WO2022164935A1 - Lentivirus for generating cells expressing anti-cd19 chimeric antigen receptor - Google Patents
Lentivirus for generating cells expressing anti-cd19 chimeric antigen receptor Download PDFInfo
- Publication number
- WO2022164935A1 WO2022164935A1 PCT/US2022/013947 US2022013947W WO2022164935A1 WO 2022164935 A1 WO2022164935 A1 WO 2022164935A1 US 2022013947 W US2022013947 W US 2022013947W WO 2022164935 A1 WO2022164935 A1 WO 2022164935A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- seq
- particle
- cell
- viral
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/76—Viruses; Subviral particles; Bacteriophages
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4211—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/48—Blood cells, e.g. leukemia or lymphoma
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/10041—Use of virus, viral particle or viral elements as a vector
- C12N2740/10043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16045—Special targeting system for viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/20011—Rhabdoviridae
- C12N2760/20211—Vesiculovirus, e.g. vesicular stomatitis Indiana virus
- C12N2760/20222—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/008—Vector systems having a special element relevant for transcription cell type or tissue specific enhancer/promoter combination
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/48—Vector systems having a special element relevant for transcription regulating transport or export of RNA, e.g. RRE, PRE, WPRE, CTE
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/50—Vector systems having a special element relevant for transcription regulating RNA stability, not being an intron, e.g. poly A signal
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the invention relates generally to in vivo transduction of immune cells to treat cancer and/or B-cell malignancies.
- Cellular therapy generally employs the transduction of immune cells ex vivo to generate a population of therapeutic cells to be introduced into the patient.
- T cells from an autologous or allogenic source can be transduced ex vivo with a vector encoding a chimeric antigen receptor.
- the resulting CAR T-cells are then infused into the patient.
- compositions and methods related to in vivo transduction of immune cells to treat cancer and/or B-cell malignancies are provided.
- the present disclosure provides a viral particle comprising a vector genome comprising a polynucleotide sequence encoding an anti-CD19 chimeric antigen receptor, wherein the viral particle transduces immune cells in vivo.
- the viral particle is a lentiviral particle.
- the immune cells are T cells.
- the viral particle comprises a polynucleotide sequence encoding a multipartite cell-surface receptor.
- the multipartite cell-surface receptor is a chemically inducible cell-surface receptor.
- the viral particle comprises a polynucleotide sequence encoding a multipartite cell-surface receptor comprising a FKBP-rapamycin complex binding domain (FRB domain) or a functional variant thereof; and the polynucleotide comprises a polynucleotide sequence encoding a FK506 binding protein domain (FKBP) or a functional variant thereof.
- the multipartite cell-surface receptor is a rapamycin-activated cell-surface receptor.
- the viral particle comprises a sequence that confers resistance to an immunosuppressive agent.
- the viral particle comprises a sequence that confers resistance to an immunosuppressive agent encodes a polypeptide that binds rapamycin, wherein optionally, the polypeptide is an FRB.
- the viral particle comprises a sequence in 5' to 3' order on a polycistronic transcript: the polynucleotide sequence encoding the multipartite cell-surface receptor and the polynucleotide sequence encoding the anti-CD19 chimeric antigen receptor.
- the viral particle comprises a sequence in 5' to 3' order on a polycistronic transcript: the polynucleotide sequence encoding the anti-CD19 chimeric antigen receptor and the polynucleotide sequence encoding the multipartite cell-surface receptor, and/or wherein the anti-CD19 chimeric antigen receptor shares at least 80%, 90%, 95%, or 100% identity to SEQ ID NO: 51, 79, 89, 121, or 122.
- the polynucleotide encoding the anti-CD19 chimeric antigen receptor and/or the polynucleotide encoding the multipartite cell-surface receptor is operatively linked to one or more promoters.
- the promoter is an inducible promoter.
- the viral particle comprises a viral envelope comprising one or more immune cell-activating proteins exposed on the surface and/or conjugated to the surface of the viral envelope.
- the viral envelope comprises an anti-CD3 single-chain variable fragment exposed on the surface and/or conjugated to the surface of the viral envelope.
- the viral envelope comprises a Cocal glycoprotein exposed on the surface and/or conjugated to the surface of the viral envelope.
- the viral envelope comprises a Cocal glycoprotein exposed on the surface and/or conjugated to the surface of the viral envelope, optionally wherein the Cocal glycoprotein comprises the R354Q mutation compared to a reference sequence according to SEQ ID NO: 5.
- the viral envelope comprises an anti-CD3 single-chain variable fragment and a Cocal glycoprotein exposed on the surface and/or conjugated to the surface of the viral envelope.
- the viral envelope comprises an anti-CD3 single-chain variable fragment sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 2 or 12.
- the viral envelope comprises a Cocal glycoprotein sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 5, 13, 19, 123, 128, 129, or 130.
- the promoter is an MND promoter.
- the viral particle comprises a sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 49.
- the viral particle comprises a sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 75.
- the viral particle comprises a sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 87.
- the present disclosure provides a method of treating a disease or disorder, transducing immune cells in vivo, and/or generating an immune cell expressing an anti-CD19 chimeric antigen receptor in a subject in need thereof, comprising administering the viral particle of the present disclosure to the subject.
- the viral particle is administered by intraperitoneal, subcutaneous, or intranodal injection.
- the transduced immune cells comprising the polynucleotides of the present disclosure are administered to the subject.
- the present disclosure provides a method of treating a disease or disorder in a subject in need thereof, comprising administering a therapeutically effective amount of a viral particle to the subject by intraperitoneal, subcutaneous, or intranodal injection, wherein the viral particle transduces immune cells in vivo.
- the viral particle is administered by intra-nodal injection, optionally via inguinal lymph node.
- the viral particle is administered by intraperitoneal injection.
- the present disclosure provides a viral particle for use in transducing immune cells in vivo, comprising a polynucleotide comprising a polynucleotide sequence encoding a chimeric antigen receptor.
- the viral particle further comprises a polynucleotide sequence encoding a dominant-negative TGFP receptor.
- expression of the chimeric antigen receptor is modulated by a FRB-degron fusion polypeptide and wherein suppression of the FRB-degron fusion polypeptide is chemically inducible by a ligand.
- the ligand is rapamycin.
- expression of the chimeric antigen receptor is modulated by a degron fusion polypeptide and wherein suppression of the degron fusion polypeptide is chemically inducible by a ligand.
- the disease or disorder comprises B-cell malignancy, relapsed/refractory CD19-expressing malignancy, diffuse large B-cell lymphoma (DLBCL), Burkitt’s type large B-cell lymphoma (B-LBL), follicular lymphoma (FL), chronic lymphocytic leukemia (CLL), acute lymphocytic leukemia (ALL), mantle cell lymphoma (MCL), hematological malignancy, colon cancer, lung cancer, liver cancer, breast cancer, renal cancer, prostate cancer, ovarian cancer, skin cancer, melanoma, bone cancer, brain cancer, squamous cell carcinoma, leukemia, myeloma, B cell lymphoma, kidney cancer, uterine cancer, adenocarcinoma, pancreatic cancer, chronic myelogenous leukemia, glioblastoma, neuroblastoma, medulloblastoma, sarcoma, and any combination
- the disease or disorder comprises diffuse large B-cell lymphoma (DLBCL).
- DLBCL diffuse large B-cell lymphoma
- the disease or disorder comprises Burkitt’s type large B-cell lymphoma (B-LBL).
- the disease or disorder comprises follicular lymphoma (FL). [0047] In some embodiments, the disease or disorder comprises chronic lymphocytic leukemia (CLL).
- FL follicular lymphoma
- CLL chronic lymphocytic leukemia
- the disease or disorder comprises acute lymphocytic leukemia (ALL).
- ALL acute lymphocytic leukemia
- the disease or disorder comprises mantle cell lymphoma (MCL).
- MCL mantle cell lymphoma
- the present disclosure provides a pharmaceutical composition comprising the viral particle of the present disclosure.
- the present disclosure provides a kit comprising the pharmaceutical composition of the present disclosure and optionally a composition comprising a ligand, optionally rapamycin.
- the present disclosure provides a viral particle for use in a method according to any viral particles of the present disclosure.
- the present disclosure provides a use of a viral particle in a method according to any method of the present disclosure.
- a method of treating a disease or disorder associated with malignant CD 19+ cells in a subject comprises administering the viral particle of the present disclosure to a subject and following administration of the viral particle, CD 19+ B cells in a subject are depleted by at least 80%, at least 85%, at least 90%, or at least 95% as compared to a subject that did not receive viral particles.
- the CD 19+ B cells are depleted in peripheral blood of the subject.
- the B cell depletion is sustained in the subject for at least 7, at least 10, at least 20, at least 30 days, at least 40 days, at least 50 days, at least 60 days, at least 70 days, or at least 80 days after administering the viral particle.
- At least 2 million, at least 4 million, at least 6 million, at least 8 million or at least 10 million transducing units of viral particle are administered to the subject.
- contacting immune cells with the ligand of the present disclosure increases the number of immune cells expressing an anti-CD19 chimeric antigen receptor in a subject by at least 10-fold, at least 50-fold, at least 100-fold, at least 200-fold, at least 500-fold, or at least 1000-fold.
- the present disclosure provides a polypeptide comprising a single-chain variable fragment that specifically binds CD3 (anti-CD3 scFv) and a glycophorin A transmembrane fragment.
- the glycophorin A transmembrane fragment shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to HFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETS DQ (SEQ ID NO: 105).
- the anti-CD3 scFv shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 2 or 12.
- the polypeptide shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 119.
- the transmembrane fragment shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO 13, 19, 25, 31, 37, 43, or 105.
- the present disclosure provides a surface-engineered lentiviral particle comprising a polypeptide according to the present disclosure displayed on the surface of the lentiviral particle.
- the present disclosure provides a method of transducing cells, comprising contacting a viral particle according to the present disclosure with an immune cell in vivo.
- the present disclosure provides a polynucleotide comprising an anti-CD3 scFv and a glycophorin A transmembrane fragment.
- the glycophorin A transmembrane fragment shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 106.
- the anti-CD3 scFv shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 7 or 15.
- the polypeptide shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 120.
- the transmembrane fragment shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO 16, 22, 25, 28, 34, 40, 47, or 106.
- the present disclosure provides a method of making a viral particle comprising: a) providing a cell in a culture medium; and b) transfecting the cell with a vector genome according to the present disclosure, a transfer plasmid, and a packaging plasmid, simultaneously or sequentially; whereby the cell expresses a surface-engineered viral particle.
- the present disclosure provides a method of treating a disease or disorder associated with malignant CD 19+ cells comprising transducing immune cells in vivo, and/or generating a viral particle expressing an anti-CD3 single-chain variable fragment exposed on the surface and/or conjugated to the surface of the viral envelope that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 2 or 12 and administering the viral particle to a subject.
- the viral particle is administered by intraperitoneal, subcutaneous, or intranodal injection.
- FIG. 1 is a graph of 293T titers of lentiviral vectors. Amicon-concentrated lentiviral vector preparations were tittered on 293T cells which were previously seeded in 12 well plates. Three days later, the transduced cells were assessed for mCherry expression. Calculated viral titers are shown.
- FIG. 2A shows flow cytometry to measure CD25 expression and mCherry positively expressing T cells in PBMCs stimulated or not and transduced with no vector. 4 days after transduction PBMCs were harvested and stained.
- FIG. 2B shows flow cytometry to measure CD25 expression and mCherry positively expressing T cells in PBMCs stimulated or not and transduced with 5 ul or 25 ul Cocal vector. 4 days after transduction PBMCs were harvested and stained.
- FIG. 2C shows flow cytometry to measure CD25 expression and mCherry positively expressing T cells in PBMCs stimulated or not and transduced with 5 ul or 25 ul aCD3+Cocal vector. 4 days after transduction PBMCs were harvested and stained.
- FIG. 2D shows flow cytometry to measure CD25 expression and mCherry positively expressing T cells in PBMCs stimulated or not and transduced with 5 ul or 25 ul aCD3-Blind- Cocal vector. 4 days after transduction PBMCs were harvested and stained.
- FIG. 3 shows flow cytometry plots of aCD19 CAR and 2 A peptide expression.
- Unstimulated PBMC cells were stained for RACR-aCD19 CAR and 2A following culture in Rapamycin.
- the unstimulated PBMCs were transduced with the indicated vectors (VT103, RACR-aCD19 CAR MND-Cocal, RACR-aCD19 CAR CMV-Cocal, RACR-aCD19 CAR CMV-aCD3 -Cocal, RACR-aCD19 CAR CMV-aCD3-(B)Cocal) at lOOul each. 4 days after transduction, rapamycin was added, and cells were cultured for 11 days. The PBMCs were then harvested and stained for aCD19 CAR and 2 A peptide.
- FIG. 4 shows flow cytometry plots of aCD19 CAR and 2 A peptide expression.
- Blinatumomab-stimulated PBMC cells were stained for RACR-aCD19 CAR and 2A following culture in Rapamycin.
- the Blinatumomab-stimulated PBMCs were transduced with the indicated vectors (RACR-aCD19 CAR MND-Cocal, RACR-aCD19 CAR CMV-Cocal, RACR-aCD19 CAR CMV-aCD3 -Cocal, RACR-aCD19 CAR CMV-aCD3-(B)Cocal) at lOOul each. 4 days after transduction, rapamycin was added, and cells were cultured for 11 days. The PBMCs were then harvested and stained for aCD19 CAR and 2 A peptide.
- FIG. 5 shows flow cytometry plots of aCD19 CAR+ CD8 T cells.
- Unstimulated PBMCs were transduced with RACR-aCD19 CAR/aCD3 -Cocal vector as described in Example 2. 4 days after transduction, Rapamycin was added to culture. 13 days later the cells were stimulated with Raji cells and intracellular cytokine production was measured as described in Example 2. Shown are Viable, CD3+, CD8+, 2A+ cells.
- FIG. 6 shows flow cytometry plots of aCD19 CAR+ CD4 T cells.
- Unstimulated PBMCs were transduced with RACR-aCD19 CAR/aCD3 -Cocal vector as described in Example 2. 4 days after transduction, Rapamycin was added to culture. 13 days later the cells were stimulated with Raji cells and intracellular cytokine production was measured as described in Example 2. Shown are Viable, CD3+, CD8+, 2A+ cells.
- FIG. 7B shows a graph of %CD25 T cells transduced with aCD19 CAR- TGFpDN/aCD3-Cocal viral particles at 0.5 MOI, 1.0 MOI, or 2.0 MOI and added to unstimulated PBMCs for 3 days.
- FIG. 8A shows flow cytometry plots of CD8+ T cells expressing 2A peptide.
- Representative flow cytometry plots of PBMCs transduced with aCD19 CAR-TGFpDN and Cocal or aCD3 -Cocal -pseudotyped viral envelope proteins analyzed for CD8+ T cells at MOI 2.
- FIG. 8B shows a graph of %aCD19 CAR+ T cells transduced with aCD19 CAR- TGFpDN/aCD3-Cocal viral particles at 0.5 MOI, 1.0 MOI, or 2.0 MOI and added to unstimulated PBMCs for 6 days.
- FIG. 9A shows a graph of %aCD19 CAR+ CD4 T cells transduced with aCD19 CAR- TGFpDN/aCD3-Cocal viral particles at 0.5 MOI, 1.0 MOI, or 2.0 MOI and added to unstimulated PBMCs for 3, 6, or 12 days.
- FIG. 9B shows a graph of %aCD19 CAR+ CD8 T cells transduced with aCD19 CAR- TGFpDN/aCD3-Cocal viral particles at 0.5 MOI, 1.0 MOI, or 2.0 MOI and added to unstimulated PBMCs for 3, 6, or 12 days.
- FIG. 10A shows a graph of %aCD19 CAR+ 293 T cells transduced with aCD19 CAR- TGFpDN, aCD19 CAR-RACR, or RACR-aCD19 CAR vectors with Cocal envelope protein.
- the 293T titers (TU/ml) of viral particle preparations are also shown.
- FIG. 10B shows a graph of %aCD19 CAR+ 293T cells transduced with aCD19 CAR- TGFpDN, aCD19 CAR-RACR, or RACR-aCD19 CAR vectors with aCD3 -Cocal envelope protein.
- the 293T titers (TU/ml) of viral particle preparations are also shown.
- FIG. 12 shows a schematic of the study protocol described in Example 5.
- FIG. 13B shows flow cytometry plots for P2A (CAR) and cell activity (CD71) in single/live/CD3+/CD8+ cells from d8 (the start of rapamycin and/or Raji treatment), dl 5, d22 post-transduction of cells transduced with the RACR-aCD19 CAR oriented vector. Red arrows denote the RACR-aCD19 CAR 2A+ populations.
- FIG. 13C shows flow cytometry plots for P2A (CAR) and cell activity (CD71) in single/live/CD3+/CD8+ cells from d8 (the start of rapamycin and/or Raji treatment), dl 5, d22 post-transduction of cells transduced with the aCD19 CAR-RACR oriented vector.
- Black arrows denote the aCD19 CAR-RACR 2A+ populations.
- FIG. 14 shows flow cytometry plots for rapamycin enrichment of CD8+ CAR-T cells, and a “sneaky” RACR-aCD19 CAR-T population that is detectable only when cells are treated with rapamycin (red arrow).
- FIG. 15 shows a graph of the total CD8+ CAR-T cells as they expand from day 8 to day 22 of the study. Cell expansion was increased in the presence of rapamycin by day 22 relative to the absence of rapamycin. The largest expansion occurred with both rapamycin and Raji cell addition.
- FIG. 16B shows flow cytometry plots for CD3+ (T cells) and GFP (Raji cells) in the presence and absence of rapamycin. Raji cells were diminished in co-culture wells transduced with the RACR-aCD19 CAR oriented vector.
- FIG. 16C shows flow cytometry plots for CD3+ (T cells) and GFP (Raji cells) in the presence and absence of rapamycin. Raji cells were diminished in co-culture wells transduced with the aCD19 CAR-RACR oriented vector.
- FIG. 17A shows a graph of the flow cytometry quantification of CAR+ T cells/ul blood in CD3+ cells.
- FIG. 17B shows a graph of the flow cytometry quantification of CAR+ T cells/ul blood in Non-CD3+ cells.
- FIG. 18A shows a graph of the flow cytometry quantification of the ratio of the %CD20+ to CD45+ T cells at the termination of the study.
- FIG. 18B shows a graph of the flow cytometry quantification of the ratio of the %CD3+ to CD45+ T cells at the termination of the study.
- FIG. 19A shows a graph of the flow cytometry quantification of B cells/ul whole blood throughout the study (Day 0 - Day 30). Bars indicate +/- standard error of the mean.
