouse.
  • the DAS recovery period (botulinum toxin action period) refers to the period during which the DAS score returns to 0 after test substance administration. Body weight was measured once a week.
  • BoNT/A + TSP11 test substance which is a mixture of 6 U/kg botulinum toxin type A (BoNT/A) and 12 U/kg toxin stabilizing peptide
  • DAS and body weight were measured for 7 weeks.
  • weight change each week based on the body weight at the time of test substance administration (Week 0)
  • no significant difference was observed between the 6 U/kg BoNT/A administration group and the 12 U/kg BoNT/A + TSP11 administration group (Table 16 ).
  • Example 12 Non-clinical efficacy test on botulinum toxin type A and TSP47, TSP48 mixed formulation in mice
  • Example 1 Female 5-week-old CD1 (ICR) mice were purchased from Orient Bio Co., Ltd., and after acclimatization and quarantine for 1 week, 6-week-old mice were used in the experiment. Feed, drinking water, and rearing conditions were the same as in Example 1. This study was conducted after review and approval (A-2022-007) by the Medytox Animal Experiment Ethics Committee.
  • ICR 5-week-old CD1
  • Toxin stabilizing peptides (TSP47, TSP48) were used in the experiment by mixing peptides at a ratio of 3x10 5 relative to 1 mole of botulinum toxin (Table 17). A mixture of botulinum toxin and toxin stabilizing peptide was diluted to a concentration of 120 U/mL and used in the experiment.
  • Example 1 For the evaluation, the compound muscle action potential CMAP test method, which measures the action potential of muscles responding to external electrical stimulation, was used. The specific evaluation method and statistical analysis were carried out in the same way as in Example 1.
  • BoNT/A + TSP47 test substance and BoNT/A + TSP48 test substance which are a mixture of botulinum toxin type A (BoNT/A) and toxin stabilizing peptide, to the right calf muscle of mice at a dose of 24 U/kg, respectively.
  • BoNT/A botulinum toxin type A
  • toxin stabilizing peptide botulinum toxin type A
  • CMAP measurements were performed on the muscle at the administered site and the muscle at the non-administered site on the opposite side.
  • a significant increase in CMAP in the muscle at the administration site was observed in the BoNT/A + TSP47 administration group on the 7th day after administration compared to the BoNT/A only administration group, but a significant difference was observed compared to the BoNT/A only administration group on the 14th day after administration.
  • Example 13 Non-clinical efficacy test on botulinum toxin type A and TSP56, TSP61 mixed formulation in mice
  • Example 1 Female 5-week-old CD1 (ICR) mice were purchased from Orient Bio Co., Ltd., and after acclimatization and quarantine for 1 week, 6-week-old mice were used in the experiment. Feed, drinking water, and rearing conditions were the same as in Example 1. This study was conducted after review and approval (A-2022-007) by the Animal Experiment Ethics Committee of Medytox Co., Ltd.
  • Toxin stabilizing peptides (TSP56, TSP61) were used in the experiment by mixing peptides at a ratio of 3x10 5 relative to 1 mole of botulinum toxin (Table 18). A mixture of botulinum toxin and toxin stabilizing peptide was diluted to a concentration of 120 U/mL and used in the experiment.
  • Example 1 For the evaluation, the compound muscle action potential CMAP test method, which measures the action potential of muscles responding to external electrical stimulation, was used. The specific evaluation method and statistical analysis were carried out in the same way as in Example 1.
  • the CMAP value of the BoNT/A + TSP56 administered group in the contralateral muscle was observed to be significantly higher than that of the BoNT/A alone administered group on the 7th and 14th days after administration.
  • CMAP in the muscle at the administration site slightly increased compared to botulinum toxin alone, but the CMAP value in the opposite leg increased more, confirming the diffusion reduction effect through mixing TSP 56.
  • the BoNT/A + TSP61 administration group no significant difference was observed in the CMAP value of the muscle at the injection site compared to the BoNT/A only administration group, but the CMAP value in the contralateral muscle was observed to be significantly higher than that of the BoNT/A only administration group. The effect of reducing diffusion through mixing of 61 was confirmed.
  • SEQ ID NOs: 1 to 10 are exemplary sequences for moieties that interact with botulinum toxin while interacting with the cell membrane of nerve cells.
  • SEQ ID NOs: 11-13 are exemplary sequences for moieties that interact with the cell membrane of nerve cells.
  • SEQ ID NOs: 14 to 21 are exemplary sequences of polypeptides included in the botulinum toxin stabilizing composition.
  • SEQ ID NO: 22 is a substance used as a control substance for the polypeptide included in the toxin stabilizing composition according to one embodiment.
  • SEQ ID NO: 23 is the sequence of recombinant botulinum toxin type A light chain.
  • SEQ ID NO: 24 is the sequence of recombinant botulinum toxin type A, in which the light chain of botulinum toxin is a combination of BoNT/A1 light chain and BoNT/A4 light chain.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Inorganic Chemistry (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

보툴리눔 독소 안정화 조성물, 이를 포함하는 보툴리눔 독소 제제 및 이에 사용하기 위한 폴리펩티드를 제공한다.

