WO2023167947A2 - Atp-dependent agonists of immune cells function as anticancer agents - Google Patents

Atp-dependent agonists of immune cells function as anticancer agents Download PDF

Info

Publication number
WO2023167947A2
WO2023167947A2 PCT/US2023/014302 US2023014302W WO2023167947A2 WO 2023167947 A2 WO2023167947 A2 WO 2023167947A2 US 2023014302 W US2023014302 W US 2023014302W WO 2023167947 A2 WO2023167947 A2 WO 2023167947A2
Authority
WO
WIPO (PCT)
Prior art keywords
sequence
nbd
polypeptide
polypeptide construct
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2023/014302
Other languages
English (en)
French (fr)
Other versions
WO2023167947A3 (en
Inventor
Rodolfo J. CHAPARRO
Ronald D. SEIDEL, III
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Crosslink Therapeutics Inc
Original Assignee
Crosslink Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA3245316A priority Critical patent/CA3245316A1/en
Priority to AU2023229182A priority patent/AU2023229182A1/en
Priority to IL315362A priority patent/IL315362A/en
Priority to EP23763905.9A priority patent/EP4486391A4/en
Priority to JP2024552150A priority patent/JP2025508958A/ja
Priority to CN202380037296.1A priority patent/CN119110731A/zh
Priority to KR1020247032672A priority patent/KR20240169151A/ko
Application filed by Crosslink Therapeutics Inc filed Critical Crosslink Therapeutics Inc
Publication of WO2023167947A2 publication Critical patent/WO2023167947A2/en
Publication of WO2023167947A3 publication Critical patent/WO2023167947A3/en
Priority to US18/593,028 priority patent/US12180297B2/en
Anticipated expiration legal-status Critical
Priority to US18/989,938 priority patent/US20250197521A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/525Tumour necrosis factor [TNF]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/525Tumour necrosis factor [TNF]
    • C07K14/5255Lymphotoxin [LT]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5418IL-7
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5428IL-10
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5434IL-12
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5443IL-15
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/55IL-2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/555Interferons [IFN]
    • C07K14/57IFN-gamma
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70532B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70575NGF/TNF-superfamily, e.g. CD70, CD95L, CD153, CD154
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2806Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2812Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD4
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2815Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD8
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2875Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3069Reproductive system, e.g. ovaria, uterus, testes, prostate
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2318/00Antibody mimetics or scaffolds
    • C07K2318/10Immunoglobulin or domain(s) thereof as scaffolds for inserted non-Ig peptide sequences, e.g. for vaccination purposes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/80Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor

Definitions

  • Newer agents that target TAAs attempt to impart a level of conditionality on the immune agonist wherein the agonist only accumulates to biologically effective concentrations at sites with sufficient density of the targeted TAA.
  • TAA-targeted immune agonists suffer from serious limitations including, but not limited to: a small number of unique and validated TAAs expressed on the cell surface which are accessible by immunotherapeutics; low TAA density resulting in low efficacy; escape of cancers due to loss of TAA expression; TAAs that are not truly tumor specific, resulting in on-target/off-tumor toxicity; and the fact that each TAA requires a different drug of low therapeutic reach relative to systemic therapies.
  • first generation bispecific T cell engagers such as blinatumomab comprise a single anti-TAA domain paired with a single anti-CD3 domain for a stoichiometry of 1 :1.
  • an anti-TAA:anti-CD3 stoichiometry of 2:2 was used instead. This format was associated with more potent T cell mediated tumor cell killing in vitro, and importantly lowered the number of cytotoxic effector T cells required for tumor cell killing.
  • TME tumor microenvironment
  • ATP extracellular adenosine triphosphate
  • hypooxia limited oxygen levels
  • a leaky vasculature and the presence of tumor proteases (e.g. MMPs).
  • extracellular ATP is an excellent candidate for exploitation in the generation of novel classes of immunotherapeutics as it is a product of an altered and essential tumor metabolic program that is common to most if not all tumors. Extracellular ATP is also observed at very high levels in the TME (50-1000 piM) relative to normal tissues (less than ⁇ 0.1 piM).
  • the present disclosure includes and provides molecular constructs comprising nucleotide binding domains (NBDs) that enable the use of tumor ATP as a trigger for the conditional (ATP-dependent) assembly of potent cancer therapeutic agents at the tumor.
  • NBD-containing constructs form dimers or higher order complexes in the presence of ATP levels found in TMEs.
  • the NBD-containing constructs find use as, among other things, therapeutic agents for treating various cancers.
  • Therapies employing the constructs are designed to take advantage of the fact that ATP driven complexation (e.g., dimerization) can result in agents that recruit immune cells into the TME and/or stimulate immune cells in the TME.
  • Stimulation may take place by, for example, multimerizing the immunomodulatory protein domains presented to immune cells as a result of ATP driven complexation of the constructs, producing more effective stimulation of the immune cells than single immunomodulatory protein sequences that cannot cause, for example, cross linking of their receptors.
  • Dimers or other higher order complexes of NBD-containing constructs may also act through other mechanisms including targeted ADCC (antibody-dependent cell-mediated cytotoxicity) and/or CDC (complement-dependent cytotoxicity) of tumor cells. Because the elevation in ATP levels relative to surrounding tissue is virtually universal in TMEs, the constructs provide a mechanism for treating diverse tumor types.
  • the constructs which can assemble immunomodulatory amino acid sequences into multivalent states in the presence of ATP levels found in TME, may be used to modulate immune cell action in TMEs and bring about selective immune-mediated anti-tumor actions.
  • the NBD-containing constructs also offer several other advantages including trans- and cis- targeting. Cis-targeting by the NBD-containing constructs can effect stimulation of tumor-infiltrating leukocytes (e.g., by providing immune stimulator agonists such as IL-2 or CD28) resulting in amplification of the anti-tumor immune response. When trans-targeted against TAAs, the constructs result in immune mediated cytolysis of tumor cells bearing the TAAs, which adds an additional tumor-specific action beyond that resulting from localized elevations in ATP levels.
  • immune stimulator agonists such as IL-2 or CD28
  • the constructs permit the use of diverse immunomodulator domains derived from, for example, CD40L, CD28, IFN-g, IL-12, etc., each of which acts through receptors that require cross linking.
  • CD40L CD40L
  • CD28 CD28
  • IFN-g IFN-g
  • IL-12 etc.
  • Other advantages of the NBD-containing constructs described herein include their relatively small size, which permits penetration into tumor tissue, and their reduced diffusion from the TME, due to their increased size where they assemble into dimers or higher order complexes.
  • the present disclosure also provides for methods of their preparation and methods of their use.
  • FIG. 1 provides at A a diagram of a construct of the present disclosure comprising a NBD with an ATP binding site, a scaffold domain (scaffold aa sequence), and an immune cell activating domain (AD) joined by linker sequences.
  • the right side of the diagram in A also shows dimerization of the construct in the presence of a sufficient ATP concentration for the binding site to be substantially occupied (e.g., a concentration in the range of the Kd of ATP binding to the NBD or a higher concentration).
  • a sufficient ATP concentration for the binding site e.g., a concentration in the range of the Kd of ATP binding to the NBD or a higher concentration.
  • a first construct comprising a tumorspecific binder (exemplified as a bivalent cell lineage or tumor-specific antibody but it may be a monovalent binder such as a scFv or nanobody) and a first NBD of a heterodimerizing NBD pair joined by a linker; and (ii) a second construct comprising a second NBD of the heterodimerizing NBD pair joined by a linker.
  • the right side of the diagram at B shows the formation of a heterodimer of the first and second constructs due to dimerization of the NBD domains in the presence of ATP.
  • FIG. 2 provides a series of constructs (structures A to E) comprising a NBD and an AD with the constructs of structures C, D, and E also comprising scaffold sequences that may be non-dimerizing or may be interspecific.
  • the elements of each construct are joined by independently selected optional linkers.
  • the figure also shows the formation of dimers of the constructs in the presence of ATP.
  • FIG. 3 provides a series of construct pairs (structures A to O).
  • the first construct in each pair comprises one or more NBDs and a tumor-specific binder that binds to a TAA and the second construct of the pair comprises a NBD and an AD and/or a monovalent immune cell engager.
  • the first construct in each pair comprises one or more NBDs and an immune cell engager and the second construct of the pair comprises a NBD and an AD.
  • Each of construct pairs E-l, L, and M has a scaffold in at least one of the constructs.
  • the first construct in each pair comprises a tumor-specific binder and two NBDs
  • the second construct of the pair comprises a NBD and an AD
  • the constructs in O also comprise a scaffold sequence.
  • FIG 3 also shows the formation of dimers of the constructs in the presence of ATP. The elements of each construct are joined by independently selected optional linkers.
  • FIG. 4A provides a series of constructs (see A, C, and D), pairs of constructs (B, E, F, G, and I), or a triplet of constructs (at H) that comprise two or more NBDs and can polymerize to form a complex in the presence of ATP (e.g., in a TME).
  • one or more of the constructs comprises a scaffold sequence and each construct may be joined by independently selected optional linkers.
  • the figure also shows the formation of complexes in the presence of ATP comprising the constructs present in each case.
  • FIG. 4B shows examples of a NBD bound to a tumor-specific binder (e.g., antibody such as anti- mesothelian) that form homodimers in the presence of elevated ATP, such as is found in the tumor environment.
  • a tumor-specific binder e.g., antibody such as anti- mesothelian
  • the construct comprises a bivalent antibody that may be monospecific or bispecific and accordingly gives rise to tetramer or tetramer-like complex in the presence of ATP.
  • the molecules need not comprise a Fc domain and may have two antigen binding domains (e.g., VHHs or scFVs tumor-specific antigen binders) and still remain bivalent.
  • the homodimerizing constructs comprise a NBD monovalent single chain antibody.
  • the tumorspecific binders in (A) to (D) may be, for example, anti-H ER2, anti-mesothelin, anti-EpCAM, anti-CLA-4, or anti- PSMA.
  • scaffold sequences When scaffold sequences are present they may be an immunoglobulin Fc peptide (such as an IgG 1 Fc) that can bind any one or more of FcyRI, FcyRII, FcyRIII receptors and/or C1q proteins.
  • ADCC antibody-dependent cellular cytotoxicity
  • ADCP antibody-dependent cellular phagocytosis
  • CDC complement-dependent cytotoxicity
  • FIG. 5 shows a dimer of the transporter associated with antigen processing 1 (TAP1) NBD including two ATP molecules.
  • FIG. 6 shows an alignment of NBD domains of: wild type TAP1 (SEQ ID NO:9), the ABCA1 gene product from UniProtKB - 095477 (SEQ ID NO: 1 ), the ABCB1 gene product from UniProtKB - P08183 (SEQ ID NO:2), the ABCC1 gene product from UniProtKB - P33527 (SEQ ID NO:3), the ABCD1 gene product from UniProtKB/Swiss- Prot: P33897 (SEQ ID NO:4), the ABCE1 gene product from UniProtKB/Swiss-Prot: P61221 (SEQ ID NO:5), the ABCF1 gene product from UniProtKB - Q8NE71 (SEQ ID NO:6), and the ABCG2 gene product from UniProtKB/Swiss-Prot: P45844 (SEQ ID NO:7).
  • a portion of the Walker A region sequence from aas 46 to 55 and the LSGGQ sequence from aas 152 to 156 of the TAP1 aa sequence are underlined and bolded.
  • the hydrolytic acidic amino acid of the TAP1 NBD shown in FIG. 3 i.e. , the Asp at position 177) and the Asp (D) or Glu (E) residues are shown.
  • FIG. 7 shows the sequence of human TAP2 from UniProtKB - Q03519 (SEQ ID NON 1).
  • FIG. 8 shows a SDS-polyacrylamide gel electrophoresis (PAGE) gel of a TAP1 variant bearing N676G,
  • FIG. 9 shows size exclusion chromatograms of a TAP1 NBD variant polypeptide bearing N676G, S677N, Q680R, E682Q, and/or Q683R substitutions and substitutions of cysteines present in the sequence with serines (I) in the presence of 1 mM adenosine diphosphate( ADP) resulting in a monomeric form of the polypeptide (apparent Mw 37kDa), and (ii) in the presence of 1 mM adenosine triphosphate (ATP) resulting in a dimeric form of the polypeptide (apparent Mw 57 kDa).
  • serines I
  • 1 mM adenosine diphosphate( ADP) resulting in a monomeric form of the polypeptide
  • ATP 1 mM adenosine triphosphate
  • FIG. 10 provides the results of a mass photometry assessment of the same TAP1 NBD variant subject to chromatograph in FIG. 9. The results, obtained in the presence of 1 mM ATP, indicate dimerization of the TAP1 NBD variant.
  • FIG. 11 provides the results of dynamic light scattering (DLS) size determination for the TAP1 in the presence of (A) ADP or (B) ATP.
  • FIG. 12 provides a coomassie blue stained gel of purified TAP1 NBD of SEQ ID NO:87 modified to homodimerize and chromatographic analysis of the purified protein in the presence of ADP and ATP.
  • FIG. 13 show SDS-PAGE gels from: (A) the induced expression of the TAP1 NBD polypeptides provided by SEQ ID NO:87 and SEQ ID NO:88; and (B) the purification of the polypeptide of SEQ ID NO:88.
  • amino acid as used herein amino acid (“aa” singular or “aas” plural) means the naturally occurring proteogenic amino acids incorporated into polypeptides and proteins in mammalian cell translation. Unless stated otherwise these are: L (Leu, leucine), A (Ala, alanine), G (Gly, glycine), S (Ser, serine), V (Vai, valine), F (Phe, phenylalanine), Y (Tyr, tyrosine), H (His, histidine), R (Arg, arginine), N (Asn, asparagine), E (Glu, glutamic acid), D (Asp, asparagine), C (Cys, cysteine), Q (Gin, glutamine), I (lie, isoleucine), M (Met, methionine), P (Pro, proline), T (Thr, threonine), K (Lys, lysine), and W (Trp, tryptophan).
  • L Le
  • substitutions of aa at specific locations in a sequence are indicated by the original aa given in single or triple letter code, the numerical position of that aa, and the aa which is substituted into the sequence in single or triple letter code.
  • an alanine (A) at position 12 of a sequence substituted with a proline (P) would be indicated as A12P using single letter code, or Ala12Pro using triple letter code.
  • A12P substitution in the same sequence as a V23A and a Q41 G substitution may be indicated by the sequence A12P/V23A/Q41G.
  • polypeptide and "protein” are used interchangeably herein, and refer to a polymeric form of aas, which unless stated otherwise are the naturally occurring proteinogenic L-aas that are incorporated biosynthetically into proteins during translation in a mammalian cell.
  • the percent sequence identity refers to the percentage of amino acids or nucleotides that are the same between two amino acid or nucleic acid sequences that have been aligned. Unless stated otherwise, the percentage sequence identity is determined using BLAST+ release 2.9.0 employing a blastp alignment for polypeptides or a blastn alignment for nucleic acids with default parameters.
  • an Ig Fc that "substantially does not induce cell lysis via ADCC or CDC” means an Ig Fc that induces no cell lysis at all or that largely but not wholly induces no cell lysis via ADCC or CDC.
  • the microenvironment within tumors differs in a number of ways from nonmalignant tissues, including differences in any one or more of its pH, ATP content, limited oxygen levels (hypoxia), and tumor protease (e.g., MMPs) levels.
  • Extracellular ATP levels in normal (non-tumor) tissues are typically in the range of 0.01-0.1 micromolar (pM) in normal tissues, whereas the extracellular level of ATP in solid tumors is generally in the range of 50-200 pM
  • the present disclosure describes and provides for the use of the ATP levels found in tumor microenvironments to bring about an immune response to cells in the tumor.
  • some constructs described herein may comprise an immune cell activating domain (“AD”) (i.e., an activating domain of an immunomodulatory molecule that engages and stimulates an immune cell) and at least one NBD that forms a substantial amount of dimers or other higher order complexes in the presence of ATP at the levels found in the tumor microenvironment (TME). Dimerization or higher order complex formation of the NBD results in a complex presenting two or more immune cell ADs.
  • ADs immune cell activating domain
  • NBD tumor microenvironment
  • constructs described herein may comprise tumor-specific binding domains that bind to TAAs or immune cell engaging domains and at least one NBD that forms a substantial amount of dimers or other higher order complexes in the presence of ATP at the levels found in the tumor microenvironment.
  • Such constructs may optionally comprise an AD. Dimerization or higher order complex formation of the NBD results in dimers or higher order complexes that can recruit and/or stimulate immune cells in the TME. Because dimerization or other higher order complexes of such constructs do not form higher order complexes outside of the TME, they permit intratumoral stimulation of an immune response while limiting immune stimulation outside of the tumor.
  • the constructs described herein do, however, provide immune stimulation localized to the TME where there is sufficient ATP to drive complex formation, and may thus be considered a form of ATP-dependent agonists of immune cell function whose action is limited to that environment.
  • the complexed forms of the constructs e.g., dimers, trimers, etc.
  • their diffusion from the TME is reduced further, restricting their action to the TME.
  • ATP-dependent agonists of immune cell function comprising NBDs and AD
  • the NBD-containing molecular constructs described herein comprise a NBD and an AD that engages and stimulates an immune cell (e.g., CD8+ T cell, NK cell, etc.).
  • the NBD comprises one or more ATP binding sites that when occupied by ATP result in two or more molecules of the construct forming a duplex or higher order complex (triplex, etc.) due to interactions between the construct's NBDs.
  • Such molecular constructs optionally comprise one or more independently selected scaffold aa sequences and/or one or more independently selected linker sequences. See, e.g., FIG. 1 , structure A, and FIG. 2, structures A-D.
  • interspecific scaffold sequences that form heterodimers may be incorporated into the constructs such that more than one type of AD may be present in the molecule as exemplified in FIG. 2 by structure E.
  • the use of ADs that, when brought together e.g., as a homodimer or heterodimer), can stimulate the targeted population of immune cells such as NK cells and/or T cells permits selective stimulation of an intratumoral immune response due to the high levels of ATP in the tumor microenvironment, while at the same time avoiding systemic activation of the targeted immune cells (e.g., NK cells or T cells) and/or an immune response in non-tumor tissues.
  • the NBD aa sequence, the scaffold aa sequence and the AD may be organized in any order.
  • the construct comprises (e.g., from N-terminus to C terminus) the NBD aa sequence, the scaffold aa sequence, and the AD.
  • the construct comprises from N-terminus to C-terminus the NBD aa sequence, the AD and the scaffold aa sequence.
  • the construct comprises from N-terminus to C-terminus, the AD, the scaffold aa sequence, and the NBD aa sequence.
  • the construct comprises from N-terminus to C-terminus, the AD, the NBD aa sequence, and the scaffold aa sequence.
  • the construct comprises from N-terminus to C-terminus, the scaffold aa sequence, the AD, and the NBD aa sequence.
  • the construct comprises from N-terminus to C-terminus, the scaffold aa sequence, the NBD aa sequence, and the AD.
  • NBD-containing constructs comprising tumor-specific binders and/or immune cell engagers
  • the NBD-containing constructs described herein may, in addition to the NBDs, also comprise one or more tumor-specific binding domains and/or an immune cell engaging domain.
  • tumorspecific binding domains also referred to as tumor-specific binders
  • Immune cell engaging domains also referred to as immune cell engagers, which are also discussed in more detail below, are domains of NBD-containing constructs that have affinity for cell surface molecules (e.g., antigens) of immune cells.
  • immune cell engagers which may be, for example, antibody fragments, are monovalent to avoid the potential for off-target stimulation (e.g., systemic stimulation) of the immune cells to which they bind.
  • NBD-containing constructs comprising one or more tumor-specific binders and/or an immune cell engager may also comprise one or more ADs. See FIG 3, structures D, E, H, and I.
  • Tumor-specific binders and immune cell engagers may be incorporated into NBD-containing constructs that form heterodimers or other higher order complexes (e.g., trimers) in the presence of ATP at the concentration found in, for example, the Th/IE environment.
  • Heterodimer formation may be driven by the incorporation of a first (1 st ) heterodimerizing NBD in the first member of the pair of constructs and a second (2 nd ) heterodimerizing NBD in the second member of the pair of constructs.
  • the 1 st and 2 nd heterodimerizing pairs of NBDs act as cognate binding partners.
  • NBD-containing construct pairs In order to exemplify the type of such NBD-containing construct pairs encompassed by the present disclosure, a series of non-limiting examples of such NBD-containing construct pairs is set forth in FIG. 3.
  • the dimerized constructs direct immune cells bound by the immune cell engager to interact with target tumor cells recognized by the tumor-specific binder, bringing about an immune response to the target tumor cells.
  • Such constructs permit the targeting of tumor cells in the TME as they require elevated ATP for complex formation, and thereby limit off-target binding and stimulation of immune cells.
  • the paired constructs comprising tumor-specific binders and immune cell engagers may be augmented by the incorporation of one or more ADs that may be the same or different, and may require dimerization brought about by interaction of the first and second NBD-containing constructs to stimulate the target immune cells.
  • Entries A and B of FIG. 3 each provide a pair of constructs in which the first NBD-containing construct comprises (e.g., from N-terminus to C-terminus or from C-terminus to N-terminus) one or more 1 st heterodimerizing NBDs linked to a tumor-specific binder and the second NBD-containing construct comprises (e.g., from N-terminus to C terminus) a cognate 2 nd heterodimerizing NBD and an AD.
  • the elements of the constructs are joined by optional linker sequences that are independently selected.
  • Such constructs permit the targeting of ADs to tumor cells in the TME as they require elevated ATP to heterodimerize, and thereby limit off-target binding and avoid systemic stimulation of immune cells by the AD.
  • the ADs of the constructs set forth at B may be the same or different and may require dimerization to function on the target immune cell.
  • either or both of the heterodimerizing constructs in A or B may also comprise a scaffold aa sequence (see, e g., entry E in FIG. 3).
  • An exemplary pair of constructs that illustrates heterodimerization of the type shown in entries A or B of FIG. 3 may comprise, for example: (I) a first NBD-containing construct comprising one or more TAP1 NBDs linked to a tumor-specific binder that has affinity for a TAA (e.g., NY ESO-1 , mesothelin, CEA, PSMA, or a MAGE such as MAGE-A1, MAGE -A4, MAGE -A9, or MAGE -A11); and (ii) a second NBD-containing construct comprising a TAP2 NBD that acts as the cognate binding partner of theTAPI NBD in the presence of ATP and an IL-2 sequence. When exposed to ATP at the levels present in the TME, such constructs heterodimerize and can act to stimulate T cells present in the TME.
  • a TAA e.g., NY ESO-1 , mesothelin, CEA, PSMA, or a MAGE such as M
  • Entries C and D of FIG. 3 each provide a heterodimerizing pair of constructs in which the first NBD- containing construct comprises (e.g., from N-terminus to C-terminus) one or more 1 st heterodimerizing NBDs linked to a tumor-specific binder and the second NBD-containing construct comprises (e.g., from N-terminus to C terminus) a cognate 2 nd heterodimerizing NBD and an immune cell engager.
  • the elements of the constructs are joined by optional linker sequences that are independently selected.
  • Either or both of the first and second constructs of the heterodimerizing pair may comprise a scaffold sequence (see, e.g., FIG. 3 at F to I).
  • Constructs comprising a tumorspecific binder and/or an immune cell engager may further comprise an AD as in entries D, E, H, and I.
  • an AD may be present in a construct that also comprises an immune cell engager, the AD may be selected from those that require presentation to the T-cell as a dimer or higher order complex (e.g., TNF family members such as 4-1 BBL) for immune cell stimulation to prevent off-target stimulation.
  • TNF family members such as 4-1 BBL
  • a first NBD-containing construct comprising (a) a TAP1 NBD linked to (b) a tumor-specific binder; and (ii) a second NBD-containing construct comprising (a) a TAP2 NBD that acts as the cognate binding partner of the TAP1 NBD in the presence of ATP and (b) a monovalent T-cell engager (e.g. , an anti-CD3 antibody fragment or single chain antibody construct such as a nanobody or scFv).
  • a monovalent T-cell engager e.g. , an anti-CD3 antibody fragment or single chain antibody construct such as a nanobody or scFv.
  • the tumor specific binder may be an antibody, antibody fragment, or single chain antibody construct such as a scFv or nanobody) that has affinity for a TAA expressed on a tumor cell surface (e.g., NY ESO-1 , mesothelin, CEA, PSMA, or a MAGE such as MAGE-A1, -A4, -A9, or -A11).
  • a tumor cell surface e.g., NY ESO-1 , mesothelin, CEA, PSMA, or a MAGE such as MAGE-A1, -A4, -A9, or -A11).
  • Entries A to I of FIG. 3 appear as combinations of two molecular constructs. Because the first construct comprising the tumor-specific binder in those combinations is separate from the second construct comprising an AD and/or an immune cell engager, a population (mixture) comprising more than one type of first or second constructw may be formed. For example, a mixture of first and second constructs depicted in any one of entries A to I of FIG. 3 may be formed wherein the mixture comprises two or more first constructs each having tumor-specific binders targeting different TAAs. A mixture of first and second constructs depicted in any one of entries A or B of FIG. 3 may be formed wherein the mixture comprises two or more second constructs each having one or more ADs directed to different immune cell receptors. Similarly, a mixture of first and second constructs depicted in any one of entries C to
  • the mixtures of first and second constructs may comprise two or more first and two or more second constructs that vary in two or more elements selected from the immune cell engager, tumor-specific binder, and AD.