- FIG. 19B shows a graph of the flow cytometry quantification of B cells (frequency of total CD45+) in the spleen. Bars indicate median value of each group.
- FIG. 19C shows a graph of the flow cytometry quantification of B cells (frequency of total CD45+) in the bone marrow. Bars indicate median value of each group.
- FIG. 20A shows a graph of the flow cytometry quantification of aCD4 CAR T cells in the blood, spleen, and bone marrow upon study termination at day 29. Individual values represent the frequency of CAR+ cells within the indicated T cell population after background subtraction. Bars indicate median value of each group.
- FIG. 20B shows a graph of the flow cytometry quantification of aCD8 CAR T cells in the blood, spleen, and bone marrow upon study termination at day 29. Individual values represent the frequency of CAR+ cells within the indicated T cell population after background subtraction. Bars indicate median value of each group.
- FIG. 21 A shows a graph of CAR payload integration in blood at days 3, 10, 14, and 21. Vector copy number was determined by digital droplet PCR (ddPCR) using human as the reference genome. Bar indicates median values for each group.
- FIG. 2 IB shows a graph of CAR payload integration in bone marrow at days 10 and 29.
- Vector copy number was determined by digital droplet PCR using human as the reference genome. Bar indicates median values for each group.
- FIG. 22A shows a diagram of an embodiment of the viral particle of the present disclosure.
- FIG. 22B shows a diagram of an embodiment of the viral particle of the present disclosure.
- FIGs. 23A and 23B show schematics of the drug product transgene.
- the transgene encodes an anti-CD19-CAR with a FMC63 scFv, a short IgG4 hinge, and a 4-lBB/CD3( ⁇ signaling domain.
- the anti-CD19-CAR is followed by a P2A ribosomal skipping sequence, and a rapamycin activated cytokine receptor cassette (FRB-RACR).
- FIG. 24 shows a schematic of the mechanism of action of the drug product.
- Lentivirus particles bind to T cells in vivo via an anti-CD3 scFv, which simultaneously activates T cells and facilitates lentivirus internalization.
- the aCD19 CAR-RACR construct-containing capsid is released into the cytosol, reverse-transcribed into DNA, and integrated into the genome.
- Transduced T cells express the anti-CD19 CAR and target CD19-expressing tumor cells.
- FIG. 25 shows a schematic of the RACR system.
- FIG. 26A shows representative flow plots of CD25 expression on CD8 T cells from a single donor. All samples were gated on viable, CD3+, and CD4+/CD8+ cells.
- FIG. 26B shows show %CD25 expression from all three donors across multiple MOIs for both CD8+ T cells. All samples were gated on viable, CD3+, and CD4+/CD8+ cells.
- FIG. 26C shows show %CD25 expression from all three donors across multiple MOIs for both CD4+ T cells. All samples were gated on viable, CD3+, and CD4+/CD8+ cells.
- FIG. 27A shows representative flow plots of aCD19 CAR+ CD8+ T cells from a single donor, +/- Rapamycin, on Day 17. CAR+ cells are gated on viable, CD3+, and CD8+ cells. [0123] FIG. 27B shows % CAR+ cells of total CD8+ T cells. CAR+ cells are gated on viable, CD3+, and CD8+ cells.
- FIG. 27C shows % CAR+ cells of total counts per well of CAR+ CD8+ T cells.
- CAR+ cells are gated on viable, CD3+, and CD8+ cells.
- total CAR counts were normalized to counting beads. Similar data was obtained in CAR+CD4+ T cells (not shown).
- FIG. 28 shows representative flow cytometry plots of GFP+ Raji cells co-cultured with non-transduced or drug product viral particle-transduced T cells at an approximate E:T ratio of 1 : 1 for one week.
- Circular gate represents the Raji cell population, which is absent in cocultures with drug product viral particle-transduced T cells and also reduced in response to rapamycin treatment alone.
- UB-VV100 denotes the drug product.
- FIG. 30A shows a graph of B cell populations assessed by flow cytometry (defined by live/singlets/human CD45+/CD3-CD20+) in the blood, spleen, and bone marrow. Error bars indicate +/- standard error of the mean. **** indicates p ⁇ 0.0001, two-way ANOVA multiple comparisons. Bars indicate median values per group. * and *** indicate p ⁇ 0.05 and ⁇ 0.001 respectively, two-tailed T-test. UB-VV100 denotes the drug product.
- FIG. 3 OB shows a graph of CAR T cells detected by peripheral leukocyte payload integration using ddPCR. UB-VV100 denotes the drug product.
- FIG. 30C shows a graph of CAR T cells detected by peripheral leukocyte payload integration using flow cytometry.
- UB-VV100 denotes the drug product.
- FIG. 31 A shows the study timeline for an illustrative lentiviral vector dose exploration study.
- FIG. 3 IB shows B Cells/ul of blood. A dose dependent antigen specific VV100 activity was observed, no B cell depletion present in the FITC RACR group. At day 25 B cell depletion plateaued, and on day 26 rapamycin treatment begun for all groups except vehicle group. Raji cells were implanted SC on day 40.
- FIG. 31C shows CAR T cells/ul of blood. An increase in CAR T cells/ul was observed in the 10E6 VV100 treatment group and CAR T cells became detectable in the 2E06 VV100 treatment group after rapamycin treatment.
- FIGs. 32A and 32B show tumor growth as measured by calipers using the formula (W A 2 * L)/2 (A), and Tumor CAR T cells analyzed by flow cytometry (B). Inhibition of tumor growth appears to be dose dependent; no RAJI tumor growth inhibition was observed in FITC RACR treated mice. Higher CAR T cell frequency in tumors from 10E 6 VV100 treated mice.
- FIG. 33A shows cytometry analysis of CAR T cells in bone marrow (left) and spleen (right) at day 81. Higher dose of UB-VV100 sustains partial B cell depletion in bone marrow and spleen at 81 days post dosing.
- FIG. 33B shows cytometry analysis of B cells in bone marrow (left) and spleen (right) at day 81. Higher dose of UB-VV100 sustains partial B cell depletion in bone marrow and spleen at 81 days post dosing.
- FIG. 33C shows the analysis of transgene integration events in the blood, bone marrow, liver, ovary, and kidney normalized to DNA. Error bars indicate +/- 1 SEM. Horizontal bars indicate median values. Dotted line indicates 50 vector copies/ug DNA as FDA guidance detection threshold.
- FIG. 34A shows the study timeline for an illustrative lentiviral vector in vivo efficacy study using a Nalm-6 tumor model.
- FIG. 34B shows the body weight changes in different groups of the Nalm-6 efficacy study.
- FIG. 35 A shows total flux (p/s) of different groups of the Nalm-6 efficacy study throughout the study as an indication of tumor burden.
- VV100 treatment significantly decreased tumor burden measured by Total Flux, all mice in the vehicle group succumbed to Nalm-6 tumor by study day 20, mice that received VV100 treatment extended their survival up to study day 41.
- FIG. 35B shows survival curves of different groups of the Nalm-6 efficacy study throughout the study. VV100 treatment significantly increased survival, all mice in the vehicle group succumbed to Nalm-6 tumor by study day 20, mice that received VV100 treatment extended their survival up to study day 41
- FIG. 36 shows Total flux data for each individual mouse in the Nalm-6 group throughout the study.
- Mice in Vehicle (upper left) and Vehicle+ rapamycin (upper right) groups had an elevated disease burden starting at study day 10. Mice in these groups had to be euthanized by day 17.
- Mice in VV100 group (lower left) had a decrease of disease burden starting at day 17, however the effects of VV100 in this group were temporary.
- All mice in the VV100 + rapamycin group (lower right) had a significant decrease in disease burden starting at day 17, and low disease burden remained in two mice. Only one mouse from this group had tumor burden increase after the initial regression.
- FIG. 37 shows Nalm-6 group bioluminescence imaging with total flux heatmap overlay. From left to right: Mice in the Vehicle group succumbed to Nalm-6 disease at day 17, mice in Vehicle + Rapamycin group succumbed to disease by day 20, most of the mice in the VV100 treatment group had a temporary decrease in disease burden, mice in the VV100 + Rapamycin group had a significant decrease of disease burden that stayed low to undetectable in most of the mice, one mouse had a partial reduction in tumor burden that then increased
- FIG. 38A shows the average CAR T cells/ul of blood. Mice treated with UB-VV100 alone have detectable circulating CAR T cells peaking at day 17 and overall low levels in the blood. In the UB-VV100 + Rapamycin group, circulating CAR T cells increased over time and were significantly higher than in the UB-VV100 alone group. Mouse 10 had a significant expansion of CAR T cells in peripheral blood increasing from 228 CAR T cells/ul on D38 to 3397.69 on day 41. [0145] FIG. 38B shows CAR T cells/ul of blood for each individual mouse. Mice treated with UB-VV100 alone have detectable circulating CAR T cells peaking at day 17 and overall low levels in the blood.
- FIG. 39A shows CAR T cell frequency of total immune cells in bone marrow and spleen.
- CAR T cell frequency in the total immune cell population is higher in the VV100 + Rapamycin treatment groups in both tissues and higher in the bone marrow than in the spleen.
- FIG. 39B shows T cell frequency of human T cells in bone marrow and spleen.
- the frequency of CAR T cells in the T cell population in bone marrow and spleen are significantly higher in the VV100 + Rapamycin treatment group than in the VV100 treatment.
- FIG. 40A shows activation of PBMCs by flow cytometry for CD25.
- FIG. 40B shows transduction efficiency of PBMCs by flow cytometry for CAR expression.
- FIG. 41 A shows flow cytometry panels of CAR T cells in PBMCs transduced with UB- VI 00 and cultured with or without 10 nM rapamycin.
- FIG. 41B shows charts of T cell yield and percentage in PBMCs transduced with UB- VI 00 and cultured with or without 10 nM rapamycin. Summarized plots combine data from 3 PBMC donors, error bars indicate + 1 SEM. **, ***, and *** indicate p values of ⁇ 0.01, 0.001, and 0.0001, 2-way ANOVA multiple comparisons for rapamycin treatment over time.
- FIG. 42A shows flow cytometry and statistical analysis of intracellular staining of INFy in CD8+ CAR T cells generated by UB-VV100 transduction.
- FIG. 42B shows flow cytometry and statistical analysis of surface CD 107a expression in CD8+ CAR T cells generated by UB-VV100 transduction.
- FIG. 42C shows statistical analysis of Raji cell survival in the presence of PBMCs transduced with UB-VV100.
- FIG. 43 A shows flow cytometry panels of the PBMC sample from a B-ALL patient at the time of UB-VV100 transduction.
- FIG. 43B shows flow cytometry panels of the PBMC sample from a B-ALL patient 7 days post UB-VV100 transduction.
- FIG. 43C shows flow cytometry panels of the PBMC sample from a B-ALL patient 7 days post UB-VV100 transduction.
- FIGs. 44A-44D show flow cytometry panels of the PBMC sample from a DLBCL patient at the time of UB-VV100 transduction.
- FIGs. 45A and 45B show circulating B cell levels in CD34-NSG mice.
- Human B cell levels hCD20+ population gated on single cells, live cells, and hCD45+ cells
- the data is shown as either (A) human B cell count (the quantified number of hCD20+ cells normalized to the volume of blood using counting beads) or (B) the human B cell frequency (% of hCD45+ cell population that was hCD20+).
- Data are mean ⁇ SEM.
- FIGs. 46A and 46B show CAR-T cell levels in the blood of CD34-NSG mice.
- CAR-T cell levels CAR+ population gated on single cells, live cells, hCD45+ cells, and hCD3+ cells
- the data is shown as either (A) CAR-T cell frequency (% of hCD3+ cell population that was CAR+) or (B) the absolute number of CAR-T cells detected normalized to the volume of blood using counting beads. Data are mean ⁇ SEM.
- FIG. 46C shows transduction of mouse immune cells in the spleen of CD34-NSG mice.
- CAR+ mouse immune cell levels (CAR+ population gated on single cells, live cells, and mCD45+ cells) were measured in the spleen after week 4 scheduled necropsies (Group 7, 8, 10).
- FIG. 46D shows UB-VV100 biodistribution in CD34-NSGmice. Copies of UB-VV100 integrated vector genomes were measured using ddPCR performed on genomic DNA extracted from bone marrow, spleen, liver, heart, lungs, kidneys, brain, and gonads of CD34-NSG mice at scheduled necropsies 1- or 4-weeks post treatment (Group 7-10). The data is shown as copies of amplified region (ssCD19) per ug of genomic DNA.
- FIG. 47 shows multiplex RNA ISH staining in liver and spleen. Representative images of the liver and spleen from a CD34-NSG mouse treated with high dose UB-VV100 and rapamycin (TOX001 48). DAPI is shown in white, custom probe recognizing the RACR sequence of UB-VV100 is shown in yellow, human CD3 RNA ISH probe pool is shown in green, mouse CD68 RNA ISH probe is shown in red, and mouse Pecam RNA ISH probe is shown in blue. Human CAR-T cells are indicated with white arrows.
- FIG. 48 shows CAR+ Nalm6 cells have reduced surface CD 19 detection, but intracellular CD 19 protein levels were the same as untransduced Nalm6 cells.
- Nalm6 cells were transduced with VV100 at MOIs 1, 10, and 20.
- CAR+ Nalm6 cells were stained with (A) an anti-CD19 antibody (clone HIB19) to assess surface CD 19 levels and (B) an anti- CD19 antibody that binds to an intracellular CD 19 epitope (clone EPR5906) to determine the overall CD 19 protein level.
- Orange curves represent data from CAR+ Nalm6 cells gated as CAR and P2A positive cells.
- Grey curves represent untransduced CD 19+ Nalm6 parental cells or CD19 knockout Nalm6 cells.
- FIG. 49 shows that anti-CD19 CAR-T cells can kill CAR+ Nalm6 cells in vitro.
- Transduced Nalm6 GFP cells VV100, MOI 10
- transduced PBMCs VV100, MOI 5
- transduced Nalm6 cells were also cocultured with mock transduced PBMCs.
- Mock transduced PBMCs were treated with “empty” virus particles that displayed anti-CD3-scFv on the surface but did not carry a transgene payload.
- transduced Nalm6 cells were gated as CART Nalm6 cells based on intracellular transgene expression by flow cytometry. The percentage of lysis was calculated based on the frequency of dead CART Nalm6 cells normalized to the mock transduced PBMC co-culture well.
- FIG. 50 shows a schematic of VV100 transduction in a high tumor burden model.
- 5e5 Nalm6 GFP and 5e5 PBMCs were mixed and transduced with VV100 at a MOI of 5.
- FIG. 51 shows that transducing a mixed population of Nalm6 cells and PBMCs with VV100 generates CART Nalm6 cells, which were eliminated by anti-CD19 CAR-T cells.
- VV100 5e5 Nalm6 GFP cells and 5e5 PBMCs from healthy donors were mixed and transduced with either VV100 or anti-FITC CAR at a MOI of 5 or left untransduced.
- FIG. 52 shows that transducing a mixed population of Nalm6 cells and PBMCs with VV100 generates anti-CD19 CAR-T cells that can eliminate CAR+ Nalm6 cells.
- 5e5 Nalm6 GFP cells and 5e5 PBMCs from healthy donors were mixed and transduced with either VV100 or anti-FITC CAR at a MOI of 5 or left untransduced.
- a total of eight healthy donors were evaluated.
- (B) total number of aCD3 CAR-T cells were determined by flow cytometry. Each line represents data from an individual healthy donor.
- FIG. 53 shows the study timeline for an illustrative lentiviral vector in vivo efficacy study.
- FIG. 54 shows the study the survival of animals treated with UB-VV100.
- FIG. 55 shows T cell phenotype 3 days after UB-VV100 administration. Peripheral blood was collected from mice and analyzed by flow cytometry to determine CD71 expression. Bars indicate median value. *, *, **, and **** indicate p value of ⁇ 0.05, ⁇ 0.01, and ⁇ 0.0001, one way ANOVA Tukey’s post comparisons test.
- FIG. 58A shows the percentage of NALM-6 GFP ffLUC tumor cells present in bone marrow at sacrifice. When humane endpoint was reached mice were euthanized, their bone marrow was collected and processed for flowcytometry analysis looking at the frequency of GFP+/ CD45-/live cells.
- FIG. 58B shows the percentage of NALM-6 GFP ffLUC tumor cells present in spleen at sacrifice. When humane endpoint was reached mice were euthanized, their spleen was collected and processed for flowcytometry analysis looking at the frequency of GFP+/ CD45- /live cells.
- FIG. 59 shows illustrative aCD3 scFv constructs for lentiviral surface expression plasmids of the present disclosure.
- FIG. 60 shows the percentage of aCD3 scFv expression in lentiviral particles with the various illustrative aCD3 scFv surface constructs.
- 293T cells were transfected with the 5 plasmid system with variation in the surface plasmid construct.
- Producer 293T cells were analyzed for aCD3 scFv expression using the anti-teplizumab antibody with flow cytometry.
- Virus was harvested and used to transduce Suptl cells which were analyzed for titer by flow cytometry.
- FIG. 61 shows the titer of Suptl cells transduced with lentivirus comprising various illustrative aCD3 scFv surface constructs.
- FIG. 62 is a graph depicting relative light units (RLU) as a function of MOI in a T Cell Activation Bioassay (NF AT) bioluminescent cell-based assay showing T cell activation.
- RLU relative light units
- FIG. 63 is a graph depicting the correlation of aCD3 scFv expression and T cell activation by way of a NF AT reporter assay (RLU (MOI2)).
- FIG. 64 shows representative flow cytometry plots for cells expressing various illustrative aCD3 scFv surface constructs and stained to visualize aCD3 scFv.
- FIG. 65 shows the biodistribution of aCD3-Cocal-GFP in canine blood samples collected24 Hours post-dose and prior to necropsy.
- Prior necropsy Day 8 for Groups 1, 2 and 3 and Day 29 for Group 4.
- Results were extrapolated in order to be represent as copy number per pg of total canine DNA for tissue samples.
- the dotted line represents 2 parameters of the qPCR assay that were part of the validation: the lower limit of quantification (LLOQ) at 50 copies/pg of DNA after extrapolation (10 copies/200 ng of DNA) and the limit of detection (LOD) at 25 copies/pg of DNA after extrapolation (5 copies/200 ng of DNA).
- LLOQ lower limit of quantification
- LOD limit of detection
- FIG. 66 shows the biodistribution of aCD3-Cocal-GFP in canine tissues. Each symbol represents a single individual. Results were extrapolated in order to be represent as copy number per pg of total canine DNA for tissue samples.