Description

보툴리눔 독소 안정화 조성물, 이를 포함하는 보툴리눔 독소 제제 및 이에 사용하기 위한 폴리펩티드
본 개시는 보툴리눔 독소 안정화 조성물, 이를 포함하는 보툴리눔 독소 제제, 및 이에 사용하기 위한 폴리펩티드에 관한 것이다.
보툴리눔 독소(Botulinum neurotoxin, BoNT)는 혐기성 박테리아 클로스트리디움 보툴리눔(Clostridium botulinum)의 폴리펩티드 생성물로서, 신경세포에 특이적으로 작용하는 독성물질이다. 보툴리눔 독소는 본래 치사를 일으키는 독성 물질이지만, 연축성 사경(cervical dystonia: CD), 안검경련(blepharospasm), 다한증(hyperhidrosis), 사시(strabismus), 이완불능(achalasia), 신경성 방광(neurogenic bladder), 비뇨기 질환(urologic disease), 편두통(migraine) 등의 치료를 위해 사용되고 있다.
국제공개 WO2008/082889호는 HIV-TAT 단편 또는 HIV-TAT 단편 유도체인 폴리펩티드를 이용하여 보툴리눔 독소를 안정화시키는 방법 및 조성물을 개시한다.
국제공개 WO2010/078242호는 특정 아미노산 서열을 포함하는 양으로 하전된(positively charged) 담체와 보툴리눔 독소가 비공유 결합에 의해 결합된 주사용 조성물을 개시한다.
보툴리눔 독소의 확산 방지에 따른 대안적인 안정화 방법이 요구되고 있다.
일 목적은 생체 내에서 보툴리눔 독소의 확산(diffusion)을 저해하는 폴리펩티드를 포함하는 보툴리눔 독소 안정화 조성물을 제공하는 것이다.
다른 목적은 보툴리눔 독소, 및 상기 보툴리눔 독소 안정화 조성물을 포함하는 보툴리눔 독소 제제를 제공하는 것이다.
또 다른 목적은 상기 조성물 또는 제제에 사용하기 위한 폴리펩티드를 제공하는 것이다.
일 양상에 따르면, 생체 내에서 보툴리눔 독소의 확산을 저해하는 아래 화학식 1의 폴리펩티드를 포함하는, 보툴리눔 독소 안정화 조성물에 관한 것이다.
[화학식 1]
(C)n-V
상기 식에서, C는 신경세포의 세포막과 상호작용하는 모이어티(moiety)를 나타내고, V는 신경세포의 세포막과 상호작용하면서 보툴리눔 독소와 상호작용하는 모이어티를 나타내며, n은 0 또는 1의 정수이다.
다른 양상에 따르면, 보툴리눔 독소, 및 상기 보툴리눔 독소 안정화 조성물을 포함하는, 보툴리눔 독소 제제에 관한 것이다.
또 다른 양상에 따르면, 서열번호 15, 서열번호 16, 서열번호 17, 서열번호 18, 서열번호 19 또는 서열번호 20의 아미노산 서열로 이루어지는 폴리펩티드에 관한 것이다.
본 개시에 따르면, 생체 내에서 보툴리눔 독소의 확산을 방지하여 안전성을 개선시키는 보툴리눔 독소 안정화 조성물, 이를 포함하는 보툴리눔 독소 제제 및 이를 위해 사용될 수 있는 폴리펩티드가 제공된다.
본 개시에 따른 보툴리눔 독소 제제는 통상적인 보툴리눔 독소 제제에 비해 주사 후 원치 않는 확산의 감소, 임상 효능 지속기간의 증가, 안전성 개선, 항원성 감소 등을 비롯하여 하나 이상의 장점을 나타낼 수 있다.
도 1은 실시예 1에서 기재된 마우스에서 플라시보, 보툴리눔 독소 A형 (BoNT/A, 코어톡스주), 보툴리눔 독소 A형 + TSP11 (BoNT/A + TSP11)을 우측 장딴지근육에 투여 후 7 및 14일째 투여 부위 근육 (A) 및 반대쪽 비투여 부위 근육 (B) 에 대한 CMAP 수치를 나타내는 그래프이다. CMAP 값에 대해 양측(two-tailed) t-검정을 사용하여 분석하였다 (*p<0.05, ***p<0.001).
도 2는 실시예 2에서 기재된 마우스에서 플라시보, 재조합 보툴리눔 독소 A형 (eBoNT/A), 재조합 보툴리눔 독소 A형 + TSP11 (eBoNT/A + TSP11)을 우측 장딴지근육에 투여 후 7 및 14일째 투여 부위 근육 (A) 및 반대쪽 비투여 부위 근육 (B) 에 대한 CMAP 수치를 나타내는 그래프이다. CMAP 값에 대해 양측(two-tailed) t-검정을 사용하여 분석하였다 (*p<0.05, ***p<0.001 vs. eBoNT/A 투여군).
도 3은 실시예 5에서 기재된 마우스에서 플라시보, 보툴리눔 독소 A형 (BoNT/A, 코어톡스주), 보툴리눔 독소 A형 + TSP17 (BoNT/A + TSP17), 보툴리눔 독소 A형 + TSP19 (BoNT/A + TSP19), 보툴리눔 독소 A형 + TSP11 (BoNT/A + TSP11) 를 우측 장딴지근육에 투여 후 7 및 14일째 투여 부위 근육 (A) 및 반대쪽 비투여 부위 근육 (B) 에 대한 CMAP 수치를 나타내는 그래프이다. CMAP 값에 대해 양측(two-tailed) t-검정을 사용하여 분석하였다 (*p<0.05, **p<0.01, ***p<0.001).
도 4는 실시예 6에서 기재된 마우스에서 플라시보, 보툴리눔 독소 A형 (BoNT/A, 코어톡스주), 보툴리눔 독소 A형 + TSP11 (BoNT/A + TSP11), 보툴리눔 독소 A형 + TSP28 (BoNT/A + TSP28)을 우측 장딴지근육에 투여 후 7 및 14일째 투여 부위 근육 (A) 및 반대쪽 비투여 부위 근육 (B) 에 대한 CMAP 수치를 나타내는 그래프이다. CMAP 값에 대해 양측(two-tailed) t-검정을 사용하여 분석하였다 (*p<0.05, **p<0.01).
도 5는 실시예 7에서 기재된 마우스에서 플라시보, 보툴리눔 독소 A형 (BoNT/A, 19S), 보툴리눔 독소 A형 + TSP11 (BoNT/A, 19S + TSP11)을 우측 장딴지근육에 투여 후 7 및 14일째 투여 부위 근육 (A) 및 반대쪽 비투여 부위 근육 (B) 에 대한 CMAP 수치를 나타내는 그래프이다. CMAP 값에 대해 양측(two-tailed) t-검정을 사용하여 분석하였다 (*p<0.05, ns; not significant).
도 6은 실시예 8에서 기재된 마우스에서 플라시보, 보툴리눔 독소 A형 (BoNT/A, 코어톡스주), 보툴리눔 독소 A형 + TSP1 (BoNT/A + TSP1), 및 보툴리눔 독소 A형 + TSP2 (BoNT/A + TSP2) 를 우측 장딴지근육에 투여 후 7 및 14일째 투여 부위 근육 (A) 및 반대쪽 비투여 부위 근육 (B) 에 대한 CMAP 수치를 나타내는 그래프이다. CMAP 값에 대해 양측(two-tailed) t-검정을 사용하여 분석하였다 (**p<0.01, ***p<0.001).
도 7은 실시예 9에서 기재된 마우스에서 플라시보, 보툴리눔 독소 A형 (BoNT/A, 코어톡스주), 보툴리눔 독소 A형 + TSP11 (BoNT/A + TSP11), 및 보툴리눔 독소 A형 + TSP23 (BoNT/A + TSP23) 를 우측 장딴지근육에 투여 후 7 및 14일째 투여 부위 근육 (A) 및 반대쪽 비투여 부위 근육 (B) 에 대한 CMAP 수치를 나타내는 그래프이다. CMAP 값에 대해 양측(two-tailed) t-검정을 사용하여 분석하였다 (**p<0.01, ***p<0.001, ns; not significant).
도 8은 실시예 10에서 기재된 마우스에서 플라시보, 보툴리눔 독소 A형 (BoNT/A, 코어톡스주), 보툴리눔 독소 A형 + TSP11 (BoNT/A + TSP11), 및 보툴리눔 독소 A형 + TSP35 (BoNT/A + TSP35) 를 우측 장딴지근육에 투여 후 7 및 14일째 투여 부위 근육 (A) 및 반대쪽 비투여 부위 근육 (B) 에 대한 CMAP 수치를 나타내는 그래프이다. CMAP 값에 대해 양측(two-tailed) t-검정을 사용하여 분석하였다 (*p<0.05, **p<0.01, ***p<0.001, ns; not significant).
도 9는 실시예 11에서 기재된 마우스에서 플라시보, 6 U/kg 보툴리눔 독소 A형 (BoNT/A), 12 U/kg 보툴리눔 독소 A형 + TSP11 (BoNT/A + TSP11)을 우측 장딴지근육에 투여 후 시간 경과에 따른 평균 DAS 값을 나타내는 그래프이다.
도 10은 실시예 12에 기재된 마우스에서 플라시보, 보툴리눔 독소 A형 (BoNT/A, 코어톡스주), 보툴리눔 독소 A형 + TSP47 (BoNT/A + TSP47), 및 보툴리눔 독소 A형 + TSP48 (BoNT/A + TSP48) 을 우측 장딴지근육에 투여 후 7 및 14일째 투여 부위 근육 (A) 및 반대쪽 비투여 부위 근육 (B) 에 대한 CMAP 수치를 나타내는 그래프이다. CMAP 값에 대해 양측(two-tailed) t-검정을 사용하여 분석하였다 (*p<0.05, **p<0.01, ***p<0.001, ns; not significant).
도 11은 실시예 13에 기재된 마우스에서 보툴리눔 독소 A형 (BoNT/A, 코어톡스주), 보툴리눔 독소 A형 + TSP56 (BoNT/A + TSP56), 및 보툴리눔 독소 A형 + TSP61 (BoNT/A + TSP61)을 우측 장딴지근육에 투여 후 7 및 14일째 투여 부위 근육 (A) 및 반대쪽 비투여 부위 근육 (B) 에 대한 CMAP 수치를 나타내는 그래프이다. CMAP 값에 대해 양측(two-tailed) t-검정을 사용하여 분석하였다 (*p<0.05, **p<0.01, ***p<0.001, ns; not significant).
본원에서 사용되는, "보툴리눔 독소 (Botulinum toxin, BoNT)"는 보툴리눔 독소의 임의의 폴리펩티드 또는 단편일 수 있다. 구체예에서, 보툴리눔 독소는 보툴리눔 독소 유도체, 즉, 보툴리눔 독소 활성을 가지나 천연 보툴리눔 독소 또는 재조합 원형(recombinant native) 보툴리눔 독소에 대해 임의의 부분 또는 임의의 사슬 상에 하나 이상의 화학적 변형 또는 기능적 변형을 포함하는 화합물인 보툴리눔 독소 유도체를 의미할 수 있다. 예를 들면, 보툴리눔 독소는 원형에 비해 결실, 변형 또는 치환된 하나 이상의 아미노산을 갖는 신경독소인 변형된 신경독소일 수 있거나, 또는 상기 변형된 신경독소는 재조합 기법에 의해 생산된 신경독소 또는 그의 유도체 또는 그의 단편일 수 있다.
상기 보툴리눔 독소는 내생의 비독소 단백질(클로스트리디움 보툴리눔에 의해 생산된 헤마글루티닌 단백질 및 비독소 비헤마글루티닌 단백질)과 결합되거나 결합되지 않은, 보툴리눔 독소(보툴리눔 독소 혈청형 A-G 중 하나에 속하는 약 150 kD의 보툴리눔 독소 단백질 분자)일 수 있다.
상기 보툴리눔 독소는 7개의 혈청형(보툴리눔 독소 타입 A, 보툴리눔 독소 타입 B, 보툴리눔 독소 타입 C, 보툴리눔 독소 타입 D, 보툴리눔 독소 타입 E, 보툴리눔 독소 타입 F 및 보툴리눔 독소 타입 G)으로 나뉘며, 이들은 아미노산 서열의 변이에 기초하여 아형(subtype)으로 추가로 세분화된다. 각 혈청형의 보툴리눔 독소는 그들이 영향을 미치는 동물 종 및 그들이 유발하는 마비의 심각도 및 지속기간이 다양하다.
용어 "아미노산 (amino acid)"은 천연 아미노산 및 비-천연 아미노산뿐 아니라, 프롤린과 같은 아미노산, 아미노산 유사체 및 천연 아미노산과 유사한 방식으로 기능하는 아미노산 모방체를 지칭한다. 즉, 상기 아미노산 모방체는 천연 아미노산의 일반적인 화학 구조와 상이한 구조를 갖지만 천연 아미노산과 유사한 방식으로 기능하는 것을 의미한다.
용어 "폴리펩티드", "펩티드"는 본 명세서에서 상호 호환적으로 사용되며, 아미노산 잔기로 구성된 폴리머를 지칭한다.
용어 "동일성(identity)"은 서열을 비교하여 결정되는 2 이상의 폴리펩티드 또는 폴리뉴클레오티드의 서열 사이의 관계를 나타낸다. 상기 동일성은 2 이상의 아미노산 잔기 또는 뉴클레오티드 잔기의 스트링(string) 사이의 매칭의 수에 의하여 결정되는 서열 관련도(sequence relatedness)의 정도를 나타낸다. 관련 폴리펩티드 또는 폴리뉴클레오티드의 동일성은 알려진 방법에 의하여 계산될 수 있다. 폴리펩티드 또는 폴리뉴클레오티드에 적용되는 "% 동일성"은 후보 아미노산 서열 또는 뉴클레오티드 서열을 제2 서열과 최대 퍼센트 동일성을 얻기 위하여, 정렬하고(aligning), 필요하다면 갭을 도입한 후 제2 서열의 잔기와 동일한 후보 서열 중의 잔기의 백분율로서 정의된다. 상기 정렬을 위한 방법 및 프로그램은 알려져 있다. 상기 프로그램은 예를 들면, BLAST, Smith-Waterman algorithm, 또는 Needleman-Wunsch algorithm일 수 있다.
일 양상은 생체 내에서 보툴리눔 독소의 확산을 저해하는 아래 화학식 1의 폴리펩티드를 포함하는, 보툴리눔 독소 안정화 조성물을 제공한다.
[화학식 1]
(C)n-V
상기 식에서, C는 신경세포의 세포막과 상호작용하는 모이어티를 나타내고, V는 신경세포의 세포막과 상호작용하면서 보툴리눔 독소와 상호작용하는 모이어티를 나타내며, n은 0 또는 1의 정수이다.
일 태양에서, V는 VAMP(vesicle　associated membrane protein), BDNF(brain-derived neurotrophic factor), 이들의 단편 또는 이들의 변이체인 것일 수 있다.
일 태양에서, V는 VAMP의 VpN 이들의 단편 또는 이들의 변이체인 것일 수 있다.
일 태양에서, VAMP는 VAMP1, VAMP2 또는 VAMP3, 예를 들어 VAMP2인 것일 수 있다.
예를 들어, V는 VAMP2, 이의 단편 또는 이의 변이체일 수 있다. 예를 들어, V는 VAMP2의 VpN, 이의 단편 또는 이의 변이체일 수 있다.
일 태양에서, V는 서열번호 1의 아미노산 서열을 포함하는(comprising) 것일 수 있다.
일 태양에서, V는 서열번호 1, 2, 3, 4, 5, 6, 7, 8, 9 또는 10의 아미노산 서열; 또는 서열번호 1, 2, 3, 4, 5, 6, 7, 또는 8의 아미노산 서열에서 하나의 아미노산이 치환된 서열로 이루어지는(consisting of) 것일 수 있다. 서열번호 8의 아미노산은 VpN이고, 서열번호 1 내지 7의 아미노산은 VpN의 단편이고, 서열번호 9 및 10은 VpN의 변이체이다.
V는 서열번호 1, 2, 3, 4, 5, 6, 7 및 8의 아미노산 서열; 및 서열번호 1, 2, 3, 4, 5, 6, 7, 및 8의 아미노산 서열에서 하나의 아미노산이 치환된 것인 아미노산 서열 중 선택되는 것일 수 있다.
서열번호 1, 2, 3, 4, 5, 6, 7 또는 8의 아미노산 중 하나의 아미노산이 치환된 서열은 치환 전 서열보다 소수성 상호작용이 감소되는 것일 수 있다. 예를 들어, 서열번호 1, 2, 3, 4, 5, 6, 7, 또는 8의 아미노산 서열에서 메티오닌 및/또는 트레오닌이 알라닌으로 치환된 것일 수 있다. 예를 들어, 서열번호 8의 아미노산 서열의 M47A 또는 T36A 변이 일 수 있다.일 태양에서, C는 세포 투과 펩티드(cell penetrating peptide) 또는 양이온성 펩티드(cationic peptide)인 것일 수 있다.