  • Entries J through M of FIG. 3 each provide a pair of constructs in which the first NBD-containing construct comprises (e.g., from N-terminus to C terminus) one or more 1 st heterodimerizing NBDs linked to an immune cell engager and the second NBD-containing construct comprises (e.g., from N-terminus to C terminus) a cognate 2 nd heterodimerizing NBD and an AD.
  • the elements of the constructs are joined by optional linker sequences that are independently selected.
  • Such constructs permit the activation of immune cells in the TME while avoiding any substantial activation outside of the TME as they require elevated ATP to heterodimerize, and thereby limit off-target binding and avoid systemic stimulation of immune cells by the AD.
  • the ADs of the constructs set forth in either K or M may be the same or different and may require dimerization to function on the target immune cell.
  • Exemplary pairs of constructs that illustrate heterodimerizing constructs of the type found in FIG. 3 at J and K comprise, for example: (I) a first NBD-containing construct comprising one or more TAP1 NBDs linked to an immune cell engager (e.g., an antibody, antibody fragment, or single chain antibody construct such as a VHH or nanobody) that has affinity for CD28 expressed on a T cell surface; and (ii) a second NBD-containing construct comprising a TAP2 NBD that acts as the cognate binding partner of theTAPI NBD in the presence of ATP and an IL-
  • an immune cell engager e.g., an antibody, antibody fragment, or single chain antibody construct such as a VHH or nanobody
  • Such constructs when complexed into a heterodimer by ATP at the levels present in the TME can act to stimulate T cells present in that environment.
  • compositions comprising a mixture of constructs find use in therapeutic applications where the use of more than one tumor-specific binder directed against different TAAs can avoid having the tumors escape monotherapy with a single construct.
  • the use of more than one immune cell engager and/or AD can recruit more than one type of immune cell and provide a more vigorous immune response to the tumor cells, thereby effectuating a more robust immune response to the tumor than would occur using monotherapy with a single construct.
  • NBD-containing constructs comprising two or more NBDs and the formation of complexes of NBD-containing molecular constructs
  • the NBD-containing constructs described herein may comprise two or more NBDs that permit the constructs to effectively polymerize into complexes in the presence of ATP.
  • the two or more NBDs may, for example, be arranged as a tandem pair. When placed in tandem the NBDs are adjacent to each other in the construct and are not separated by any element of the constructs other than an intervening linker aa sequence (e.g., no AD (s), scaffold, tumor-specific binding domain(s), or immune cell engaging domain(s) are present between the tandem NBDs). Additional NBDs may be located in the construct so that they are not placed in tandem.
  • NBD-containing constructs comprising two or more NBDs may be formed by replacing the NBD of the first through sixth cases described above in section C.1. (ATP-dependent agonists of immune cell function comprising NBDs and AD) with a pair of NBDs in tandem.
  • NBD-containing constructs comprising two or more NBDs may also be formed from constructs comprising an immune cell engager or tumor-specific binder.
  • NBD-containing molecular constructs comprising at least two NBDs can be formed by placing the constructs in an environment, such as a TME, where ATP levels are sufficiently high for ATP to occupy the binding sites.
  • an environment such as a TME
  • ATP levels are sufficiently high for ATP to occupy the binding sites.
  • FIG. 3 Such complexes are exemplified in FIG. 3 at N and O, and in FIG. 4A.
  • the constructs may, in effect, reversibly polymerize in the presence of ATP to produce complexes.
  • the complexes formed in the presence of ATP may be dimers, trimers, tetramers or even higher order structures. See, e.g., FIG. 4A.
  • Incorporating more than one NBD in the constructs may permit maximization of potency and efficacy, and may affect other properties.
  • complexes that become polyvalent for an element expressed on the surface of target cells e.g., for a tumor-specific engager or AD
  • larger complexes may remain in the TME longer thereby effectively extending the in vivo half-life of the complex, etc.
  • Complexes may comprise at least two NBDs arranged in tandem, with at most a linker aa sequence (e.g., a rigid linker) separating the NBD aa sequences (see FIG. 4A, structures A, B, and E) and an AD, immune cell engager and/or tumor-specific binder.
  • the NBDs may be separately attached to the tumor-specific binder or immune cell engager (see FIG. 4A, structures C and D).
  • NBD-containing constructs used to form complexes may comprise homodimerizing or heterodimerizing NBDs.
  • homodimerizing NBDs in the same construct molecule may be prevented from self-associating by constructing the molecule such that a productive ATP binding interface between the domains cannot be formed. This may be accomplished by, for example, limiting the distance between the NBDs or by the use of a rigid peptide linker between the NBDs.
  • NBD-containing constructs comprising at least two NBDs and an AD are exemplified in FIG. 4A by structures A and B.
  • Structure A employs a NBD that homodimerizes in the presence of ATP and may form dimers and/or a larger construct as shown in FIG 4A, structure A.
  • structure B comprises a structure that forms a heterodimer or polymer in the presence of ATP.
  • ADs e.g., as AD homodimers or heterodimers.
  • Complexes of such NBD-containing constructs may stimulate target immune cells, such as NK cells and/or T cells, in the TME.
  • the ADs present in the complex may be the same (e.g., FIG. 4A, structure A) or different (e.g., FIG. 4A, structure B).
  • the aa sequence of the 1 st AD and the 2 nd AD present in a complex may be identical and lead to activation of an immune cell response when presented in a dimer or higher order complex.
  • the 1 st AD and the 2 nd AD present in a complex may be from different molecules (e.g., different interleukins) that when presented together cause immune cell activation.
  • NBD-containing constructs each comprising a single NBD may be assembled into a complex comprise two different (non-identical) ADs in the presence of ATP.
  • active AD comprised of two subunits can assemble into an active AD using constructs each comprising a single NBD the presence of ATP (see, e.g., FIG. 2, structures A and B).
  • NBD-containing constructs that comprise at least two NBDs and a tumor-specific binding aa sequence (tumor-specific binder) exemplified by FIG. 4A, structure C, and/or an immune cell binding aa sequence (immune cell engager), exemplified by FIG. 4A, structure D.
  • Such molecular constructs optionally comprise one or more independently selected scaffold aa sequences and/or one or more independently selected linker sequences.
  • Tumor-specific binders include, but are not limited to, antibodies that bind to TAAs (e.g , HER-2, MAGE-2, MAGE-4, NY-ESO, and the like).
  • Immune cell engagers include molecules including, but not limited to, antibodies that bind to immune cell surface antigens (e.g., CD3, CD8, or CD4 on op T cells, TRGV9 on 6yT cells, CD16 on NK cells, etc.). Unless stated otherwise, immune cell engagers are monovalent to avoid stimulation of immune cells outside of the TME and have sequences that can lead to antibody-dependent cell-mediated cytotoxicity (ADCC) or complement-dependent cytotoxicity (CDC) modified to substantially limit or prevent such responses.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • CDC complement-dependent cytotoxicity
  • constructs that comprise at least two NBDs and a tumor-specific binder and/or an immune cell engager form large complexes that can lead to immune stimulation.
  • Constructs comprising at least two NBDs, a scaffold comprising an IgFc, and a tumor-specific binder can form a complex in the TME (see, e.g., FIG. 4A, structure C) that can, for example, lead to ADCC or CDC.
  • Constructs comprising at least two NBDs and an immune cell engager can form a complex in the TME (see, e.g., FIG. 4A, structure D) that can, for example, lead to stimulation of the targeted immune cells due to crosslinking of the target antigen (e.g., CD3 on CD8+ T cells or CD16 on NK cells) on their surface.
  • the target antigen e.g., CD3 on CD8+ T cells or CD16 on NK cells
  • Combining a NBD-containing construct comprising at least two NBDs and a tumor-specific binder (e.g., FIG. 4A, structure C) and a NBD-containing construct comprising at least two NBDs and an immune cell engager (e.g., FIG. 4A, structure D) may result in complexes that comprise both tumor-specific binders and immune cell engagers.
  • the use of 1 st heterodimerizing NBDs with the tumor-specific binder and 2 nd heterodimerizing NBDs with the immune cell engager can ensure the complex formed in the presence of ATP contains both the binder and engager and can stimulate immune cell responses to the target tumor cell.
  • the tumor-specific binder and/or immune cell engager aa sequences present in each construct used to form a complex need not be the same. Accordingly, the complexes of FIG. 3, structures A to I, and FIG. 4A, structures C to I, may have more than one tumor-specific binder directed to different TAAs (e.g., two or more tumorspecific binders), and, when present, more than one immune cell engager.
  • TAAs e.g., two or more tumorspecific binders
  • immune cell engager e.g., two or more tumorspecific binders
  • Using two or more different tumorspecific binders directed against different TAAs in a single complex not only permits the complex formed from constructs comprising two or more NBDs to be active against tumors expressing different tumor antigenic targets, but also may limit tumor escape from therapy by loss of tumor antigen expression.
  • ADs into complexes that form in the TME, including complexes containing a construct that includes a tumor-specific binder. This can be done by, for example, combining one or more constructs that comprise an AD and a NBD (e.g., two or more NBDs) in the complex such as is exemplified in FIG 4A at H, or by combining one or more constructs that comprise an AD, a NBD (e.g., two or more NBDs), and a tumor-specific binder in the complex such as is exemplified in FIG. 4A at I.
  • a NBD e.g., two or more NBDs
  • the composition of the complex can be controlled by mixing different constructs (e.g., prior to or during administration to a patient). Thus, a single construct may find use in different therapeutic combinations.
  • NBDs for incorporation into the constructs described herein may be selected based on several criteria. Where the constructs are intended for human therapeutic use, the NBDs are preferentially derived from human ATP binding proteins to limit their immunogenicity and are preferably able to undergo solution phase dimerization or higher complex formation when exposed to sufficient ATP. Where non-human proteins that are immunogenic are employed, immunogenic portions may be humanized by altering the immunogenic regions to more closely or completely match their human homologs. The solution phase formation of dimers or higher order complexes used in the constructs described herein occurs at ATP concentrations found in the target TME, but not in normal tissues.
  • a NBD for use in the constructs provided herein may have, for example, a dissociation constant for ATP from about an order of magnitude above (10 times above) the upper level found in the extracellular space of normal tissues (i.e , about 1 pM or higher) up to about the level of ATP found in the TME.
  • the affinity of a NBD will be from about 1 pM to about 200 pM.
  • the ATP affinity of a NBD may be in a range from about 1 pM to about 5 pM, or from about 5 pM to about 25 pM.
  • the ATP affinity of a NBD may be in a range from about 25 pM to about 50 pM.
  • the affinity of a NBD may be in a range from about 50 pM to about 100 pM or from about 100 pM to about 200 pM.
  • NBDs of some proteins form homodimers in the presence of sufficient levels of ATP, while others form heterodimers in the presence of sufficient levels of ATP.
  • Both homodimerizing NBDs and heterodimerizing NBDs may be employed in various aspects of the polypeptide constructs described herein. Where it is desirable to have the NBDs form homodimers in solution when sufficient levels of ATP are present, aa residues at the interface between the dimers may be modified to either remove or substitute aa residues that interfere with interface formation between two NBD molecules. Alternatively, it is possible to substitute aas not contributing to the interactions between the two NBD molecules with aas that will contribute to interactions resulting in homodimer formation. a) ATP-binding cassettes as NBDs
  • a number of proteins comprise NBDs that are suitable for use as NBDs of the constructs described herein.
  • ATP-binding cassette (ABC) transporters represent suitable candidates in part because they are an abundant transporter family that is highly conserved and as such unlikely to be immunogenic.
  • ABC transporters are a large superfamily of membrane proteins with diverse functions that utilize the energy from ATP hydrolysis to facilitate transport of substrates either into or out of the cytoplasm. See, e.g., Locher, Philos Trans R Soc Lond B Biol Sci., 364(1514): 239-245 (2009), and reference cited therein.
  • the human genome codes for 48 or 49 distinct ABC transporters. Id.
  • the ABC transporters are divided into seven distinct family members, ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White.
  • a representative member of each family including TAP1 are aligned in FIG 6.
  • the NBD of the ATP-binding cassette family is conserved and comprises two sub-domains. Id. The first resembles RecA protein and contains P-loops (Walker-A motifs). The second subdomain, referred to as the “helical sub-domain,” comprises an LSGGQ motif. Id.
  • the NBDs of the transporters assemble as dimers in head-to- tail orientation forming two ATP binding and hydrolysis sites sandwiched at their interface (see FIG. 5).
  • Stabilized dimers can be formed by including aa substitutions that make the NBD domain sequences ATP hydrolysis deficient or substantially ATP hydrolysis deficient (e.g., by reducing the ATP hydrolysis rate by one or more orders of magnitude (see, e.g., Vakkasoglu et al., (2107) PLoS ONE, 12(5): e0178238, available at doi. org/10.1371 /journal. pone.0178238).
  • the hydrolytic Asp or Glu residue found in NBD proteins may be substituted by an Asn or Gin residue (see, e.g., FIG. 3).
  • residues at the interface between the dimers may be modified to either remove or substitute aa residues that interfere with interface formation, or to substitute aas not contributing to the interface interactions with aas that can contribute to the interactions.
  • NBD of rat TAP1 homodimerizes in solution and can be used as a model for the formation of the ATP-sandwich interface to bring about solution phase homodimerization in the presence of ATP (see, e.g., Vakkasoglu et al., (2107) PLoS ONE, 12(5): e0178238. https://doi.
  • Alignment of a NBD aa sequence with a sequence known to undergo homodimerization can be used to guide alterations in a target sequence.
  • NCBI National Center for Biotechnology Information
  • a NBD aa sequence of an ABC containing protein may comprise all or part of the NBD domain of a Phospholipid-Transporting ATPase (ABC or ABCA1 transporter) encoded by the ABCA1 gene, UniProtKB - 095477 (SEQ ID NOH).
  • a NBD may comprise a sequence having at least about 90% or at least about 95% sequence identity to SEQ ID NON .
  • a NBD aa sequence may comprise all or part of the NBD domain of Multidrug Resistance Protein 1 (MDR/TAP) encoded by the ABCB1 gene, UniProtKB - P08183 (SEQ ID NO:2).
  • MDR/TAP Multidrug Resistance Protein 1
  • a NBD may comprise a sequence having at least about 90% or at least about 95% sequence identity to SEQ ID NO:2.
  • a NBD aa sequence may comprise all or part of the NBD domain of a Multidrug resistance-associated protein (MRP, Multidrug resistance-associated protein 1) encoded by the ABCC1 gene, UniProtKB - P33527 (SEQ ID NO:3)
  • MRP Multidrug resistance-associated protein 1
  • a NBD may comprise a sequence having at least about 90% or at least about 95% sequence identity to SEQ ID NO:3.
  • a NBD aa sequence may comprise all or part of the NBD domain of an ATP-binding cassette subfamily D member 1 protein (ALD, Adrenoleukodystrophy Protein) encoded by the ABCD1 gene, UniProtKB/Swiss-Prot: P33897 (SEQ ID NO:4).
  • a NBD may comprise a sequence having at least about 90% or at least about 95% sequence identity to SEQ ID NO:4.
  • a NBD aa sequence may comprise all or part of the NBD domain of an ATP-binding cassette subfamily E member 1 protein (OABP, 2'-5'-Oligoadenylate-Binding Protein) encoded by the ABCE1 gene, UniProtKB/Swiss-Prot: P61221 (SEQ ID NO:5).
  • a NBD may comprise a sequence having at least about 90% or at least about 95% sequence identity to SEQ ID NO:5.
  • a NBD aa sequence may comprise all or part of the NBD domain of an ATP-binding cassette subfamily F member 1 protein (GCN20, TNFalpha-lnducible ATP-Binding Protein) encoded by the ABCF1 gene, UniProtKB - Q8NE71 (SEQ ID NO:6).
  • GCN20 ATP-binding cassette subfamily F member 1 protein
  • a NBD may comprise a sequence having at least about 90% or at least about 95% sequence identity to SEQ ID NO:6.
  • a NBD aa sequence may comprise all or part of the NBD domain of an ATP-binding cassette subfamily G member 1 protein (White, Homolog Of Drosophila White) encoded by the ABCG2 gene, UniProtKB/Swiss-Prot: P45844 (SEQ ID NOT).
  • a NBD may comprise a sequence having at least about 90% or at least about 95% sequence identity to SEQ ID NOT.
  • TAP1 and TAP2 proteins are cognate binding partners that act as a transporter coupling ATP binding and heterodimerization with peptide translocation across inner cell membranes.
  • TAP1 and TAP2 are members of the ABC transporter superfamily that represents a source of NBDs for use in the constructs provided herein.
  • Rat TAP1 NBD is known to undergo homodimerization in the presence of ATP.
  • the NBD of human TAP1 does not undergo homodimerization in the presence of ATP, but can be induced to undergo homodimerization using previously defined substitutions. See, e.g. , Vakkasoglu et al.
  • TAP1 antigen processing 1
  • the TAP1 substitutions leading to homodimerization may include one or more (e.g., all) of N676G, S677N, Q680R, E682Q, and Q683R substitutions.
  • the portions (e.g., domains) of TAP1 and TAP2 proteins employed as NBDs may also include substitutions of one or more cysteines present in the sequence (e.g., with serine residues) to prevent undesirable disulfide bond formation leading to non-functional folding or undesirable intermolecular disulfide bond formation.
  • TAP1 and TAP2 NBDs may also include a His tag, for example at the C- terminus of the domain for purification of constructs comprising those NBDs.
  • a NBD aa sequence from human TAP1 may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to the NBD aa sequence (aas 492-748) of NCBI Reference Sequence: NP_000584.3 of SEQ ID NO:8, or of UniProtKB - Q03518-2:
  • TAP1 NBD domain common to both the NCBI and UniProt sequence is:
  • a NBD aa sequence from human TAP1 may, for example, comprise an aa sequence having greater than 97% or greater than 98% sequence identity to at least 230 contiguous aas of the NBD of the aa sequence set forth in NCBI Reference Sequence: NP_000584.2 (aas 492-748) provided as SEQ ID NO:9.
  • a NBD aa sequence from human TAP1 may, for example, comprise substitutions at the aa residues corresponding to C662 (e.g., C662S) and C735 (e.g., C735S) of SEQ ID NO:8.
  • the NBD aa sequence from human TAP1 may also, for example, comprise substitutions at aas corresponding to one or more of N676, S677, Q680, E682, and Q683 (e.g, N676G, S677N, Q680R, E682Q, and/or Q683R) of SEQ ID NO:8, which are bolded and italicized in SEQ ID NO: 10 below.
  • the NBD aa sequence from human TAP1 may also comprise a substitution at, for example, the Asp corresponding to D668 of SEQ ID NO:8, which renders the NBD ATP hydrolysis-deficient.
  • a NBD polypeptide aa sequence of TAP1 may, for example, comprise the aa sequence of SEQ ID NO: 10, or an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence:
  • the NBD aa sequence may have greater than 97% or greater than 98% sequence identity to at least 230 or 240 contiguous aas of the sequence provided in SEQ ID NO: 10.
  • a NBD aa sequence from human TAP1 may, for example, comprise substitutions corresponding to those at 0662 (e.g, C662S) and 0735 (e.g, C735S) of SEQ ID NO:8.
  • the NBD aa sequence from human TAP1 may also, for example, comprise substitutions corresponding to those at one or more of N676, S677, Q680, E682, and Q683 (e.g., N676G, S677N, Q680R, E682Q, and/or Q683R) in SEQ ID N0:8, which are bolded and italicized in SEQ ID NO:87 below.
  • NBD aa sequence from human TAP1 may comprise a substitution at the Asp corresponding to D668 of SEQ ID NO:8, which renders the NBD ATP hydrolysis-deficient.
  • a NBD polypeptide aa sequence of TAP1 may, for example, comprise the aa sequence of SEQ ID NO:87 or an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence:
  • the NBD aa sequence may have greater than 97% or greater than 98% sequence identity to at least 250 or 260 contiguous aas of the sequence provided in SEQ ID NO:87.
  • a NBD aa sequence from human TAP1 may, for example, comprise substitutions corresponding to those at C662 (e.g., C662S) and C735 (e.g., C735S) of SEQ ID NO:8.
  • the NBD aa sequence from human TAP1 may also, for example, comprise substitutions corresponding to those at one or more of N676, S677, Q680, E682, and Q683 (e.g., N676G, S677N, Q680R, E682Q, and/or Q683R) in SEQ ID NO:8, which are bolded and italicized in SEQ ID NO:88 below.
  • NBD aa sequence from human TAP1 may comprise a substitution at the aa corresponding to D668 of SEQ ID N0:8 (e.g., a D668N substitution), which renders the NBD ATP hydrolysisdeficient.
  • a NBD polypeptide aa sequence of TAP1 may, for example, comprise the aa sequence of SEQ ID NO:88 or an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence:
  • the NBD aa sequence may have greater than 97% or greater than 98% sequence identity to at least 300 or 310 contiguous aas of the sequence provided in SEQ ID NO:88.
  • the NBD provided in SEQ ID NO:88 comprises, in addition to TAP1 NBD sequences, the coupling helix 1 (CH1 , aas 2-11) from TAP1 and coupling helix 2 (CH2, aas 17-25) from TAP2, and associated GS linkers (aas 12-16 and 25-30), which together constitute a “cap'' on the sequence.
  • TAP1 NBD constructs express at substantially higher levels in biological expression systems as shown in Example 3.
  • NBDs from TAP proteins that do not homodimerize, but rather heterodimerize with a cognate NBD are used to prepare pairs of constructs (see, e.g., FIG. 2 at B and D and FIG. 3) or complexes of constructs (see, e.g., FIG. 4A) of the present disclosure.
  • a pair of constructs bearing human TAP1 NBDs and human TAP2 NBDs can be prepared.
  • the pair of constructs comprising TAP1 and TAP2 NBDs will form heterodimers through interaction of TAP1 and TAP2 in the presence of sufficient ATP.
  • NBDs such as TAP1 and TAP2 that can heterodimerize permits different specific combinations of activating sequences to be combined for immune cell stimulation.
  • a construct comprising IL-12A (p35), an optional linker aa sequence, and TAP1 can heterodimerize in the presence of sufficient ATP with a construct comprising IL-12B (p40), an optional linker aa sequence, and TAP2 to form a pair of constructs presenting an active IL-12AB heterodimer.
  • Such constructs may also comprise a scaffold aa sequence such as an Ig Fc aa sequence if desired.
  • FIG. 7 provides the sequence of human TAP2.
  • a NBD of a construct of the present disclosure may comprise an aa sequence from the NBD from human TAP2 or an aa sequence having greater than 90% or greater than 95% sequence identity to a human TAP2 NBD.
  • the NBD may comprise an aa sequence having greater than 90% or greater than 95% sequence identity to the NBD aa sequence of Uni ProtKB - Q03519 (TAP2_HUMAN):
  • a NBD may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to the human TAP2 aa sequence:
  • the NBD may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID N0:12.
  • a mutation removing the catalytic acidic aa residue corresponding to the D668N substitution of TAP1 rendering it ATP hydrolysis deficient may be incorporated into a TAP2 NBD aa sequence.
  • a NBD of a construct of the present disclosure may comprise an aa sequence from the NBD from human cystic fibrosis transmembrane conductance regulator (CFTR) or an aa sequence having greater than 90% or greater than 95% sequence identity to a human CFTR.