- the dotted line represents 2 parameters of the qPCR assay that were part of the validation: the lower limit of quantification (LLOQ) at 50 copies/pg of DNA after extrapolation (10 copies/200 ng of DNA) and the limit of detection (LOD) at 25 copies/pg of DNA after extrapolation (5 copies/200 ng of DNA). Samples that were below the limit of quantification (BLQ) were given a value of 37, which is between the LLOQ and LOD values after extrapolation for graphical representation. In order to visualize negative samples on the logarithmic scale, samples that gave an undetectable result were given a value of 1 for graphical representation but remain undetectable in this study. DETAILED DESCRIPTION OF THE INVENTION
- the disclosure relates generally to a viral particle comprising a vector genome comprising a polynucleotide sequence encoding an anti-CD19 chimeric antigen receptor, wherein the viral particle transduces immune cells in vivo.
- compositions described herein may facilitate administering the viral particles directly into the subjects in need of treatment.
- the present disclosure provides a method of treating a disease or disorder, transducing immune cells in vivo, and/or generating an immune cell expressing an anti-CD19 chimeric antigen receptor in a subject in need thereof, comprising administering the viral particle of the present disclosure to the subject.
- the method further comprises administering rapamycin to the subject.
- the method of the disclosure eliminates the need for pre-activation of the immune cells prior to administration of the viral particle.
- the method comprises no pre-activation of the immune cells in the subject prior to administration of the viral particle (e.g., no pre-activation within about 1, 2, 3, 4, 5, 6, or 7 days, or within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 weeks prior to administration of the viral particle).
- pre-activation of the immune cells comprises activating the CD3 and/or CD28 signaling in the immune cells (e.g., T cells), optionally by administering anti-CD3 and/or anti-CD28 antibodies, respectively.
- the method of the disclosure does not comprise administering separate CD3 and/or CD28 activating agents prior to administration of the viral particle.
- a polynucleotide encoding a chimeric antigen receptor (CAR) is administered to the subject which allows the production of the CAR in vivo.
- the administration of such polynucleotide generates similar effect in vivo as direct administration of the CAR.
- the administration of such polynucleotide improves the in vivo transduction efficiency of a particle.
- the polynucleotide is an mRNA.
- in vivo delivery of such polynucleotides generates CAR expression over time (e.g., starting within hours and lasting several days).
- in vivo delivery of such polypeptides results in desirable pharmacokinetics, pharmacodynamics and/or safety profile of the encoded CAR.
- the polynucleotide may be optimized by one or more means to prevent immune activation, increase stability, reduce any tendency to aggregate, such as over time, and/or to avoid impurities.
- Such optimization may include the use of modified nucleosides, modified, and/or particular 5' UTRs, 3'UTRs, and/or poly(A) tail modifications for improved intracellular stability and translational efficiency (see, e.g., Stadler et al., 2017, Nat. Med.). Such modifications are known in the art.
- the viral particle of the present disclosure can transduce T cells in vivo to express an anti-CD19 CAR and target CD19-expressing tumor cells.
- the viral particle has a multi-step mechanism of action:
- the viral particle binds to T cells in vivo via an anti-CD3 scFv, activates the T cells and facilitates viral particle internalization through interaction with the Cocal glycoprotein
- the transduced T cells express the anti-CD19 CAR and target CD19-expressing cells, while also expressing the FRB and RACR system for rapamycin-controlled cytokine signaling.
- the viral particle is administered via a route selected from the group consisting of parenteral, intravenous, intramuscular, subcutanous, intratumoral, intraperitoneal, and intralymphatic. In some embodiments, the viral particle is administered multiple times. In some embodiments, the viral particle is administered by intralymphatic injection of the viral particle. In some embodiments, the viral particle is administered by intraperitoneal injection of the viral particle. In some embodiments, the viral particle is administered by intra-nodal injection - that is, the viral particle may be administered via injection into a lymph node, such as an inguinal lymph node. In some embodiments, the viral particle is administered by injection of the viral particle into tumor sites (i.e. intratumoral).
- the viral particle is administered subcutaneously. In some embodiments, the viral particle is administered systemically. In some embodiments, the viral particle is administered intravenously. In some embodiments, the viral particle is administered intraarterially. In some embodiments, the viral particle is a lentiviral particle.
- the viral particle is administered by intraperitoneal, subcutaneous, or intranodal injection. In some embodiments, the viral particle is administered by intraperitoneal injection. In some embodiments, the viral particle is administered by subcutaneous injection. In some embodiments, the viral particle is administered by intranodal injection.
- the transduced immune cells comprising the polynucleotide of the present disclosure is administered to the subject.
- the viral particle is administered as a single injection. In some embodiments, the viral particle is administered as at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 injections.
- the viral particle comprises a polynucleotide.
- the polynucleotide encodes at least one therapeutic polypeptide.
- therapeutic polypeptide refers to a polypeptide which is being developed for therapeutic use, or which has been developed for therapeutic use.
- the therapeutic polypeptide is expressed in target cells (e.g., host T cells) for therapeutic use.
- the therapeutic polypeptide comprises a T cell receptor, a chimeric antigen receptor, or a cytokine receptor.
- the viral particle as described herein is a retroviral particle.
- the viral particle is a lentiviral particle.
- the viral particle is an adeno-associated virus particle.
- viral particle refers to a macromolecular complex capable of transferring a nucleic acid into a cell.
- Viral vectors contain structural and/or functional genetic elements that are primarily derived from a virus.
- the term “retroviral vector” refers to a viral vector containing structural and functional genetic elements, or portions thereof, that are primarily derived from a retrovirus.
- the term “lentiviral vector” refers to a viral vector containing structural and functional genetic elements, or portions thereof, including LTRs that are primarily derived from a lentivirus.
- hybrid refers to a vector, LTR or other nucleic acid containing both retroviral, e.g., lentiviral, sequences and non-lentiviral viral sequences.
- a hybrid vector refers to a vector or transfer plasmid comprising retroviral, e.g., lentiviral, sequences for reverse transcription, replication, integration and/or packaging.
- the lentiviral particle of the present disclosure is a replication incompetent, self-inactivating (SIN) lentiviral vector (LVV) particle comprising:
- a surface-engineered viral envelope that includes expression of a membrane-bound anti-CD3 single-chain variable fragment (scFv) and the Cocal glycoprotein.
- scFv membrane-bound anti-CD3 single-chain variable fragment
- a 2 nd generation anti-CD19 chimeric antigen receptor comprising the binding domain FMC63 and the 4-1BB and CD3zeta signaling domains;
- T-cell proliferative signaling system rapamycin-activated cytokine receptor, RACR
- a human protein domain derived from the mammalian target of rapamycin (mTOR) complex that binds intracellular rapamycin to confer rapamycin-resi stance to transduced cells.
- Retroviruses include lentiviruses, gamma-retroviruses, and alpha-retroviruses, each of which may be used to deliver polynucleotides to cells using methods known in the art.
- Lentiviruses are complex retroviruses, which, in addition to the common retroviral genes gag, pol, and env, contain other genes with regulatory or structural function. The higher complexity enables the virus to modulate its life cycle, as in the course of latent infection.
- Illustrative lentiviruses include but are not limited to: HIV (human immunodeficiency virus; including HIV type 1, and HIV type 2; visna-maedi virus (VMV) virus; the caprine arthritis-encephalitis virus (CAEV); equine infectious anemia virus (EIAV); feline immunodeficiency virus (FIV); bovine immune deficiency virus (BIV); and simian immunodeficiency virus (SIV).
- the backbones are HIV-based vector backbones (i.e., HIV cis-acting sequence elements). Retroviral particles have been generated by multiply attenuating the HIV virulence genes, for example, the genes env, vif, vpr, vpu and nef are deleted, making the vector biologically safe.
- Illustrative lentiviral particles include those described in Naldini et al. (1996) Science 272:263-7; Zufferey et al. (1998) J. Virol. 72:9873-9880; Dull et al. (1998) J. Virol. 72:8463- 8471; U.S. Pat. No. 6,013,516; and U.S. Pat. No. 5,994,136, which are each incorporated herein by reference in their entireties.
- these particles are configured to carry the essential sequences for selection of cells containing the particle, for incorporating foreign nucleic acid into a lentiviral particle, and for transfer of the nucleic acid into a target cell.
- a commonly used lentiviral particles system is the so-called third-generation system.
- Third-generation lentiviral particles systems include four plasmids.
- the “transfer plasmid” encodes the polynucleotide sequence that is delivered by the lentiviral vector system to the target cell.
- the transfer plasmid generally has one or more transgene sequences of interest flanked by long terminal repeat (LTR) sequences, which facilitate integration of the transfer plasmid sequences into the host genome.
- LTR long terminal repeat
- transfer plasmids are generally designed to make the resulting particles replication incompetent.
- the transfer plasmid lacks gene elements necessary for generation of infective particles in the host cell.
- the transfer plasmid may be designed with a deletion of the 3’ LTR, rendering the virus “self-inactivating” (SIN). See Dull et al. (1998) J. Virol. 72:8463-71; Miyoshi et al. (1998) J. Virol. 72:8150-57.
- the viral particle may also comprise a 3' untranslated region (UTR) and a 5' UTR.
- the UTRs comprise retroviral regulatory elements that support packaging, reverse transcription and integration of a proviral genome into a cell following contact of the cell by the retroviral particle.
- Third-generation systems also generally include two “packaging plasmids” and an “envelope plasmid.”
- the “envelope plasmid” generally encodes an Env gene operatively linked to a promoter.
- the Env gene is VSV-G and the promoter is the CMV promoter.
- the Env gene is Cocal G protein (Cocal glycoprotein) and the promoter is the MND (myeloproliferative sarcoma virus enhancer, negative control region deleted, dl587rev primer-binding site substituted) promoter.
- the Env gene is Cocal G protein (Cocal glycoprotein) and the promoter is the CMV promoter.
- the third-generation system uses two packaging plasmids, one encoding gag and pol and the other encoding rev as a further safety feature — an improvement over the single packaging plasmid of so-called second-generation systems. Although safer, the third-generation system can be more cumbersome to use and result in lower viral titers due to the addition of an additional plasmid.
- Exemplary packing plasmids include, without limitation, pMD2.G, pRSV-rev, pMDLG-pRRE, and pRRL-GOI.
- the packaging cell line is a cell line whose cells are capable of producing infectious retroviral particles when the transfer plasmid, packaging plasmid(s), and envelope plasmid are introduced into the cells.
- Various methods of introducing the plasmids into the cells may be used, including transfection or electroporation.
- a packaging cell line is adapted for high- efficiency packaging of a retroviral particle system into retroviral particles.
- retroviral particle refers to a viral particle that includes a polynucleotide encoding a heterologous protein (e.g. a chimeric antigen receptor), one or more capsid proteins, and other proteins necessary for transduction of the polynucleotide into a target cell.
- Retroviral particles and lentiviral particles generally include an RNA genome (derived from the transfer plasmid), a lipid-bilayer envelope in which the Env protein is embedded, and other accessory proteins including integrase, protease, and matrix protein.
- the ex vivo efficiency of a retroviral or lentiviral particle system may be assessed in various ways known in the art, including measurement of vector copy number (VCN) or vector genomes (vg) such as by quantitative polymerase chain reaction (qPCR), digital droplet PCR (ddPCR) or titer of the virus in infectious units per milliliter (lU/mL).
- VCN vector copy number
- vg vector genomes
- qPCR quantitative polymerase chain reaction
- ddPCR digital droplet PCR
- titer of the virus in infectious units per milliliter titer may be assessed using a functional assay performed on the cultured tumor cell line HT1080 as described in Humbert et al. Development of Third-generation Cocal Envelope Producer Cell Lines for Robust Retroviral Gene Transfer into Hematopoietic Stem Cells and T-cells. Molecular Therapy 24:1237-1246 (2016).
- the retroviral particles and/or lentiviral particles of the disclosure comprise a polynucleotide comprising a sequence encoding a receptor that specifically binds to a hapten.
- a sequence encoding a receptor that specifically binds to the hapten is operatively linked to a promoter.
- Illustrative promoters include, without limitation, a cytomegalovirus (CMV) promoter, a CAG promoter, an SV40 promoter, an SV40/CD43 promoter, an EF-la promoter, and a MND promoter.
- CMV cytomegalovirus
- the polynucleotide encoding the chimeric antigen receptor is operatively linked to one or more promoters.
- the promoter is an inducible promoter.
- the promoter is CMV.
- the promoter is MND.
- the polynucleotide encoding the RACR is operatively linked to one or more promoters.
- the promoter is an inducible promoter.
- the promoter is CMV.
- the promoter is MND.
- the retroviral particles comprise transduction enhancers. In some embodiments, the retroviral particles comprise a polynucleotide comprising a sequence encoding a T cell activator protein. In some embodiments, the retroviral particles comprise a polynucleotide comprising a sequence encoding a hapten-binding receptor. In some embodiments, the retroviral particles comprise tagging proteins.
- each of the retroviral particles comprises a polynucleotide comprising, in 5' to 3' order: (i) a 5' long terminal repeat (LTR) or untranslated region (UTR), (ii) a promoter, (iii) a sequence encoding a receptor that specifically binds to the hapten, and (iv) a 3' LTR or UTR.
- LTR 5' long terminal repeat
- UTR untranslated region
- the retroviral particles comprise a cell surface receptor that binds to a ligand on a target host cell, allowing host cell transduction.
- the viral particle may comprise a heterologous viral envelope glycoprotein yielding a pseudotyped viral particle.
- the viral envelope glycoprotein may be derived from RD114 or one of its variants, VSV-G, Gibbon-ape leukemia virus (GALV), or is the Amphotropic envelope, Measles envelope or baboon retroviral envelope glycoprotein.
- the viral envelope glycoprotein is a VSV G protein from the Cocal strain (Cocal glycoprotein) or a functional variant thereof.
- the viral envelope glycoprotein is a VSV G protein from the Cocal strain (Cocal glycoprotein) is a Cocal envelope variant containing the R354Q mutation, this variant may be referred to as “blinded” Cocal envelope.
- Illustrative Cocal envelope variants are provided in, e.g., US 2020/0216502 Al, which is incorporated herein by reference in its entirety.
- the viral particle comprises a polypeptide comprising a Cocal glycoprotein that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 5.
- the viral particle comprises a nucleic acid sequence encoding a Cocal glycoprotein that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 10.
- the viral particle comprises a nucleic acid sequence encoding a Cocal glycoprotein that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 104.
- the viral particle comprises a polynucleotide comprising CD8 derived signal peptide sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 1.
- CD8 signal peptide MALPVTALLLPLALLLHAARP (SEQ ID NO: 1).
- the viral particle comprises a nucleic acid sequence encoding a CD8 derived signal peptide that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 6.
- CD8 signal peptide :
- CACGCCCA (SEQ ID NO: 6).
- the cell surface receptor is anti-CD3 single-chain variable fragment or a functional variant thereof.
- fusion glycoproteins can be used to pseudotype lentiviral particles. While the most commonly used example is the envelope glycoprotein from vesicular stomatitis virus (VSV-G), many other viral proteins have also been used for pseudotyping of lentiviral particles. See Joglekar et al. Human Gene Therapy Methods 28:291-301 (2017). The present disclosure contemplates substitution of various fusion glycoproteins. Notably, some fusion glycoproteins result in higher viral particle efficiency.
- VSV-G vesicular stomatitis virus
- pseudotyping a fusion glycoprotein or functional variant thereof facilitates targeted transduction of specific cell types, including, but not limited to, T cells or NK-cells.
- the fusion glycoprotein or functional variant thereof is/are full-length polypeptide(s), functional fragment(s), homolog(s), or functional variant(s) of Human immunodeficiency virus (HIV) gpl60, Murine leukemia virus (MLV) gp70, Gibbon ape leukemia virus (GALV) gp70, Feline leukemia virus (RD114) gp70, Amphotropic retrovirus (Ampho) gp70, 10A1 MLV (10A1) gp70, Ecotropic retrovirus (Eco) gp70, Baboon ape leukemia virus (BaEV) gp70, Measles virus (MV) H and F, Nipah virus (NiV) H and F, Rabies virus (RabV) G, Mokol
- the fusion glycoprotein or functional variant thereof is a full- length polypeptide, functional fragment, homolog, or functional variant of the G protein of Vesicular Stomatitis Alagoas Virus (VSAV), Carajas Vesiculovirus (CJSV), Chandipura Vesiculovirus (CHPV), Cocal Vesiculovirus (COCV), Vesicular Stomatitis Indiana Virus (VSIV), Isfahan Vesiculovirus (ISFV), Maraba Vesiculovirus (MARAV), Vesicular Stomatitis New Jersey virus (VSNJV), Bas-Congo Virus (BASV).
- the fusion glycoprotein or functional variant thereof is the Cocal virus G protein.
- the viral particle is a Nipah virus (NiV) envelope pseudotyped lentivirus particle (“Nipah envelope pseudotyped vector”).
- Nipah envelope pseudotyped vector is pseudotyped using Nipah virus envelope glycoproteins NiV-F and NiV-G.
- the NiV-F and/or NiV-G glycoproteins on such Nipah envelope pseudotyped vector are modified variants.
- the NiV-F and/or NiV-G glycoproteins on such Nipah envelope pseudotyped vector are modified to include an antigen binding domain.
- the antigen is EpCAM, CD4, or CD8.
- the Nipah envelope pseudotyped vector can efficiently transduce cells expressing EpCAM, CD4, or CD8. See US. Pat. No. 9,486,539 and Bender et al. PLoS Pathog. (2016) Jun; 12(6): el005641.
- the glycoprotein on an envelope pseudotyped viral particle is modified to include an antigen binding domain.
- the antigen is CD3.
- the envelope pseudotyped viral particle can efficiently transduce cells expressing CD3.
- the antigen binding domain is an anti-CD3 singlechain variable fragment (scFv).
- the antigen binding domain is an anti- CD3 humanized murine scFv.
- the envelope pseudotyped viral particle is modified to include a fusion glycoprotein or functional variant thereof and an antigen binding domain or functional variant thereof. In some embodiments, the envelope pseudotyped viral particle is modified to include the Cocal virus G protein or functional variant thereof and an anti-CD3 scFv or functional variant thereof.
- the retroviral vector particle is surface-engineered.
- Illustrative methods of surface-engineering a retroviral vector particle are provided in, e.g., WO 2019/200056, PCT/US2019/062675, and US 62/916,110, each of which is incorporated herein by reference in its entirety.
- the retroviral particle is surface-engineered to include a fusion glycoprotein or functional variant thereof and an antigen binding domain or functional variant thereof. In some embodiments, the retroviral particle is surface-engineered to include the Cocal virus G protein or functional variant thereof and an anti-CD3 scFv or functional variant thereof.