예를 들면 양이온성 아미노산은 리신, 아르기닌, 히스티딘에서 선택될 수 있다. 예를 들어, 양이온성 아미노산은 아르기닌일 수 있다.
구체예에서, C는 아르기닌-풍부 펩티드인 것일 수 있다. 예를 들어, C의 전체 아미노산 중 3/5 이상 또는 2/3 이상이 아르기닌으로 구성된 것일 수 있다.
일 태양에서, C는 방향족 아미노산을 추가로 포함하는 것일 수 있다.
예를 들면, 방향족 아미노산은 트립토판, 페닐알라닌, 티로신에서 선택될 수 있다.
구체예에서, 방향족 아미노산은 트립토판일 수 있다.
구체예에서, C는 6~9개의 아르기닌 및 2~3개의 트립토판을 포함하는 것일 수 있다. 예를 들어, C는 6~9개의 아르기닌 및 2~3개의 트립토판으로 구성될 수 있다.
예를 들어, C가 6~9개의 아르기닌 및 2~3개의 트립토판으로 구성되는 경우 C는 동일한 서열의 아미노산이 최대 세 번까지 반복되는 것일 수 있다.
일 태양에서, C는 아르기닌 및 트립토판이 일면으로 편향되어 있는 3차원 구조를 갖는 것일 수 있다.
일 태양에서, C는 서열번호 11, 서열번호 12 또는 서열번호 13의 아미노산 서열로 이루어지는 것일 수 있다.
일 태양에서, 폴리펩티드는 10~50개, 10~40개, 15~40개 또는 15~35개, 예를 들어 17~32개 또는 25~32개, 예를 들어 17개, 25개, 26개, 31개 또는 32개의 아미노산으로 이루어지는 것일 수 있다.
일 태양에서, 폴리펩티드는 서열번호 8(TSP19), 서열번호 14(TSP11), 서열번호 15(TSP28), 서열번호 16(TSP17), 서열번호 17(TSP35), 서열번호 18(TSP23). 서열번호 19(TSP2), 서열번호 20(TSP56) 또는 서열번호 21(TSP61)의 아미노산 서열로 이루어지는 것일 수 있다.
상기 폴리펩티드는 개시된 아미노산 서열의 변이체일 수 있다. 상기 변이체는 개시된 아미노산 서열과 80% 이상의 서열 동일성을 갖는 폴리펩티드일 수 있다. 예를 들면, 개시된 아미노산 서열과 82.5% 이상, 85% 이상, 90% 이상, 95% 이상, 또는 98% 이상의 서열 동일성을 갖는 것일 수 있다.
상기 폴리펩티드에 있어서, N-말단은 보호기로 보호된 것일 수 있다. 상기 N-말단은 보호기로서 아세틸기(acetyl group), 플루오레닐메톡시카르보닐기(fluoreonylmethoxycarbonyl group), 포르밀기(formyl group), 팔미토일기(palmitoyl group), 미리스틸기(myristyl group), 스테아릴기(stearyl group), 부톡시카르보닐기(butoxycarbonyl group), 알릴옥시카르보닐기(allyloxycarbonyl group) 또는 폴리에틸렌글리콜(polyethylene glycol; PEG)과 결합된 것일 수 있다.
상기 폴리펩티드의 C-말단은 보호기로 보호된 것일 수 있다. 상기 C-말단은 보호기로서 아미노기(amino group, -NH2), 삼차 알킬기(tertiary alkyl group) 또는 아자이드(azide, -NHNH2)와 결합된 것일 수 있다. 상기 삼차 알킬기에 있어서, 알킬기는 탄소수 4 내지 20, 4 내지 16, 4 내지 12, 4 내지 8, 5 내지 20, 5 내지 16, 5 내지 12, 또는 5 내지 8을 갖는 것일 수 있다.
다른 양상은 보툴리눔 독소 또는 이를 포함하는 제제에 상기 화학식 1의 폴리펩티드를 제공하여, 생체 내에서 보툴리눔 독소의 확산을 저해하는 방법을 제공한다.
다른 양상은 보툴리눔 독소 또는 이를 포함하는 제제에 상기 화학식 1의 폴리펩티드를 제공하여, 보툴리눔 독소를 안정화하는 방법을 제공한다.
다른 양상은 상기 화학식 1의 폴리펩티드의 생체 내에서 보툴리눔 독소의 확산을 저해하기 위한 용도를 제공한다.
다른 양상은 상기 화학식 1의 폴리펩티드의 보툴리눔 독소를 안정화하기 위한 용도를 제공한다.
다른 양상은 상기 화학식 1의 폴리펩티드의 보툴리눔 독소 부형제로 사용하기 위한 용도를 제공한다.
다른 양상은 보툴리눔 독소, 및 상기 보툴리눔 독소 안정화 조성물을 포함하는, 보툴리눔 독소 제제가 제공된다.
다른 양상은 생체 내에서 보툴리눔 독소의 확산을 저해하기 위한 상기 화학식 1의 폴리펩티드를 제공한다.
다른 양상은 보툴리눔 독소를 안정화하기 위한 상기 화학식 1의 폴리펩티드를 제공한다.
다른 양상은 보툴리눔 독소 부형제로 사용하기 위한 상기 화학식 1의 폴리펩티드를 제공한다.
일 태양에서, 보툴리눔 독소는 타입 A, B, C, D, E, F 또는 G인 것일 수 있다.
일 태양에서, 보툴리눔 독소는 천연 또는 재조합 독소인 것일 수 있다.
구체예에서, 재조합 독소는 한국출원 10-2021-0083930호(그 개시내용은 전체로서 본원에 참조로서 도입된다)에 개시된 것일 수 있는바, 재조합 독소는 보툴리눔 독소 타입 A4가 아닌 보툴리눔 독소 타입 A 경쇄의 제 1, 2, 3, 및 4 도메인 중 제 3 도메인의 서열이, 보툴리눔 독소 타입 A4의 제3 도메인 또는 그의 변이체의 서열로 치환된 재조합 보툴리눔 독소 타입 A 경쇄를 포함하는 것일 수 있다. 예를 들어, 재조합 보툴리눔 독소 타입 A 경쇄의 제 1, 2, 3, 및 4 도 메인 중 제 4 도메인의 서열이, 보툴리눔 독소 타입 A4의 제 4 도메인 또는 그 변이체의 서열로 추가로 치환된 것일 수 있다. 예를 들어, 보툴리눔 독소 타입 A 경쇄는 보툴리눔 독소 타입 A1, A2, A3, A5, A6, A7 또는 A8, 예를 들어 보툴리눔 독소 타입 A1인 것일 수 있다. 예를 들어, 재조합 보툴리눔 독소 타입 A 경쇄는 제 1, 2, 3, 및 4 도 메인으로서 A1-A1-A4-A4를 포함하는 것일 수 있다. 예를 들어, 재조합 보툴리눔 독소 타입 A 경쇄는 서열번호 23의 아미노산 서열로 이루어지는 것일 수 있다.
구체예에서, 재조합 독소는 한국출원 10-2021-0083950호(그 개시내용은 전체로서 본원에 참조로서 도입된다)에 개시된 것일 수 있는바, 재조합 독소는 보툴리눔 독소 타입 A1이 아닌 보툴리눔 독소 타입 A 경쇄의 제1, 2, 3, 및 4 도메인 중 제 2 도메인의 서열이, 보툴리눔 독소 타입 A1의 제 2 도메인 또는 그의 변이체의 서열로 치환된 것인, 재조합 보툴리눔 독소 타입 A 경쇄를 포함하는 것일 수 있다. 예를 들어, 재조합 보툴리눔 독소 타입 A 경쇄의 제 1, 2, 3, 및 4 도 메인 중 제 4 도메인의 서열이, 보툴리눔 독소 타입 A1의 제 4 도메인 또는 그 변 이체의 서열로 추가로 치환된 것일 수 있다. 예를 들어, 보툴리눔 독소 타입 A 경쇄는 보툴리눔 독소 타입 A2, A3, A4, A5, A6, A7 또는 A8, 예를 들어 보툴리눔 독소 타입 A4인 것일 수 있다. 예를 들어, 재조합 보툴리눔 독소 타입 A 경쇄는 제 1, 2, 3, 및 4 도메인으로서 A4-A1-A4-A1을 포함하는 것일 수 있다.
일 태양에서, 보툴리눔 독소는 7S(150kD) 또는 19S(900kD) 형태의 것일 수 있다.
일 태양에서, 상기 폴리펩티드의 사용량은 보툴리눔 독소의 확산을 저해하는 활성을 나타내면서 보툴리눔 독소의 목적하는 임상 효능은 저해하지 않는 범위 이내인 한, 특별히 제한되지 않으나, 예를 들어 보툴리눔 독소 1몰 대비 10 내지 1010배, 102 내지 109배, 103 내지 108배, 103 내지 107배, 103 내지 106배, 또는 3Х103 내지 106 배의 양으로 사용될 수 있다.
상기 보툴리눔 독소 제제는 약제학적으로 허용 가능한 부형제 또는 담체를 추가로 포함하는 것일 수 있다.
용어 "약제학적으로 허용 가능한"은 해당 보툴리눔 독소 안정화 조성물 또는 성분들이 과도한 독성, 불안정성, 알레르기 반응 등이 없이 조직들과 접촉에서의 사용 또는 환자에서의 사용을 위해 적합하다는 것을 의미한다. 약제학적 또는 미용학적으로 전형적이고 허용가능할 경우, 본 개시의 보툴리눔 독소 제제는 약제학 및 피부학 분야에서 통상적으로 사용되는 임의의 성분을 포함할 수 있다.
본 개시의 보툴리눔 독소 제제는 하나 이상의 추가적인 약제학적으로 허용가능한 부형제 또는 첨가제와 혼합하여 제조될 수 있다. 예를 들면, 완충 식염수와 같은 단순한 수성의 약학적으로 허용가능한 부형제 또는 첨가제를 포함할 수 있다. 이 경우 본 개시의 보툴리눔 독소 제제가 주사에 의해 적용될 수 있다. 약제학적으로 허용되는 부형제 또는 첨가제는 안정화제, 이온 화합물(ionic compound), 계면활성제, 완충제, 동결건조 보호제, 또는 이들의 조합, 예를 들어 아미노산(예를 들어 메티오닌), 염(예를 들어 NaCl), 완충액, 비이온성 계면활성제(예를 들어 폴리소르베이트, 예를 들어 폴리소르베이트 20), 당(예를 들어 백당 등과 같은 다이사카라이드), 당 알코올(예를 들어 소르비톨), 또는 이들의 조합일 수 있다.
상기 보툴리눔 독소 제제는 알부민 또는 동물 유래 성분이나 폴리사카라이드를 포함하지 않는 것일 수 있다.
상기 보툴리눔 독소 제제는 고체 또는 액체 제제, 예를 들어 동결건조 분말, 액상, 또는 프리필드 시린지(pre-filled syringe) 제제 등 어떠한 형태로도 제제화될 수 있다.
본 개시의 보툴리눔 독소 제제는 용액, 에멀젼(마이크로에멀젼 포함), 현탁액, 크림, 로션, 겔, 분말, 또는 본 개시의 보툴리눔 독소 제제가 이용될 수 있는 피부 또는 기타 조직으로의 적용을 위해 이용되는 기타 전형적인 고체 또는 액체 조성물을 포함할 수 있다. 그와 같은 조성물은 보툴리눔 독소와 안정화 펩티드 외에, 일반적으로 이용되는 다른 성분들, 예를 들면, 항미생물제(antimicrobial), 보습제 및 수화제, 투과제(penetration agent), 보존제, 유화제(emulsifier), 천연 또는 합성 오일, 용매, 계면활성제, 디터전트, 겔화제, 연화제(emollient), 항산화제, 방향제, 충진제(filler), 증점제(thickener), 왁스, 탈취제(odor absorber), 염료, 착색제, 분말, 점도 조절제 및 물을 포함하고, 선택적으로 마취제, 항-소양증제(anti-itch actives), 식물 추출물, 컨디셔닝제(conditioning agent), 흑화제(darkening agent) 또는 미백제(lightening agent), 글리터(glitter), 습윤제(humectant), 운모(mica), 미네랄, 폴리페놀, 실리톤 또는 그의 유도체, 차광제(sunblock), 비타민, 및 약용식물(phytomedicinal)을 포함할 수 있다.
다른 양상은 상기 보툴리눔 독소 안정화 조성물 및 제제에 사용하기 위한 서열번호 15, 서열번호 16, 서열번호 17 또는 서열번호 18의 아미노산 서열로 이루어지는 폴리펩티드를 제공한다.
다른 양상은 상기 보툴리눔 독소 제제를 개체에 투여하여 질환을 개선하거나 치료하기 위한 용도를 제공하는 것이다.
"투여" 또는 "투여하는 것"은 제약 조성물 또는 유효성분을 대상에게 제공하는 단계를 의미한다. 제약 조성물은 다양한 적절한 경로를 통하여 투여될 수 있다.
"제약 조성물"은 유효성분이 보툴리눔 독소일 수 있는 제제를 의미한다. "제제"라는 용어는 보툴리눔 신경독소 유효성분 이외에 적어도 1종의 추가적인 성분, 예를 들면 알부민(인간 혈청 알부민 또는 재조합 인간 알부민) 및/또는 소듐 클로라이드가 제약 조성물 중에 존재한다는 것을 의미한다. 제약 조성물은 인간 환자와 같은 대상에의 투여에 적합한 제제이다. 제약 조성물은 동결건조된 형태, 예를 들면 식염수 또는 물을 사용한 동결건조된 제약 조성물의 재구성 후 형성되는 용액, 또는 재구성을 필요로 하지 않는 용액 형태일 수 있다. 제약 조성물은 액체 또는 고체일 수 있다.
본 개시는 보툴리눔 독소 제제의 유효량이 투여되도록 적용된다. 본 명세서에서 사용된 용어 "유효량"은 원하는 효과를 내기에 충분하나, 안전한 즉, 심각한 부작용을 방지할 수 있을 정도의 보툴리눔 독소 제제의 양을 의미한다. 원하는 효과는 예를 들면, 미세 주름, 특히 안면의 미세 주름을 감소시키거나 안면의 외형을 조정하거나, 또는 근육 긴장의 전반적인 완화를 목적으로 한 특정 근육의 이완을 포함한다. 근육 긴장의 전반적인 완화는 얼굴 또는 그 외의 부위에서 일어날 수 있다.
"치료하다", "치료하는 것" 또는 "치료"는 예컨대 상처를 입거나 손상된 조직의 치유, 또는 기존의 것이거나 인지된 질환, 장애 또는 이상을 변경, 변화, 강화, 개선, 개량 및/또는 미화하는 것에 의해, 원하는 치료상의 결과를 달성하도록 하는, 질환, 장애 또는 이상의 경감 또는 감소(일부 감소, 상당한 감소, 거의 완전한 감소 및 완전한 감소 포함), 해결 또는 예방(일시적이거나 영구적인 것)을 의미한다. 본 명세서에서, "치료"는 예방을 포함하는 개념이다. "예방"은 질병, 장애 또는 질환의 발병의 지연을 의미한다. 질병, 장애 또는 질환의 발병이 예정된 기간 동안 지연된 경우 예방은 완전한 것으로 간주될 수 있다.
다른 양상은 상기 보툴리눔 독소 제제를 개체에 투여하여 질환을 개선하거나 치료하기 위한 용도를 제공하는 것이다.
상기 "개체"는 질병의 치료를 필요로 하는 대상을 의미한다. 상기 개체는 예를 들면, 사람, 마우스, 고양이, 말, 및 소 등의 포유동물일 수 있다.
본 개시는 상기 보툴리눔 독소 제제를 환자에게 투여하여 질환을 개선하거나 치료하기 위한 것이다. 구체예에서, 상기 안정화된 보툴리눔 독소 안정화 조성물은 유효량으로 질환의 치료를 필요로 하는 개체 또는 환자에 적용되어 예를 들면, 근육 마비, 과다분비 또는 발한의 경감, 신경계 통증 또는 편두통의 치료, 근육 경련의 경감, 여드름의 예방 또는 경감, 면역 반응의 경감 또는 강화, 주름 감소, 또는 다양한 기타 질환의 예방 또는 치료를 포함할 수 있다. 일 구체예에서, 보툴리눔 독소 제제는 예를 들면, 피하 주사와 같은, 비경구 주사에 의해 투여된다. 투여는 예를 들면, 다리, 어깨, 허리, 손바닥, 발, 목, 서혜부, 손등, 발등, 팔꿈치, 상완, 무릎, 상지, 둔부, 몸체, 골반, 또는 보툴리눔 독소 조성물의 투여가 바람직한 신체 부위일 수 있다.
본 개시는 또한 피부를 통해 본 명세서에 기재된 보툴리눔 독소 안정화 조성물을 전달하는 경피 전달 장치를 포함한다. 그와 같은 장치는 또한 피부 패치와 같이 단순한 구조일 수 있거나, 또는 조성물을 분배하고 조성물의 분배를 모니터링하는 수단, 및 분배되는 약제학적 조성물에 대한 개체의 반응을 모니터링하는 것을 포함하는 수단을 포함하는 장치일 수 있다.
본 개시의 보툴리눔 독소 제제는 약 4.5 내지 약 6.3 범위의 pH를 갖는 생리적 환경에서 사용하기에 적합한 pH를 가질 수 있다. 본 개시에 따른 보툴리눔 독소 제제는 실온 또는 냉장 조건 하에서 보관될 수 있다.