  • the NBD may comprise an aa sequence having greater than 90% or greater than 95% sequence identity to the NBD aa sequence of Uni ProtKB - P13569 (SEQ ID NO:13):
  • a NBD may, for example, comprise an aa sequence having greater than 80% or greater than 85% sequence identity to the human CFTR aa sequence: VLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGK IKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAV YKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDF (SEQ ID NO: 14).
  • the NBD may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID N0:14.
  • the NBD may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO: 14.
  • a NBD may, for example, comprise an aa sequence having greater than 80% or greater than 85% sequence identity to the human CFTR aa sequence Ser-NBD1 [387-646(D405-436)] described in Atwell et al., (2010), Protein Engineering, Design & Selection, 23(5) 375-384: SXTTTEWMENVTAFWEEGGTPVLKDINFKIER GQLLAVAGSTGAGKTSLLIWIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDI SKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL KKADKILILH EGSSYFYGTFSELQNLQPDFSSKLMX (SEQ ID NO: 15), where X at position 2 may be absent or L; and X at position 229 is absent or G.
  • the NBD may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO: 15.
  • the NBD may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO: 15.
  • a NBD may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to aas 1-216 of SEQ ID NON 6, where X at position 2 may be absent or L.
  • Scaffold aa sequences may be incorporated into the ATP-dependent agonists constructs described herein as a means of structural organization, to increase the half-life of the molecules in vivo, and, where capable of inducing ADCC, ADCP, and/or CDC, to act as a basis for those effector functions.
  • the scaffolds may be capable of forming dimers and higher order complexes (e.g., trimers) or non-dimerizable (non-dimerizing) in which case they do not form dimers or higher order complexes.
  • Scaffolds incorporated into the constructs described herein may, for example, comprise an immunoglobulin (Ig) aa sequence or non-immunoglobulin aa sequence.
  • the scaffold polypeptide sequence comprises an immunoglobulin heavy chain constant region (CH2-CH3) polypeptide sequence that functions as a dimerization or multimerization sequence.
  • the scaffold comprises an immunoglobulin (Ig) aa sequence
  • it may comprise an immunoglobulin heavy chain constant region (CH2-CH3) polypeptide aa sequence (e.g., an Ig Fc aa sequence).
  • the scaffold aa sequence may, for example, comprise Ig CH2 and/or CH3 aa sequences modified to prevent dimerization.
  • a scaffold polypeptide may comprise the wild-type (wt) Homo sapiens lgG1 Fc polypeptide sequence of (SEQ ID NO:56):
  • the scaffold may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:56.
  • the scaffold may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:56.
  • a scaffold polypeptide may comprise a Homo sapiens lgG1 Fc aa sequence of SEQ ID NO:57, which comprises a LALA substitution (L234A, L235A substitutions, appearing as bolded and italicized aas 14 and 15 respectively):
  • the scaffold may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:57
  • the scaffold may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:57
  • Non-dimerizing scaffolds may be prepared as human single chain Fc (scFc) dimers See, e g., Zhou et al., Biomaterials 117:24-31 (2017).
  • scFc dimers may be based on lgG1 and have the sequence:
  • the scaffold may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO: 102.
  • the scaffold may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO: 102.
  • the scaffold construct of SEQ ID NO:102 is competent for the induction of ADCC, ADCP, and CDC, but substitutions including "LALA” discussed below may be introduced to selectively alter the ability of the scFc to induce those effector functions.
  • a scaffold polypeptide may comprise the wt Homo sapiens lgG2 Fc polypeptide of SEQ ID NO:58 (see GenBank AAN76044 amino acids 99-325):
  • the scaffold may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:58.
  • the scaffold may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:58.
  • a scaffold polypeptide may comprise the wt Homo sapiens lgG3 Fc polypeptide of SEQ ID NO:59 (see, e.g., GenBank AAW65947 amino acids 19-246):
  • the scaffold may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:59.
  • the scaffold may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:59.
  • a scaffold polypeptide may comprise the wt Homo sapiens lgG4 Fc polypeptide of SEQ ID NO:60:
  • the scaffold may, for example, comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:60.
  • the scaffold may also comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NQ:60.
  • the human protein family is comprised of FcyRI (CD64), FcyRII (CD32, which includes isoforms FcyRlla, FcyRllb, and FcyRllc), and FcyRIII (CD16, which includes isoforms FcyRyllla and FcyRlllb). See, e.g., Lazar et al. (2006) PNAS:103 (11), 4005-4010.
  • variants that can enhance one or more antibody related effector functions are: the individual substitutions S239D and I332E; and the double and triple substitutions at S239D/I332E and S239D/I332E/A330L in human IgG 1.
  • substitutions corresponding to S239D, I332E, and A330L in the human lgG1 Re sequence are S19D, I 112E, and A110L.
  • the substitutions are the double and triple mutants S239D/I332E or S239D/I332E/A330L. See Lazar et al., 2006.
  • substitutions that enhance one or more antibody related effector function in IgG 1 antibodies include, but are not limited to: Ser298Ala/Glu333Ala/Lys334Ala; Ser239Asp/Ala330Leu/lle332Glu; Ser239Asp/lle332Glu; Gly236Ala/Ser239Asp/Ala330Leu/lle332Glu ; Gly236Ala; Ser239Asp/lle332Glu/Gly236Ala;
  • At least ADCC is enhanced by the substitutions.
  • at least ADCP is enhanced by the substitutions.
  • at least CDC is enhanced by the substitutions.
  • at least complement fixation is enhanced by the substitutions.
  • Variants that can substantially diminish one or more antibody related effector functions of IgG 1 antibodies include, but are not limited to: Leu235Glu; Leu234Ala/Leu235Ala (LALA); Ser228Pro/Leu235Glu; Leu234Ala/Leu235Ala/Pro329Gly; Pro331 Ser/Leu234Glu/Leu235Phe; Asp265Ala; Gly237Ala; Glu318Ala; Glu233Pro; and Gly236Arg/Leu328Arg.
  • the scaffold sequence comprises an lgG1 Fc sequence with a LALA substitution (see, e.g., SEQ ID NO:57).
  • at least ADCC is substantially diminished by the substitutions.
  • at least ADCP is substantially diminished by the substitutions.
  • at least CDC is substantially diminished by the substitutions.
  • at least complement fixation is substantially diminished by the substitutions. See, e.g., Saunders 2019 and citations therein.
  • the lgG1 Fc substitutions may be S239D/I332E/A330L, which permit enhancement of ADCC without substantially altering the CDC function (see Lazar et al., 2006).
  • variants in lgG1, lgG2, and lgG4 antibody sequences that can substantially diminish one or more antibody related effector functions include, but are not limited to: His268Gln/Val309Leu/Ala330Ser/Pro331 Ser (lgG2m4); Vai 234AI a/Gly237AI a/Pro238Ser/His268Ala/Val309Leu/AI a330Ser/Pro331 Ser (lgG2a); Leu234Ala/L235Ala/Gly237Ala/P238Ser/His268Ala/Ala330Ser/Pro331Ser (IgGIcr); and S228P/Phe234Ala/Leu235Ala (lgG4PAA). See, e.g., Saunders 2019 and citations therein.
  • Alternative non-dimerizing scaffold domains include, but are not limited to, XTENylation, PEGylation, Lipidation (see pubs.acs.org/doi/10.1021/acsmedchemlett.8b00226 on the world wide web “www”), Human Serum Albumin (HSA) fusions (see nature.com/articles/s42003-021 -01790-2 on the www) and anti HSA binding domains, including but not limited to anti-HSA peptides (see pubs.acs.org/doi/10.1021/acs.molpharmaceut.2c00106 on the www), antibody and antibody fragments (e.g. ScFvs, FABs, etc) and VHH domains (see semanticscholar.org/paper/Serum-albumin%E2%80%90binding-VHHs-with-variable-pH-enable-Faassen-
  • the constructs of the present disclosure optionally have linkers located between any two elements.
  • the linkers can be located between any two of the NBD aa sequence, the scaffold aa sequence, and the AD.
  • Linkers are typically comprised of aa sequences from 4 to 50 aas in length (e.g., from 4 to 25 aas or from 25 to 50 aas) and may be chosen for, among other things, their rigidity. Linkers are each selected independently.
  • linkers are flexible aa sequences that are comprised of glycine, serine, and/or alanine residues.
  • linkers are aa sequences comprised of glycine and serine.
  • the sequence GGGS (SEQ ID NO:16) or the sequence GGGGS (SEQ ID NO:26) may appear or be repeat from 1-10 times in the linkers (GGGS)MO (SEQ ID NOs: 16-25) or (GGGGS)i-io (SEQ ID NOs:26-35). In some cases where linkers comprise a GGGS or GGGGS sequence, those sequences may appear from 1-5 or from 5-10 times.
  • Rigid linkers may be employed where it is desirable to maintain a substantially fixed distance or spatial separation between the domains to reduce or substantially eliminate unfavorable interactions between domains of the constructs (e g., between NBDs in the same construct).
  • a pair of NBDs present in a single molecule may kept from self-associating through the use of rigid linkers.
  • Exemplary rigid peptide or polypeptide linkers include linkers comprising the sequence X(EAAAK)n X, where EAAAK may appear in the linker from 1-20 times (i.e., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 times, SEQ ID NOs:36-55) and where X is absent or alanine.
  • n may be from 1-5 or from 5-10. In some cases where linkers comprise the X(EAAAK)n X sequence, n may be from 11-15 or from 16-20.
  • rigid peptide linkers may comprise repeats of (Lys-Pro), (Glu-Pro), (Thr-Pro-Arg), and (Ala-Pro) having a length of 4 to 40 (e.g., 4-20 or 20-40 amino acids).
  • Other rigid linkers include linkers comprising repeats of the dipeptide sequence KP or EP from 2 to 10 or 10 to 20 times.
  • Immune cell engaging domains are domains of the NBD-containing constructs that can bind to immune cell surface molecules.
  • Immune cell engagers are typically antibody-related molecules/aa sequences (e.g., an antigen binding fragment of an antibody, Fab, Fab’, single chain antibody, scFv, peptide aptamer, or nanobody). Unless stated otherwise, immune cell engagers are understood to be monovalent to prevent individual molecules from crosslinking the cellular target (e.g., immune cell surface antigen) and off target stimulation of the immune cell.
  • the immune cell engager are generally incapable of acting as an agonist and stimulating the immune cells to which they bind; however, when multiple constructs bearing an immune cell engager are localized in a complex (see, e.g , FIG. 4A at D or E) or immobilized on the surface of a tumor cell (e g., using a construct such as in FIG 3 at C), the immune cell engager may function as an agonist of the immune cell stimulation/activation.
  • Immune cell engagers may be directed to a number of different immune cells that appear or may be recruited into the TME. Such immune cells and the targets of their corresponding immune cell engagers include those set forth in Table 1. Table 1 Some Immune cells and their corresponding immune cell engager
  • ⁇ Antibody related molecules include, but are not limited to, antigen binding fragments of an antibody, Fabs, Fab's, and polypeptides comprising single chain antibody, scFv, peptide aptamer, or nanobody aa sequences
  • immune cell engagers such as those listed in Table 1 are incorporated into a first NBD-containing polypeptide construct that can pair or complex with a second NBD-containing construct comprising a tumor-specific binder directed against a TAA, then trans-targeting of tumor cells leading to their cytolysis may be observed (see, e.g., FIG. 3 at C, D, and F-H, and also complexes in FIG 4A at E, F, H, and I).
  • the incorporation of antibody-related molecules/aa sequences directed against immune cell surface proteins including, but not limited to, CD3, TCRs, and/or CD16 in such constructs and complexes may produce potent cytolytic action. Cytolytic activity may be enhanced when immune cell engagers that interact with more than one type of immune cell are employed.
  • Some exemplary anti-CD3 immune cell engagers are provide below.
  • An immune cell engager polypeptide may be a scFv, anti-human CD3 based upon the UCHT-1 monoclonal antibody having the sequence: AIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNWYQQKPGKA PKLLIYYTSRLESGVPSRFSGSGSGTDYTLT ISSLQPEDFATYYCQQGNTLPWTFGQGTKVEIKGGGGSG GGGSGGGGSGGGGSGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALIN PYKGVTTYADSVKGRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTVSS (SEQ ID NO:61).
  • the immune cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:61.
  • the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:61 .
  • An immune cell engager polypeptide may be a scFv, anti-human CD3 based upon the UCHT-1 monoclonal antibody having the sequence: AIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNWYQQKPGKA PKLLIYYTSRLESGVPSRFSGSGSGTDYTLT ISSLQPEDFATYYCQQGNTLPWTFGQGTKVEIKGGGGSG GGGSGGGGSGGGGSGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALIN PYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTVSS (SEQ ID NO:62).
  • the immune cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:62.
  • the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:62.
  • An immune cell engager polypeptide may be an anti-human CD3 VHH having the sequence:
  • the immune Cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:63.
  • the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:63.
  • An immune cell engager polypeptide may be an anti-human CD3 scFv (vH-vL) based upon the L2K antibody having the sequence: DVQLVQSGAEVKKPGASVKVSCKASGYTFTRYTMHWVRQAP GQGLEWIGY INPSRGYTNYADSVKGRFTITTDKSTSTAYMELSSLRSEDTATYYCARYYDDHYCLDYWGQGTTVTVSSG GGGSGGGGSGGSD IVLTQSPATLSLSPGERATLSCRASQSVSYMNWYQQKPGKAPKRWIYDTSKVASG VPARFSGSGSGTDYSLTINSLEAEDAATYYCQQWSSNPLTFGGGTKVEIK (SEQ ID NO:64).
  • the immune cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:64.
  • the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:64.
  • An immune cell engager polypeptide may be an anti-human CD3 scFv (vH-vL) based upon the L2K antibody having the sequence set forth in SEQ ID NO:65, which includes a disulfide bond between the cysteine substitutions at Q43C and G99C (G233C as shown): DVQLVQSGAEVKKPGASVKVSCKASGYTFTRYTMHWV RQAPGCGLEWIGYINPSRGYTNYADSVKGRFTITTDKSTSTAYMELSSLRSEDTATYYCARYYDDHYCLD YWGQGTTVTVSSGGGGSGGGGSGGSDIVLTQSPATLSLSPGERATLSCRASQSVSYMNWYQQKPGKAP KRWIYDTSKVASGVPARFSGSGSGTDYSLTINSLEAEDAATYYCQQWSSNPLTFGCGTKVE IK (SEQ ID NO:65).
  • the immune cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:65.
  • the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:65.
  • An immune cell engager polypeptide may be an anti-human CD3 scFv (vH-vL) based upon the L2K antibody having the sequence set forth in SEQ ID NO:66, which includes a disulfide bond between the cysteine substitutions at Q43C and G100C (G234C as shown): DVQLVQSGAEVKKPGASVKVSCKASGYTFTRYTMHW VRQAPGCGLEWIGYINPSRGYTNYADSVKGRFT ITTDKSTSTAYMELSSLRSEDTATYYCARYYDDHYCL DYWGQGTTVTVSSGGGGSGGGGSGGGGSD IVLTQSPATLSLSPGERATLSCRASQSVSYMNWYQQKPGKA PKRWIYDTSKVASGVPARFSGSGSGTDYSLT INSLEAEDAATYYCQQWSSNPLTFGGCTKVEIK (SEQ ID NO:66).
  • the immune cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:66.
  • the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:66.
  • An immune cell engager polypeptide may be an anti-human CD3 scFv (vH-vL) based upon the L2K antibody having the sequence set forth in SEQ ID NO:67, which includes a disulfide bond between the cysteine substitutions at G44C and :G99C (G233C as shown): DVQLVQSGAEVKKP GASVKVSCKASGYTFTRYTMHWV RQAPGQCLEWIGYINPSRGYTNYADSVKGRFTITTDKSTSTAYMELSSLRSEDTATYYCARYYDDHYCLD YWGQGTTVTVSSGGGGSGGGGSGGSDIVLTQSPATLSLSPGERATLSCRASQSVSYMNWYQQKPGKAP KRWIYDTSKVASGVPARFSGSGSGTDYSLTINSLEAEDAATYYCQQWSSNPLTFGCGTKVE IK (SEQ ID NO:67).
  • the immune cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:67.
  • the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:67.
  • An immune cell engager polypeptide may be an anti-human CD3 scFv (vH-vL) based upon the L2K antibody having the sequence set forth in SEQ ID NO:68, which includes a disulfide bond between the cysteine substitutions at G44C and G100C (G234C as shown):
  • the immune cell engager may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:68.
  • the immune cell engager may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:68.
  • the GGGS (SEQ ID NO:16) and/or GGGGS (SEQ ID NO:26) containing repeats in SEQ ID NOs:61-62 and 64-68, are linker sequences between domains.
  • ADs Activating Domains
  • Activating Domains that can be incorporated into constructs of the present disclosure include a variety of molecules or fragments of molecules (e.g., fragments of cytokines) that are capable of stimulating anti-tumor cell immune responses when presented as dimers or higher order complexes, but that have a limited ability to stimulate immune cells when presented singly.
  • Some immune cell agonists that require receptor crosslinking for maximal activity include, but are not limited to, CD40L, CD28, IFN-g, and IL-12.
  • Anti-tumor cell immune responses may result, for example, from the stimulation of NK cells or T cells (e.g., CD8+ T cells) by constructs comprising ADs, and may include granule dependent and granule independent responses.
  • ADs may comprise, for example, aa sequences of TNF superfamily members such as TNF, lymphotoxin a, lymphotoxin ap, and BAFF (CD25).
  • ADs may also comprise, for example, aa sequences of B7 superfamily members, such as CD80 and CD86.
  • An AD may also comprise, for example, the aa sequence of all or part of IL-15, IL-12, IL-2, or IL-7 (e.g., all or part of the extracellular domain).
  • An AD may comprise, for example, all or part of the aa sequence of IL-12 (e.g., one or both subunits of human IL-12).
  • ADs that may be employed in constructs that homodimerize (see, e.g., FIG. 2 at A and C) or form homomeric complexes (see, e.g., FIG. 4A at A) in the presence of ATP levels found in the TME include, but are not limited to, immunomodulatory aa sequences of: IL-15, IL-12, or IL-7.
  • Antibody related sequences e.g., single chain scFV or nanobody sequences having anti-PD1 , anti-PDL1 , anti-CD40, anti-CD40L, anti-CD 137/4- 1 BB, anti-TGFp, anti-IL-10, or anti-IL10R binding activity may also be employed.
  • nucleic acids including nucleic acids with CpG repeats or one or more
  • IMT504 sequences may be used as ADs and may be incorporated into homodimerizing or heterodimerizing NBD- containing constructs.
  • An AD may comprise, for example, the CD80 polypeptide aa sequence:
  • an AD may comprise a sequence having at least 90% or at least 95% sequence identity with SEQ ID NO:99.
  • An AD may also comprise a sequence having at least 96% or at least 98% sequence identity to at least 170 or 180 contiguous aas of SEQ ID NO:99.
  • An AD may comprise, for example, the CD86 polypeptide aa sequence comprising the CD86 (IgV-lgC domain):
  • an AD may comprise a sequence having at least 90% or at least 95% sequence identity with SEQ ID NQs:100 or 101.
  • An AD may also comprise a sequence having at least 96% or at least 98% sequence identity to at least 100 or 110 contiguous aas of SEQ ID NQs:100 or 101.
  • An AD may comprise, for example, an aa sequence that binds the IL-12 as an agonist (e.g , IL-12 or an anti-CD28 scFv or nanobody aa sequence).
  • An AD may comprise, for example, a single chain IL-12 that comprises the sequence:
  • an AD may comprise a sequence having at least 90% or at least 95% sequence identity with SEQ ID NQ:90.
  • An AD may also comprise a sequence having at least 96% or at least 98% sequence identity to at least 480 or 500 contiguous aas of SEQ ID NQ:90.
  • the constructs of the present disclosure may comprise NBDs that heterodimerize in the presence of ATP. Accordingly, a complex between a first construct and a second construct that comprise heterodimerizing NBDs can be used to assemble an AD see, e.g., FIG. 2 at B and D).
  • an IL-12 AD may be formed in the presence of ATP by employing:
  • a first construct comprising a p40 subunit (as a 1 st immunomodulatory domain) comprising the sequence:
  • SEQ ID NO:92 181 RIRAVT IDRV SYLNAS (SEQ ID NO:92), or a sequence having at least 90% or at least 95% sequence identity with SEQ ID NO:92.
  • An AD may comprise, for example, all or part of an aa sequence that binds to PD1 (e.g , an anti-PD1 scFv or nanobody aa sequence) or an aa sequence that binds to PDL1 (e.g., an anti-PDL 1 scFv or nanobody aa sequence).
  • aa sequence that binds to PD1 e.g , an anti-PD1 scFv or nanobody aa sequence
  • PDL1 e.g., an anti-PDL 1 scFv or nanobody aa sequence
  • An AD may comprise, for example, an aa sequence that binds to CD40 (e.g., an anti-CD40 scFv or nanobody aa sequence or a CD40L aa sequence) or an aa sequence that binds to CD40L (e.g., an anti-CD40L scFv or nanobody aa sequence, or a CD40 aa sequence).
  • a polypeptide that may be employed as an AD may comprise the CD40L aa sequence:
  • a polypeptide that may be employed as an AD comprises a trimer of CD40L aa sequences separated by linker sequences (e.g., linker sequences comprising GGGGS repeats):
  • An AD may comprise, for example, an aa sequence that binds to CD137/4-1 BB (e.g., an anti-CD137 scFv or nanobody aa sequence, or a CD137L/4-1 BBL aa sequence), or an aa sequence that binds to TGFp (e.g., an anti ⁇
  • a polypeptide that may be employed as an AD may comprise the 4-1 BBL aa sequence:
  • a polypeptide that may be employed as an AD comprises a trimer of 4-1 BBL aa sequences separated by linker sequences (e.g., linker sequences comprising GGGGS repeats):
  • An AD may comprise, for example, an aa sequence that binds to IL-10 (e.g., an anti-IL-10 scFv or nanobody aa sequence) or an aa sequence that binds to IL-1 OR (e.g., an anti-IL-10R scFv or nanobody aa sequence).
  • IL-10 e.g., an anti-IL-10 scFv or nanobody aa sequence
  • an aa sequence that binds to IL-1 OR e.g., an anti-IL-10R scFv or nanobody aa sequence
  • An AD may comprise, for example, an aa sequence that binds to CD3 (e.g., an anti-CD3 scFv or nanobody aa sequence).
  • An AD may comprise, for example, an aa sequence that binds to CTLA-4 (e.g., an anti-CTLA-4 scFv or nanobody aa sequence).
  • An AD may comprise, for example, an aa sequence that binds to CD28 (e.g., an anti-CD28 scFv or nanobody aa sequence).
  • An anti-CD28 scFv that may be used as an AD may comprise the sequence:
  • an AD may comprise a sequence having at least 90% or at least
  • An AD may also comprise a sequence having at least 96% or at least 98% sequence identity to at least 220 or 230 contiguous aas of SEQ ID NO:89.
  • An AD may comprise, for example, an interferon-y (IFN-y) polypeptide sequence, or an aa sequence that binds to the IFN-y receptor (e.g., an anti-IFN-y receptor scFv or nanobody aa sequence).
  • IFN-y interferon-y
  • a scIFN-y polypeptide that may be employed as an IFN-y AD may comprise the sequence:
  • an AD may comprise a sequence having at least 90% or at least 95% sequence identity with SEQ ID NO:97.
  • An AD may also comprise a sequence having at least 96% or at least 98% sequence identity to at least 220 or 230 contiguous aas of SEQ ID NO:97.
  • An AD may comprise, for example, an aa sequence that binds to CD16 (e.g., an anti-CD16 scFv or nanobody aa sequence).
  • Anti-CD 16 VHH polypeptides that may be employed as an AD may comprise one of:
  • an AD may comprise a sequence having at least 90% or at least 95% sequence identity with SEQ ID NOs:98 or 103.
  • An AD may also comprise a sequence having at least 96% or at least 98% sequence identity to at least 100 or 110 contiguous aas of SEQ ID NOs:98 or 103.
  • ADs do not have to be comprised of an aa sequence, and may, for example, be comprised of nucleic acid sequences.
  • nucleic acid ADs include nucleic acid sequences with CpG repeats (e.g., a CpG oligodeoxynucleotide sequence) or IMT504 (TCATCATTTTGTCATTTTGTCATT (SEQ ID NO:69, see, e.g., Insula et al., 2007 Stem Cells, 25:1047-1054) optionally having 1, 2 or 3 nucleotide substitutions, deletions, or insertions.
  • CpG repeats e.g., a CpG oligodeoxynucleotide sequence
  • IMT504 TCATCATTTTGTCATTTTGTCATT (SEQ ID NO:69, see, e.g., Insula et al., 2007 Stem Cells, 25:1047-1054
  • TCATCATTTTGTCATTTTGTCATT SEQ
  • a tumor-specific binding domain of the constructs described herein is a polypeptide aa sequence that functions as a targeting sequence directing the construct to tumor cells by binding to target molecules expressed on the tumor cell surface.
  • the target molecules may be a tumor-associated antigen (“TAA”) (also referred to herein as a cancer associated antigen or “CAA”) whose cell surface expression is restricted, or substantially restricted, to one or more cancer cell types.
  • TAA tumor-associated antigen
  • CAA cancer associated antigen
  • other molecules present on a tumor cell's surface may be targeted including, but not limited to, cell proteins expressed on normal (non-transformed) cells, which may be upregulated in the tumor cell.