- non-viral proteins capable of viral surface display are provided by the present disclosure.
- the non-viral proteins are co-stimulatory molecules.
- lentiviral transduction in vitro requires additional of an exogenous activating agent, such as a “stimbead,” for example DynabeadsTM Human T-Activator aCD3/aCD28.
- the retroviral (e.g. lentiviral) vectors of the present disclosure incorporate one or more copies of non-viral proteins such as T-cell activation or co-stimulation molecule(s).
- T-cell activation or co-stimulation molecule(s) in the particle may render the particle capable of activating and efficiently transducing T cells in the absence of, or in the presence of lower amounts of, an exogenous activating agent, i.e. without a stimbead or equivalent agent.
- the T-cell activation or co-stimulation molecule may be selected from the group consisting of an anti-CD3 antibody, CD28 ligand (CD28L), and 41bb ligand (41BBL or CD137L).
- Various T-cell activation or co-stimulation molecules are known in the art and include, without limitation, agents that specifically bind any of the T-cell expressed proteins CD3, CD28, CD134 also known as 0X40, or 41bb also known as 4-1BB or CD137 or TNFRSF9.
- an agent that specifically binds CD3 may be an anti-CD3 antibody (e.g., OKT3, CRIS-7 or I2C) or an antigen-binding fragment of an anti-CD3 antibody.
- an agent that specifically binds CD3 is a single chain Fv fragment (scFv) of an anti-CD3 antibody.
- the viral particle comprises a polypeptide comprising an anti- CD3 scFv (CD3 VL - linked to a CD3 VH by 3x G4S linkers) that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 2.
- an anti- CD3 scFv CD3 VL - linked to a CD3 VH by 3x G4S linkers
- DIQMTQ SP SLS AS VGDRVTITC S AS S S VS YMNW YQQTPGK APKRWIYDTSKL ASGV PSRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSNPFTFGQGTKLQITRTSGGGGSGG GGSGGGGSQVQLVQSGGGVVQPGRSLRLSCKASGYTFTRYTMHWVRQAPGKGLE WIGYINPSRGYTNYNQKVKDRFTISRDNSKNTAFLQMDSLRPEDTGVYFCARYYDD HYCLDYWGQGTPVTVSSAAAKP (SEQ ID NO: 2).
- CDR complementary determining regions
- SEQ ID NO: 133 The complementary determining regions (CDR) of this scFv are SASSSVSYMN (CDR-L1; SEQ ID NO: 133), DTSKLASG (CDR-L2; SEQ ID NO: 134), QQWSSNPFT (CDR-L3; SEQ ID NO: 135), RYTMH (CDR-H1; SEQ ID NO: 144), YINPSRGYTNYNQKVKD (CDR-H2; SEQ ID NO: 136), and YYDDHYCLDY (CDR-H3; SEQ ID NO: 137).
- the viral particle comprises a polypeptide comprising an anti-CD3 scFv having these CDRs, wherein optionally the anti-CD3 scFv shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 2.
- the viral particle comprises a nucleic acid sequence encoding an anti-CD3 scFv (CD3 VL - linked to a CD3 VH by 3x G4S linkers) that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 7.
- Anti-CD3 scFv (VL-G4S x 3 linker- VH): GATATCCAGATGACCCAGTCCCCAAGCTCCCTGAGCGCCTCCGTGGGCGACCGG GTGACAATCACCTGCAGCGCCTCTAGCTCCGTGTCCTACATGAACTGGTATCAGC AGACACCTGGCAAGGCCCCAAAGAGATGGATCTACGATACCAGCAAGCTGGCCT CCGGCGTGCCTTCTAGGTTTTCTGGCAGCGGCTCCGGCACAGATTATACATTCAC CATCTCTAGCCTGCAGCCAGAGGACATCGCCACCTACTATTGCCAGCAGTGGTCC TCTAATCCCTTTACATTCGGCCAGGGCACCAAGCTGCAGATCACAAGAACCTCTG GAGGAGGAGGAAGCGGAGGAGGAGGATCCGGCGGCGGCGGCTCTCAGGTGCAG CTGGTGCAGAGCGGAGGAGGATCCGGCGGCGGCGGCTCTCAGGTGCAG CTGGTGCAGAGCGGAGGAGGATCCGGCGGCGGCG
- the viral particle comprises a polypeptide comprising an anti- CD3 scFv (CD3 VL - linked to a CD3 VH by 3x G4S linkers) that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 12.
- Anti-CD3 scFv VL-G4S x 3 linker- VH:
- DIQMTQ SP SLS AS VGDRVTITC S AS S S VS YMNW YQQTPGK APKRWIYDTSKL ASGV PSRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSNPFTFGQGTKLQITRTSGGGGSGG GGSGGGGSQVQLVQSGGGVVQPGRSLRLSCKASGYTFTRYTMHWVRQAPGKGLE WIGYINPSRGYTNYNQKVKDRFTISRDNSKNTAFLQMDSLRPEDTGVYFCARYYDD HYCLDYWGQGTPVTVSSAS (SEQ ID NO: 12).
- CDR complementary determining regions
- SEQ ID NO: 133 The complementary determining regions (CDR) of this scFv are SASSSVSYMN (CDR-L1; SEQ ID NO: 133), DTSKLASG (CDR-L2; SEQ ID NO: 134), QQWSSNPFT (CDR-L3; SEQ ID NO: 135), RYTMH (CDR-H1; SEQ ID NO: 144), YINPSRGYTNYNQKVKD (CDR-H2; SEQ ID NO: 136), and YYDDHYCLDY (CDR-H3; SEQ ID NO: 137).
- the viral particle comprises a polypeptide comprising an anti-CD3 scFv having these CDRs, wherein optionally the anti-CD3 scFv shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 12.
- the viral particle comprises a nucleic acid sequence encoding an anti-CD3 scFv (CD3 VL - linked to a CD3 VH by 3x G4S linkers) that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 15.
- an anti-CD3 scFv CD3 VL - linked to a CD3 VH by 3x G4S linkers
- Anti-CD3 scFv (VL-G4S x 3 linker- VH): GACATCCAGATGACCCAGTCTCCTAGCAGCCTCAGCGCTAGCGTGGGCGATAGA GTGACCATCACATGTAGCGCCAGCAGCAGCGTGTCCTACATGAACTGGTACCAG CAAACACCTGGAAAGGCCCCTAAAAGGTGGATCTATGACACATCTAAGCTGGCT TCTGGAGTGCCATCTAGATTTTCTGGCAGCGGCTCCGGCACTGATTATACATTCA CCATCAGCAGCCTGCAGCCCGAGGATATCGCCACCTACTACTGTCAGCAGTGGTC CTCTAATCCCTTCACCTTCGGCCAGGGCACCAAGCTGCAGATCACCAGAACCAGC GGCGGGGGAGGAAGCGGCGGGGGAGGATCTGGCGGCGGCGGCAGCCAGGTGCA
- the viral particle comprises a polypeptide comprising an anti- CD3 scFv comprising a CD3 VL linked to a CD3 VH by 3x G4S linkers.
- the viral particle comprises a nucleic acid sequence encoding an anti-CD3 scFv comprising a CD3 VL linked to a CD3 VH by 3x G4S linkers.
- the viral particle comprises a polypeptide comprising a Gaussia luciferase signal peptide, operably linked to an anti-CD3 scFv, operably linked to a hinge domain, operably linked to a Cocal envelope derived transmembrane domain and cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 107.
- the viral particle comprises a nucleic acid encoding a Gaussia luciferase signal peptide, operably linked to an anti-CD3 scFv, operably linked to a hinge domain, operably linked to a Cocal envelope derived transmembrane domain and cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 108.
- the viral particle comprises a polypeptide comprising a Gaussia luciferase signal peptide, operably linked to an anti-CD3 scFv, operably linked to a hinge domain, operably linked to a Cocal envelope derived transmembrane domain and cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 109.
- the viral particle comprises a nucleic acid encoding a Gaussia luciferase signal peptide, operably linked to an anti-CD3 scFv, operably linked to a hinge domain, operably linked to a Cocal envelope derived transmembrane domain and cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 110.
- aCD3scFv_long hinge TM CT pUMJ_163
- the viral particle comprises a polypeptide comprising a Gaussia luciferase signal peptide, operably linked to an anti-CD3 scFv, operably linked to a linker, operably linked to a Glycophorin A derived transmembrane domain and HIV envelope derived cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 111.
- the viral particle comprises a nucleic acid encoding a Gaussia luciferase signal peptide, operably linked to an anti-CD3 scFv, operably linked to a linker, operably linked to a Glycophorin A derived transmembrane domain and HIV envelope derived cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 112.
- the viral particle comprises a nucleic acid encoding a Gaussia luciferase signal peptide, operably linked to an anti-CD3 scFv, operably linked to a linker, operably linked to a HIV envelope derived transmembrane domain and cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 114.
- the viral particle comprises a polypeptide comprising a Gaussia luciferase signal peptide, operably linked to an anti-CD3 scFv, operably linked to a triple G4Slinker, operably linked to a HIV envelope derived transmembrane domain and cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 115.
- the viral particle comprises a nucleic acid encoding a Gaussia luciferase signal peptide, operably linked to an anti-CD3 scFv, operably linked to a triple G4Slinker, operably linked to a HIV envelope derived transmembrane domain and cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 116.
- the viral particle comprises a polypeptide comprising a Gaussia luciferase signal peptide, operably linked to an anti-CD3 scFv, operably linked to a hinge domain, operably linked to a Cocal envelope derived transmembrane domain, cytoplasmic tail, and T2A self-cleaving peptide, operably linked to a Cocal envelope that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 117.
- the viral particle comprises a nucleic acid encoding a Gaussia luciferase signal peptide, operably linked to an anti-CD3 scFv, operably linked to a hinge domain, operably linked to a Cocal envelope derived transmembrane domain, cytoplasmic tail, and T2A self-cleaving peptide, operably linked to a Cocal envelope that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 118.
- anti-CD3scFv_short hinge TM CT _T2A_ Cocal envelope [0273] anti-CD3scFv_short hinge TM CT _T2A_ Cocal envelope:
- the viral particle comprises a polypeptide comprising a Gaussia luciferase signal peptide, operably linked to an anti-CD3 scFv, operably linked to a linker, operably linked to a Glycophorin A derived hinge, transmembrane domain, and cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 119.
- the viral particle comprises a nucleic acid encoding a Gaussia luciferase signal peptide, operably linked to an anti-CD3 scFv, operably linked to a linker, operably linked to a Glycophorin A derived hinge, transmembrane domain, and cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 120.
- the T-cell activation or co-stimulation molecule is selected from the group consisting of an anti-CD3 antibody, a ligand for CD28 (e.g., CD28L), and 41bb ligand (41BBL or CD137L).
- CD86 also known as B7-2, is a ligand for both CD28 and CTLA- 4.
- the ligand for CD28 is CD86.
- CD80 is an additional ligand for CD28.
- the ligand for CD28 is CD80.
- the ligand for CD28 is an anti-CD28 antibody or an anti-CD28 scFv coupled to a transmembrane domain for display on the surface of the vector.
- the co-stimulation molecule is CD80.
- Viral particles comprising one or more T-cell activation or co-stimulation molecule(s) may be made by engineering the packaging cell line by methods provided by WO 2016/139463; or by expression of the T-cell activation or co-stimulation molecule(s) from a polycistronic helper vector as described in IntT Pat. Pub. No. WO 2020/106992 Al.
- the viral particle comprises CD 19, or a functional fragment thereof, coupled to its native transmembrane domain or a heterologous transmembrane domain.
- CD 19 acts as a ligand for blinatumomab, thus providing an adapter for coupling the particle to T-cells via the anti-CD3 moiety of blinatumomab.
- another type of particle surface ligand can serve to couple an appropriately surface engineered lentiviral particle to a T-cell using a multispecific antibody comprising a binding moiety for the particle surface ligand.
- the multispecific antibody is a bispecific antibody, for example, a Bispecific T-cell engager (BiTE).
- the non-viral protein may be a cytokine.
- the cytokine may be selected from the group consisting of IL-15, IL-7, and IL-2.
- the non-viral protein used is a soluble protein (such as an scFv or a cytokine) it may be tethered to the surface of the lentiviral particle by fusion to a transmembrane domain, such as the transmembrane domain of CD8. Alternatively, it may be indirectly tethered to the lentiviral particle by use of a transmembrane protein engineered to bind the soluble protein. Further inclusion of one or more cytoplasmic residues may increase the stability of the fusion protein.
- the surface-engineered vector comprises a transmembrane protein comprising a mitogenic domain and/or cytokine-based domain.
- the mitogenic domain binds a T cell surface antigen, such as CD3, CD28, CD134 and CD137.
- the mitogenic domain binds to a CD3s chain.
- CD28 is one of the proteins expressed on T cells that provide co-stimulatory signals required for T cell activation and survival.
- T cell stimulation through CD28 in addition to the T-cell receptor (TCR) can provide a potent signal for the production of various interleukins (IL-6 in particular).
- CD 134 also known as 0X40, is a member of the TNFR-superfamily of receptors which is not constitutively expressed on resting naive T cells, unlike CD28. Expression of 0X40 is dependent on full activation of the T cell; without CD28, expression of 0X40 is delayed and of fourfold lower levels.
- CD137 also known as 4-1BB, is a member of the tumor necrosis factor (TNF) receptor family.
- CD137 can be expressed by activated T cells, but to a larger extent on CD8 than on CD4 T cells.
- CD137 expression is found on dendritic cells, follicular dendritic cells, natural killer cells, granulocytes and cells of blood vessel walls at sites of inflammation.
- the best characterized activity of CD137 is its costimulatory activity for activated T cells.
- Crosslinking of CD 137 enhances T cell proliferation, IL-2 secretion survival and cytolytic activity.
- the mitogenic domain may comprise all or part of an antibody or other molecule which specifically binds a T-cell surface antigen.
- the antibody may activate the TCR or CD28.
- the antibody may bind the TCR, CD3 or CD28.
- examples of such antibodies include: OKT3, 15E8 and TGN1412.
- Other suitable antibodies include: Anti-CD28: CD28.2, 10F3; Anti-CD3/TCR: UCHT1, YTH12.5, TR66.
- the mitogenic domain may comprise the binding domain from OKT3, 15E8, TGN1412, CD28.2, 10F3, UCHT1, YTH12.5 or TR66.
- the mitogenic domain may comprise all or part of a co-stimulatory molecule such as OX40L and 41 BBL.
- the mitogenic domain may comprise the binding domain from OX40L or 41 BBL.
- the vector comprises an anti-CD3s antibody, or antigen-binding fragment thereof, coupled to a transmembrane domain.
- An illustrative anti-CD3s antibody is OKT3.
- OKT3 also known as Murom onab-CD3, is a monoclonal antibody targeted at the CD3s chain.
- the vector comprises a ligand for 4-1BB, or functional fragment thereof, coupled to its native transmembrane domain or a heterologous transmembrane domain.
- 4-1BBL is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for 4-1BB, which is a costimulatory receptor molecule in T lymphocytes. 4-1BBL has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation.
- TNF tumor necrosis factor
- the mitogenic transduction enhancer and/or cytokine- based transduction enhancer may comprise a “spacer sequence” to connect the antigen-binding domain with the transmembrane domain.
- a flexible spacer allows the antigen-binding domain to orient in different directions to facilitate binding.
- the term “coupled to” refers to a chemical linkage, a direct C-terminal to N-terminal fusion of two protein; chemical linkage to a non-peptide space; chemical linkage to a polypeptide space; and C-terminal to N-terminal fusion of two protein via peptide bonds to a polypeptide spacer, e.g., a spacer sequence.
- the spacer sequence may, for example, comprise an IgGl Fc region, an IgGl hinge or a human CD8 stalk or the mouse CD8 stalk.
- the spacer may alternatively comprise an alternative linker sequence which has similar length and/or domain spacing properties as an IgGl Fc region, an IgGl hinge or a CD8 stalk.
- a human IgGl spacer may be altered to remove Fc binding motifs.
- the spacer sequence may be derived from a human protein.
- the spacer sequence comprises a CD8 derived hinge.
- the spacer sequence comprises a ‘short’ hinge.
- the short hinge is described as hinge region comprising fewer nucleotides relative to CAR hinge regions known in the art.
- the viral particle comprises a polypeptide comprising a CD8 hinge that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 3.
- CD8 hinge TTTPAPRPPTPAPTIASQPLSLRPEASRPAAGGAVHTRGLDFASD (SEQ ID NO: 3).
- the viral particle comprises a nucleic acid sequence encoding a CD8 hinge that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 8.
- the viral particle comprises a polypeptide comprising a short hinge operably linked to a transmembrane domain operably linked to a cytoplasmic tail derived from the Cocal glycoprotein that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 13.
- the viral particle comprises a nucleic acid sequence encoding a short hinge operably linked to a transmembrane domain operably linked to a cytoplasmic tail derived from the Cocal glycoprotein that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 16.
- the viral particle comprises a polypeptide comprising a long hinge operably linked to a transmembrane domain operably linked to a cytoplasmic tail derived from the Cocal glycoprotein that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 19.
- the viral particle comprises a nucleic acid sequence encoding a long hinge operably linked to a transmembrane domain operably linked to a cytoplasmic tail derived from the Cocal glycoprotein that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 22.
- the viral particle comprises a polypeptide comprising a 218 linker operably linked to a human Glycophorin A ectodomain transmembrane domain operably linked to a cytoplasmic tail derived from a HIV viral envelope that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 25.
- the viral particle comprises a nucleic acid sequence encoding a 218 linker operably linked to a human Glycophorin A ectodomain transmembrane domain operably linked to a cytoplasmic tail derived from a HIV viral envelope that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 28.
- the viral particle comprises a polypeptide comprising a 218 linker operably linked to a HIV viral envelope transmembrane domain and cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 31.
- the viral particle comprises a nucleic acid sequence encoding a 218 linker operably linked to a HIV viral envelope transmembrane domain and cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 34.
- the viral particle comprises a polypeptide comprising a triple G4S linker operably linked to a HIV viral envelope transmembrane domain and cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 37.
- the viral particle comprises a nucleic acid sequence encoding a triple G4S linker operably linked to a HIV viral envelope transmembrane domain and cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 40.
- the viral particle comprises a polypeptide comprising a Ser-Gly peptide operably linked to small ectodomain, transmembrane and cytoplasmic tail sequences derived from human Glycophorin A that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 97.
- the underlined sequence denotes the transmembrane domain fragment.
- the viral particle comprises a nucleic acid sequence encoding a Ser-Gly peptide operably linked to small ectodomain, transmembrane and cytoplasmic tail sequences derived from human Glycophorin A that shares that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 98.