보툴리눔 독소의 치료 유효량은 약 0.01 U/㎏ 내지 약 100 U/㎏, 약 0.1 U/㎏ 내지 약 100 U/㎏, 약 0.2 U/㎏ 내지 약 100 U/㎏, 약 0.2 U/㎏ 내지 약 50 U/㎏, 약 0.2 U/㎏ 내지 약 30 U/㎏, 약 0.2 U/㎏ 내지 약 10 U/㎏, 약 0.2 U/㎏ 내지 약 1 U/㎏이다. 다른 태양에서, 체중 60 ㎏ 성인 기준으로 약 1 U 내지 약 10,000 U, 약 1 U 내지 약 5,000 U, 약 1 U 내지 약 2,500 U, 약 1 U 내지 약 1,000 U, 약 1 U 내지 약 500 U, 약 1 U 내지 약 300 U, 약 1 U 내지 약 200 U, 약 10 U 내지 약 200 U, 약 10 U 내지 약 100 U, 약 10 U 내지 약 50 U일 수 있다.
본 명세서에서 사용되는, "유닛", "unit(s)", 또는 "U"라는 용어는 보툴리눔 독소 주사를 맞은 마우스 중 50%를 사멸시킨 보툴리눔 독소의 양으로서 정의되는, LD50 용량을 지칭하는 것으로, 호환 가능하게 사용된다.
또 다른 양상은 상기 보툴리눔 독소 제제를 개체에 투여하여 보툴리눔 독소를 안정화하는 방법을 제공하는 것이다.
용어 "안정화"는 약제학적 조성물의 저장 또는 생산 도중에 응집체 (비가용성 및/또는 가용성)의 형성 또는 화학적 분해를 최소화하는 것이고, 단백질의 pH 및 고유의 구조를 유지하여 생물학적 활성 및 단백질 안정성의 실질적인 보유를 유지하는 것을 의미한다. 또한, 보툴리눔 독소의 타 조직으로의 확산이 방지되어 부작용 발생의 위험이 줄어드는 것을 의미한다.
보툴리눔 독소가 질환을 개선하거나 치료하기 위한 용도로 신체에 국소적으로 적용될 경우, 시간의 경과에 따라 확산될 수 있으며 이로 인해 신체의 다른 부위에서 원하지 않는 근육마비를 일으킬 수 있다. 예를 들면, 보툴리눔 독소가 주름 개선을 눈 주변에 투여되고 인접 조직에 확산될 경우, "안검하수 (Ptosis)"가 발생하여 정상적인 시각을 방해할 수 있다.
본 개시의 보툴리눔 독소 제제는 인체에 투여 후 확산이 감소될 수 있다. 이에 따라, 보툴리눔 독소의 목표 조직으로의 정확하게 전달되어 보툴리눔 독소의 확산과 관련된 원하지 않는 부작용을 감소시킬 수 있다.
본 개시의 보툴리눔 독소 제제는 보툴리눔 독소의 확산과 관련된 원하지 않는 부작용을 감소시킬 수 있음에 따라, 제제 내에 통상적으로 사용되는(폴리펩티드를 포함하지 않는 제제에 사용되는) 양 보다 증가된 양의 보툴리눔 독소를 포함할 수 있다. 이 경우 통상적인 보툴리눔 독소 제제에 비해 증가된 보툴리눔 독소의 임상적 효능 지속기간(duration)을 나타낼 수 있다. 이에 따라 투여 주기를 늘리고 투여 빈도를 낮출 수 있다. 구체예에서, 보툴리눔 독소 제제는 통상적으로 사용되는 양의 1.5배, 2배, 3배, 4배, 5배 이상의 보툴리눔 독소를 포함할 수 있다. 구체예에서, 보툴리눔 독소 제제는 통상적인 투여 주기의 1.5배, 2배, 3배, 4배 이상의 투여 주기, 예를 들어, 3개월 초과, 4개월, 5개월, 6개월, 7개월, 8개월, 9개월, 10개월, 11개월 또는 12개월 이상의 주기로 투여될 수 있다.
이하 본 개시를 실시예를 들어 보다 상세히 설명하나, 이는 본 개시를 설명하기 위한 것일 뿐 그 범위를 어떤 식으로든지 제한하고자 하는 것은 아니다.
본 실험에서는, 아래 표 1에 나타낸 폴리펩티드를 합성(업체명: 애니젠)하여 사용하였다. 하기 표 1의 구조에는 서열번호에 따른 아미노산 구조 외에 보호기로서 아미노기 결합 여부도 표시하였다.
펩티드 명칭 서열번호 구조 비고
TSP1 서열번호 22 RKKRRQRRRGKKKKKKKKKKKKKKKGRKKRRQRRR-NH2
TSP2 서열번호 19 RALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR-NH2 BDNF 유래
TSP11 서열번호 14 RRWRRWNRFNRRRCRRRLQQTQAQVDEVVDIM IMTP8+VPN
TSP17 서열번호 16 RRWRRWNRFNRRRCRRRLQQTQAQV IMTP8+VPN 단편
TSP19 서열번호 8 RRLQQTQAQVDEVVDIM-NH2 VPN 단독
TSP23 서열번호 18 RRWRRWNRFNRRRCRGWRFIRIDTSCVCTLT-NH2 IMTP8 + TSP2(BDNF)
TSP28 서열번호 15 RRWWRRWRRRRLQQTQAQVDEVVDIM-NH2 TSP11 서열에서 C 모이어티의 서열을 Arginine 6개, Tryptophan 3개로 치환
TSP35 서열번호 17 RRRWRRWRRRRLQQTQAQVDEVVDIM-NH2 TSP28 서열에서 W 서열 1개를 R로 치환
TSP47 서열번호 14 RRWRRWNRFNRRRCRRRLQQTQAQVDEVVDIM-NH2 TSP11 서열에 C-term amidation
TSP48 서열번호 15 RRWWRRWRRRRLQQTQAQVDEVVDIM TSP28 서열에 no amidation
TSP56 서열번호 20 RRWRRWNRFNRRRCRRRLQQTQAQVDEVVDIA TSP11 서열에서 VPN의 1 amino acid 교체 (M47A)
TSP61 서열번호 21 RRWRRWNRFNRRRCRRRLQQAQAQVDEVVDIM TSP11 서열에서 VPN의 1 amino acid 교체 (T36A)
실시예 1: 마우스에서 보툴리눔 독소 A형과 TSP11 혼합 제형에 대한 비임상 효능 시험
암컷 5주령 CD1 (ICR) 마우스를 ㈜오리엔트바이오에서 구입하여 1주간 순화 및 검역 후 6주령 마우스를 실험에 사용하였다. 사료는 멸균된 실험동물용 고형사료 (R40-10, SAFE, France)를 자유급이 하였으며, 음수는 상수도수를 고온고압멸균하여 자유 급이하였다. 순화, 검역 및 실험기간 동안 마우스는 온도 23 ± 3℃, 상대습도 55 ± 15%, 조명시간 12시간 (오전8시~오후8시), 환기횟수 15회/시간 및 조도 150~300 Lux로 설정된 특정-병원체-부재 조건하에서 사육되었다. 본 연구는 ㈜메디톡스 동물실험윤리위원회의 검토 및 승인 (A-2020-016) 후 수행되었다.
시험물질은 코어톡스주 (메디톡스)가 사용되었으며 플라시보 (위약투여군)은 멸균 생리식염수 (대한약품공업)가 사용되었다. 독소 안정화 펩티드 (TSP11)는 보툴리눔 독소 1몰 대비 3*104 ~ 1*105 비율로 펩티드를 혼합하여 실험에 사용하였다(표 2). 보툴리눔 독소와 독소 안정화 펩티드 혼합액을 120 U/mL 농도로 희석하여 실험에 사용하였다.
시험물질이 투여된 날을 0일로 하였으며, 주사마취제 (100 mg/kg 염산케타민 + 10 mg/kg 자일라진)를 이용해 마우스를 마취한 뒤 군구성 표 2에 따라 각각의 시험물질을 마우스의 오른쪽 장딴지근육에 해밀턴 주사기를 이용하여 0.2 mL/kg로 투여하였다.
군 동물수 투여물질 및 용량 투여경로 평가지표
1 6 Placebo 우측 장딴지근육 CMAP
2 6 24 U/kg BoNT/A 우측 장딴지근육 CMAP
3 6 24 U/kg BoNT/A + 15.5 ng/U TSP11 우측 장딴지근육 CMAP
4 6 24 U/kg BoNT/A + 4.65 ng/U TSP11 우측 장딴지근육 CMAP
평가는 외부적인 전기 자극에 반응하는 근육의 활동전위를 측정하는 복합근육 활동전위 (CMAP: compound muscle action potential) 시험법이 사용되었다. CMAP은 Nicolet Viking Quest (Viasys Healthcare, Inc.) 또는 UltraPro S100 (Natus Neurology Inc.) 장비를 이용하여 각 마우스의 오른쪽 장딴지근 부위 (투여 부위) 및 왼쪽 장딴지근육 (비투여 부위)에서 측정되었다. 주사마취제로 마취 한 뒤 측정부위의 털을 제모하고 엎드린 자세로 마우스를 위치시켰다. 측정하고자 하는 다리 쪽의 좌골신경 부위에 음극을 위치시키고, 그 부위로부터 척추를 기준으로 약 1 cm 떨어진 부위에 양극을 위치시켰다. 기록 전극과 기준 전극을 장딴지근 부위와 아킬레스 건 부위에 각각 위치시키고, 접지 전극을 대퇴직근 부위에 위치시켰다. 자극의 수준과 기간은 7~8 mA, 0.1 ms로 하였으며, 증폭기의 필터 범위는 60 Hz 에서 2-10 K로 설정하였다. 해당 조건으로 측정하였을 때 파형의 기저부에서 최고점까지의 높이를 CMAP 측정값으로 데이터화 하였다. 시험물질 투여 후 7 및 14일째 투여부위 장딴지 근육과 반대쪽 다리의 장딴지 근육에 대해 측정하였다.
Graphpad Prism 7.05 (GraphPad Software Inc., CA, USA)은 그래프 제시에 사용되었으며 SPSS software 25.0 (SPSS Inc., IL, USA) 및 Excel (2013, MS, USA)는 통계 분석에 사용되었다. 실험의 결과는 평균 ± 표준편차로 표시하였다. Kolmogorov-Smirnov test를 이용해 정규성 검정을 실시하였다. 비모수 데이터는 Mann-Whitney 검정을 통해 통계분석을 하였으며, 모수 데이터의 경우 양측 (two-tailed) t-검정을 수행하여 p-value가 0.05 보다 작은 경우 통계적으로 유의성이 있다고 판단하였다.
마우스 우측 장딴지근육에 보툴리눔 독소 A형 (BoNT/A)과 독소 안정화 펩티드가 혼합된 BoNT/A + TSP11 시험물질을 24 U/kg 용량으로 투여한 후 7 및 14일째 투여 부위 근육과 반대쪽의 비투여 부위 근육에 대해 CMAP 측정을 실시하였다. 그 결과, 투여 부위 근육의 CMAP 값은 BoNT/A 단독 투여군과 BoNT/A + TSP11 투여군 간 유의미한 차이가 관찰되지 않았으나, 반대쪽 근육에서의 CMAP 값은 BoNT/A + 15.5 ng/U TSP11 투여군 및 BoNT/A + 4.65 ng/U TSP11 투여군에서 BoNT/A 단독 투여군 대비 유의적으로 높게 관찰되었다(도 1). 이러한 결과로부터 보툴리눔 독소와 TSP11 혼합을 통해 반대쪽 다리로의 확산 감소 효과를 확인하였다.
실시예 2: 마우스에서 재조합 보툴리눔 독소 A형과 TSP11 혼합 제형에 대한 비임상 효능 시험
실시예 1과 동일하게 암컷 5주령 CD1 (ICR) 마우스를 ㈜오리엔트바이오에서 구입하여 1주간 순화 및 검역 후 6주령 마우스를 실험에 사용하였다. 사료, 음수, 및 사육조건은 실시예 1과 동일하였다. 본 연구는 ㈜메디톡스 동물실험윤리위원회의 검토 및 승인 (A-2020-016) 후 수행되었다.
플라시보(위약투여군)은 멸균 생리식염수 (대한약품공업)가 사용되었다. 재조합 보툴리눔 독소 A형 (eBoNT/A)은 보툴리눔 독소의 경쇄가 BoNT/A1 경쇄와 BoNT/A4 경쇄의 조합으로 이루어진 재조합된 보툴리눔 독소로 재조합 전장 보툴리눔 독소 유전자(서열번호 24)를 pMTL80000 벡터 시스템을 이용하여 인퓨전 방법으로(infusion-HD, Takara) 클로닝하하여 독소 유전자가 불활성화 된 무독화 홀 에이-하이퍼 (hall A-hyper) 균주를 사용하여 생산하였으며 복합체 성분을 포함하지 않는 약 150 kDa의 형태로 정제하였다. 상기 재조합 보툴리눔 독소의 모든 제조는 당국의 규제에 따라 독소 생산이 허가된 시설에서 수행하였다. 독소 안정화 펩티드 (TSP11)는 4.65 ~ 46.5 ng/U 비율로 펩티드를 혼합하여 실험에 사용하였다(표 3).
각 시험물질의 투여 용량은 모두 unit (U: 보툴리눔 독소의 생물학적 활성을 나타내는 값으로 1 U은 마우스 복강투여에 의한 마우스 반수치사량)을 기준으로 동일하게 투여되었다. 보툴리눔 독소와 독소 안정화 펩티드 혼합액을 60 U/mL 농도로 희석하여 실험에 사용하였다.
시험물질이 투여된 날을 0일로 하였으며, 주사마취제 (100 mg/kg 염산케타민 + 10 mg/kg 자일라진)를 이용해 마우스를 마취한 뒤 군구성 표 3에 따라 각각의 시험물질을 마우스의 오른쪽 장딴지근육에 해밀턴 주사기를 이용하여 0.2 mL/kg로 투여하였다. 1회 시험에 각 시험물질 당 6마리의 마우스가 사용되었으며, 각 시험물질에 대해 총 2~3회의 반복시험이 수행되었다. 평가는 외부적인 전기 자극에 반응하는 근육의 활동전위를 측정하는 복합근육 활동전위 CMAP 시험법이 사용되었다. 구체적인 평가 방법 및 통계분석은 실시예 1과 동일하게 진행되었다.
군 동물수 투여물질 및 용량 투여경로 평가지표
1 18 Placebo 우측 장딴지근육 CMAP
2 18 12 U/kg eBoNT/A 우측 장딴지근육 CMAP
3 12 12 U/kg eBoNT/A + 4.65 ng/U TSP11 우측 장딴지근육 CMAP
4 18 12 U/kg eBoNT/A + 15.5 ng/U TSP11 우측 장딴지근육 CMAP
5 18 12 U/kg eBoNT/A + 46.5 ng/U TSP11 우측 장딴지근육 CMAP
마우스 우측 장딴지근육에 재조합 보툴리눔 독소 A형 (eBoNT/A) 그리고 재조합 보툴리눔 독소 A형과 독소 안정화 펩티드가 혼합된 eBoNT/A + TSP11 시험물질을 12 U/kg 용량으로 투여한 후 7 및 14일째 투여 부위 근육과 반대쪽의 비투여 부위 근육에 대해 CMAP 측정을 실시하였다. 그 결과, 투여 부위 근육의 CMAP 값은 투여후 7일째 eBoNT/A + 46.5 ng/U TSP11 투여군에서 eBoNT/A 단독 투여군 대비 유의적인 CMAP 증가가 관찰되었으나, 투여 후 14일째는 eBoNT/A 단독 투여군 대비 독소 안정화 펩티드가 혼합된 시험군에서는 관찰되지 않았다(도 2). 반대쪽 근육에서의 CMAP 값은 투여 후 7일째 및 14일째 모두 eBoNT/A 단독투여군 대비 eBoNT/A + TSP11 투여군에서 유의적인 증가가 관찰되었다(도 2). 이러한 결과로부터 재조합 보툴리눔 독소 A형의 반대쪽 다리로의 확산이 독소 안정화 펩티드(TSP11)와의 혼합을 통해 감소됨을 확인하였다.
실시예 3: 마우스에서 보툴리눔 독소 A형과 TSP1, TSP11, TSP28 혼합 제형에 대한 IM LD50 시험
실시예 1과 동일하게 암컷 5주령 CD1 (ICR) 마우스를 ㈜오리엔트바이오에서 구입하여 1주간 순화 및 검역 후 6주령 마우스를 실험에 사용하였다. 사료, 음수, 및 사육조건은 실시예 1과 동일하다. 본 연구는 ㈜메디톡스 동물실험윤리위원회의 검토 및 승인 (A-2020-015) 후 수행되었다.
시험물질은 코어톡스주 (메디톡스)가 사용되었으며 독소 안정화 펩티드 (TSP1, TSP11, TSP28)은 보툴리눔 독소 1몰 대비 3×105 비율로 펩티드를 혼합하여 실험에 사용하였다(표 4). 보툴리눔 독소와 독소 안정화 펩티드 혼합액을 300, 450, 675, 1012.5 U/mL 농도로 희석하여 실험에 사용하였다.
시험물질이 투여된 날을 0일로 하였으며, 실험동물의 마취 및 시험물질의 투여는 실시예 1과 동일하게 진행되었다. 1회 시험에 각 시험군 당 10마리의 마우스가 사용되었으며, 총 2회의 반복시험이 수행되었다. 시험물질을 오른쪽 장딴지근육에 투여 후 7일간 사망개체 확인을 실시하였다. 각 투여 용량별 사망개체에 대해 SPSS software 25.0 (SPSS Inc., IL, USA)를 이용하여 프로빗 분석을 통해 IM LD50 값을 산출하였다.