  • Checkpoint proteins (e.g., V-domain Ig suppressor of T cell activation or “VISTA”, T-cell immunoglobulin and mucin domain 3 or “Tim-3”, and Programmed Death Ligand 1 or “PD-L1”), which are expressed on normal and many tumor cells (e.g., transformed tumor cells), may also serve as target molecules for TSBs.
  • Targeting checkpoint proteins which are often upregulated by tumor cells as a means of immune evasion or escape, both offers a target that may be abundantly expressed on the tumor cell’s surface and provides checkpoint inhibition by the TSB. Proteins not substantially restricted to expression on transformed tumor cells are considered as targets of TSBs when expressed on tumor cells.
  • TSBs include, for example, polypeptides and other molecules such as antibodies, antigen binding fragments of an antibody, Fabs, Fab’s, and polypeptides comprising single chain antibody, scFv, peptide aptamer, or nanobody aa sequences.
  • TAAs associated with a solid tumor that may be targeted by TSBs include, but are not limited to: carbonic anhydrase IX (CAIX), cadherins, carcinoembryonic antigen (CEA), cellular- mesenchymal epithelial transition factor (c-MET), Cytotoxic T-Lymphocyte Associated Protein 4 (CTLA-4), Epidermal Growth Factor Receptor (EGFR) family members, Epithelial Cell Adhesion Molecule (EpCAM), Ephrin Type-A Receptor 3 (EphA3), Fibroblast Activation Protein Alpha (FAP), folate-binding protein, Folate Receptor alpha (FR-alpha), Erb-B2 Receptor Tyrosine Kinase 2 (HER2), Erb-B2 Receptor Tyrosine Kinase 3 (HER3), Insulin Like Growth Factor 1 Receptor (IGF- 1 R), integrin aVf>3, integrin a5
  • TAAs associated with a solid tumor that may be targeted by TSBs include, but are not limited to: Cancer/Testis Antigen 1A, Cancer/Testis Antigen 1 B, or Cancer/Testis Antigen 2 (NY-ESO-2, CTAG2), [00124] Some TAAs associated with a solid tumor that may be targeted by TSBs include, but are not limited to: MAGEA-1, MAGEA-4, or MAGEA-9.
  • TAAs associated with a solid tumor that may be targeted by TSBs include, but are not limited to: MAGEC-1 , MAGEC-2, or MAGEC-3.
  • checkpoint proteins that may serve as targets of TSBs include, but are not limited to, VISTA, TIM-3, PD-L1, CTLA-4, and LAG-3.
  • a TSB polypeptide may be an anti-human mesothelin scFv polypeptide related to the murine-derived SS1 antibody, also employed in Amatuximab having the sequence: QVQLQQSGPELEKP GASVKISCKASGYSFTGY TMNWVKQSHGKSLEWIGLITPYNGASSYNQKFRGKATLTVDKSSSTAYMDLLSLTSEDSAVYFCARGGYD G-RGFDYWGSGTFVTVSSGXGGSGGGGSGGGGSDIELTQSPAIMSASPGEKvVTMTCSASSSVSYMHWYQQK SGTSPKRWIYDTSKLASGVPGRFSGSGSGNSYSLTISSVEAEDDATYYCQQWSKHPLTFGSGTKVEIK, where X is V or G (SEQ ID NO:70).
  • the TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence.
  • a TSB polypeptide may comprise an anti-human mesothelin scFv (vH-vL) polypeptide related to the monoclonal antibody YP218, having the sequence: QEQLVE SGGGLVQP GASLTLTCTASGIDFSRYYMCWVRQ APGKGLEGIACIYIGGSGSTYYASWAKGRFTISKASSTTVTLQMTSLTAADTATYFCARGTNLNYIFRLW GPGTLVTVSSGXGGSGGGGSGGGGSDWMTQTPASVSEPVGGTVTIKCQASQRISSYLSWYQQKPGQRPK LLIFGASTLASGVPSRFKGSGSGTEYTLTISDLECADAATYYCQSYAYFDSNNWHAFGGGTEVW, Where X is V or G (SEQ ID NO:71).
  • the TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence.
  • the TSB polypeptide may comprise an aa sequence
  • a TSB polypeptide may comprise an anti-human mesothelin scFv (vL-vH) polypeptide related to the monoclonal antibody YP218, having the sequence: DVVMTQTPASVSEPVGGTVT IKCQASQRIS SYLSWYQQK PGQRPKLLIFGASTLASGVPSRFKGSGSGTEYTLTISDLECADAATYYCQSYAYFDSNNWHAFGGGTEVV VGXGGSGGGGSGGGGSQEQLVESGGGLVQPGASLTLTCTASGIDFSRYYMCWVRQAPGKGLEGIACIYIG GSGSTYYASWAKGRFTISKASSTTVTLQMTSLTAADTATYFCARGTNLNYIFRLWGPGTLVTVSS, Where X is V or G (SEQ ID NO:72).
  • the TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence.
  • the TSB polypeptide may comprise an a
  • a TSB polypeptide may comprise an anti-human mesothelin scFv (vH-vL) polypeptide related to the monoclonal antibody 15B6, having the sequence: EVQLQQSGPVLVKPGASVKI SCKASGYSFTGYYMHWVRQS NGKSLEWIGRINPYTGVPSYKHNFKDKASLTVDKSSSTAYMELHSLTSEDSAVYYCARELGGYWGQGTTL TVSSGXGGSGGGGSGGGGSQAWTQESALTTSPGETVTLTCRSSTGAVTTGNYPNWVQEKPDHLFTGLIA GTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWFSSHWVFGGGTKLTVLG, Where X is V Or G (SEQ ID NO:73).
  • the TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence.
  • the TSB polypeptide may comprise an a
  • a TSB polypeptide may comprise an anti-human mesothelin scFv (vL-vH) polypeptide related to the monoclonal antibody 15B6, having the sequence: PDHLFTGLIAGTNNRAPGVPARFSGSLI GDKAALTI TGAQ TEDEAIYFCALWFSSHWVFGGGTKLTVLGGXGGSGGGGSGGGGSEVQLQQSGPVLVKPGASVKISCKASG YSFTGYYMHWVRQSNGKSLEWIGRINPYTGVPSYKHNFKDKASLTVDKSSSTAYMELHSLTSEDSAVYYC ARELGGYWGQGTTLTVSS, where X is V or G (SEQ ID NO:74).
  • the TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence.
  • the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence
  • a TSB polypeptide may comprise an anti-human mesothelin scFv (vL-vH) polypeptide related to the monoclonal antibody 15B6 with a disulfide linkage between the vL and vH positions G102C and K43C (K168C as shown), having the sequence: QAVVTQE SALTTSPGETVTLTCRSSTGAVTTGNYPNWVQEKPDHLFTGL IA GTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALVJFSSHWVFGCGFKLTVLGGGGGSGGGGSG GGGSEVQLQQSGPVLVKPGASVKISCKASGYSFTGYYMHWVRQSNGCSLEWIGRINPYTGVPSYKHNFKD KASLTVDKSSSTAYMELHSLTSEDSAVYYCARELGGYWGQGTTLTVSS (SEQ ID NO75).
  • the TSB polypeptide may also comprise an aa sequence having greater than
  • a TSB polypeptide may comprise an anti-human mesothelin scFv (vL-vH) polypeptide related to the monoclonal antibody 15B6 with a disulfide linkage between the vL and vH positions G102C and S44C (S169C as shown), having the sequence: QAVVTQE SALTTSPGETVTLTCRSSTGAVTTGNYPNWVQEKPDHLFTGL IA GTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWFSSHWVFGCGTKLTVLGGGGGSGGGGSG GGGSEVQLQQSGPVLVKPGASVKISCKASGYSFTGYYMHWVRQSNGKCLEWIGRINPYTGVPSYKHNFKD KASLTVDKSSSTAYMELHSLTSEDSAVYYCARELGGYWGQGTTLTVSS (SEQ ID NO76).
  • the TSB polypeptide may also comprise an aa sequence having greater than 90%
  • a TSB polypeptide may comprise an anti-human mesothelin scFv (vL-vH) polypeptide related to the monoclonal antibody 15B6 with a disulfide linkage between the vL and vH positions G103C and K43C (K168C as shown), having the sequence: QAVVTQE SALTTSPGETVTLTCRSSTGAVTTGNYPNWVQEKPDHLFTGL IA GTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWFSSHWVFGGCTKLTVLGGGGGSGGGGSG GGGSEVQLQQSGPVLVKPGASVKISCKASGYSFTGYYMHWVRQSNGCSLEWIGRINPYTGVPSYKHNFKD KASLTVDKSSSTAYMELHSLTSEDSAVYYCARELGGYWGQGTTLTVSS (SEQ ID NO77).
  • the TSB polypeptide may also comprise an aa sequence having greater than 90%
  • a TSB polypeptide may comprise an anti-human mesothelin scFv (vL-vH) polypeptide related to the monoclonal antibody 15B6 with a disulfide linkage between the vL and vH positions G103C and S44C (S169C as shown), having the sequence: QAVVTQE SALTTSPGETVTLTCRSSTGAVTTGNYPNWVQEKPDHLFTGL IA GTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWFSSHWVFGGCTKLTVLGGGGGSGGGGSG GGGSEVQLQQSGPVLVKPGASVKISCKASGYSFTGYYMHWVRQSNGKCLEWIGRINPYTGVPSYKHNFKD KASLTVDKSSSTAYMELHSLTSEDSAVYYCARELGGYWGQGTTLTVSS (SEQ ID NO78).
  • the TSB polypeptide may also comprise an aa sequence having greater than 90%
  • a TSB binder polypeptide may comprise an anti-human mesothelin (VHH) polypeptide related to the monoclonal antibody SD1, having the sequence: QVQLVQSGGGLVQP GGSLRLSCAASDFDFAAYEMSWVRQA PGQGLEWVAI ISHDGIDKYYTDSVKGRFT ISRDNSKNTLYLQMNTLRAEDTATYYCLRLGAVGQGTLVTV sss (SEQ ID NO:79).
  • the TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence.
  • the TSB polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
  • a TSB polypeptide may comprise an anti-human EpCAM scFv (vH-vL) polypeptide related to the monoclonal antibody MT201 and Adecatumumab, having the sequence: EVQLLESGGGWQPGRSLRLSCAASG FTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC AKDMGWGSGWRPYYYYGMDVWGQGTTVTVSSGXGGSGGGGSGGGGSELQMTQSPSSLSASVGDRVTITCR TSQSI SSYLNWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYDI PYTFGQGTKLE IKRTV, where X is V or G (SEQ ID NO:80).
  • the TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 9
  • a TSB polypeptide may comprise an anti-human EpCAM scFv (vL-vH) polypeptide related to the monoclonal antibody MT201 and Adecatumumab, having the sequence: ELQMTQSP SSLSASVGDRVT ITCRTS QSISSYLNWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYDIPY TFGQGTKLEIKRTVGXGGSGGGGSGGGGSEVQLLESGGGWQPGRSLRLSCAASGFTFSSYGMHWVRQAP GKGLEWVAVISYDGSNKYYADSVKGRFTI SRDNSKNTLYLQMNSLRAEDTAVYYCAKDMGWGSGWRPYYYY YGMDVWGQGTTVTVS S, where X is V or G (SEQ ID NO:81).
  • the TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence
  • a TSB polypeptide may comprise an anti-human CTLA-4 scFv (vL-vH) polypeptide related to Ipilimumab, having the sequence: E IVLTQSP GTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRAT GIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVE IKRGGGGSGGGGSGGGGSQVQ LVESGGGWQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTF ISYDGNNKYYADSVKGRFTISRD NSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSS (SEQ ID NO:82).
  • the TSB polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence.
  • the TSB polypeptide may comprise an aa sequence having greater than 96% or greater
  • a TSB polypeptide may comprise an anti-human CTLA-4 scFv (vL-vH) polypeptide related to Ipilimumab with a disulfide linkage between the vL and vH positions Q101C and K43C (K167C as shown), having the sequence: EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGT DFTLT ISRLEFEDFAVYYCQQYGSSFWTFGCGTKVEZKRGGGGSGGGGSGGGGSQVQLVESGGGVVQPGR SLRLSCAASGFTFSSYTMHWVRQAPGCGLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSL AEDTAIYYCARTGWLGPFDYWGQGTLVTVS S (SEQ ID NO:83).
  • the TSB polypeptide may also comprise an aa sequence having greater than 90% or
  • a TSB polypeptide may comprise an anti-human CTLA-4 scFv (vL-vH) polypeptide related to Ipilimumab with a disulfide linkage between the vL and vH positions Q101C and G44C (G167C as shown), having the sequence: IVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIEPDRFSGSGSGT DFTLT ISRLEPEDFAVYYCQQYGSSPWTFGCGTKVEIKRGGGGSGGGGSGGGGSQVQLVESGGGVVQPGR SLRLSCAASGFTFSSYTMHWVRQAPGKCLEWVTFISYDGNNKYYADSVKGRFT ISRDNSKNTLYLQMNSL RAEDTAIYYCARTGWLGPFDYWGQGTLVTVS S (SEQ ID NO:84).
  • the TSB polypeptide may also comprise an aa sequence having greater than 90%
  • a TSB polypeptide may comprise an anti-human CTLA-4 scFv (vL-vH) polypeptide related to Ipilimumab with a disulfide linkage between the vL and vH positions G102C and K43C (K167C as shown), having the sequence: E IVLTQSPGTLSLSP GERATLSCRASQSVGS SYLAWYQQKPGQAPRLLIYGAF SRATGIPDRF SGSGSGT DFTLT ISRLEPEDFAVYYCQQYGSSPWTFGQCTKVEIKRGGGGSGGGGSGGGGSQVQLVESGGGVVQPGR SLRLSCAASGFTFSSYTMHWVRQAPGCGLEWVTFISYDGNNKYYADSVKGRFT ISRDNSKNTLYLQMNSL RAEDTAIYYCARTGWLGPFDYWGQGTLVTVS S (SEQ ID NO:85).
  • the tumor-specific binder polypeptide may also comprise an aa sequence having greater than 90% or greater than 95% sequence identity to that sequence.
  • the tumor-specific binder polypeptide may comprise an aa sequence having greater than 96% or greater than 98% sequence identity to that sequence.
  • a TSB polypeptide may comprise an anti-human CTLA-4 scFv (vL-vH) polypeptide related to Ipilimumab with a disulfide linkage between the vL and vH positions G102C and G44C (G168C as shown), having the sequence: EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGT DFTLT ISRLEPEDFAVYYCQQYGSSPWTFGQCTKVEIKRGGGGSGGGGSGGGGSQVQLVESGGGVVQPGR SLRLSCAASGFTFSSYTMHWVRQAPGKCLEWVTFISYDGNNKYYADSVKGRFT ISRDNSKNTLYLQMNSL RAEDTAIYYCARTGWLGPFDYWGQGTLVTVS S (SEQ ID NO:86).
  • the TSB polypeptide may also comprise an aa sequence having greater than
  • the present disclosure includes and provides for the preparation of the constructs disclosed herein by transcription and translation of nucleic acids encoding the constructs in mammalian cells (CHO cells), yeast cells (e.g. , pica pastoris), sodoptera cells, or bacterial cells (e.g., E. coli cells). Portions of the constructs may also be prepared separately, such as by cellular expression as discussed above, chemical synthesis, etc., and then conjugated together using one or more chemical or enzymatic processes. Indeed, enzymatic means, self-catalyzed protein splicing, or chemical crosslinking (e.g., with a heterobifunctional crosslinker) can be used to couple (e.g.
  • enzymatic means and self-catalyzed protein splicing represent coupling options that permit both the stoichiometry and structure of the coupling reaction, while substantially avoiding potential secondary coupling reactions.
  • sortases and split inteins may be utilized to append a sequence comprising a NBD to an AD, a TSB binder, or an immune cell engager.
  • the enzyme catalyzed SpyTag/SpyCatcher system which may employ the CnaB2 domain of the FbaB protein from Streptococcus pyogenes, can be utilized for conjugating an AD to a polypeptide comprising a NBD. See, e.g., Reddington and Howarth, Curr. Opin in Chem. Biol., 29: 94—99 (2015).
  • the AD is not an aa sequence that can be translated in a biological system (e.g., it is a nucleic acid such as a CpG oligodeoxynucleotide), it may be coupled to the other portions of the molecule using, for example, bifunctional crosslinkers (e.g., homobifunctional or heterobifunctional crosslinkers).
  • bifunctional crosslinkers e.g., homobifunctional or heterobifunctional crosslinkers.
  • the constructs may be purified using a variety of methods known in the art. For example, where the construct comprises an IgFc region as a scaffold, it may be purified by protein A or protein G chromatography. The constructs may be purified by nucleotide affinity chromatography or dye-ligand affinity chromatography using Cibacron Blue F3GA, Procion Blue HB, or Reactive blue 2 as affinity ligands. Size exclusion chromatography may also be used alone or in combination with affinity chromatography to purify the products.
  • NBD-containing constructs and complexes disclosed herein may be formulated into compositions comprising pharmaceutically acceptable components.
  • compositions may be prepared for parenteral and/or other forms of administration.
  • the constructs or compositions comprising the constructs may be administered by any suitable route, such as intravenously, intramuscularly, subcutaneously, intratumorally, or intralymphatically.
  • the constructs may also be administered in conjunction with one or more other agents that act synergistically or non-synergistically with the constructs.
  • constructs of the present disclosure may be administered with immune checkpoint inhibitors such as Pembrolizumab (Keytruda®, targeting PD-1), Avelumab (Bavencio®, targeting PD-L1), or Ipilimumab (Yervoy®, targeting CTLA-4).
  • immune checkpoint inhibitors such as Pembrolizumab (Keytruda®, targeting PD-1), Avelumab (Bavencio®, targeting PD-L1), or Ipilimumab (Yervoy®, targeting CTLA-4).
  • Any solid tumor that contains elevated levels of ATP relative to normal tissue may be treated utilizing the constructs of the present disclosure. Treatable tumors include mesotheliomas, melanomas, sarcomas, carcinomas, carcinosarcomas, lymphomas, and germ cell tumors.
  • carcinomas include, but are not limited to, colorectal carcinoma, breast carcinoma, neuroendocrine tumors, lung carcinoma, and gastric carcinoma.
  • the tumors may be lung, liver, skin, gastrointestinal, pancreatic, brain, or reproductive tissue (e.g., ovarian sarcomas) tumors.
  • a polypeptide construct comprising a nucleotide binding domain (NBD) amino acid (aa) sequence, and an activating domain (AD) aa sequence, optionally joined by a linker peptide sequence; wherein the NBD comprises one or more adenosine triphosphate (ATP) binding sites and can homodimerize or heterodimerize with a cognate non-identical NBD in the presence of ATP (e.g., the NBD of TAP1 or TAP2 which can heterodimerize).
  • NBD nucleotide binding domain
  • AD activating domain
  • polypeptide construct of aspect 1 wherein the construct is organized in the N-terminal to C-terminal direction as (i) NBD, optional linker, and AD aa sequences, or (ii) AD, optional linker, and NBD aa sequences.
  • polypeptide construct of aspect 1 or 2 comprising a NBD aa sequence, scaffold aa sequence, and AD sequence optionally joined by independently selected linker aa sequences.
  • polypeptide construct of aspect 3 wherein the construct comprises in the N-terminal to C-terminal direction the NBD, scaffold, and AD aa sequences.
  • polypeptide construct of aspect 3 wherein the construct comprises in the N-terminal to C-terminal direction the NBD, AD, and scaffold aa sequences.
  • polypeptide construct of aspect 3 wherein the construct comprises in the N-terminal to C-terminal direction, the AD, scaffold, and NBD aa sequences.
  • polypeptide construct of aspect 3 wherein the construct comprises in the N-terminal to C-terminal direction, the AD, NBD, and scaffold aa sequences.
  • polypeptide construct of aspect 3 wherein the construct comprises in the N-terminal to C-terminal direction, the scaffold, AD, and NBD aa sequences.
  • polypeptide construct of aspect 3 wherein the construct comprises in the N-terminal to C-terminal direction, the scaffold, NBD, and AD aa sequences.
  • polypeptide construct of any one of aspects 1-9 comprising two or more (e.g., three or more) independently selected AD aa sequences, wherein the AD aa sequences are optionally placed in tandem.
  • polypeptide construct of any one of aspects 1-10 comprising two or more (e.g., three or more) independently selected NBD aa sequences, optionally placed in tandem (constrained so that no two NBDs within the same molecule can interact to form a complex in the presence of ATP).
  • polypeptide construct of aspect 11 further comprising a rigid linker that substantially prevents interactions between the two or more NBD aa sequences in the presence of ATP.
  • a composition comprising a first polypeptide construct and a second polypeptide construct of any of aspects 13- 18, wherein the first polypeptide construct comprises a first NBD aa sequence and the second polypeptide construct comprises a second NBD aa sequence, and the first and second NBD aa sequences are cognate sequences that may homodimerize or heterodimerize in the presence of ATP to form a homodimer or heterodimer complex.
  • a composition comprising the first polypeptide construct and the second polypeptide construct of aspect 19, wherein the first polypeptide construct comprises one or more (e.g., two or more) first NBD aa sequences and the second polypeptide construct comprises one or more (e.g., two or more) second NBD aa sequences, and the first and second NBD aa sequences are cognate sequences that may homodimerize or heterodimerize in the presence of ATP to form a homodimer, heterodimer or higher order complex. See, e.g., FIG.
  • each construct comprises a NBD (e.g., a single NBD) aa sequence
  • FIG. 4A at B wherein at least one of the first and second (e.g., both) constructs comprises two or more NBD aa sequences.
  • a polypeptide construct comprising a nucleotide binding domain (NBD) amino acid (aa) sequence, and tumorspecific binder (TSB) aa sequence, optionally joined by a linker peptide sequence wherein: the NBD comprises one or more adenosine triphosphate (ATP) binding sites and can homodimerize or heterodimerize with a cognate non-identical NBD in the presence of ATP (e.g., the NBD of TAP1 or TAP2 which can heterodimerize); and wherein the polypeptide construct optionally comprises one or more ADs.
  • NBD nucleotide binding domain
  • TBS tumorspecific binder
  • the polypeptide construct of aspect 21 wherein the construct is organized in the N-terminal to C-terminal direction as (i) NBD, optional linker, and TSB aa sequences, or (ii) TSB, optional linker, and NBD aa sequences.
  • the polypeptide construct of aspect 23 wherein the construct comprises in the N-terminal to C-terminal direction the NBD, scaffold, and TSB aa sequences.
  • the polypeptide construct of aspect 31 further comprising a rigid linker that substantially prevents interactions between the two or more NBD aa sequences in the presence of ATP.
  • polypeptide construct of aspect 31 or 32 comprising two or more NBD aa sequences that may homodimerize to form a dimer or higher order complex of the construct in the presence of ATP. See, e.g., FIG. 4A at C.
  • the polypeptide construct of aspect 37 wherein the construct comprises a NBD (e.g., a single NBD) aa sequence, or one or more (e.g., two or more) NBD aa sequences.
  • a composition comprising a first polypeptide construct and a second polypeptide construct of any of aspects 33- 38, wherein the first polypeptide construct comprises a first NBD aa sequence and the second polypeptide construct comprises a second NBD aa sequence, and the first and the second NBD aa sequences are cognate sequences that may homodimerize or heterodimerize in the presence of ATP to form a homodimer or heterodimer complex.
  • a composition comprising the first polypeptide construct and the second polypeptide construct of aspect 39, wherein the first polypeptide construct comprises one or more (e.g., two or more) first NBD aa sequences and the second polypeptide construct comprise one or more (e.g., two or more) second NBD aa sequences, and the first and second NBD aa sequences are cognate sequences that may homodimerize or heterodimerize in the presence of ATP to form a homodimer or heterodimer or higher order complex.
  • TSB of the first polypeptide construct and the TSB of the second polypeptide construct recognize a single tumor-associated antigen (TAA) or different (non-identical) TAAs.
  • a polypeptide construct comprising a nucleotide binding domain (NBD) amino acid (aa) sequence, and an immune cell engager (ICE) aa sequence, optionally joined by a linker peptide sequence wherein: the NBD comprises one or more adenosine triphosphate (ATP) binding sites and can homodimerize or heterodimerize with a cognate non-identical NBD in the presence of ATP (e.g., the NBD of TAP1 or TAP2 which can heterodimerize); and wherein the polypeptide construct optionally comprises one or more ADs.
  • NBD nucleotide binding domain
  • ICE immune cell engager
  • the polypeptide construct of aspect 42 wherein the construct is organized in the N-terminal to C-terminal direction as (i) NBD, optional linker, and ICE aa sequences, or (ii) ICE, optional linker, and NBD aa sequences.
  • the polypeptide construct of aspect 42 or 43 comprising a NBD aa sequence, scaffold aa sequence, and ICE aa sequence optionally joined independently by selected linker aa sequences.
  • the polypeptide construct of aspect 43 wherein the construct comprises in the N-terminal to C-terminal direction the NBD, scaffold, and ICE aa sequences.
  • the polypeptide construct of aspect 43 wherein the construct comprises in the N-terminal to C-terminal direction the NBD, ICE, and scaffold aa sequences.
  • the polypeptide construct of aspect 43 wherein the construct comprises in the N-terminal to C-terminal direction, the ICE, scaffold, and NBD aa sequences.
  • the polypeptide construct of aspect 43 wherein the construct comprises in the N-terminal to C-terminal direction, the ICE, NBD, and scaffold aa sequences.
  • the polypeptide construct of aspect 43 wherein the construct comprises in the N-terminal to C-terminal direction, the scaffold, NBD, and ICE aa sequences.
  • the polypeptide construct of any one of aspects 42-50 comprising two or more (e.g., three or more) independently selected ICE aa sequences, wherein the ICE aa sequences are optionally placed in tandem.
  • the polypeptide construct of any one of aspects 42-51 comprising two or more (e.g., three or more) independently selected NBD aa sequences, optionally placed in tandem (constrained so that no two NBDs within the same molecule can interact to form a complex in the presence of ATP).
  • the polypeptide construct of aspect 52 further comprising a rigid linker that substantially prevent interactions between the two or more NBD aa sequences in the presence of ATP.
  • the polypeptide construct of aspect 53 or 54 comprising two or more NBD aa sequences that may homodimerize to form a dimer or higher order complex of the construct in the presence of ATP.
  • a composition comprising a first polypeptide construct and a second polypeptide construct of aspect 58, wherein the construct comprises a first NBD aa sequence and a second polypeptide construct comprise a second NBD aa sequence, and the first and the second NBD aa sequences are cognate sequences that may heterodimerize in the presence of ATP to form a heterodimer complex.
  • a composition comprising the first polypeptide construct and the second polypeptide construct of aspect 59, wherein the first polypeptide construct comprises one or more (e.g., two or more) first NBD aa sequences and the second polypeptide construct comprise one or more (e.g., two or more) second NBD aa sequences, and the first and second NBD aa sequences are cognate sequences that may heterodimerize in the presence of ATP to form a heterodimer or higher order complex.
  • a composition comprising a first polypeptide construct of any one of aspects 1-18, and a second polypeptide construct of any one of aspects 42-58, wherein:
  • the first polypeptide construct comprises one or more (e.g., two or more) first heterodimerizing NBD aa sequences and the second polypeptide construct comprises one or more (e.g., two or more) second heterodimerizing NBD aa sequences;