- CAGCGTGGAAATCGAGAACCCCGAAACCAGCGACCAG (SEQ ID NO: 98).
- the viral particle comprises a polypeptide comprising transmembrane domain and cytoplasmic tail sequences derived from human Glycophorin A that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 105.
- the viral particle comprises a nucleic acid sequence encoding a hinge operably linked to a Glycophorin A transmembrane domain and cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 106.
- the viral particle comprises a polypeptide comprising a short hinge operably linked to a Cocal glycoprotein transmembrane domain and cytoplasmic tail that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 43.
- the viral particle comprises a nucleic acid sequence encoding a short hinge operably linked to a Cocal glycoprotein transmembrane domain and cytoplasmic tail operably linked to a T2A linker that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 47.
- Short hinge-TM-CT from Cocal Env_T2A is a nucleic acid sequence encoding a short hinge operably linked to a Cocal glycoprotein transmembrane domain and cytoplasmic tail operably linked to a T2A linker that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 47.
- the viral particle comprises a polypeptide comprising a CD4 derived transmembrane domain and cytoplasmic tail operably linked to a T2 A linker that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 4.
- CD4 TM and cytoplasmic tail_T2A MALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQGSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 4).
- the viral particle comprises a nucleic acid sequence encoding a CD4 derived transmembrane domain and cytoplasmic tail operably linked to a T2A linker that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 9.
- CD4 TM and cytoplasmic tail_T2A are identical to CD4 TM and cytoplasmic tail_T2A:
- the viral particle comprises a polypeptide comprising a Gaussia luciferase derived signal peptide sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 11.
- Gaussia luciferase SP MGVKVLFALICIAVAEA (SEQ ID NO: 11).
- the viral particle comprises a nucleic acid sequence encoding a Gaussia luciferase derived signal peptide that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 14.
- Gaussia luciferase SP ATGGGCGTGAAAGTGCTGTTCGCCCTGATCTGCATCGCAGTTGCTGAAGCC (SEQ ID NO: 14).
- the transmembrane domain is the sequence of the mitogenic transduction enhancer and/or cytokine-based transduction enhancer that spans the membrane.
- the transmembrane domain may comprise a hydrophobic alpha helix.
- the transmembrane domain may be derived from CD28. In some embodiments, the transmembrane domain is derived from a human protein.
- the viral particle of the present invention may comprise a cytokine-based transduction enhancer in the viral envelope.
- the cytokine-based transduction enhancer is derived from the host cell during viral particle production.
- the cytokine-based transduction enhancer is made by the host cell and expressed at the cell surface. When the nascent viral particle buds from the host cell membrane, the cytokine-based transduction enhancer may be incorporated in the viral envelope as part of the packaging cell- derived lipid bilayer.
- the cytokine-based transduction enhancer may comprise a cytokine domain and a transmembrane domain. It may have the structure C-S-TM, where C is the cytokine domain, S is an optional spacer domain (e.g., a spacer sequence) and TM is the transmembrane domain.
- C is the cytokine domain
- S is an optional spacer domain (e.g., a spacer sequence)
- TM is the transmembrane domain.
- the spacer domain and transmembrane domains are as defined above.
- the cytokine domain may comprise a T-cell activating cytokine, such as from IL2, IL7 and IL15, or a functional fragment thereof.
- a “functional fragment” of a cytokine is a fragment of a polypeptide that retains the capacity to bind its particular receptor and activate T-cells.
- IL2 is one of the factors secreted by T cells to regulate the growth and differentiation of T cells and certain B cells.
- IL2 is a lymphokine that induces the proliferation of responsive T cells. It is secreted as a single glycosylated polypeptide, and cleavage of a signal sequence is required for its activity.
- Solution NMR suggests that the structure of IL2 comprises a bundle of 4 helices (termed A-D), flanked by 2 shorter helices and several poorly defined loops. Residues in helix A, and in the loop region between helices A and B, are important for receptor binding.
- Viral particle envelope expression cassettes are important for receptor binding.
- the viral particles of the present disclosure comprise a viral envelope expression cassette encoding, in 5' to 3' order:
- the viral particles of the present disclosure comprise a viral envelope expression cassette encoding, in 5' to 3' order:
- the viral particles of the present disclosure comprise a viral envelope expression cassette encoding, in 5' to 3' order:
- the viral particles of the present disclosure comprise a viral envelope expression cassette encoding, in 5' to 3' order:
- the viral particles of the present disclosure comprise a viral envelope expression cassette encoding, in 5' to 3' order:
- the viral particles of the present disclosure comprise a viral envelope expression cassette encoding, in 5' to 3' order:
- the viral particles of the present disclosure comprise a viral envelope expression cassette encoding, in 5' to 3' order:
- the viral particle is an adeno-associated virus (AAV) particle.
- AAV is a 4.7 kb, single stranded DNA virus.
- Recombinant particles based on AAV are associated with excellent clinical safety, since wild-type AAV is nonpathogenic and has no etiologic association with any known diseases.
- AAV offers the capability for highly efficient gene delivery and sustained transgene expression in numerous tissues.
- AAV particle is meant a particle derived from an adeno-associated virus serotype, including without limitation, AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAVrh.10, AAVrh.74, etc.
- AAV vectors can have one or more of the AAV wild-type genes deleted in whole or part, e.g., the rep and/or cap genes, but retain functional flanking inverted terminal repeat (ITR) sequences. Functional ITR sequences are necessary for the rescue, replication and packaging of the AAV virion.
- an AAV vector is defined herein to include at least those sequences required in cis for replication and packaging (e.g., functional ITRs) of the virus.
- the ITRs need not be the wild-type nucleotide sequences, and may be altered, e.g. by the insertion, deletion or substitution of nucleotides, as long as the sequences provide for functional rescue, replication and packaging.
- AAV particles may comprise other modifications, including but not limited to one or more modified capsid protein (e.g, VP1, VP2 and/or VP3).
- a capsid protein may be modified to alter tropism and/or reduce immunogenicity.
- the serotype of a recombinant AAV particle is determined by its capsid.
- International Patent Publication No. W02003042397A2 discloses various capsid sequences including those of AAV1, AAV2, AAV3, AAV8, AAV9, and rhlO.
- International Patent Publication No. W02013078316A1 discloses the polypeptide sequence of the VP1 from AAVrh74. Numerous diverse naturally occurring or genetically modified AAV capsid sequences are known in the art.
- Gene delivery viral particles useful in the practice of the present disclosure can be constructed utilizing methodologies known in the art of molecular biology.
- viral vectors carrying transgenes are assembled from polynucleotides encoding the transgene, suitable regulatory elements and elements necessary for production of viral proteins, which mediate cell transduction.
- Such recombinant viruses may be produced by techniques known in the art, e.g, by transfecting packaging cells or by transient transfection with helper plasmids or viruses.
- virus packaging cells include but are not limited to HeLa cells, SF9 cells (optionally with a baculovirus helper vector), 293 cells, etc.
- the viral particles described herein are used to transduce a nucleic acid sequence (polynucleotide) encoding one or more chimeric antigen receptor (CARs) into a cell (e.g., a T lymphocyte).
- a cell e.g., a T lymphocyte
- the transduction of the viral particle results in expression of one or more CARs in the transduced cells.
- CARs are artificial membrane-bound proteins that direct a T lymphocyte to an antigen and stimulate the T lymphocyte to kill cells displaying the antigen. See, e.g., Eshhar, U.S. Pat. No. 7,741,465.
- CARs are genetically engineered receptors comprising an extracellular domain that binds to an antigen, e.g., an antigen on a cell, an optional linker, a transmembrane domain, and an intracellular (cytoplasmic) domain comprising a costimulatory domain and/or a signaling domain that transmits an activation signal to an immune cell.
- a single receptor can be programmed to both recognize a specific antigen and, when bound to that antigen, activate the immune cell to attack and destroy the cell bearing that antigen.
- an immune cell that expresses the CAR can target and kill the tumor cell. All other conditions being satisfied, when a CAR is expressed on the surface of, e.g., a T lymphocyte, and the extracellular domain of the CAR binds to an antigen, the intracellular signaling domain transmits a signal to the T lymphocyte to activate and/or proliferate, and, if the antigen is present on a cell surface, to kill the cell expressing the antigen.
- CARs can comprise a stimulatory and a costimulatory domain such that binding of the antigen to the extracellular domain results in transmission of both a primary activation signal and a costimulatory signal.
- expression of the polycistronic transgene payload is driven by the MND promoter.
- the MND promoter myeloproliferative sarcoma virus enhancer, negative control region deleted, dl587rev primer-binding site substituted
- the MND promoter is a viral-derived synthetic promoter that contains the U3 region of a modified Moloney murine leukemia virus (MoMuLV) LTR with myeloproliferative sarcoma virus enhancer 13 and has high expression in human CD34+ stem cells, lymphocytes, and other tissues.
- MoMuLV Moloney murine leukemia virus
- four separate proteins are expressed, separated by 2A peptide sequences that induce ribosomal skipping and cleavage during translation.
- the CAR is a second- generation CAR comprised of the FMC63 mouse anti -human CD 19 scFv linked to the 4- IBB costimulatory domain and the CD3zeta intracellular signaling domain.
- the intracellular domain of the CAR is or comprises an intracellular domain or motif of a protein that is expressed on the surface of T lymphocytes and triggers activation and/or proliferation of said T lymphocytes.
- a domain or motif is able to transmit a primary antigen-binding signal that is necessary for the activation of a T lymphocyte in response to the antigen's binding to the CAR's extracellular portion.
- this domain or motif comprises, or is, an ITAM (immunoreceptor tyrosine-based activation motif).
- ITAM-containing polypeptides suitable for CARs include, for example, the zeta CD3 chain (CD3Q or ITAM-containing portions thereof.
- the intracellular domain is a CD3( ⁇ intracellular signaling domain.
- the intracellular domain is from a lymphocyte receptor chain, a TCR/CD3 complex protein, an Fc receptor subunit or an IL-2 receptor subunit.
- the intracellular signaling domain of CAR may be derived from the signaling domains of for example 003 ⁇ , CD3s, CD22, CD79a, CD66d or CD39.
- “Intracellular signaling domain,” refers to the part of a CAR polypeptide that participates in transducing the message of effective CAR binding to a target antigen into the interior of the immune effector cell to elicit effector cell function, e.g., activation, cytokine production, proliferation and cytotoxic activity, including the release of cytotoxic factors to the CAR-bound target cell, or other cellular responses elicited following antigen binding to the extracellular CAR domain.
- the intracellular domain of the CAR is the zeta CD3 chain (CD3zeta).
- the viral particle comprises a polypeptide comprising a CAR whose intracellular domain comprises a CD3zeta domain that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 54.
- CD3zeta [0361] CD3zeta:
- the viral particle comprises a nucleic acid encoding the intracellular domain of a CAR comprising a CD3zeta domain that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 66.
- CD3zeta [0363] CD3zeta:
- the CAR additionally comprises one or more co-stimulatory domains or motifs, e.g., as part of the intracellular domain of the polypeptide.
- Co-stimulatory molecules are well-known cell surface molecules other than antigen receptors or Fc receptors that provide a second signal required for efficient activation and function of T lymphocytes upon binding to antigen.
- the one or more co-stimulatory domains or motifs can, for example, be, or comprise, one or more of a co-stimulatory CD27 polypeptide sequence, a co-stimulatory CD28 polypeptide sequence, a co-stimulatory 0X40 (CD 134) polypeptide sequence, a co- stimulatory 4-1BB (CD137) polypeptide sequence, or a co-stimulatory inducible T-cell costimulatory (ICOS) polypeptide sequence, or other costimulatory domain or motif, or any combination thereof.
- a co-stimulatory CD27 polypeptide sequence a co-stimulatory CD28 polypeptide sequence
- a co-stimulatory 0X40 (CD 134) polypeptide sequence a co-stimulatory 4-1BB (CD137) polypeptide sequence
- a co-stimulatory inducible T-cell costimulatory (ICOS) polypeptide sequence or other costimulatory domain or motif, or any combination thereof.
- the one or more co-stimulatory domains are selected from the group consisting of intracellular domains of 4-1BB, CD2, CD7, CD27, CD28, CD30, CD40, CD54 (ICAM), CD83, CD134 (0X40), CD150 (SLAMF1), CD152 (CTLA4), CD223 (LAG3), CD270 (HVEM), CD278 (ICOS), DAP10, LAT, NKD2C SLP76, TRIM, and ZAP70.
- the co-stimulatory domain is the intracellular domains of 4-1BB.
- the viral particle comprises a polypeptide comprising a CAR whose intracellular domain comprises a co-stimulatory 4- IBB polypeptide sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 53.
- the viral particle comprises a nucleic acid encoding the intracellular domain of a CAR comprising a co-stimulatory 4- IBB sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 65.
- the viral particle comprises a polypeptide comprising a CAR whose intracellular domain comprises an IgG4 linker operatively linked to a CD28 derived transmembrane domain operatively linked to a co-stimulatory 4- IBB polypeptide operatively linked to a CD3zeta domain that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 80.
- IgG4 linker-CD28 TM_4-lBB-CD3zeta [0371]
- the viral particle comprises a nucleic acid encoding the intracellular domain of a CAR comprising an IgG4 linker operatively linked to a CD28 derived transmembrane domain operatively linked to a co-stimulatory 4- IBB polypeptide operatively linked to a CD3zeta domain that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 86.
- IgG4 linker-CD28 TM_4-lBB-CD3zeta
- the viral particle comprises a polypeptide comprising a CAR whose intracellular domain comprises an IgG4 linker operatively linked to a CD28 derived transmembrane domain operatively linked to a co-stimulatory 4- IBB polypeptide operatively linked to a CD3zeta domain that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 90.
- IgG4 linker-CD28 TM_4-lBB-CD3zeta_P2A [0375]
- the viral particle comprises a nucleic acid encoding the intracellular domain of a CAR comprising an IgG4 linker operatively linked to a CD28 derived transmembrane domain operatively linked to a co-stimulatory 4- IBB polypeptide operatively linked to a CD3zeta domain that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 95.
- IgG4 linker-CD28 TM_4-lBB-CD3zeta_P2A [0377]
- the intracellular domain can be further modified to encode a detectable, for example, a fluorescent, protein (e.g., green fluorescent protein) or any variants known thereof.
- a detectable for example, a fluorescent, protein (e.g., green fluorescent protein) or any variants known thereof.
- the transmembrane region can be any transmembrane region that can be incorporated into a functional CAR, e.g., a transmembrane region from a CD4 or a CD8 molecule.
- the transmembrane domain of CAR may be derived from the transmembrane domain of CD8, an alpha, beta or zeta chain of a T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, KIRDS2, 0X40, CD2, CD27, LFA-1 (CDl la, CD18), ICOS (CD278), 4-1 BB (CD 137), 4-1 BBL, GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRFI), CD 160, CD 19, IL2R beta, IL2R gamma, IL7R a, ITGA1, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD l id
- the optional linker of CAR positioned between the extracellular domain and the transmembrane domain may be a polypeptide of about 2 to 100 amino acids in length.
- the linker can include or be composed of flexible residues such as glycine and serine so that the adjacent protein domains are free to move relative to one another. Longer linkers may be used, e.g., when it is desirable to ensure that two adjacent domains do not sterically interfere with one another.
- Linkers may be cleavable or non-cleavable. Examples of cleavable linkers include 2A linkers (for example T2A), 2A-like linkers or functional equivalents thereof and combinations thereof.
- the linker is P2A self-cleaving peptide.
- the viral particle comprises a polypeptide comprising a P2A linker that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 55.
- P2A self-cleaving peptide GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 55).
- the viral particle comprises a nucleic acid encoding a P2A linker that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 67.
- the viral particle comprises a nucleic acid encoding a P2A linker that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 69.
- the linker is derived from a hinge region or portion of the hinge region of any immunoglobulin. In some embodiments, the linker is derived from IgG4.
- the linker is an IgG4 linker operably linked to a CD28 derived transmembrane domain that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 52.
- IgG4 linker-CD28 TM [0390]
- the linker is an IgG4 linker operably linked to a CD28 derived transmembrane domain that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 64.
- IgG4 linker-CD28 TM [0392]
- the nucleic acid transduced into cells using the methods described herein comprises a sequence that encodes a polypeptide, wherein the extracellular domain of the polypeptide binds to an antigen of interest.
- the extracellular domain comprises a receptor, or a portion of a receptor, that binds to said antigen.
- the extracellular domain comprises, or is, an antibody or an antigenbinding portion thereof.
- the extracellular domain comprises, or is, a single-chain Fv domain.
- the single-chain Fv domain can comprise, for example, a VL linked to VH by a flexible linker, wherein said VL and VH are from an antibody that binds said antigen.
- the extracellular domain of CAR may contain any polypeptide that binds the desired antigen (e.g. prostate neoantigen).
- the extracellular domain may comprise a scFv, a portion of an antibody or an alternative scaffold.
- CARs may also be engineered to bind two or more desired antigens that may be arranged in tandem and separated by linker sequences. For example, one or more domain antibodies, scFvs, llama VHH antibodies or other VH only antibody fragments may be organized in tandem via a linker to provide bispecificity or multispecificity to the CAR.
- the antigen to which the extracellular domain of the polypeptide binds can be any antigen of interest, e.g., can be an antigen on a tumor cell.
- the tumor cell may be, e.g., a cell in a solid tumor, or a cell of a blood cancer.
- the antigen can be any antigen that is expressed on a cell of any tumor or cancer type, e.g., cells of a lymphoma, a lung cancer, a breast cancer, a prostate cancer, an adrenocortical carcinoma, a thyroid carcinoma, a nasopharyngeal carcinoma, a melanoma, e.g., a malignant melanoma, a skin carcinoma, a colorectal carcinoma, a desmoid tumor, a desmoplastic small round cell tumor, an endocrine tumor, an Ewing sarcoma, a peripheral primitive neuroectodermal tumor, a solid germ cell tumor, a hepatoblastoma, a neuroblastoma, a non-rhabdomyosarcoma soft tissue sarcoma, an osteosarcoma, a retinoblastoma, a rhabdomyosarcoma, a Wilms tumor, a glio
- said lymphoma can be chronic lymphocytic leukemia (small lymphocytic lymphoma), B-cell prolymphocytic leukemia, lymphoplasmacytic lymphoma, Waldenstrom macroglobulinemia, splenic marginal zone lymphoma, plasma cell myeloma, plasmacytoma, extranodal marginal zone B cell lymphoma, MALT lymphoma, nodal marginal zone B cell lymphoma, follicular lymphoma, mantle cell lymphoma, diffuse large B cell lymphoma, mediastinal (thymic) large B cell lymphoma, intravascular large B cell lymphoma, primary effusion lymphoma, Burkitt's lymphoma, T lymphocyte prolymphocytic leukemia, T lymphocyte large granular lymphocytic leukemia, aggressive NK cell leukemia, adult T lymphocyte leukemia/lymphoma, extranodal NK/T lymph
- the B cells of the CLL have a normal karyotype. In some embodiments, in which the cancer is chronic lymphocytic leukemia (CLL), the B cells of the CLL carry a 17p deletion, an l lq deletion, a 12q trisomy, a 13q deletion or a p53 deletion.