군 동물수 투여물질 및 용량 투여경로 평가지표
1 10 60 U/kg BoNT/A 우측 장딴지근육 Survival
2 10 90 U/kg BoNT/A 우측 장딴지근육 Survival
3 10 135 U/kg BoNT/A 우측 장딴지근육 Survival
4 10 60 U/kg BoNT/A + 50.9 ng/U TSP1 우측 장딴지근육 Survival
5 10 90 U/kg BoNT/A + 50.9 ng/U TSP1 우측 장딴지근육 Survival
6 10 135 U/kg BoNT/A + 50.9 ng/U TSP1 우측 장딴지근육 Survival
7 10 202.5 U/kg BoNT/A + 50.9 ng/U TSP1 우측 장딴지근육 Survival
8 10 60 U/kg BoNT/A + 38.3 ng/U TSP28 우측 장딴지근육 Survival
9 10 90 U/kg BoNT/A + 38.3 ng/U TSP28 우측 장딴지근육 Survival
10 10 135 U/kg BoNT/A + 38.3 ng/U TSP28 우측 장딴지근육 Survival
11 10 202.5 U/kg BoNT/A + 38.3 ng/U TSP28 우측 장딴지근육 Survival
12 10 60 U/kg BoNT/A + 46.5 ng/U TSP11 우측 장딴지근육 Survival
13 10 90 U/kg BoNT/A + 46.5 ng/U TSP11 우측 장딴지근육 Survival
14 10 135 U/kg BoNT/A + 46.5 ng/U TSP11 우측 장딴지근육 Survival
15 10 202.5 U/kg BoNT/A + 46.5 ng/U TSP11 우측 장딴지근육 Survival
시험물질 1회차 근육투여 반수치사량 (U/kg) 2회차 근육투여 반수치사량 (U/kg) 1~2회 평균 근육투여 반수치사량 (U/kg)
BoNT/A 98.8 83.3 91.1
BoNT/A + TSP1 81.2 71.9 76.6
BoNT/A + TSP28 128.5 122.1 125.3
BoNT/A + TSP11 152.1 142.8 147.5
표 5에서와 같이, 마우스 우측 장딴지근육에 보툴리눔 독소 A형 (BoNT/A)과 독소 안정화 펩티드가 혼합된 BoNT/A + TSP1, BoNT/A + TSP28, BoNT/A + TSP11 시험물질을 투여한 후 7일간 사망개체 발생을 관찰하여 반수 치사량(IM LD50)을 산출한 결과, BoNT/A 단독 투여군은 평균 91.1 U/kg, BoNT/A + TSP1 투여군은 평균 76.6 U/kg, BoNT/A + TSP28 투여군은 평균 125.3 U/kg, BoNT/A + TSP11 투여군은 평균 147.5 U/kg으로 관찰되었다. BoNT/A 단독 투여군 대비 BoNT/A + TSP28 투여군에서 약 1.4배, BoNT/A + TSP11 투여군에서 약 1.6배 증가가 관찰되었다(표 5). 이러한 결과로부터 보툴리눔 독소와 독소 안정화 펩티드 (TSP11, TSP28) 혼합을 통한 안전성 개선 효과를 확인하였다.
실시예 4: 마우스에서 재조합 보툴리눔 독소 A형과 TSP11 혼합 제형에 대한 IM LD50 시험
실시예 1과 동일하게 암컷 5주령 CD1 (ICR) 마우스를 ㈜오리엔트바이오에서 구입하여 1주간 순화 및 검역 후 6주령 마우스를 실험에 사용하였다. 사료, 음수, 및 사육조건은 실시예 1과 동일하다. 본 연구는 ㈜메디톡스 동물실험윤리위원회의 검토 및 승인 (A-2020-015) 후 수행되었다.
시험물질로 재조합 보툴리눔 독소 A형은 실시예 2와 동일한 재조합 보툴리눔 독소 A형이 사용되었다. 독소 안정화 펩티드 (TSP11)는 46.5 ng/U 비율로 실험에 사용하였다(표 6). 재조합 보툴리눔 독소 A형과 독소 안정화 펩티드 혼합액을 300, 450, 675 U/mL 농도로 희석하여 실험에 사용하였다. 시험물질이 투여된 날을 0일로 하였으며, 실험동물의 마취 및 시험물질의 투여는 실시예 1과 동일하게 진행되었다. 시험물질을 오른쪽 장딴지근육에 투여 후 14일간 사망개체 확인을 실시하였다. 각 투여 용량별 사망개체에 대해 SPSS software 25.0 (SPSS Inc., IL, USA)를 이용하여 프로빗 분석을 통해 IM LD50 값을 산출하였다.
군 동물수 투여물질 및 용량 투여경로 평가지표
1 10 60 U/kg eBoNT/A 우측 장딴지근육 Survival
2 10 90 U/kg eBoNT/A 우측 장딴지근육 Survival
3 10 135 U/kg eBoNT/A 우측 장딴지근육 Survival
10 10 60 U/kg eBoNT/A + 46.5 ng/U TSP11 우측 장딴지근육 Survival
11 10 90 U/kg eBoNT/A + 46.5 ng/U TSP11 우측 장딴지근육 Survival
12 10 135 U/kg eBoNT/A + 46.5 ng/U TSP11 우측 장딴지근육 Survival
시험물질 근육투여 반수치사량 (U/kg)
eBoNT/A 63.8
eBoNT/A + TSP11 81.2
표 7에서와 같이 마우스 우측 장딴지근육에 재조합 보툴리눔 독소 A형 (eBoNT/A)과 독소 안정화 펩티드가 혼합된 eBoNT/A + TSP11 시험물질을 투여한 후 14일간 사망개체 발생을 관찰하여 반수 치사량을 산출한 결과, eBoNT/A 단독 투여군은 63.8 U/kg, eBoNT/A + TSP11 투여군은 81.2 U/kg로 관찰되어 eBoNT/A 단독 투여군 대비 약 1.3배 증가가 관찰되었다(표 7). 이러한 결과로부터 재조합 보툴리눔 독소와 독소 안정화 펩티드 (TSP11) 혼합을 통한 재조합 보툴리눔 독소의 안전성 개선 효과를 확인하였다.
실시예 5: 마우스에서 보툴리눔 독소 A형과 TSP11, TSP17, TSP19 혼합 제형에 대한 비임상 효능 시험
실시예 1과 동일하게 암컷 5주령 CD1 (ICR) 마우스를 ㈜오리엔트바이오에서 구입하여 1주간 순화 및 검역 후 6주령 마우스를 실험에 사용하였다. 사료, 음수 및 사육조건은 실시예 1과 동일하다.
시험물질로 코어톡스주 (메디톡스)가 사용되었으며 플라시보(위약투여군)은 멸균 생리식염수 (대한약품공업)가 사용되었다. 독소 안정화 펩티드 (TSP11, TSP17, TSP19)는 합성(업체명: 애니젠)하여 사용하였으며 보툴리눔 독소 1몰 대비 3×105 비율로 펩티드를 혼합하여 실험에 사용하였다 (표 8). 보툴리눔 독소와 독소 안정화 펩티드 혼합액을 120 U/mL 농도로 희석하여 실험에 사용하였다.
시험물질이 투여된 날을 0일로 하였으며, 실험동물의 마취 및 시험물질의 투여는 실시예 1과 동일하게 진행되었다.
평가는 외부적인 전기 자극에 반응하는 근육의 활동전위를 측정하는 복합근육 활동전위 CMAP 시험법이 사용되었다. 구체적인 평가 방법과 통계 분석은 실시예 1과 동일하게 진행되었다.
군 동물수 투여물질 및 용량 투여경로 평가지표
1 6 Placebo 우측 장딴지근육 CMAP
2 6 24 U/kg BoNT/A 우측 장딴지근육 CMAP
3 6 24 U/kg BoNT/A + 37.9 ng/U TSP17 우측 장딴지근육 CMAP
4 6 24 U/kg BoNT/A + 22.2 ng/U TSP19 우측 장딴지근육 CMAP
5 6 24 U/kg BoNT/A + 46.5 ng/U TSP11 우측 장딴지근육 CMAP
마우스 우측 장딴지근육에 보툴리눔 독소 A형 (BoNT/A)과 독소 안정화 펩티드가 혼합된 BoNT/A + TSP17, BoNT/A + TSP19, BoNT/A + TSP11 시험물질을 24 U/kg 용량으로 투여한 후 7 및 14일째 투여 부위 근육과 반대쪽의 비투여 부위 근육에 대해 CMAP 측정을 실시하였다. 그 결과, 투여 부위 근육의 CMAP 값은 BoNT/A 단독 투여군과 BoNT/A + TSP17, BoNT/A + TSP19, BoNT/A + TSP11 투여군 간 유의미한 차이가 관찰되지 않았으나, 반대쪽 근육에서의 CMAP 값은 투여 후 7일째 BoNT/A + TSP19, BoNT/A + TSP11 투여군에서, 그리고 투여 후 14일째에는 BoNT/A + TSP17, BoNT/A + TSP11 투여군에서 BoNT/A 단독 투여군 대비 유의적으로 높게 관찰되었다 (도 3). 이러한 결과로부터 보툴리눔 독소와 독소 안정화 펩티드 (TSP11, TSP17, TSP19) 혼합을 통해 반대쪽 다리로의 확산 감소 효과를 확인하였다.
실시예 6: 마우스에서 보툴리눔 독소 A형과 TSP11, TSP28 혼합 제형에 대한 비임상 효능 시험
실시예 1과 동일하게 암컷 5주령 CD1 (ICR) 마우스를 ㈜오리엔트바이오에서 구입하여 1주간 순화 및 검역 후 6주령 마우스를 실험에 사용하였다. 사료, 음수 및 사육조건은 실시예 1과 동일하다.
시험물질로 코어톡스주(메디톡스)가 사용되었으며 플라시보(위약투여군)은 멸균 생리식염수 (대한약품공업)가 사용되었다. 독소 안정화 펩티드 (TSP11, TSP28)는 보툴리눔 독소 1몰 대비 3×105 비율로 혼합하여 실험에 사용하였다(표 9). 보툴리눔 독소와 독소 안정화 펩티드 혼합액을 120 U/mL 농도로 희석하여 실험에 사용하였다.
시험물질이 투여된 날을 0일로 하였으며, 실험동물의 마취 및 시험물질의 투여는 실시예 1과 동일하게 진행되었다.
평가는 외부적인 전기 자극에 반응하는 근육의 활동전위를 측정하는 복합근육 활동전위 CMAP 시험법이 사용되었다. 구체적인 평가 방법과 통계 분석은 실시예 1과 동일하게 진행되었다.
군 동물수 투여물질 및 용량 투여경로 평가지표
1 6 Placebo 우측 장딴지근육 CMAP
2 6 24 U/kg BoNT/A 우측 장딴지근육 CMAP
3 6 24 U/kg BoNT/A + 46.5 ng/U TSP11 우측 장딴지근육 CMAP
4 6 24 U/kg BoNT/A + 38.3 ng/U TSP28 우측 장딴지근육 CMAP
마우스 우측 장딴지근육에 보툴리눔 독소 A형 (BoNT/A)과 독소 안정화 펩티드가 혼합된 BoNT/A + TSP11, BoNT/A + TSP24 시험물질을 24 U/kg 용량으로 투여한 후 7 및 14일째 투여 부위 근육과 반대쪽의 비투여 부위 근육에 대해 CMAP 측정을 실시하였다. 그 결과, 투여 부위 근육의 CMAP 값은 BoNT/A 단독 투여군과 BoNT/A + TSP11, BoNT/A + TSP28 투여군 간 유의미한 차이가 관찰되지 않았으나, 반대쪽 근육에서의 CMAP 값은 투여 후 7일째 및 14일째 모두 BoNT/A + TSP11, BoNT/A + TSP28 투여군에서 BoNT/A 단독 투여군 대비 유의적으로 높게 관찰되었다(도 4). 이러한 결과로부터 보툴리눔 독소와 독소 안정화 펩티드 (TSP11, TSP28) 혼합을 통해 반대쪽 다리로의 확산 감소 효과를 확인하였다.
실시예 7: 마우스에서 보툴리눔 독소 A형 19S와 TSP11 혼합 제형에 대한 비임상 효능 시험
실시예 1과 동일하게 암컷 5주령 CD1 (ICR) 마우스를 ㈜오리엔트바이오에서 구입하여 1주간 순화 및 검역 후 6주령 마우스를 실험에 사용하였다. 사료, 음수 및 사육조건은 실시예 1과 동일하다.
시험물질로 19S 비알부민 제제(메디톡스; 코어톡스의 7S 독소 대신 19S 독소를 포함한 제제)가 사용되었으며 플라시보(위약투여군)은 멸균 생리식염수 (대한약품공업)가 사용되었다. 독소 안정화 펩티드 (TSP11)는 보툴리눔 독소 1몰 대비 3×105 비율로 펩티드를 혼합하여 실험에 사용하였다(표 10). 보툴리눔 독소와 독소 안정화 펩티드 혼합액을 120 U/mL 농도로 희석하여 실험에 사용하였다.
시험물질이 투여된 날을 0일로 하였으며, 실험동물의 마취 및 시험물질의 투여는 실시예 1과 동일하게 진행되었다. 평가는 외부적인 전기 자극에 반응하는 근육의 활동전위를 측정하는 복합근육 활동전위 CMAP 시험법이 사용되었다. 구체적인 평가 방법과 통계 분석은 실시예 1과 동일하게 진행되었다.
군 동물수 투여물질 및 용량 투여경로 평가지표
1 6 Placebo 우측 장딴지근육 CMAP
2 6 24 U/kg BoNT/A 19S 우측 장딴지근육 CMAP
3 6 24 U/kg BoNT/A 19S + 46.5 ng/U TSP11 우측 장딴지근육 CMAP
마우스 우측 장딴지근육에 보툴리눔 독소 A형 19S (BoNT/A)와 독소 안정화 펩티드가 혼합된 BoNT/A 19S + TSP11 시험물질을 24 U/kg 용량으로 투여한 후 7 및 14일째 투여 부위 근육과 반대쪽의 비투여 부위 근육에 대해 CMAP 측정을 실시하였다. 그 결과, 투여 부위 근육의 CMAP 값은 BoNT/A 19S 단독 투여군과 BoNT/A 19S + TSP11 투여군 간 유의미한 차이가 관찰되지 않았으나, 반대쪽 근육에서의 CMAP 값은 투여 후 14일째 BoNT/A 19S + TSP11 투여군에서 BoNT/A 19S 단독 투여군 대비 유의적으로 높게 관찰되었다(도 5). 이러한 결과로부터 보툴리눔 독소 19S와 독소 안정화 펩티드 (TSP11) 혼합을 통해 반대쪽 다리로의 확산 감소 효과를 확인하였다.
실시예 8: 마우스에서 보툴리눔 독소 A형과 TSP1, TSP2 혼합 제형에 대한 비임상 효능 시험
실시예 1과 동일하게 암컷 5주령 CD1 (ICR) 마우스를 ㈜오리엔트바이오에서 구입하여 1주간 순화 및 검역 후 6주령 마우스를 실험에 사용하였다. 사료, 음수 및 사육조건은 실시예 1과 동일하다.
시험물질로 코어톡스주 (메디톡스)가 사용되었으며 플라시보(위약투여군)은 멸균 생리식염수 (대한약품공업)가 사용되었다. 독소 안정화 펩티드 (TSP1, TSP2)는 보툴리눔 독소 1몰 대비 1×106 비율로 펩티드를 혼합하여 실험에 사용하였다 (표 11). 보툴리눔 독소와 독소 안정화 펩티드 혼합액을 60 U/mL 농도로 희석하여 실험에 사용하였다.
시험물질이 투여된 날을 0일로 하였으며, 실험동물의 마취 및 시험물질의 투여는 실시예 1과 동일하게 진행되었다.
평가는 외부적인 전기 자극에 반응하는 근육의 활동전위를 측정하는 복합근육 활동전위 CMAP 시험법이 사용되었다. 구체적인 평가 방법과 통계 분석은 실시예 1과 동일하게 진행되었다.
군 동물수 투여물질 및 용량 투여경로 평가지표
1 6 Placebo 우측 장딴지근육 CMAP
2 6 12 U/kg BoNT/A 우측 장딴지근육 CMAP
3 6 12 U/kg BoNT/A + 169.7 ng/U TSP1 우측 장딴지근육 CMAP
4 6 12 U/kg BoNT/A + 137 ng/U TSP2 우측 장딴지근육 CMAP