  • each of the one or more first heterodimerizing NBD aa sequences are cognate binding partners of the one or more second heterodimerizing NBD aa sequences;
  • the first polypeptide construct and the second polypeptide construct bind to each other through interactions between at least one of the one or more first heterodimerizing NBD aa sequences and at least one of the one or more second heterodimerizing NBD sequences in the presence of ATP to form a heterodimer or higher order complex of the first and second polypeptide constructs.
  • composition of aspect 62 wherein the first polypeptide construct comprises two or more first heterodimerizing NBDs, and the second polypeptide construct comprises a single heterodimerizing NBD. See, e.g., FIG. 3 at K where the NBDs are in tandem.
  • compositions of any one of aspects 62-66, wherein the first and/or second polypeptide construct comprises a scaffold sequence A composition comprising a first polypeptide construct of any one of aspects 21-38, and a second polypeptide construct of any one of aspects 1-18, wherein:
  • the first polypeptide construct comprises one or more (e g., two or more) first heterodimerizing NBD aa sequences and the second polypeptide construct comprises one or more (e.g., two or more) second heterodimerizing NBD aa sequences;
  • each of the one or more first heterodimerizing NBD aa sequences are cognate binding partners of the one or more second heterodimerizing NBD aa sequences;
  • the first polypeptide construct and the second polypeptide construct bind to each other through interactions between at least one of the one or more first heterodimerizing NBD aa sequences and at least one of the one or more second heterodimerizing NBD sequences in the presence of ATP to form a heterodimer or higher order complex of the first and second polypeptide constructs.
  • the composition of aspect 68 wherein the first polypeptide construct comprises two or more first heterodimerizing NBDs, and the second polypeptide construct comprises a single heterodimerizing NBD. See, e.g., FIG. 3 at B where the NBDs are in tandem, and N and 0 where the NBDs are not in tandem.
  • composition of any one of aspects 62-66, wherein the first and/or second polypeptide construct comprises a scaffold sequence.
  • a composition comprising a first polypeptide construct of any of aspects 21-38, and a second polypeptide construct of any of aspects 42-58, wherein:
  • the first polypeptide construct comprises one or more (e.g., two or more) first heterodimerizing NBD aa sequences and the second polypeptide construct comprises one or more (e.g., two or more) second heterodimerizing NBD aa sequences;
  • each of the one or more first heterodimerizing NBD aa sequences are cognate binding partners of the one or more second heterodimerizing NBD aa sequences;
  • the first polypeptide construct and the second polypeptide construct bind to each other through interactions between at least one of the one or more first heterodimerizing NBD aa sequences and at least one of the one or more second heterodimerizing NBD sequences in the presence of ATP to form a heterodimer or higher order complex of the first and second polypeptide constructs.
  • the composition of aspect 74 wherein the first polypeptide construct comprises two or more first heterodimerizing NBDs, and the second complex comprises a single heterodimerizing NBD. See, e.g., FIG. 3 at M, F, G, and L, wherein the NBDs are in tandem, and N and 0 where the NBDs are not in tandem.
  • composition of any one of aspects 62-79, wherein the first and/or second polypeptide construct comprises an independently selected scaffold.
  • polypeptide construct or composition of any one of aspects 80-82 wherein at least one scaffold (e.g., each scaffold present) does not comprise an immunoglobulin polypeptide aa sequence (e.g., it does not comprise an immunoglobulin Fc, CHi, CH2, or CH3 domain).
  • polypeptide construct or composition of aspect 84 wherein at least one (e.g., each) scaffold comprises an independently selected immunoglobulin polypeptide aa sequence of an lgG1 IgFc of SEQ ID NO:56 or 57, or a sequence having at least 90% or at least 95% sequence identity to SEQ ID NO:56 or 57.
  • the polypeptide construct or composition of aspect 84, wherein the at least one (e.g., each) scaffold comprises an independently selected non-dimerizing IgFc polypeptide aa sequence.
  • the polypeptide construct or composition of aspect 86 wherein the at least one (e.g., each) scaffold comprises the IgFc polypeptide aa sequence of SEQ ID NO: 102, or a sequence having at least 90% or at least 95% sequence identity to SEQ ID NQ:102.
  • antibody related effector functions e.g., ADCC, ADCP, and/or GDC
  • the IgFc polypeptide sequence comprises one or more substitutions that enhance (e.g., substantially enhance) at least one (e.g., all) antibody related effector function selected from ADCC, ADCP, and CDC. Changes in function may be assessed relative to the polypeptide construct lacking the one or more substitutions.
  • each AD comprises an aa sequence of all or part of the polypeptides of: CD40L, CD28, 1 FN-y, TNF superfamily members, TNF, lymphotoxin a, lymphotoxin a(3, BAFF (CD25), B7 superfamily members, CD80, CD86, IL-15, IL-2, IL-7, IL-10, IL-12, PD1, anti-CD3, anti-CTLA4, anti-CD28.
  • the at least one (e.g., each) AD comprises the (I) single chain IL-12 of SEQ ID NQ:90, or (ii) the IL-12 p40 subunit of SEQ ID NO:91 and/or the p35 subunit of SEQ ID NO:92, or an aa sequence having greater than 95% or greater than 98% sequence identity to any of those IL-12 sequences.
  • each AD comprises an aa sequence that binds to PD1 (e.g., an anti-PD 1 scFv or nanobody aa sequence that may act as an agonist of RD 1 ) or an aa sequence that binds to PDL1 (e.g., an anti- PDL1 scFv or nanobody aa sequence).
  • PD1 e.g., an anti-PD 1 scFv or nanobody aa sequence that may act as an agonist of RD 1
  • PDL1 e.g., an anti- PDL1 scFv or nanobody aa sequence
  • each AD comprises an aa sequence that binds to CD40 (e.g., an anti-CD40 scFv or nanobody aa sequence that may act as an agonist of CD40 signaling) or an aa sequence that binds to CD40L (e.g., an anti-CD40L scFv or nanobody aa sequence).
  • CD40 e.g., an anti-CD40 scFv or nanobody aa sequence that may act as an agonist of CD40 signaling
  • CD40L e.g., an anti-CD40L scFv or nanobody aa sequence
  • the at least one (e.g., each) AD comprises the CD40L aa sequence of SEQ ID NO:96, the CD40L trimer aa sequence of SEQ ID NO:95, or an aa sequence having at least 90% or at least 95% sequence identity to either SEQ ID NO:95 or 96 (e.g., greater than 97% or greater than 99% sequence identity to either SEQ ID NO:95 or 96).
  • each AD comprises an aa sequence that binds to CD137/4-1 BB (e.g., an anti- CD137 scFv or nanobody aa sequence) or an aa sequence that binds to TGF
  • CD137/4-1 BB e.g., an anti- CD137 scFv or nanobody aa sequence
  • 3 e.g., an anti-TGFp scFv or nanobody aa sequence
  • the polypeptide construct or composition of aspect 97 wherein the at least one (e.g., each) AD comprises the 4-1 BBL sequence of SEQ ID NO:94, the 4-1 BBL trimer aa sequence of SEQ ID NO:93, or an aa sequence having at least 90% or at least 95% sequence identity to either SEQ ID NO:93 or 94 (e.g., greater than 97% or greater than 99% sequence identity to either SEQ ID NO:93 or 94).
  • each AD comprises an aa sequence that binds to IL-10 (e.g , an anti-IL-10 scFv or nanobody aa sequence) or an aa sequence that binds to the IL-10 receptor ("IL-1 OR”) (e.g., an anti-IL-10R scFv or nanobody aa sequence).
  • IL-10 e.g , an anti-IL-10 scFv or nanobody aa sequence
  • IL-1 OR e.g., an anti-IL-10R scFv or nanobody aa sequence
  • polypeptide construct or composition of any preceding aspect wherein, when one or more ADs are present, at least one (e.g., each) AD comprises an aa sequence that binds to CTLA-4 (e.g., an anti-CTLA-4 scFv or nanobody aa sequence).
  • CTLA-4 e.g., an anti-CTLA-4 scFv or nanobody aa sequence
  • at least one (e.g., each) AD comprises an aa sequence that binds to CD3 (e g., an anti-CD3 scFv or nanobody aa sequence).
  • each AD comprises an aa sequence that binds to CD28 (e.g., an anti-CD28 scFv or nanobody aa sequence).
  • the polypeptide construct or composition of aspect 102 wherein the at least one (e.g., each) AD comprises the anti-CD28 scFv sequence of SEQ ID NO:89, or an aa sequence having at least 90% or at least 95% sequence identity to SEQ ID NO:89 (e.g., greater than 96% or greater than 99% sequence identity to SEQ ID NO:89)
  • the polypeptide construct or composition of any preceding aspect wherein, when one or more ADs are present, at least one (e.g., each) AD comprises an aa sequence that binds to IFN-y receptor (e.g., an anti-IFN-y receptor scFv or nanobody aa sequence).
  • the polypeptide construct or composition of aspect 104 wherein the at least one (e.g., each) AD comprises the scIFN-y polypeptide of SEQ ID NO:97, or an aa sequence having at least 90% or at least 95% sequence identity to SEQ ID NO:97 (e.g., greater than 96% or greater than 99% sequence identity to SEQ ID NO:97).
  • the polypeptide construct or composition of any preceding aspect wherein, when one or more ADs are present, at least one (e.g., each) AD comprises an aa sequence that binds to CD16 (e.g., an anti-CD16 scFv or nanobody aa sequence).
  • the polypeptide construct or composition of aspect 106 wherein the at least one (e.g., each) AD comprises the anti-CD16 VHH polypeptide of SEQ ID NO:98 or 103, or an aa sequence having at least 90% or at least 95% sequence identity to either SEQ ID NO:98 or 103 (e.g., greater than 96% or greater than 99% sequence identity to either SEQ ID NO:98 or 103).
  • each AD comprises the CD80 aa sequence of SEQ ID NO:99, or an aa sequence having at least 90% or at least 95% sequence identity to SEQ ID NO:99 (e.g., greater than 96% or greater than 99% sequence identity to SEQ ID NO:99).
  • the polypeptide construct or composition of any preceding aspect wherein, when one or more ADs are present, at least one (e.g., each) AD comprises the CD86 aa sequence of either SEQ ID NO: 100 or 101 , or an aa sequence having at least 90% or at least 95% sequence identity to either SEQ ID NQ:100 or 101 (e.g., greater than 96% or greater than 99% sequence identity to either SEQ ID NQ:100 or 101).
  • at least one (e.g., each) AD comprises a nucleic acid with CpG repeats (e.g., a CpG oligodeoxynucleotide sequence).
  • each AD comprises a nucleic acid comprising the sequence TCATCATTTTGTCATTTTGTCATT (SEQ ID NO:69) optionally having 1, 2 or 3 nucleotide substitutions, deletions, or insertions.
  • TSBs when one or more (e.g., two or more) TSBs are present in the construct or composition at least one (e.g., at least two, or each) TSB is independently selected to display affinity for a TAA selected from the group consisting of: carbonic anhydrase IX (CAIX), cadherins, carcinoembryonic antigen (CEA), cellular-mesenchymal epithelial transition factor (c- MET), Cytotoxic T-Lymphocyte Associated Protein 4 (CTLA-4), Epidermal Growth Factor Receptor (EGFR) family members, Epithelial Cell Adhesion Molecule (EpCAM), Ephrin Type-A Receptor 3 (EphA3), Fibroblast Activation Protein Alpha (FAP), folate-binding protein, Folate Receptor alpha (FR-alpha), Erb-B2 Receptor Tyrosine Kinase 2 (HER2), Erb-B
  • TAA selected from the group consisting of
  • the polypeptide construct or composition of aspect 112 wherein the at least one (e.g., at least two, or each) TSB comprises an anti-human mesothelin scFv of SEQ ID NO:70 or an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NOVO (e.g , greater than 96% or greater than 98% sequence identity to SEQ ID NOVO)
  • polypeptide construct or composition of any one of aspects 112-114 wherein the at least one (e.g., at least two, or each) TSB comprises an anti-human mesothelin scFv (vL-vH) of SEQ ID NOV2 or an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NOV2 (e.g , greater than 96% or greater than 98% sequence identity to SEQ ID NOV2).
  • the at least one e.g., at least two, or each
  • TSB comprises an anti-human mesothelin scFv (vL-vH) of SEQ ID NOV2 or an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NOV2 (e.g , greater than 96% or greater than 98% sequence identity to SEQ ID NOV2).
  • polypeptide construct or composition of any one of aspects 112-115 wherein the at least one (e.g., at least two, or each) TSB comprises an anti-human mesothelin scFv (vH-vL) of SEQ ID NOV3 or an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NOV3 (e.g., greater than 96% or greater than 98% sequence identity to SEQ ID NOV3).
  • the at least one (e.g., at least two, or each) TSB comprises an anti-human mesothelin scFv (vH-vL) of SEQ ID NOV3 or an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NOV3 (e.g., greater than 96% or greater than 98% sequence identity to SEQ ID NOV3).
  • the at least one e.g., at least two, or each
  • TSB comprises an anti-human mesothelin VHH (nanobody) of SEQ ID NO V9, or an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:79 (e.g., greater than 96% or greater than 98% sequence identity to SEQ ID NOV9).
  • TSB comprises an anti-human EpCAM scFv (vH-vL) of SEQ ID NQ:80 or an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NQ:80 (e.g., greater than 96% or greater than 98% sequence identity to SEQ ID NQ:80).
  • any one of aspects 112-120 wherein the at least one (e.g., at least two, or each) TSB comprises an anti-human EpCAM scFv (vL- vH) of SEQ ID NO:81 or an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:81 (e.g., greater than 96% or greater than 98% sequence identity to SEQ ID NO:81).
  • the at least one e.g., at least two, or each
  • TSB comprises an anti-human EpCAM scFv (vL- vH) of SEQ ID NO:81 or an aa sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:81 (e.g., greater than 96% or greater than 98% sequence identity to SEQ ID NO:81).
  • the polypeptide construct or composition of any one of aspects 112-121 wherein the at least one (e.g., at least two, or each) TSB comprises an anti-human CTLA-4 scFv (vL-vH) of any of SEQ ID NOs:82-86 or an aa sequence having greater than 90% or greater than 95% sequence identity to any of SEQ ID NOs: 82-86.
  • the polypeptide construct or composition of any of aspects 1-111 wherein, when one or more TSBs are present in the construct or composition, at least one (e.g., at least two, or each) TSB displays affinity for a checkpoint protein.
  • ICEs immune cell engagers
  • a polypeptide construct or composition aspect 126 wherein the at least one ICE aa sequence (e.g., at least two, or each ICE sequence) is selected independently from the group consisting of antibody, antigen binding fragment(s) of an antibody, Fab, Fab’, scFv, aptamer, and nanobody aa sequences.
  • the at least one ICE aa sequence e.g., at least two, or each ICE sequence
  • the at least one ICE aa sequence is selected independently from the group consisting of antibody, antigen binding fragment(s) of an antibody, Fab, Fab’, scFv, aptamer, and nanobody aa sequences.
  • the polypeptide construct or complex of aspect 126 or 127 wherein the at least one (e.g., at least two, or each) ICE comprises a scFv, an anti-human CD3 comprising the sequence of SEQ ID NO:61 or 62, or a sequence having greater than 90% or greater than 95% sequence identity to either SEQ ID NO:61 or 62 (e.g., an aa sequence having greater than 96% or greater than 98% sequence identity to either SEQ ID NO:61 or 62).
  • the at least one (e.g., at least two, or each) ICE comprises an anti-human CD3 VHH comprising the sequence of SEQ ID NO:63, or a sequence having greater than 90% or greater than 95% sequence identity to SEQ ID NO:63 (e.g., an aa sequence having greater than 96% or greater than 98% sequence identity to SEQ ID NO:63).
  • each NBD is a NBD of an ATP- binding cassette (ABC) transporter.
  • the polypeptide construct or composition of aspect 131 wherein the ABC transporter is a member of the ABC1 , MDR/TAP, MRP, ALD, OABP, GCN20, or White ABC transporter family.
  • the polypeptide construct or composition of aspect 131 wherein the ABC transporter NBD comprises an aa sequence selected from ABCA1 (SEQ ID NON), ABCB1 (SEQ ID NO:2), ABCC1 (SEQ ID NO ), ABCD1 (SEQ ID NO:4), ABCE1 (SEQ ID NOS), ABCF1 (SEQ ID NOS), ABCG2 (SEQ ID NO:7), and TAP1 (SEQ ID NOS), or a sequence having greater than 90% or greater than 95% sequence identity to any one of those sequences.
  • the polypeptide construct or composition of aspect 133 wherein the NBD comprises an aa sequence having greater than 97% or greater than 98% sequence identity to any one of the aa sequences of SEQ ID NOs:1-7 and 9.
  • the polypeptide construct or composition of aspect 131 wherein the NBD comprises aTAP2 aa sequence, a TAP2 aa sequence of SEQ ID NON 1, or an aa sequence having greater than 90% or greater than 95% sequence identity to the aa sequence of SEQ ID NON 1 .
  • the polypeptide construct or composition of aspect 131 wherein the NBD comprises a TAP1 NBD aa sequence.
  • the polypeptide construct or composition of aspect 131 wherein the NBD comprises theTAPI aa sequence of any one of SEQ ID NOsNO, 87, or 88, or a sequence having greater than 90% or greater than 95% sequence identity to any one of those sequences.
  • the polypeptide construct or composition of aspect 140 wherein the NBD comprises the TAP1 aa sequence of SEQ ID NO:88, or a TAP1 aa sequence having greater than 90% or greater than 95% sequence identity to the TAP1 aa sequence of SEQ ID NO:88.
  • the polypeptide construct of aspect 144 wherein the NBD comprises a substitution for at least one (e.g., at least two or at least three) of aas N185, S186, Q189, E191, and Q192.
  • the polypeptide construct or composition of aspect 146 wherein the at least one (e.g., each) NBD comprises a TAP1 NBD having a D668 substitution (e.g., D668N) numbered as in SEQ ID NO:8, or a corresponding substitution (in, for example, any of SEQ ID NOs:9, 10, 87, or 88) that renders the at least one (e.g., each) NBD substantially ATP hydrolysis deficient.
  • the polypeptide construct or composition of any preceding aspect comprising one or more independently selected linkers (e.g., flexible or rigid linkers), optionally located between any of the NBD aa sequence, the scaffold aa sequence, and the AD aa sequence.
  • the polypeptide construct or composition of aspect 148 wherein the one or more independently selected linkers comprise an aa sequence selected independently from any of SEQ ID NOs:16-35.
  • the polypeptide construct or composition of aspect 148 or 149 further comprising one or more independently selected rigid linker aa sequences.
  • the polypeptide construct or composition of aspect 150 wherein the one or more independently selected rigid linker aa sequences is/are selected independently from any of SEQ ID NOs:36-55.
  • a dimer or higher order complex of constructs comprising two or more constructs, or a first polypeptide construct and a second polypeptide construct (e.g., a composition) according to any of aspects 1-151 and at least one molecule (e.g., at least two molecules) of ATP.
  • the dimer or other higher order complex of aspect 152 wherein each of the constructs in the complex is identical.
  • the dimer or other higher order complex of aspect 153 wherein the dimer or other higher order complex is a homodimer.
  • the dimer or higher order complex of aspect 152 wherein each of the constructs in the complex is not identical.
  • the dimer or other higher order complex of aspect 155 wherein the dimer or other higher order complex is a heterodimer.
  • a population of constructs (e.g., group or collection of constructs as a composition) comprising at least one or at least two of the dimer or higher order complex of constructs of any of aspects 152-156.
  • the population of aspect 157 wherein at least one or at least two of the dimer or higher order complex of constructs comprise immunoglobulin constant regions that effect ADCC, ADCP, and/or CDC.
  • the population of any of aspects 157-160, wherein at least one or at least two of the dimer or higher order complex of constructs comprise an independently selected TSB.
  • a pair of constructs of any of aspects 1-151 having a structure set forth in any of FIGs. 2, 3, 4A, or 4B.
  • a dimer or higher order complex of any of aspects 152-156 having a structure set forth in any of FIGs. 2 or 3.
  • a dimer or higher order complex of any of aspects 152-156 having a structure set forth in any of FIGs. 4A or 4B.
  • the dimer or higher order complex of any of aspects 152-156 comprising a homodimer of TAP1 or TAP2 NBD aa sequences, or a heterodimer of TAP1 and TAP2 NBD aa sequences.
  • a method of stimulating CD4+ T cells, 5y T cell, NK cells, myeloid derived suppressor cells, and/or CD8+ T cells comprising contacting the cells with a construct or composition of any of aspects 1-151 , in the presence of sufficient ATP to bind to the NBD.
  • the method of aspect 168 conducted in vitro, or outside of the body of a mammal or non-mammalian animal.
  • the method of aspect 169 conducted in a cell or tissue.
  • the method of aspect 168 conducted in vivo or within the body of a mammal.
  • a method of treating a cancer comprising administering a construct or composition of any one of aspects 1-151 to a patient or subject.
  • a nucleic acid comprising a sequence encoding one or more constructs, or one or more constructs of a composition, of any of aspects 1-151.
  • a vector comprising the nucleic acid of aspect 179, optionally under the control of a promoter (e.g., a constitutive promoter) or an inducible promoter.
  • a cell comprising the vector or nucleic acid of aspect 179 or 180.
  • the cell of aspect 181 wherein the cell is a mammalian cell, yeast cell, insect cell, or bacterial cell. VII. Examples
  • a human TAP1 NBD comprising:
  • N676, S677, Q680, E682, and Q683 e.g., N676G, S677N, Q680R, E682Q, and Q683R substitutions,
  • TAP1 NBD of SEQ ID NO:87 with a peptide comprising a SpyTag3, TEV protease, and a His tag attached at the C-terminus was expressed in E.coli. and the cells pelleted and frozen until analysis.
  • the TAP1 NBD fragment was purified by cell lysis followed by chromatograph on a HisTrap column.
  • Lysate was then clarified by centrifugation at 12,000 x g for 1 hour at 4°C, then 0.22-
  • CV column volumes
  • the column was then transferred to an AKTAxpress FPLC, and bound proteins were eluted with an imidazole gradient from 0 to 500 mM over 40 CV in binding buffer (20 mM Tris-CI pH 8.0, 200 mM NaCI, 5 mM MgCI?, 10% glycerol, 2 mM ATP, 0.5 mM PMSF).
  • the purified protein was subject to SDS-PAGE along with molecular weight samples.
  • the coomassie blue stained gel is provided in FIG. 12, the leftmost lane is molecular weight samples and the rightmost lane is the purified protein.
  • Samples of the purified protein (1 mg each) were buffer-exchanged on PD-10 columns (Cytiva 17085101) according to manufacturer instructions.
  • PD-10 desalting columns were equilibrated with target buffer (20 mM Tris-CI pH 8.0, 50 mM NaCI, 5 mM MgCI2, 10% glycerol) containing either 1 mM ATP or 1 mM ADP.
  • target buffer 20 mM Tris-CI pH 8.0, 50 mM NaCI, 5 mM MgCI2, 10% glycerol
  • Buffer-exchanged proteins were then concentrated to 0.5 ml ( ⁇ 60pM) and loaded onto a Superdex S200 Increase column (Cytiva) equilibrated in the appropriate buffer containing ATP or ADP and eluted at 0.5 ml/min.
  • the ATP- containing sample eluted at a volume of 15.75 ml, corresponding to a molecular weight of approximately 65 kDa, while the ADP sample eluted at 16.81 ml, corresponding to approximately 38 kDa. Traces of the chromatographic analysis are provided in FIG. 12.
  • the ATP-containing sample eluted at a volume of 15.75 ml, corresponding to a molecular weight of approximately 65 kDa, while the ADP sample eluted at 16.81 ml, corresponding to approximately 38 kDa.
  • the cells in the aliquots were pelleted at 6800 x g for 3 minutes, and the pellet resuspended in 300 pil of 1 x PBS, after which the resuspended material was frozen at -80C. After induction with 80 pM IPTG the cells were grown and a comparable sample of 1 OD-ml (e.g. 0.25 ml of 4 OD) was collected during the final harvest after induction. For analysis of induction the frozen samples were thawed and the cells in all samples were lysed by mixing with an equal volume of 2x lysis buffer (1x PBS with 0.2% Triton X-100, 100 pig/ml lysozyme and 2x concentration of Universal Nuclease from Pierce).
  • 2x lysis buffer (1x PBS with 0.2% Triton X-100, 100 pig/ml lysozyme and 2x concentration of Universal Nuclease from Pierce.
  • Samples were incubated on a rocker at 4° C for 30 minutes, after which the lysates were spun at 21,000 x g for 10 minutes to pellet debris.
  • Samples (30 l) of the supernatant were mixed with 10 pl of 4x SDS-PAGE loading buffer, heated at 70° C for about 5 minutes, then loaded on a SDS-PAGE gel. Results are shown in FIG. 13, SDS-PAGE gel A.
  • FIG. 13 provides SDS PAGE analysis of induced and uninduced expression at A and analysis of the purified protein at B.
  • the lanes of the reducing SDS-PAGE gel images provided in FIG. 13 are as follows