- the antigen is expressed on a B-cell malignancy cell, relapsed/refractory CD19-expressing malignancy cell, diffuse large B-cell lymphoma (DLBCL) cell, Burkitt’s type large B-cell lymphoma (B-LBL) cell, follicular lymphoma (FL) cell, chronic lymphocytic leukemia (CLL) cell, acute lymphocytic leukemia (ALL) cell, mantle cell lymphoma (MCL) cell, hematological malignancy cell, colon cancer cell, lung cancer cell, liver cancer cell, breast cancer cell, renal cancer cell, prostate cancer cell, ovarian cancer cell, skin cancer cell, melanoma cell, bone cancer cell, brain cancer cell, squamous cell carcinoma cell, leukemia cell, myeloma cell, B cell lymphoma cell, kidney cancer cell, uterine cancer cell, adenocarcinoma cell, pancreatic cancer cell, chronic myelogen
- the antigen is a tumor-associated antigen (TAA) or a tumorspecific antigen (TSA).
- TAA tumor-associated antigen
- TSA tumorspecific antigen
- the tumor-associated antigen or tumor-specific antigen is B cell maturation antigen (BCMA), B cell Activating Factor (BAFF), Her2, prostate stem cell antigen (PSCA), prostate-specific membrane antigen (PSMA) alpha-fetoprotein (AFP), carcinoembryonic antigen (CEA), EGFRvIII, cancer antigen- 125 (CA-125), CA19-9, calretinin, MUC-1, epithelial membrane protein (EMA), epithelial tumor antigen (ETA), tyrosinase, melanoma-associated antigen (MAGE), CD 19, CD20, CD34, CD45, CD99, CD117, chromogranin, cytokeratin, desmin, glial fibrillary acidic protein (GFAP), gross cystic disease fluid protein (GCDFP-15), HMB-
- the antigen is CD 19.
- a CAR comprises an extracellular domain comprising a FMC63 scFv binding domain for CD 19 binding.
- the viral particle comprises a polypeptide comprising a CAR whose extracellular domain comprises a signal peptide that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 50.
- Signal peptide Human CSF2R: MLLLVTSLLLCELPHPAFLLIP (SEQ ID NO: 50).
- the viral particle comprises a polynucleotide encoding a CAR whose extracellular domain comprises a aCD19 scFv (CD 19 VL linked to a CD 19 VH) that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 51.
- aCD19 scFv CD 19 VL linked to a CD 19 VH
- CDR complementary determining regions
- RASQDISKYLN RASQDISKYLN
- CDR-L1 SEQ ID NO: 138
- HTSRLHS CDR-L2
- QQGNTLPYT CDR-L3
- SEQ ID NO: 140 DYGV
- VIWGSETTYYNSALKS CDR-H2; SEQ ID NO: 142
- HYYYGGSYAMDY CDR-H3; SEQ ID NO: 143.
- the viral particle comprises a polynucleotide encoding a CAR whose extracellular domain comprises a aCD19 scFv having these CDRs, wherein optionally the aCD19 scFv shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 51.
- the viral particle comprises a polynucleotide encoding a CAR whose extracellular domain comprises a aCD19 scFv having these CDRs, wherein optionally the aCD19 scFv shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 51 or 89.
- the viral particle comprises a nucleic acid encoding a signal peptide for the extracellular domain of CAR that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 62.
- the viral particle comprises a nucleic acid encoding the extracellular domain of a CAR comprising a aCD19 scFv that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 63.
- the viral particle comprises a polypeptide comprising a CAR whose extracellular domain comprises a aCD19 scFv that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 79.
- the viral particle comprises a nucleic acid encoding the extracellular domain of a CAR comprising a aCD19 scFv that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 85.
- the viral particle comprises a polynucleotide encoding a CAR whose extracellular domain comprises a aCD19 scFv that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 89.
- CDR complementary determining regions
- RASQDISKYLN RASQDISKYLN
- CDR-L1 SEQ ID NO: 138
- HTSRLHS CDR-L2
- QQGNTLPYT CDR-L3
- SEQ ID NO: 140 DYGV
- VIWGSETTYYNSALKS CDR-H2; SEQ ID NO: 142
- HYYYGGSYAMDY CDR-H3; SEQ ID NO: 143.
- the viral particle comprises a polynucleotide encoding a CAR whose extracellular domain comprises a aCD19 scFv having these CDRs, wherein optionally the aCD19 scFv shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 89.
- the viral particle comprises a nucleic acid encoding the extracellular domain of a CAR comprising a aCD19 scFv that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 94.
- the TAA or TSA is a cancer/testis (CT) antigen, e.g., BAGE, CAGE, CTAGE, FATE, GAGE, HCA661, HOM-TES-85, MAGEA, MAGEB, MAGEC, NA88, NY-ESO-1, NY-SAR-35, OY-TES-1, SPANXB1, SPA17, SSX, SYCP1, or TPTE.
- CT cancer/testis
- the TAA or TSA is a carbohydrate or ganglioside, e.g., fuc- GM1, GM2 (oncofetal antigen-immunogenic- 1; OFA-I-1); GD2 (OFA-I-2), GM3, GD3, and the like.
- fuc- GM1, GM2 oncofetal antigen-immunogenic- 1; OFA-I-1); GD2 (OFA-I-2), GM3, GD3, and the like.
- the TAA or TSA is alpha-actinin-4, Bage-1, BCR-ABL, Bcr- Abl fusion protein, beta-catenin, CA 125, CA 15-3 (CA 27.29 ⁇ BCAA), CA 195, CA 242, CA- 50, CAM43, Casp-8, cdc27, cdk4, cdkn2a, CEA, coa-1, dek-can fusion protein, EBNA, EF2, Epstein Barr virus antigens, ETV6-AML1 fusion protein, HLA-A2, HLA-A11, hsp70-2, KIAAO205, Mart2, Mum-1, 2, and 3, neo-PAP, myosin class I, OS-9, pml-RARa fusion protein, PTPRK, K-ras, N-ras, triosephosphate isomerase, Gage 3, 4, 5, 6, 7, GnTV, Herv-K-mel, Lü-1, NA-
- said tumor-associated antigen or tumorspecific antigen is integrin avP3 (CD61), galactin, K-Ras (V-Ki-ras2 Kirsten rat sarcoma viral oncogene), or Ral-B.
- integrin avP3 CD61
- galactin galactin
- K-Ras V-Ki-ras2 Kirsten rat sarcoma viral oncogene
- Ral-B integrin avP3
- Other tumor-associated and tumor-specific antigens are known to those in the art.
- Antibodies, and scFvs, that bind to TSAs and TAAs include antibodies and scFVs that are known in the art, as are nucleotide sequences that encode them.
- the antigen is an antigen not considered to be a TSA or a TAA, but which is nevertheless associated with tumor cells, or damage caused by a tumor.
- the antigen is, e.g., a growth factor, cytokine or interleukin, e.g., a growth factor, cytokine, or interleukin associated with angiogenesis or vasculogenesis.
- Such growth factors, cytokines, or interleukins can include, e.g., vascular endothelial growth factor (VEGF), basic fibroblast growth factor (bFGF), platelet-derived growth factor (PDGF), hepatocyte growth factor (HGF), insulin-like growth factor (IGF), or interleukin-8 (IL-8).
- VEGF vascular endothelial growth factor
- bFGF basic fibroblast growth factor
- PDGF platelet-derived growth factor
- HGF hepatocyte growth factor
- IGF insulin-like growth factor
- IL-8 interleukin-8
- Tumors can also create a hypoxic environment local to the tumor.
- the antigen is a hypoxia-associated factor, e.g., HIF-la, HIF-ip, HIF-2a, HIF- 2p, HIF-3a, or HIF-3p.
- the antigen is a DAMP, e.g., a heat shock protein, chromatin-associated protein high mobility group box 1 (HMGB1), S100A8 (MRP8, calgranulin A), S100A9 (MRP 14, calgranulin B), serum amyloid A (SAA), or can be a deoxyribonucleic acid, adenosine triphosphate, uric acid, or heparin sulfate.
- DAMP damage associated molecular pattern molecules
- the extracellular domain is joined to said transmembrane domain directly or by a linker, spacer or hinge polypeptide sequence, e.g., a sequence from CD28 or a sequence from CTLA4.
- the extracellular domain that binds the desired antigen may be derived from antibodies or their antigen binding fragments generated using the technologies described herein.
- the viral particle comprises a polynucleotide sequence encoding a multipartite cell-surface receptor.
- the multipartite cell-surface receptor is a proliferatory receptor.
- the multipartite cell-surface receptor is a rapamycin-activated cell-surface receptor (RACR).
- RACR rapamycin-activated cell-surface receptor
- the multipartite cell-surface receptor is a chemically inducible cell-surface receptor.
- the multipartite cell-surface receptor comprises a polynucleotide sequence encoding FKBP-rapamycin complex binding domain (FRB domain) or a functional variant thereof. In some embodiments, the multipartite cell-surface receptor further comprises a polynucleotide sequence encoding a FK506 binding protein domain (FKBP) or a functional variant thereof. In some embodiments, the FKBP is FKBP12.
- the viral particle comprises a RACR polypeptide comprising a signal peptide operably linked to FKBP12 that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 57.
- the viral particle comprises a RACR polypeptide comprising an IL-2R gamma transmembrane domain operably linked to a cytoplasmic domain that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 58.
- IL-2R gamma TM-Cytoplasmic domain [0433] IL-2R gamma TM-Cytoplasmic domain:
- the viral particle comprises a RACR polypeptide comprising a P2A self-cleaving peptide that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 55.
- P2A GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 55).
- the viral particle comprises a RACR polypeptide comprising a signal peptide operably linked to FRB that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 59.
- the viral particle comprises a RACR polypeptide comprising an IL-2R beta transmembrane domain operably linked to a cytoplasmic domain that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 60.
- the viral particle comprises a nucleic acid encoding a signal peptide operably linked to FKBP12 that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 70.
- the viral particle comprises a nucleic acid encoding an IL-2R gamma transmembrane domain operably linked to a cytoplasmic domain that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 71.
- IL-2R gamma TM-Cytoplasmic domain [0443] IL-2R gamma TM-Cytoplasmic domain:
- the viral particle comprises a nucleic acid encoding a P2A selfcleaving peptide that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 72.
- the viral particle comprises a nucleic acid encoding a signal peptide operably linked to FRB that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 73.
- the viral particle comprises a nucleic acid encoding an IL-2R beta transmembrane domain operably linked to a cytoplasmic domain that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 74.
- IL-2R beta TM-Cytoplasmic domain [0449] IL-2R beta TM-Cytoplasmic domain:
- the viral particle comprises a RACR polypeptide comprising a FKBP12 operably linked to an IL-2R gamma domain operably linked to a P2A peptide that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 77.
- the viral particle comprises a RACR polypeptide comprising a FRB operably linked to an IL-2R beta domain operably linked to a P2A peptide that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 78.
- the viral particle comprises a nucleic acid encoding a FKBP12 operably linked to an IL-2R gamma domain operably linked to a P2A that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 83.
- the viral particle comprises a nucleic acid encoding a FRB operably linked to an IL-2R beta domain operably linked to a P2A that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 84.
- the FKBP domain and FRB domain form a T cell activator protein complex
- the complex formed by the FKBP and F RB domains promote growth and/or survival of a cell.
- the complex formed by the FKBP and FRB domains is controlled by a ligand.
- the ligand is rapamycin.
- the FRB domain and FKBP form a tripartite complex with rapamycin that sequesters rapamycin in the transduced cell.
- the ligand is a protein, an antibody, a small molecule, or a drug.
- the ligand is rapamycin or a rapamycin analog (rapalogs).
- the rapalog comprises variants of rapamycin having one or more of the following modifications relative to rapamycin: demethylation, elimination or replacement of the methoxy at C7, C42 and/or C29; elimination, derivatization or replacement of the hydroxy at C13, C43 and/or C28; reduction, elimination or derivatization of the ketone at C14, C24 and/or C30; replacement of the 6-membered pipecolate ring with a 5-membered prolyl ring; and alternative substitution on the cyclohexyl ring or replacement of the cyclohexyl ring with a substituted cyclopentyl ring.
- the rapalog is everolimus, novolimus, pimecrolimus, ridaforolimus, tacrolimus, temsirolimus, umirolimus, zotarolimus, CCI-779, C20-methallylrapamycin, Cl 6- (S)-3-methylindolerapamycin, C16-iRap, AP21967, sodium mycophernolic acid, benidipine hydrochloride, rapamine, AP23573, or AP1903, or metabolites, derivatives, and/or combinations thereof.
- the ligand is an IMID-class drug (e.g., thalidomide, pomalidimide, lenalidomide or related analogues).
- the molecule is selected from FK1012, tacrolimus (FK506), FKCsA, rapamycin, coumermycin, gibberellin, HaXS, TMP-HTag, and ABT-737 or functional derivatives thereof.
- the FKBP domain is operably linked to an IL2R gamma domain.
- the FRB domain is operably linked to an IL2R beta domain.
- the IL2R gamma domain and IL2R beta domain heterodimerize.
- the IL2R gamma domain and IL2R beta domain heterodimerize in the presence of a ligand to promote growth and/or survival of a cell.
- the IL2R gamma domain and IL2R beta domain heterodimerize in the presence of rapamycin to promote growth and/or survival of a cell.
- the IL2R gamma domain and IL2R beta domain heterodimerize in the presence of rapamycin to promote T cell activation.
- vector genome comprises a polynucleotide sequence that confers resistance to an immunosuppressive agent.
- the polynucleotide that confers resistance to an immunosuppressive agent binds rapamycin.
- the polynucleotide that confers resistance to an immunosuppressive agent encodes a cytosolic (“naked”) FRB domain.
- the naked FRB domain is an approximately 100 amino acid domain extracted from the mTOR protein kinase. It is expressed in the cytosol as a freely diffusible soluble protein.
- the purpose of the FRB domain is to reduce the inhibitory effects of rapamycin on mTOR in the transduced cells, which should allow for consistent activation of transduced T cells and give them a proliferative advantage over native T cells.
- the viral particle comprises a polypeptide comprising a cytosolic FRB domain that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 56.
- the viral particle comprises a nucleic acid encoding a cytosolic FRB domain that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 68.
- the viral particle comprises a polypeptide comprising a cytosolic FRB domain operably linked to a P2A peptide that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 76.
- the viral particle comprises a nucleic acid encoding a cytosolic FRB domain operable linked to a P2A that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 82.
- the viral particle comprises a polypeptide comprising a cytosolic FRB domain operably linked to a P2A peptide that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 88.
- the viral particle comprises a nucleic acid encoding a cytosolic FRB domain operable linked to a P2A that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 93.
- GAATCCAGGACCT (SEQ ID NO: 93).
- expression of the chimeric antigen receptor is modulated by a degron fusion polypeptide and wherein suppression of the degron fusion polypeptide is chemically inducible by a ligand.
- expression of the chimeric antigen receptor is modulated by a FRB-degron fusion polypeptide and wherein suppression of the FRB-degron fusion polypeptide is chemically inducible by a ligand.
- the ligand is rapamycin or a rapalog as described herein.
- TGF-P transforming growth factor P
- Blocking TGF-P signaling in T cells increases their ability to infiltrate, proliferate, and mediate antitumor responses (Kloss et al., Mol. Therapy 26(7):1855-1866 (2016)).
- TGF- P DN The dominant-negative TGF-P (TGF- P DN) is truncated and lacks the intracellular domain necessary for downstream signaling
- the viral particle of the present disclosure comprises a polynucleotide sequence of a dominant-negative TGF-p.
- the viral particle comprises a polypeptide comprising a dominant-negative TGF-P that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 91.
- TGF beta DN TGF beta DN:
- the viral particle comprises a nucleic acid encoding a dominant-negative TGF-P that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 96.
- TGF beta DN [0485]
- the viral particles of the present disclosure comprise a polynucleotide sequence encoding, in 5' to 3' order on a polycistronic transcript:
- the viral particles of the present disclosure comprise a polynucleotide sequence encoding, in 5' to 3' order:
- the viral particle comprises a nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 35.
- the viral particle comprises a polypeptide sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 49.
- the viral particle comprises a nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 61.
- the viral particles of the present disclosure comprises a polynucleotide sequence encoding, in 5' to 3' order on a polycistronic transcript:
- the viral particles of the present disclosure comprises a polynucleotide sequence encoding, in 5' to 3' order:
- the viral particle comprises a polypeptide sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 75.
- the viral particle comprises a nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 81.
- the viral particles of the present disclosure comprise a polynucleotide sequence encoding, in 5' to 3' order on a polycistronic transcript:
- the viral particles of the present disclosure comprise a polynucleotide sequence encoding, in 5' to 3' order:
- the viral particle comprises a polypeptide sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 87.
- the viral particle comprises a nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 92.
- the viral particles of the present disclosure comprise a polynucleotide sequence encoding, in 5' to 3' order:
- RSV promoter (a) RSV promoter, (b) 5' LTR, (c) HIV-1 packaging signal (Psi), (d) Rev response element (RRE) of HIV- 1, (e) gp41 peptide, (f) cPPT/CTS, (g) MND promoter, (h) CMV2 extension, (i) Human CSF2R signal peptide, (j) anti-CD19 scFv, (k) IgG4 hinge domain, (1) human CD28 transmembrane domain, (m) 41BB, (n) CD3( ⁇ , (o) P2A, (p) cytosolic FRB domain, (q) P2A, (r) neutrophil gelatinase-associated lipocalin, ER signaling domain, (s) FKBP12, (t) IL2RG, (u) transmembrane domain, (v) cytoplasmic domain, (w) P2A, (x) CD8a signal peptide, (y) Frb (Dm
- the viral particle comprises a nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 121.
- the viral particles of the present disclosure comprise a polynucleotide sequence encoding, in 5' to 3' order:
- the viral particle comprises a nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 122.
- the viral particles of the present disclosure comprise a polynucleotide sequence encoding, in 5' to 3' order on a polycistronic transcript:
- gag protein (a) a gag protein
- the viral particle comprises a gag protein amino acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 99.