마우스 우측 장딴지근육에 보툴리눔 독소 A형 (BoNT/A)과 독소 안정화 펩타이드가 혼합된 BoNT/A + TSP1, BoNT/A + TSP2 시험물질을 12 U/kg 용량으로 투여한 후 7 및 14일째 투여 부위 근육과 반대쪽의 비투여 부위 근육에 대해 CMAP 측정을 실시하였다. 그 결과, 투여 부위 근육의 CMAP 값은 BoNT/A 단독 투여군과 BoNT/A + TSP1, BoNT/A + TSP2 투여군 간 유의미한 차이가 관찰되지 않았으나, 반대쪽 근육에서의 CMAP 값은 BoNT/A + TSP2 투여군이 BoNT/A 단독 투여군 대비 유의적으로 높게 관찰되었다 (도 6). 반면, BoNT/A + TSP1 투여군의 경우 BoNT/A 단독 투여군 대비 반대쪽 근육에서의 CMAP 값이 유의적인 차이가 관찰되지 않았다. 이러한 결과로부터 보툴리눔 독소와 TSP2 혼합을 통해 반대쪽 다리로의 확산 감소 효과를 확인하였다.
실시예 9: 마우스에서 보툴리눔 독소 A형과 TSP11, TSP23 혼합 제형에 대한 비임상 효능 시험
실시예 1과 동일하게 암컷 5주령 CD1 (ICR) 마우스를 ㈜오리엔트바이오에서 구입하여 1주간 순화 및 검역 후 6주령 마우스를 실험에 사용하였다. 사료, 음수 및 사육조건은 실시예 1과 동일하다.
시험물질로 코어톡스주 (메디톡스)가 사용되었으며 플라시보(위약투여군)은 멸균 생리식염수 (대한약품공업)가 사용되었다. 독소 안정화 펩티드 (TSP11, TSP23)는 보툴리눔 독소 1몰 대비 3×105 비율로 펩티드를 혼합하여 실험에 사용하였다 (표 12). 보툴리눔 독소와 독소 안정화 펩티드 혼합액을 120 U/mL 농도로 희석하여 실험에 사용하였다.
시험물질이 투여된 날을 0일로 하였으며, 실험동물의 마취 및 시험물질의 투여는 실시예 1과 동일하게 진행되었다.
평가는 외부적인 전기 자극에 반응하는 근육의 활동전위를 측정하는 복합근육 활동전위 CMAP 시험법이 사용되었다. 구체적인 평가 방법과 통계 분석은 실시예 1과 동일하게 진행되었다.
군 동물수 투여물질 및 용량 투여경로 평가지표
1 6 Placebo 우측 장딴지근육 CMAP
2 6 24 U/kg BoNT/A 우측 장딴지근육 CMAP
3 6 24 U/kg BoNT/A + 46.5 ng/U TSP11 우측 장딴지근육 CMAP
4 6 24 U/kg BoNT/A + 44.8 ng/U TSP23 우측 장딴지근육 CMAP
마우스 우측 장딴지근육에 보툴리눔 독소 A형 (BoNT/A)과 독소 안정화 펩타이드가 혼합된 BoNT/A + TSP11, BoNT/A + TSP23 시험물질을 24 U/kg 용량으로 투여한 후 7 및 14일째 투여 부위 근육과 반대쪽의 비투여 부위 근육에 대해 CMAP 측정을 실시하였다. 그 결과, 투여 부위 근육의 CMAP 값은 BoNT/A 단독 투여군과 BoNT/A + TSP11 투여군 간 유의미한 차이가 관찰되지 않았으나, BoNT/A 단독 투여군과 BoNT/A + TSP23 투여군 간 유의미한 차이가 확인되었다. 반대쪽 근육에서의 CMAP 값은 BoNT/A + TSP11, BoNT/A + TSP23 투여군이 BoNT/A 단독 투여군 대비 유의적으로 높게 관찰되었다 (도 7).
실시예 10: 마우스에서 보툴리눔 독소 A형과 TSP11, TSP35 혼합 제형에 대한 비임상 효능 시험
실시예 1과 동일하게 암컷 5주령 CD1 (ICR) 마우스를 ㈜오리엔트바이오에서 구입하여 1주간 순화 및 검역 후 6주령 마우스를 실험에 사용하였다. 사료, 음수 및 사육조건은 실시예 1과 동일하다.
시험물질로 코어톡스주 (메디톡스)가 사용되었으며 플라시보(위약투여군)은 멸균 생리식염수 (대한약품공업)가 사용되었다. 독소 안정화 펩티드 (TSP11, TSP35)는 보툴리눔 독소 1몰 대비 3×105 비율로 펩티드를 혼합하여 실험에 사용하였다 (표 13). 보툴리눔 독소와 독소 안정화 펩티드 혼합액을 120 U/mL 농도로 희석하여 실험에 사용하였다.
시험물질이 투여된 날을 0일로 하였으며, 실험동물의 마취 및 시험물질의 투여는 실시예 1과 동일하게 진행되었다.
평가는 외부적인 전기 자극에 반응하는 근육의 활동전위를 측정하는 복합근육 활동전위 CMAP 시험법이 사용되었다. 구체적인 평가 방법과 통계 분석은 실시예 1과 동일하게 진행되었다.
군 동물수 투여물질 및 용량 투여경로 평가지표
1 6 Placebo 우측 장딴지근육 CMAP
2 6 24 U/kg BoNT/A 우측 장딴지근육 CMAP
3 6 24 U/kg BoNT/A + 46.5 ng/U TSP11 우측 장딴지근육 CMAP
4 6 24 U/kg BoNT/A + 38.0 ng/U TSP35 우측 장딴지근육 CMAP
마우스 우측 장딴지근육에 보툴리눔 독소 A형 (BoNT/A)과 독소 안정화 펩타이드가 혼합된 BoNT/A + TSP11, BoNT/A + TSP35 시험물질을 24 U/kg 용량으로 투여한 후 7 및 14일째 투여 부위 근육과 반대쪽의 비투여 부위 근육에 대해 CMAP 측정을 실시하였다. 그 결과, 7일째의 투여 부위 근육의 CMAP 값은 BoNT/A 단독 투여군과 BoNT/A + TSP11 투여군 간과 BoNT/A 단독 투여군과 BoNT/A + TSP35 투여군 간의 유의미한 차이가 관찰되었으나, 14일째에는 BoNT/A 단독군과 BoNT/A + TSP35에서만 유의미한 차이가 관찰되었다. 반면 반대쪽의 비투여 부위 근육의 CMAP 값은 7일차 14일차 모두 BoNT/A 단독군과 BoNT/A + TSP11 군, BoNT/A + TSP35 군에서 모두 유의미한 차이가 관찰되었다 (도 8).
실시예 11: 마우스에서 보툴리눔 독소 A형과 TSP11 혼합 제형에 대한 비임상 효능 시험
실시예 1과 동일하게 암컷 5주령 CD1 (ICR) 마우스를 ㈜오리엔트바이오에서 구입하여 1주간 순화 및 검역 후 6주령 마우스를 실험에 사용하였다. 사료, 음수 및 사육조건은 실시예 1과 동일하다.
시험물질로 코어톡스주(메디톡스)가 사용되었으며 플라시보(위약투여군)은 멸균 생리식염수 (대한약품공업)가 사용되었다. 독소 안정화 펩티드 (TSP11)는 보툴리눔 독소 1몰 대비 3×105 비율로 혼합하여 실험에 사용하였다(표 14). 보툴리눔 독소와 독소 안정화 펩티드 혼합액을 30, 60 U/mL 농도로 희석하여 실험에 사용하였다.
시험물질이 투여된 날을 0일로 하였으며, 실험동물의 마취 및 시험물질의 투여는 실시예 1과 동일하게 진행되었다.
평가는 마우스 근육 마비 정도를 육안으로 평가하는 DAS (digit abduction score)가 수행되었다. 표 15에 표기된 DAS 수치는 마우스에서 투여된 쪽의 발가락 형태에 의한 근육 마비 정도를 나타낸다. DAS 회복기간 (보툴리눔 독소 작용기간)은 시험물질 투여 후 DAS 점수가 0점으로 회복되는 기간을 나타낸다. 주 1회 체중측정이 실시되었다.
군 동물수 투여물질 및 용량 투여경로 평가지표
1 8 Placebo 우측 장딴지근육 DAS
2 8 6 U/kg BoNT/A 우측 장딴지근육 DAS
3 8 12 U/kg BoNT/A + 46.5 ng/U TSP11 우측 장딴지근육 DAS
점수 기준
0 정상, 주입하지 않은 쪽의 발 모양과 다르지 않음
1 발가락 사이의 넓이가 좁아져 있음, 또는 두 개의 발가락이 서로 붙어 있고 나머지는 완전히 펴짐
2 모든 발가락 사이가 상당히 좁아져 있음, 또는 세 개의 발가락이 서로 붙어 있음
3 발이 굽어 있고 네 개의 발가락이 서로 붙어 있음
4 발이 굽어 있고 모든 발가락이 서로 붙어 있음
각 측정시점에서 0주차 체중 기준 평균 체중 변화량 (%)
0주 1주 2주 3주 4주 5주 6주 7주
Placebo 100 105.4 109.5 116.9 122 124.8 131.6 132.1
6 U/kg BoNT/A 100 99.8 102.7 111.1 113.5 124.6 125.7 126.3
12 U/kg BoNT/A + TSP11 100 99.9 103.4 114.3 114.7 120.1 126.3 126.7
마우스 우측 장딴지근육에 6 U/kg 보툴리눔 독소 A형 (BoNT/A)과 12 U/kg 독소 안정화 펩티드가 혼합된 BoNT/A + TSP11 시험물질을 투여한 후 7주간 DAS 및 체중 측정을 실시하였다. 시험물질 투여시점(0주차) 체중을 기준으로 각 주차별 체중 변화량을 측정한 결과 6 U/kg BoNT/A 투여군과 12 U/kg BoNT/A + TSP11 투여군 사이 유의미한 차이는 관찰되지 않았다 (표 16). 그리고 6 U/kg BoNT/A 투여군에서는 평균 23.8일째 DAS 회복이 관찰되었으며 12 U/kg BoNT/A + TSP11 투여군에서는 평균 35.6일째 DAS 회복이 관찰되어 BoNT/A 단독 투여군 대비 약 1.5배 증가된 작용기간이 관찰되었다 (도 9). 이러한 결과로부터 보툴리눔 독소와 독소 안정화 펩티드 (TSP11) 혼합 제형에서 보툴리눔 독소의 투여량을 증가한 경우 안전성에는 변화 없이 보툴리눔 독소의 작용 기간을 증가시킬 수 있음을 확인하였다.
실시예 12: 마우스에서 보툴리눔 독소 A형과 TSP47, TSP48 혼합 제형에 대한 비임상 효능 시험
실시예 1과 동일하게 암컷 5주령 CD1 (ICR) 마우스를 ㈜오리엔트바이오에서 구입하여 1주간 순화 및 검역 후 6주령 마우스를 실험에 사용하였다. 사료, 음수, 및 사육조건은 실시예 1과 동일하였다. 본 연구는 ㈜메디톡스 동물실험윤리위원회의 검토 및 승인 (A-2022-007) 후 수행되었다.
시험물질은 코어톡스주 (메디톡스)가 사용되었으며 플라시보 (위약투여군)은 멸균 생리식염수 (대한약품공업)가 사용되었다. 독소 안정화 펩티드(TSP47, TSP48)는 보툴리눔 독소 1몰 대비 3x105 비율로 펩티드를 혼합하여 실험에 사용하였다(표 17). 보툴리눔 독소와 독소 안정화 펩티드 혼합액을 120 U/mL 농도로 희석하여 실험에 사용하였다.
시험물질이 투여된 날을 0일로 하였으며, 실험동물의 마취 및 시험물질의 투여는 실시예 1과 동일하게 진행되었다.
평가는 외부적인 전기 자극에 반응하는 근육의 활동전위를 측정하는 복합근육 활동전위 CMAP 시험법이 사용되었다. 구체적인 평가 방법과 통계 분석은 실시예 1과 동일하게 진행되었다.
군 동물수 투여물질 및 용량 투여경로 평가지표
1 6 Placebo 우측 장딴지근육 CMAP
2 6 24 U/kg BoNT/A 우측 장딴지근육 CMAP
3 6 24 U/kg BoNT/A + 46.49 ng/U TSP47 우측 장딴지근육 CMAP
4 6 24 U/kg BoNT/A + 38.33 ng/U TSP48 우측 장딴지근육 CMAP
마우스 우측 장딴지근육에 보툴리눔 독소 A형 (BoNT/A)과 독소 안정화 펩티드가 혼합된 BoNT/A + TSP47 시험물질 및 BoNT/A + TSP48 시험물질을 각각 24 U/kg 용량으로 투여한 후 7일 및 14일 째 투여 부위 근육과 반대쪽의 비투여 부위 근육에 대해 CMAP 측정을 실시하였다. 그 결과, 투여 부위 근육의 CMAP 값은 투여후 7일째 BoNT/A + TSP47 투여군에서 BoNT/A 단독 투여군 대비 유의적인 CMAP 증가가 관찰되었으나, 투여 후 14일째는 BoNT/A 단독 투여군 대비 유의미한 차이가 관찰되지 않았다. 반면, 반대쪽 근육에서의 BoNT/A + TSP47 투여군 및 BoNT/A + TSP48 투여군의 CMAP 값은 모두 투여 후 7일째 및 14일째에서 BoNT/A 단독 투여군 대비 유의적으로 높게 관찰되었다. 이러한 결과로부터 보툴리눔 독소와 TSP47 또는 TSP 48 혼합을 통해 반대쪽 다리로의 확산 감소 효과를 확인하였다(도 10).
실시예 13: 마우스에서 보툴리눔 독소 A형과 TSP56, TSP61 혼합 제형에 대한 비임상 효능 시험
실시예 1과 동일하게 암컷 5주령 CD1 (ICR) 마우스를 ㈜오리엔트바이오에서 구입하여 1주간 순화 및 검역 후 6주령 마우스를 실험에 사용하였다. 사료, 음수, 및 사육조건은 실시예 1과 동일하였다. 본 연구는 ㈜메디톡스 동물실험윤리위원회의 검토 및 승인 (A-2022-007) 후 수행되었다.
시험물질은 코어톡스주 (메디톡스)가 사용되었으며 플라시보 (위약투여군)은 멸균 생리식염수 (대한약품공업)가 사용되었다. 독소 안정화 펩티드(TSP56, TSP61)는 보툴리눔 독소 1몰 대비 3x105 비율로 펩티드를 혼합하여 실험에 사용하였다(표 18). 보툴리눔 독소와 독소 안정화 펩티드 혼합액을 120 U/mL 농도로 희석하여 실험에 사용하였다.
시험물질이 투여된 날을 0일로 하였으며, 실험동물의 마취 및 시험물질의 투여는 실시예 1과 동일하게 진행되었다.
평가는 외부적인 전기 자극에 반응하는 근육의 활동전위를 측정하는 복합근육 활동전위 CMAP 시험법이 사용되었다. 구체적인 평가 방법과 통계 분석은 실시예 1과 동일하게 진행되었다.
군 동물수 투여물질 및 용량 투여경로 평가지표
1 6 24 U/kg BoNT/A 우측 장딴지근육 CMAP
2 6 24 U/kg BoNT/A + 45.85 ng/U TSP56 우측 장딴지근육 CMAP
3 6 24 U/kg BoNT/A + 46.18 ng/U TSP61 우측 장딴지근육 CMAP
마우스 우측 장딴지근육에 보툴리눔 독소 A형 (BoNT/A)과 독소 안정화 펩티드가 혼합된 BoNT/A + TSP56 시험물질 및 BoNT/A + TSP61 시험물질을 각각 24 U/kg 용량으로 투여한 후 7일 및 14일 째 투여 부위 근육과 반대쪽의 비투여 부위 근육에 대해 CMAP 측정을 실시하였다. 그 결과, 투여 부위 근육의 CMAP 값은 투여후 7일째 및 14일째 BoNT/A + TSP56 투여군에서 BoNT/A 단독 투여군 대비 유의적인 CMAP 증가가 관찰되었다. 다만, 반대쪽 근육에서의 BoNT/A + TSP56 투여군의 CMAP 값은 투여 후 7일째 및 14일째에서 BoNT/A 단독 투여군 대비 유의적으로 높게 관찰되었다. 보툴리눔 독소와 TSP56을 혼합하는 경우 보툴리눔 독소 단독 투여 대비 투여 부위 근육에서의 CMAP이 약간 증가하지만 반대쪽 다리에서의 CMAP 값은 더 많이 증가한 결과를 보이는 바, TSP 56의 혼합을 통한 확산 감소 효과를 확인하였다. BoNT/A + TSP61 투여군의 경우 투여 부위 근육의 CMAP 값은 BoNT/A 단독 투여군과 유의미한 차이가 관찰되지 않았으나, 반대쪽 근육에서의 CMAP 값은 BoNT/A 단독 투여군 대비 유의적으로 높게 관찰된 바, TSP 61의 혼합을 통한 확산 감소 효과를 확인하였다.
서열번호 1 내지 10은 신경세포의 세포막과 상호작용하면서 보툴리눔 독소와 상호작용하는 모이어티에 대한 예시적인 서열이다. 서열번호 11 내지 13은 신경세포의 세포막과 상호작용하는 모이어티에 대한 예시적인 서열이다. 서열번호 14 내지 21은 보툴리눔 독소 안정화 조성물에 포함된 폴리펩티드의 예시적인 서열이다. 서열번호 22는 일 실시예에 따른 독소 안정화 조성물에 포함된 폴리펩티드의 대조물질로 사용한 물질이다. 서열번호 23은 재조합 보툴리눔 독소 타입 A 경쇄의 서열이다. 서열번호 24는 보툴리눔 독소의 경쇄가 BoNT/A1 경쇄와 BoNT/A4 경쇄의 조합으로 이루어진 재조합 보툴리눔 독소 타입 A의 서열이다.