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Cell Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Pregnancy & Childbirth (AREA)
  • Gynecology & Obstetrics (AREA)
  • Oncology (AREA)
  • Reproductive Health (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
PCT/US2023/014302 2022-03-01 2023-03-01 Atp-dependent agonists of immune cells function as anticancer agents Ceased WO2023167947A2 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
AU2023229182A AU2023229182A1 (en) 2022-03-01 2023-03-01 Atp-dependent agonists of immune cells function as anticancer agents
IL315362A IL315362A (en) 2022-03-01 2023-03-01 ATP-dependent agonists of immune cells function as anticancer agents
EP23763905.9A EP4486391A4 (en) 2022-03-01 2023-03-01 ATP-DEPENDENT IMMUNE CELL FUNCTION AGONS AS ANTICANCER AGENTS
JP2024552150A JP2025508958A (ja) 2022-03-01 2023-03-01 抗癌剤としての免疫細胞機能のatp依存性アゴニスト
CN202380037296.1A CN119110731A (zh) 2022-03-01 2023-03-01 作为抗癌剂的免疫细胞功能的atp依赖性激动剂
CA3245316A CA3245316A1 (en) 2022-03-01 2023-03-01 ATP-DEPENDENT IMMUNE CELL FUNCTION AGONISTS AS ANTICANCER AGENTS
KR1020247032672A KR20240169151A (ko) 2022-03-01 2023-03-01 면역 세포 기능을 갖는, 항암제로서의 atp 의존성 작용제
US18/593,028 US12180297B2 (en) 2022-03-01 2024-03-01 ATP-dependent agonists of immune cells function as anticancer agents
US18/989,938 US20250197521A1 (en) 2022-03-01 2024-12-20 ATP-Dependent Agonists of Immune Cells Function as Anticancer Agents