- the viral particle comprises a Pol protein amino acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 100.
- the viral particle comprises a gag-pol nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 101.
- the viral particle comprises a gag-pol nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 124.
- the viral particles of the present disclosure comprise a polynucleotide sequence encoding, in 5' to 3' order:
- the viral particle comprises a gag-pol nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 131.
- the viral particle comprises a Rev protein amino acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 102.
- the viral particle comprises a Rev nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 103.
- the viral particle comprises a Rev nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 125.
- the viral particles of the present disclosure comprise a polynucleotide sequence encoding, in 5' to 3' order:
- the viral particle comprises a gag-pol nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 132.
- the viral particle comprises a nucleic acid encoding a Cocal envelope, anti-CD3 scFv
- the viral particle comprises a Cocal envelope and anti-CD3 scFv nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 128.
- the viral particles of the present disclosure comprise a polynucleotide sequence encoding, in 5' to 3' order:
- poly A signal and the polynucleotide sequence shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 128.
- the viral particles of the present disclosure comprise a polynucleotide sequence encoding, in 5' to 3' order:
- the viral particle comprises a nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 129.
- the viral particles of the present disclosure comprise a polynucleotide sequence encoding, in 5' to 3' order:
- polynucleotide sequence shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 123.
- the viral particle comprises a nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 123.
- the viral particles of the present disclosure comprise a polynucleotide sequence encoding, in 5' to 3' order:
- MND promoter (a) MND promoter, (b) Cocal envelope, (c) transmembrane domain, (d) cytoplasmic tail domain, (e) WPRE, (f) BGH polyA signal, and the polynucleotide sequence shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 130.
- the viral particle comprises a nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 130. anti-CD3 plasmids
- the viral particle comprises an anti-CD3 nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 126.
- the viral particles of the present disclosure comprise a polynucleotide sequence encoding, in 5' to 3' order: (a) human CMV enhancer and CMV promoter, (b) human beta-globin intron, (c) Gaussia luc signal peptide, (d) anti-CD3 VL chain, (e) G4S linker, (f) anti-CD3 VH chain, (g) hinge domain, (h) transmembrane domain, (i) cytoplasmic tail domain, (j) BGH poly A signal, and the polynucleotide sequence shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 126.
- the viral particle comprises an anti-CD3 nucleic acid sequence that shares at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identity to SEQ ID NO: 127.
- the viral particles of the present disclosure comprise a polynucleotide sequence encoding, in 5' to 3' order:
- a polynucleotide e.g. transgene
- enzyme e.g. a polynucleotide
- guide RNA e.g. a polynucleotide that is delivered in one, two, three or more vectors of the same type (e.g. lentivirus, AAV, etc.) or different types (including e.g.
- the methods and systems of the disclosure can be used for generating point mutation(s), insertions, deletions, etc. Random mutagenesis and multi-locus gene editing are also within the scope of the disclosure.
- Non-limiting examples of cells that can be the target of the viral particle described herein include T lymphocytes, dendritic cells (DC), Treg cells, B cells, Natural Killer cells, and macrophages.
- DC dendritic cells
- Treg cells Treg cells
- B cells B cells
- Natural Killer cells and macrophages.
- T cells are a type of lymphocyte (itself a type of white blood cell) that play a central role in cell-mediated immunity. There are several subsets of T cells, each with a distinct function. T cells can be distinguished from other lymphocytes, such as B cells and NK cells, by the presence of a T cell receptor (TCR) on the cell surface.
- TCR T cell receptor
- the TCR is responsible for recognizing antigens bound to major histocompatibility complex (MHC) molecules and is composed of two different protein chains. In 95% of the T cells, the TCR consists of an alpha (a) and beta (P) chain.
- the T lymphocyte When the TCR engages with antigenic peptide and MHC (peptide/MHC complex), the T lymphocyte is activated through a series of biochemical events mediated by associated enzymes, co-receptors, specialized adaptor molecules, and activated or released transcription factors.
- the cells used in the methods provided herein are primary T lymphocytes (e.g., primary human T lymphocytes).
- the primary T lymphocytes used in the methods provided herein may be naive T lymphocytes or MHC-restricted T lymphocytes.
- the T lymphocytes are CD4+.
- the T lymphocytes are CD8+.
- the primary T lymphocytes are tumor infiltrating lymphocytes (TILs).
- TILs tumor infiltrating lymphocytes
- the primary T lymphocytes have been isolated from a tumor biopsy or have been expanded from T lymphocytes isolated from a tumor biopsy.
- the primary T lymphocytes have been isolated from, or are expanded from T lymphocytes isolated from, peripheral blood, cord blood, or lymph.
- the T lymphocytes are allogeneic with respect to a particular individual, e.g., a recipient of said T lymphocytes.
- the T lymphocytes are not allogeneic with respect to a certain individual, e.g., a recipient of said T lymphocytes.
- the T lymphocytes are autologous with respect to a particular individual, e.g., a recipient of said T lymphocytes.
- primary T lymphocytes used in the methods described herein are isolated from a tumor, e.g., are tumor-infiltrating lymphocytes.
- T lymphocytes are specific for a tumor specific antigen (TSA) or tumor associated antigen (TAA).
- TSA tumor specific antigen
- TAA tumor associated antigen
- primary T lymphocytes are obtained from an individual, optionally expanded, and then transduced, using the methods described herein, with a nucleic acid encoding one or more chimeric antigen receptors (CARs), and optionally then expanded.
- CARs chimeric antigen receptors
- T lymphocytes can be expanded, for example, by contacting the T lymphocytes in culture with antibodies to CD3 and/or CD28, e.g., antibodies attached to beads, or to the surface of a cell culture plate; see, e.g., U.S. Pat. Nos. 5,948,893; 6,534,055; 6,352,694; 6,692,964; 6,887,466; and 6,905,681.
- the antibodies are anti-CD3 and/or anti-CD28, and the antibodies are not bound to a solid surface (e.g., the antibodies contact the T lymphocytes in solution).
- either of the anti-CD3 antibody or anti-CD28 antibody is bound to a solid surface (e.g. bead, tissue culture dish plastic), and the other antibody is not bound to a solid surface (e.g., is present in solution).
- NK cells are cytotoxic lymphocytes that constitute a major component of the innate immune system. NK cells typically comprise approximately 10 to 15% of the mononuclear cell fraction in normal peripheral blood. NK cells do not express T-cell antigen receptors (TCR), CD3 or surface immunoglobulins (Ig) B cell receptor, but usually express the surface markers CD 16 (FcyRIII) and CD56 in humans. NK cells are cytotoxic; small granules in their cytoplasm contain special proteins such as perforin and proteases known as granzymes.
- granzyme B also known as granzyme 2 and cytotoxic T- lymphocyte-associated serine esterase 1
- granzyme B is a serine protease crucial for rapid induction of target cell apoptosis in the cell-mediated immune response.
- NK cells are activated in response to interferons or macrophage-derived cytokines Activated NK cells are referred to as lymphokine activated killer (LAK) cells.
- LAK lymphokine activated killer
- NK cells possess two types of surface receptors, labeled “activating receptors” and “inhibitory receptors,” that control the cells' cytotoxic activity.
- NK cells play a role in the host rejection of tumors. Because many cancer cells have reduced or no class I MHC expression, they can become targets of NK cells. Natural killer cells can become activated by cells lacking, or displaying reduced levels of, major histocompatibility complex (MHC) proteins. In addition to being involved in direct cytotoxic killing, NK cells also serve a role in cytokine production, which can be important to control cancer and infection. Activated and expanded NK cells and LAK cells have been used in both ex vivo therapy and in vivo treatment of patients having advanced cancer, with some success against bone marrow related diseases, such as leukemia; breast cancer; and certain types of lymphoma.
- MHC major histocompatibility complex
- administration of the particle to a subject results in the activation of immune cells.
- the activation of immune cells is mediated by the CAR’s binding to both immune cells and cells expressing specific antigens.
- activation of immune cells is measured by the level of one or more cell markers. In some embodiments, activation of immune cells is measured by the percentage of the immune cells that are positive for one or more cell markers.
- the immune cells are T cells (T lymphocytes) or NK cells. In some embodiments, the immune cells are CD4+ T cells or CD8+ T cells. In some embodiments, the one or more cell markers are selected from the groups consisting of CD71, CD25, and any combination thereof.
- activation of immune cells is measured by the percentage of the immune cells that are CD71 positive.
- administration of the viral particle increases the percentage of the CD71+ immune cells by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%.
- activation of immune cells is measured by the level of CD71 expressed on the surface of the immune cells.
- administration of the viral particle increases the level of CD71 expressed on the surface of the immune cells by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 1-fold, at least 2-fold, at least 3-fold, at least 5-fold, at least 7-fold, or at least 10-fold.
- activation of immune cells is measured by the percentage of the immune cells that are CD25 positive.
- administration of the viral particle increases the percentage of the CD25+ immune cells by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%.
- activation of immune cells is measured by the level of CD25 expressed on the surface of the immune cells.
- administration of the viral particle increases the level of CD25 expressed on the surface of the immune cells by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 1-fold, at least 2-fold, at least 3-fold, at least 5-fold, at least 7-fold, or at least 10-fold.
- administration of the viral particle in a subject results in active proliferation of immune cells.
- the proliferation of immune cells increase the number and/or susceptibility to transduction by vector.
- administration of the viral particle in a subject results in a decrease of numbers of immune cells (e.g., T cells) in the GO phase and/or an increase of numbers of immune cells e.g., T cells) in the non-GO phase.
- immune cells e.g., T cells
- administration of the viral particle in a subject increases the number and/or percentage of immune cells that are in a state of metabolic fitness for transduction of vector.
- administration of the viral particle in a subject results in the accumulation of immune cells in lymph nodes. In some embodiments, administration of the viral particle in a subject results in the accumulation of immune cells in tumor sites.
- the viral particle is a lentiviral particle.
- the immune cells are T cells.
- the immune cells here are a subset of immune cells in vivo that can be recognized by at least one antigen-specific binding domain of the CAR.
- the immune cells reside in the lymph nodes.
- a viral particle may be used to infect cells in vivo at an any effective dosage.
- the viral particle is administered to a subject in vivo, by direct injection to the cell, tissue, organ or subject in need of therapy.
- Viral particles may also be delivered according to viral titer (TU/mL).
- the amount of lentivirus directly injected is determined by total TU and can vary based on both the volume that could be feasibly injected to the site and the type of tissue to be injected.
- the viral titer delivered is about 1 * 10 5 to 1 * 10 6 , about 1 * 10 5 to 1 * 10 7 , 1 * 10 5 to l x 10 7 , about l x 10 6 to l x io 9 , about l x 10 7 to UlO 10 , about l x 10 7 to IxlO 11 , or about l x 10 9 to 1 x 10 11 TU or more per injection could be used.
- the viral titer delivered is about l x 10 6 to 1 x 10 7 , about l x 10 6 to 1 x 10 8 , l x 10 6 to 1 x 10 9 , about l x 10 7 to 1 x IO 10 , about l x 10 8 to IxlO 11 , about l x 10 8 to l x 10 12 , or about l x 10 10 to l x 10 12 or more per injection could be used.
- a brain injection site may only allow for a very small volume of virus to be injected, so a high titer prep would be preferred, a TU of about l x 10 6 to l x 10 7 , about l x 10 6 to 1 x 10 8 , l x 10 6 to IxlO 9 , about l x 10 7 to 1 x IO 10 , about l x 10 8 to l x 10 n , about l x 10 8 to IxlO 12 , or about l x 10 10 to l x 10 12 or more per injection could be used.
- a systemic delivery could accommodate a much larger TU, a load of about l x 10 8 , about l x 10 9 , about l x 10 10 , about l x 10 n , about l x 10 12 , about l x 10 13 , about l x 10 14 , or about l x 10 15 , could be delivered.
- the vector is administered at a dose of between about 1 x 10 12 and 5 x 10 14 vector genomes (vg) of the vector per kilogram (vg) of total body mass of the subject (vg/kg). In some embodiments, the vector is administered at a dose of between about l x 10 13 and 5 X 10 14 vg/kg. In some embodiments, the vector is administered at a dose of between about 5 X 10 13 and 3 x 10 14 vg/kg. In some embodiments, the vector is administered at a dose of between about 5 x 10 13 and l x 10 14 vg/kg.
- the vector is administered at a dose of less than about l x 10 12 vg/kg, less than about 3 x 10 12 vg/kg, less than about 5 x 10 12 vg/kg, less than about 7 x 10 12 vg/kg, less than about l x 10 13 vg/kg, less than about 3 x io 13 vg/kg, less than about 5 X 10 13 vg/kg, less than about 7 X 10 13 vg/kg, less than about 1 x 10 14 vg/kg, less than about 3 x 10 14 vg/kg, less than about 5 X 10 14 vg/kg, less than about 7 x 10 14 vg/kg, less than about l x 10 15 vg/kg, less than about 3 x 10 15 vg/kg, less than about 5 X 10 15 vg/kg, or less than about 7xl0 15 vg/kg.
- the vector is administered at a dose of between about 1 x 10 12 and 5 x 10 14 vector particles (vp) of the vector per kilogram (vp) of total body mass of the subject (vp/kg). In some embodiments, the vector is administered at a dose of between about l x 10 13 and 5 X 10 14 vp/kg. In some embodiments, the vector is administered at a dose of between about 5 X 10 13 and 3 x 10 14 vp/kg. In some embodiments, the vector is administered at a dose of between about 5 x 10 13 and l x 10 14 vp/kg.
- the vector is administered at a dose of less than about l x 10 12 vp/kg, less than about 3 x 10 12 vp/kg, less than about 5 x 10 12 vp/kg, less than about 7 x 10 12 vp/kg, less than about l x 10 13 vp/kg, less than about 3 x io 13 vp/kg, less than about 5 X 10 13 vp/kg, less than about 7 X 10 13 vp/kg, less than about 1 x 10 14 vp/kg, less than about 3* 10 14 vp/kg, less than about 5* 10 14 vp/kg, less than about 7* 10 14 vp/kg, less than about I x io 15 vp/kg, less than about 3* 10 15 vp/kg, less than about 5* 10 15 vp/kg, or less than about 7x l0 15 vp/kg.
- administration of the viral particles of the present disclosure decreases the number of B cells in the subject by at least 1%, at least 2%, at least 3%, at least 5%, at least 7%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%.
- the decrease is evaluated by the number of B cells 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 weeks after the viral particle is administered, wherein the reference number is the number of B cells in a subject that was administered a vehicle control.
- administration of the viral particles of the present disclosure decreases the number of B cells in the subject by at least 95%.
- the B cells are in the peripheral blood of the subject. In some embodiments, the B cells are in the bone marrow of the subject. In some embodiments, the B cells are in the spleen of the subject
- the B cells are depleted in the subject for at least 7 days, at least 10 days, at least 20 days, at least 30 days, at least 40 days, at least 50 days, at least 60 days, at least 70 days, or at least 80 days after administering the viral particle.
- the B cells are depleted in the subject for at least 80 days after administering the viral particle.
- Rapamune® (sirolimus, rapamycin) is available as an oral solution or tablet and is FDA approved for the following indications:
- rapamycin is available in 1 mg/mL oral solution or 0.5, 1, or 2 mg tablets and is to be administered once daily. Rapamycin may also be delivered in other dosage forms and/or by other administration routes. [0567] In some embodiments, rapamycin is administered at a dose of between about 0.1 mg/m 2 and 100 mg/m 2 of surface area of the subject. In some embodiments, the subject is a human. In some embodiments, rapamycin is administered at a dose of between about 0.5 mg/m 2 and 50 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.5 mg/m 2 and 10 mg/m 2 .
- USPI US Prescribing Information
- rapamycin is administered at a dose of between about 0.5 mg/m 2 and 3 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.5 mg/m 2 and 5 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 1 mg/m 2 and 5 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 2 mg/m 2 and 6 mg/m 2 . In some embodiments, rapamycin is administered at a dose of about 1 mg/m 2 . In some embodiments, rapamycin is administered at a dose of about 2 mg/m 2 .
- rapamycin is administered at a dose of about 3 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 2 mg/m 2 and 6 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 3 mg/m 2 and 9 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 4 mg/m 2 and 12 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 5 mg/m 2 and 15 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 6 mg/m 2 and 20 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 10 mg/m 2 and 50 mg/m 2 . In some embodiments, the dose of rapamycin is the total dose within a 24-hour time period.
- rapamycin is administered at a dose of between about 0.001 mg/m 2 and 100 mg/m 2 of surface area of the subject.
- the subject is a human.
- rapamycin is administered at a dose of between about 0.001 mg/m 2 and 0.1 mg/m 2 , between about 0.01 mg/m 2 and 1 mg/m 2 , between about 0.1 mg/m 2 and 10 mg/m 2 , between about 1 mg/m 2 and 100 mg/m 2 , between about 0.001 mg/m 2 and 0.05 mg/m 2 , between about 0.005 mg/m 2 and 0.25 mg/m 2 , between about 0.01 mg/m 2 and 0.5 mg/m 2 , between about 0.05 mg/m 2 and 2.5 mg/m 2 , between about 0.1 mg/m 2 and 5 mg/m 2 , between about 0.5 mg/m 2 and 25 mg/m 2 , between about 1 mg/m 2 and 50 mg/m 2 , between about 2 mg
- rapamycin is administered at a dose of between about 0.001 mg/m 2 and 0.005 mg/m 2 In some embodiments, rapamycin is administered at a dose of between about 0.002 mg/m 2 and 0.01 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.003 mg/m 2 and 0.015 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.004 mg/m 2 and 0.02 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.005 mg/m 2 and 0.025 mg/m 2 .
- rapamycin is administered at a dose of between about 0.006 mg/m 2 and 0.03 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.007 mg/m 2 and 0.035 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.008 mg/m 2 and 0.04 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.009 mg/m 2 and 0.045 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.01 mg/m 2 and 0.05 mg/m 2 .
- rapamycin is administered at a dose of between about 0.02 mg/m 2 and 0.1 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.03 mg/m 2 and 0.15 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.04 mg/m 2 and 0.2 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.05 mg/m 2 and 0.25 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.06 mg/m 2 and 0.3 mg/m 2 .
- rapamycin is administered at a dose of between about 0.07 mg/m 2 and 0.35 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.08 mg/m 2 and 0.4 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.09 mg/m 2 and 0.45 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.1 mg/m 2 and 0.5 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.2 mg/m 2 and 1 mg/m 2 .
- rapamycin is administered at a dose of between about 0.3 mg/m 2 and 1.5 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.4 mg/m 2 and 2 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.5 mg/m 2 and 2.5 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.6 mg/m 2 and 3 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.7 mg/m 2 and 3.5 mg/m 2 .