Claims (20)

  1. 생체 내에서 보툴리눔 독소의 확산(diffusion)을 저해하는 아래 화학식 1의 폴리펩티드를 포함하는, 보툴리눔 독소 안정화 조성물:
    [화학식 1]
    (C)n-V
    상기 식에서, C는 신경세포의 세포막과 상호작용하는 모이어티를 나타내고, V는 신경세포의 세포막과 상호작용하면서 보툴리눔 독소와 상호작용하는 모이어티를 나타내며, n은 0 또는 1의 정수이다.
  2. 제1항에 있어서, V는 VAMP(vesicle　associated membrane protein), BDNF(brain-derived neurotrophic factor), 이들의 단편 또는 이들의 변이체인 것인, 보툴리눔 독소 안정화 조성물.
  3. 제1항 또는 제2항에 있어서, V는 VAMP의 VpN, 이들의 단편 또는 이들의 변이체인 것인, 보툴리눔 독소 안정화 조성물.
  4. 제2항 또는 제3항에 있어서, VAMP는 VAMP1, VAMP2, VAMP3, 이들의 단편, 또는 이들의 변이체인 것인, 보툴리눔 독소 안정화 조성물.
  5. 제1항 내지 제4항 중 어느 한 항에 있어서, V는 서열번호 1의 아미노산 서열을 포함하는 것인, 보툴리눔 독소 안정화 조성물.
  6. 제5항에 있어서, V는 서열번호 1, 2, 3, 4, 5, 6, 7 및 8의 아미노산 서열; 및 서열번호 1, 2, 3, 4, 5, 6, 7, 및 8의 아미노산 서열에서 하나의 아미노산이 치환된 것인 아미노산 서열 중 선택되는 것인, 보툴리눔 독소 안정화 조성물.
  7. 제1항 내지 제6항 중 어느 한 항에 있어서, C는 세포 투과 펩티드 또는 양이온성 펩티드인 것인, 보툴리눔 독소 안정화 조성물.
  8. 제7항에 있어서, C는 아르기닌-풍부 펩티드인 것인 보툴리눔 독소 안정화 조성물.
  9. 제7항 또는 제8항에 있어서, C는 방향족 아미노산을 추가로 포함하는 것인, 보툴리눔 독소 안정화 조성물.
  10. 제9항에 있어서, 방향족 아미노산은 트립토판인 것인, 보툴리눔 독소 안정화 조성물.
  11. 제7항 내지 제10항 중 어느 한 항에 있어서, C는 6~9개의 아르기닌 및 2~3개의 트립토판을 포함하는 것인, 보툴리눔 독소 안정화 조성물.
  12. 제7항 또는 제11항 중 어느 한 항에 있어서, C는 아르기닌 및 트립토판이 일면으로 편향되어 있는 3차원 구조를 갖는 것인, 보툴리눔 독소 안정화 조성물.
  13. 제7항 내지 제12항에 있어서, C는 서열번호 11, 서열번호 12 또는 서열번호 13의 아미노산 서열로 이루어지는 것인, 보툴리눔 독소 안정화 조성물.
  14. 제1항 내지 제13항 중 어느 한 항에 있어서, 폴리펩티드는 서열번호 8, 서열번호 14, 서열번호 15, 서열번호 16, 서열번호 17, 서열번호 18, 서열번호 19, 서열번호 20 또는 서열번호 21의 아미노산 서열로 이루어지는 것인, 보툴리눔 독소 안정화 조성물.
  15. 보툴리눔 독소, 및 제1항 내지 제14항 중 어느 한 항에 따른 보툴리눔 독소 안정화 조성물을 포함하는, 보툴리눔 독소 제제.
  16. 제15항에 있어서, 보툴리눔 독소는 타입 A, B, C, D, E, F 또는 G인 것인, 보툴리눔 독소 제제.
  17. 제15항 또는 제16항에 있어서, 보툴리눔 독소는 천연 또는 재조합 독소인 것인, 보툴리눔 독소 제제.
  18. 제15항 내지 제17항 중 어느 한 항에 있어서, 보툴리눔 독소는 7S 또는 19S 형태의 것인, 보툴리눔 독소 제제.
  19. 제16항 내지 제19항 중 어느 한 항에 있어서, 보툴리눔 독소 안정화 조성물을 포함하지 않는 경우에 비해 증가된 양의 보툴리눔 독소를 포함하는, 보툴리눔 독소 제제.
  20. 서열번호 15, 서열번호 16, 서열번호 17 서열번호 18, 서열번호 19 또는 서열번호 20의 아미노산 서열로 이루어지는 폴리펩티드.
PCT/KR2023/008066 2022-06-10 2023-06-12 보툴리눔 독소 안정화 조성물, 이를 포함하는 보툴리눔 독소 제제 및 이에 사용하기 위한 폴리펩티드 WO2023239229A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20220070554 2022-06-10
KR10-2022-0070554 2022-06-10