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US202263315529P 2022-03-01 2022-03-01
US63/315,529 2022-03-01
US202263330120P 2022-04-12 2022-04-12
US63/330,120 2022-04-12
US202263353896P 2022-06-21 2022-06-21
US63/353,896 2022-06-21

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US18/593,028 Continuation US12180297B2 (en) 2022-03-01 2024-03-01 ATP-dependent agonists of immune cells function as anticancer agents

Publications (2)

Publication Number Publication Date
WO2023167947A2 true WO2023167947A2 (en) 2023-09-07
WO2023167947A3 WO2023167947A3 (en) 2023-12-07

Family

ID=87884241

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2023/014302 Ceased WO2023167947A2 (en) 2022-03-01 2023-03-01 Atp-dependent agonists of immune cells function as anticancer agents

Country Status (9)

Country Link
US (2) US12180297B2 (https=)
EP (1) EP4486391A4 (https=)
JP (1) JP2025508958A (https=)
KR (1) KR20240169151A (https=)
CN (1) CN119110731A (https=)
AU (1) AU2023229182A1 (https=)
CA (1) CA3245316A1 (https=)
IL (1) IL315362A (https=)
WO (1) WO2023167947A2 (https=)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023167947A3 (en) * 2022-03-01 2023-12-07 Crosslink Therapeutics Inc. Atp-dependent agonists of immune cells function as anticancer agents
WO2025054553A1 (en) * 2023-09-06 2025-03-13 Crosslink Therapeutics Inc. Atp-dependent agonists of immune cells function as anticancer agents

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6284879B1 (en) 1998-04-16 2001-09-04 The General Hospital Corporation Transport associated protein splice variants
US6830913B1 (en) 1999-11-29 2004-12-14 Active Pass Pharmaceuticals, Inc. ABCB9 transporter and uses thereof
EP1217066A1 (en) * 2000-12-21 2002-06-26 Universiteit Gent Modulation of ATP-binding cassette transporter activity
WO2018213612A1 (en) 2017-05-18 2018-11-22 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-mesothelin polypeptides and proteins
EP3678691A4 (en) * 2017-09-07 2021-06-09 Cue Biopharma, Inc. Multimeric t-cell modulatory polypeptides and methods of use thereof
US11560413B2 (en) * 2018-02-15 2023-01-24 Uab Research Foundation Modified cystic fibrosis transmembrane conductance regulator (CFTR) polypeptides with increased stability and uses thereof
JP2025508958A (ja) * 2022-03-01 2025-04-10 クロスリンク セラピューティクス インク. 抗癌剤としての免疫細胞機能のatp依存性アゴニスト

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023167947A3 (en) * 2022-03-01 2023-12-07 Crosslink Therapeutics Inc. Atp-dependent agonists of immune cells function as anticancer agents
WO2025054553A1 (en) * 2023-09-06 2025-03-13 Crosslink Therapeutics Inc. Atp-dependent agonists of immune cells function as anticancer agents

Also Published As

Publication number Publication date
US20240254254A1 (en) 2024-08-01
CN119110731A (zh) 2024-12-10
KR20240169151A (ko) 2024-12-02
IL315362A (en) 2024-11-01
CA3245316A1 (en) 2023-09-07
US20250197521A1 (en) 2025-06-19
JP2025508958A (ja) 2025-04-10
EP4486391A2 (en) 2025-01-08
WO2023167947A3 (en) 2023-12-07
AU2023229182A1 (en) 2024-10-10
US12180297B2 (en) 2024-12-31
EP4486391A4 (en) 2026-01-21

Similar Documents

Publication Publication Date Title
US12023368B2 (en) Immunoconjugates
TWI890718B (zh) 新穎之il2促效劑及其使用方法(一)
US20230071733A1 (en) Immunoconjugates
AU2019355971B2 (en) IL-12 heterodimeric Fc-fusion proteins
US20250197521A1 (en) ATP-Dependent Agonists of Immune Cells Function as Anticancer Agents
CN103370339A (zh) 多聚体il-15可溶性融合分子与其制造与使用方法
WO2021209402A2 (en) Immunoconjugates
US20240269277A1 (en) Alternative pd1-il7v immunoconjugates for the treatment of cancer
US20260083855A1 (en) Immunoconjugates
JP2025519448A (ja) 膜結合il12を用いて遺伝子操作した人工多能性幹細胞に由来する免疫エフェクター細胞ならびにその使用
CA3220027A1 (en) Bispecific fc fusion proteins with spd-1 and il-15
CN117337298A (zh) 治疗1型糖尿病(t1d)的mhc ii类t细胞调节多肽及其使用方法
US20250257148A1 (en) ATP-Dependent Agonists of Immune Cells Function as Anticancer Agents
KR20250166361A (ko) Mhc 도메인 및 항원 펩티드를 포함하는 펩티드-mhc 착물 및 면역 세포 항원 표적화 모이어티를 포함하는 다중특이적 분자

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23763905

Country of ref document: EP

Kind code of ref document: A2

DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
WWE Wipo information: entry into national phase

Ref document number: 2024552150

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 315362

Country of ref document: IL

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112024017944

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: AU2023229182

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 202417072750

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 11202405996P

Country of ref document: SG

WWE Wipo information: entry into national phase

Ref document number: 2023763905

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2023763905

Country of ref document: EP

Effective date: 20241001

ENP Entry into the national phase

Ref document number: 2023229182

Country of ref document: AU

Date of ref document: 20230301

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202380037296.1

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23763905

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 112024017944

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20240830