Publications (1)

Publication Number Publication Date
WO2023239229A1 true WO2023239229A1 (ko) 2023-12-14

Family

ID=89118744

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/008066 WO2023239229A1 (ko) 2022-06-10 2023-06-12 보툴리눔 독소 안정화 조성물, 이를 포함하는 보툴리눔 독소 제제 및 이에 사용하기 위한 폴리펩티드

Country Status (2)

Country Link
KR (1) KR20230171400A (ko)
WO (1) WO2023239229A1 (ko)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP5178009B2 (ja) * 2003-12-19 2013-04-10 ウィスコンシン アルムニ リサーチ ファンデイション ボツリヌス神経毒素検出のための方法および複合体
KR20180077202A (ko) * 2015-10-29 2018-07-06 레반스 테라퓨틱스, 아이엔씨. 주사용 보툴리눔 독소 제제 및 긴 지속기간의 치료적 또는 미용적 효과를 갖는 이를 이용한 방법
KR20190026834A (ko) * 2016-07-08 2019-03-13 칠드런'즈 메디컬 센터 코포레이션 신규 보툴리눔 신경독소 및 그의 유도체
KR20200131348A (ko) * 2008-12-31 2020-11-23 레반스 테라퓨틱스, 아이엔씨. 주사용 보툴리눔 독소 제제
KR20210097530A (ko) * 2020-01-30 2021-08-09 (주)메디톡스 Snare 복합체의 형성을 저해하는 펩티드, 및 그의 용도

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP5178009B2 (ja) * 2003-12-19 2013-04-10 ウィスコンシン アルムニ リサーチ ファンデイション ボツリヌス神経毒素検出のための方法および複合体
KR20200131348A (ko) * 2008-12-31 2020-11-23 레반스 테라퓨틱스, 아이엔씨. 주사용 보툴리눔 독소 제제
KR20180077202A (ko) * 2015-10-29 2018-07-06 레반스 테라퓨틱스, 아이엔씨. 주사용 보툴리눔 독소 제제 및 긴 지속기간의 치료적 또는 미용적 효과를 갖는 이를 이용한 방법
KR20190026834A (ko) * 2016-07-08 2019-03-13 칠드런'즈 메디컬 센터 코포레이션 신규 보툴리눔 신경독소 및 그의 유도체
KR20210097530A (ko) * 2020-01-30 2021-08-09 (주)메디톡스 Snare 복합체의 형성을 저해하는 펩티드, 및 그의 용도

Also Published As

Publication number Publication date
KR20230171400A (ko) 2023-12-20

Similar Documents

Publication Publication Date Title
WO2016105086A1 (ko) 안질환 치료 펩티드 및 이를 포함하는 안질환 치료용 조성물
WO2020060128A1 (ko) 세포 침투 효과가 우수한 보툴리늄 유래 펩타이드를 포함하는 화장료 조성물
US11306121B2 (en) Composition for muscle relaxation
WO2018155997A1 (ko) 에리스로포이에틴 유래 펩티드의 세포손상방지에 효과를 통한 활용
WO2021251789A1 (ko) 펜타펩타이드를 유효성분으로 포함하는 조성물
KR20200040719A (ko) 효능 지속시간이 연장된 보툴리눔 독소 조성물
WO2018066914A1 (ko) 지방산이 결합된 트리펩타이드 및 이를 포함하는 주름 개선용 화장료 조성물
WO2023239229A1 (ko) 보툴리눔 독소 안정화 조성물, 이를 포함하는 보툴리눔 독소 제제 및 이에 사용하기 위한 폴리펩티드
WO2023055007A1 (ko) 항노화 활성을 갖는 펩타이드 및 이의 용도
WO2021251790A1 (ko) 항비만 활성을 가지는 디옥시콜산-펩타이드 결합체 및 이의 용도
WO2020138674A1 (ko) 근육 이완용 조성물
US20170189500A1 (en) Use of recombinant clostridial neurotoxins for the treatment of patients having certain muscle-related disorders
WO2021221239A1 (ko) 탄닌산을 포함하는 보툴리눔 독소 약제학적 조성물
WO2020222315A1 (ko) 피부 또는 세포 투과능이 우수한 피부 주름 개선 또는 치료용 조성물
WO2023085849A1 (ko) 보툴리눔 독소 조성물
WO2021251791A1 (ko) 보툴리눔 톡신 유사 활성을 갖는 펩타이드 및 이의 용도
WO2022131860A1 (ko) 보툴리눔 독소의 액상 제제를 장기 보관하기 위한 약제학적 조성물
WO2023211198A1 (ko) 신규 염증해소 펩타이드 및 그의 용도
WO2023055011A1 (ko) 항노화 활성을 갖는 펩타이드 및 이의 용도
WO2023075060A1 (ko) 보툴리눔 유래 펩타이드를 포함하는 통증개선용 조성물
WO2019164134A1 (ko) 보툴리눔 독소, 안정화제, 및 국소마취제를 포함하는 액상 제형 및 이의 제조방법
WO2024049286A1 (ko) 내성 발현이 감소된 보툴리눔 독소 제제 및 이와 관련된 방법
US20170112907A1 (en) Novel uses of recombinant clostridial neurotoxins with decreased duration of effect
WO2023234703A1 (ko) 신규의 d-아미노산 유도체 및 이를 포함하는 약학 조성물
WO2023055006A1 (ko) 항노화 활성을 갖는 펩타이드 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23820164

Country of ref document: EP

Kind code of ref document: A1