- rapamycin is administered at a dose of between about 0.8 mg/m 2 and 4 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.9 mg/m 2 and 4.5 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 1 mg/m 2 and 5 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 2 mg/m 2 and 10 mg/m 2 In some embodiments, rapamycin is administered at a dose of between about 3 mg/m 2 and 15 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 4 mg/m 2 and 20 mg/m 2 .
- rapamycin is administered at a dose of between about 5 mg/m 2 and 25 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 6 mg/m 2 and 30 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 7 mg/m 2 and 35 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 8 mg/m 2 and 40 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 9 mg/m 2 and 45 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 10 mg/m 2 and 50 mg/m 2 .
- rapamycin is administered at a dose of between about 20 mg/m 2 and 100 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.001 mg/m 2 and 0.02 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.002 mg/m 2 and 0.04 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.003 mg/m 2 and 0.06 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.004 mg/m 2 and 0.08 mg/m 2 .
- rapamycin is administered at a dose of between about 0.005 mg/m 2 and 0.1 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.006 mg/m 2 and 0.12 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.007 mg/m 2 and 0.14 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.008 mg/m 2 and 0.16 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.009 mg/m 2 and 0.18 mg/m 2 .
- rapamycin is administered at a dose of between about 0.01 mg/m 2 and 0.2 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.02 mg/m 2 and 0.4 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.03 mg/m 2 and 0.6 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.04 mg/m 2 and 0.8 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.05 mg/m 2 and 1 mg/m 2 .
- rapamycin is administered at a dose of between about 0.06 mg/m 2 and 1.2 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.07 mg/m 2 and 1.4 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.08 mg/m 2 and 1.6 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.09 mg/m 2 and 1.8 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.1 mg/m 2 and 2 mg/m 2 .
- rapamycin is administered at a dose of between about 0.2 mg/m 2 and 4 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.3 mg/m 2 and 6 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.4 mg/m 2 and 8 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.5 mg/m 2 and 10 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.6 mg/m 2 and 12 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.7 mg/m 2 and 14 mg/m 2 .
- rapamycin is administered at a dose of between about 0.8 mg/m 2 and 16 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 0.9 mg/m 2 and 18 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 1 mg/m 2 and 20 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 2 mg/m 2 and 40 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 3 mg/m 2 and 60 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 4 mg/m 2 and 80 mg/m 2 . In some embodiments, rapamycin is administered at a dose of between about 5 mg/m 2 and 100 mg/m 2 . In some embodiments, the dose of rapamycin is the total dose within a 24-hour time period.
- a dose of rapamycin is administered every day. In some embodiments, a dose of rapamycin is administered about every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14 days. In some embodiments, a dose of rapamycin is administered about every 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 weeks. In some embodiments, a dose of rapamycin is administered about every 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 months.
- the first dose of rapamycin is administered about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14 days post first administration of the viral particle. In some embodiments, after the first administration of the viral particle, the first dose of rapamycin is administered about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14 weeks post first administration of the viral particle. In some embodiments, after the first administration of the viral particle, the first dose of rapamycin is administered about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14 months post first administration of the viral particle.
- the first dose of rapamycin is administered between about 1-3 days, between about 2-6 days, between about 3- 9 days, between about 4-12 days, between about 5-15 days, between about 1-3 weeks, between about 2-4 weeks, between about 3-6 weeks, or between about 4-8 weeks post first administration of the viral particle.
- administration of rapamycin increases the number of viral particle transduced immune cells (e.g., CAR T cells) in the subject, or in a particular organ/region of the subject.
- the organ/region of the subject is blood.
- the organ/region of the subject is spleen.
- the organ/region of the subject is bone marrow.
- administration of rapamycin increases the number of viral particle transduced immune cells (e.g., CAR T cells) by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 1-fold, at least 2-fold, at least 3-fold, at least 5-fold, at least 7-fold, or at least 10-fold, in the subject.
- the increase is evaluated by the number of viral particle transduced immune cells 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 weeks after the first dose of the rapamycin (once the viral particle is administered), wherein the reference number is the number of viral particle transduced immune cells on the day of the first dose of rapamycin.
- the increase is evaluated by the number of viral particle transduced immune cells 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months after the first dose of the rapamycin (once the viral particle is administered), wherein the reference number is the number of viral particle transduced immune cells on the day of the first dose of rapamycin.
- administration of rapamycin increases the percentage of viral particle transduced immune cells (e.g., CAR T cells) in the subject, or in a particular organ/region of the subject.
- the organ/region of the subject is blood.
- the organ/region of the subject is spleen.
- the organ/region of the subject is bone marrow.
- administration of rapamycin increases the percentage of viral particle transduced immune cells (e.g., CAR T cells) by at least 1%, at least 2%, at least 3%, at least 5%, at least 7%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% in the subject.
- the increase is evaluated by the percentage of viral particle transduced immune cells 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 weeks after the first dose of the rapamycin (once the viral particle is administered), wherein the reference percentage is the percentage of viral particle transduced immune cells on the day of the first dose of rapamycin.
- the increase is evaluated by the percentage of viral particle transduced immune cells 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months after the first dose of the rapamycin (once the viral particle is administered), wherein the reference percentage is the percentage of viral particle transduced immune cells on the day of the first dose of rapamycin.
- the percentage is the percentage of viral particle transduced immune cells in total immune cells in the subject or in the particular organ/region of the subject.
- the percentage is the percentage of viral particle transduced immune cells in immune cells of the same type (e.g., T cells) in the subject or in the particular organ/region of the subject.
- compositions of the present disclosure may comprise a combination of any number of viral particles, and optionally one or more additional pharmaceutical agents (polypeptides, polynucleotides, compounds etc.) formulated in pharmaceutically acceptable or physiologically-acceptable compositions for administration to a cell, tissue, organ, or an animal, either alone, or in combination with one or more other modalities of therapy.
- additional pharmaceutical agent polypeptides, polynucleotides, compounds etc.
- the one or more additional pharmaceutical agent further increases transduction efficiency of vectors.
- compositions comprising a therapeutically-effective amount of a viral particle, as described herein, formulated together with one or more pharmaceutically acceptable carriers (additives) and/or diluents.
- the composition further comprises other agents, such as, e.g., cytokines, growth factors, hormones, small molecules or various pharmaceutically active agents.
- compositions and formulations of the viral particles used in accordance with the present disclosure may be prepared for storage by mixing a viral particle having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions.
- Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed.
- one or more pharmaceutically acceptable surface-active agents surfactant
- buffers isotonicity agents
- salts amino acids
- sugars stabilizers and/or antioxidant
- Suitable pharmaceutically acceptable surfactants comprise but are not limited to polyethylen-sorbitan-fatty acid esters, polyethylene-polypropylene glycols, polyoxyethylene- stearates and sodium dodecyl sulphates.
- Suitable buffers comprise but are not limited to histidine-buffers, citrate-buffers, succinate-buffers, acetate-buffers and phosphate-buffers.
- Isotonicity agents are used to provide an isotonic formulation.
- An isotonic formulation is liquid, or liquid reconstituted from a solid form, e.g. a lyophilized form and denotes a solution having the same tonicity as some other solution with which it is compared, such as physiologic salt solution and the blood serum.
- Suitable isotonicity agents comprise but are not limited to salts, including but not limited to sodium chloride (NaCl) or potassium chloride, sugars including but not limited to glucose, sucrose, trehalose or and any component from the group of amino acids, sugars, salts and combinations thereof.
- isotonicity agents are generally used in a total amount of about 5 mM to about 350 mM.
- Non-limiting examples of salts include salts of any combinations of the cations sodium potassium, calcium or magnesium with anions chloride, phosphate, citrate, succinate, sulphate or mixtures thereof.
- Non-limiting examples of amino acids comprise arginine, glycine, ornithine, lysine, histidine, glutamic acid, asparagic acid, isoleucine, leucine, alanine, phenylalanine, tyrosine, tryptophane, methionine, serine, proline.
- Non-limiting examples of sugars according to the invention include trehalose, sucrose, mannitol, sorbitol, lactose, glucose, mannose, maltose, galactose, fructose, sorbose, raffinose, glucosamine, N- methylglucosamine (also referred to as “meglumine”), galactosamine and neuraminic acid and combinations thereof.
- Non-limiting examples of stabilizer includes amino acids and sugars as described above as well as commercially available cyclodextrins and dextrans of any kind and molecular weight as known in the art.
- Non-limiting examples of antioxidants include excipients such as methionine, benzylalcohol or any other excipient used to minimize oxidation.
- compositions that do not produce an allergic or similar untoward reaction when administered to a human.
- pharmaceutically acceptable refers to molecular entities and compositions that do not produce an allergic or similar untoward reaction when administered to a human.
- the preparation of an aqueous composition that contains a protein as an active ingredient is well understood in the art.
- such compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid prior to injection can also be prepared.
- the preparation can also be emulsified.
- carrier includes any and all solvents, dispersion media, vehicles, coatings, diluents, antibacterial and antifungal agents, isotonic and absorption delaying agents, buffers, carrier solutions, suspensions, colloids, and the like.
- solvents dispersion media, vehicles, coatings, diluents, antibacterial and antifungal agents, isotonic and absorption delaying agents, buffers, carrier solutions, suspensions, colloids, and the like.
- the use of such media and agents for pharmaceutical active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients can also be incorporated into the compositions.
- compositions comprising a carrier are suitable for parenteral administration, e.g., intravascular (intravenous or intraarterial), intraperitoneal or intramuscular administration.
- pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the transduced cells, use thereof in the pharmaceutical compositions of the present disclosure is contemplated.
- compositions may further comprise one or more polypeptides, polynucleotides, vectors comprising same, compounds that increase the transduction efficiency of vectors, formulated in pharmaceutically acceptable or physiologically-acceptable solutions for administration to a cell or an animal, either alone, or in combination with one or more other modalities of therapy.
- compositions of the present disclosure may be administered in combination with other agents as well, such as, e.g., cytokines, growth factors, hormones, small molecules or various pharmaceutically active agents.
- agents such as, e.g., cytokines, growth factors, hormones, small molecules or various pharmaceutically active agents.
- compositions comprising an expression cassette or vector (e.g., therapeutic vector) disclosed herein and one or more pharmaceutically acceptable carriers, diluents or excipients.
- the pharmaceutical composition comprises a lentiviral vector comprising an expression cassette disclosed herein, e.g., wherein the expression cassette comprises one or more polynucleotide sequences encoding one or more chimeric antigen receptor (CARs) and variants thereof.
- CARs chimeric antigen receptor
- the pharmaceutical compositions that contain the expression cassette or vector may be in any form that is suitable for the selected mode of administration, for example, for intraventricular, intramyocardial, intracoronary, intravenous, intra-arterial, intra-renal, intraurethral, epidural, intrathecal, intraperitoneal, or intramuscular administration.
- the vector can be administered, as sole active agent, or in combination with other active agents, in a unit administration form, as a mixture with conventional pharmaceutical supports, to animals and human beings.
- the pharmaceutical composition comprises cells transduced ex vivo with any of the vectors according to the present disclosure.
- the viral particle e.g., lentiviral particle
- a pharmaceutical composition comprising that viral particle is effective when administered systemically.
- the viral vectors of the disclosure demonstrate efficacy when administered intravenously to subject (e.g., a primate, such as a non-human primate or a human).
- the viral vectors of the disclosure are capable of inducing expression of CAR in various immune cells when administered systemically (e.g., in T-cells, dendritic cells, NK cells).
- the pharmaceutical compositions contain vehicles (e.g., carriers, diluents and excipients) that are pharmaceutically acceptable for a formulation capable of being injected.
- vehicles e.g., carriers, diluents and excipients
- exemplary excipients include a poloxamer.
- Formulation buffers for viral vectors general contains salts to prevent aggregation and other excipients (e.g., poloxamer) to reduce stickiness of the viral particle.
- the formulation is stable for storage and use when frozen (e.g., at less than 0°C, about -60°C, or about -72°C). In some embodiments, the formulation is a cryopreserved solution.
- compositions of the present disclosure formulation of pharmaceutically acceptable excipients and carrier solutions is well-known to those of skill in the art, as is the development of suitable dosing and treatment regimens for using the particular compositions described herein in a variety of treatment regimens, including e.g., oral, parenteral, intravenous, intranasal, intraperitoneal, and intramuscular administration and formulation.
- suitable dosing and treatment regimens for using the particular compositions described herein in a variety of treatment regimens, including e.g., oral, parenteral, intravenous, intranasal, intraperitoneal, and intramuscular administration and formulation.
- Solutions of the active compounds as free base or pharmacologically acceptable salts may be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions may also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
- the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions (U.S. Pat. No. 5,466,468, specifically incorporated herein by reference in its entirety).
- the form should be sterile and should be fluid to the extent that easy syringability exists. It should be stable under the conditions of manufacture and storage and should be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and/or vegetable oils.
- polyol e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like
- suitable mixtures thereof e.g., vegetable oils
- vegetable oils e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like
- suitable mixtures thereof e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like
- vegetable oils e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like
- Proper fluidity may be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion
- isotonic agents for example, sugars or sodium chloride
- Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
- aqueous solution for parenteral administration in an aqueous solution, for example, the solution should be suitably buffered if necessary and the liquid diluent first rendered isotonic with sufficient saline or glucose.
- aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration.
- a sterile aqueous medium that can be employed will be known to those of skill in the art in light of the present disclosure.
- one dosage may be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion (see, e.g., Remington: The Science and Practice of Pharmacy, 20th Edition.
- the present disclosure provides formulations or compositions suitable for the delivery of viral vector systems (i.e., viral-mediated transduction) including, but not limited to, retroviral (e.g., lentiviral) vectors.
- viral vector systems i.e., viral-mediated transduction
- retroviral vectors e.g., lentiviral
- the present disclosure further contemplates that one or more additional agents that improve the transduction efficiency of viral particle may be used.
- the method further comprises administering to the subject one or more anti-cancer therapies.
- the one or more anti-cancer therapies is selected from the group consisting of an autologous stem cell transplant (ASCT), radiation, surgery, a chemotherapeutic agent, an immunomodulatory agent and a targeted cancer therapy.
- ASCT autologous stem cell transplant
- the one or more anti-cancer therapies is selected from the group consisting of lenalidomide, thalidomide, pomalidomide, bortezomib, carfilzomib, elotozumab, ixazomib, melphalan, dexamethasone, vincristine, cyclophosphamide, hydroxy daunorubicin, prednisone, rituximab, imatinib, dasatinib, nilotinib, bosutinib, ponatinib, bafetinib, saracatinib, tozasertib or danusertib, cytarabine, daunorubicin, idarubicin, mitoxantrone, hydroxyurea, decitabine, cladribine, fludarabine, topotecan, etoposide 6-thioguanine, cor
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Wood Science & Technology (AREA)
- Epidemiology (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- General Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Virology (AREA)
- Cell Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Hematology (AREA)
- Toxicology (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Mycology (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2023545274A JP2024505887A (ja) | 2021-01-27 | 2022-01-26 | 抗cd19キメラ抗原受容体を発現する細胞を生成するためのレンチウイルス |
| CN202280022238.7A CN116997565A (zh) | 2021-01-27 | 2022-01-26 | 用于产生表达抗cd19嵌合抗原受体的细胞的慢病毒 |
| US18/262,859 US20240141375A1 (en) | 2021-01-27 | 2022-01-26 | Lentivirus for generating cells expressing anti-cd19 chimeric antigen receptor |
| AU2022212952A AU2022212952A1 (en) | 2021-01-27 | 2022-01-26 | Lentivirus for generating cells expressing anti-cd19 chimeric antigen receptor |
| KR1020237028818A KR20230143150A (ko) | 2021-01-27 | 2022-01-26 | 항-cd19 키메라 항원 수용체를 발현하는 세포를 생성하기 위한 렌티바이러스 |
| CA3206009A CA3206009A1 (en) | 2021-01-27 | 2022-01-26 | Lentivirus for generating cells expressing anti-cd19 chimeric antigen receptor |
| EP22706707.1A EP4284821A1 (en) | 2021-01-27 | 2022-01-26 | Lentivirus for generating cells expressing anti-cd19 chimeric antigen receptor |
| BR112023014980A BR112023014980A2 (pt) | 2021-01-27 | 2022-01-26 | Lentivírus para gerar células que expressam o receptor de antígeno quimérico anti-cd19 |
| MX2023008831A MX2023008831A (es) | 2021-01-27 | 2022-01-26 | Lentivirus para generar células que expresan receptores de antígeno quimérico anti-cd19. |
| IL304506A IL304506A (en) | 2021-01-27 | 2023-07-17 | Lentivirus to generate cells expressing anti-cd19 chimeric antigen receptor |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163142347P | 2021-01-27 | 2021-01-27 | |
| US63/142,347 | 2021-01-27 | ||
| US202163185765P | 2021-05-07 | 2021-05-07 | |
| US63/185,765 | 2021-05-07 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022164935A1 true WO2022164935A1 (en) | 2022-08-04 |
Family
ID=80624056
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/013947 Ceased WO2022164935A1 (en) | 2021-01-27 | 2022-01-26 | Lentivirus for generating cells expressing anti-cd19 chimeric antigen receptor |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20240141375A1 (https=) |
| EP (1) | EP4284821A1 (https=) |
| JP (1) | JP2024505887A (https=) |
| KR (1) | KR20230143150A (https=) |
| AU (1) | AU2022212952A1 (https=) |
| BR (1) | BR112023014980A2 (https=) |
| CA (1) | CA3206009A1 (https=) |
| IL (1) | IL304506A (https=) |
| MX (1) | MX2023008831A (https=) |
| WO (1) | WO2022164935A1 (https=) |
Cited By (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114981441A (zh) * | 2019-10-16 | 2022-08-30 | 优莫佳生物制药股份有限公司 | 用于通用受体疗法的逆转录病毒载体 |
| WO2023133595A2 (en) | 2022-01-10 | 2023-07-13 | Sana Biotechnology, Inc. | Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses |
| US11759480B2 (en) | 2017-02-28 | 2023-09-19 | Endocyte, Inc. | Compositions and methods for CAR T cell therapy |
| US11779602B2 (en) | 2018-01-22 | 2023-10-10 | Endocyte, Inc. | Methods of use for CAR T cells |
| WO2024081820A1 (en) | 2022-10-13 | 2024-04-18 | Sana Biotechnology, Inc. | Viral particles targeting hematopoietic stem cells |
| US12006366B2 (en) | 2020-06-11 | 2024-06-11 | Provention Bio, Inc. | Methods and compositions for preventing type 1 diabetes |
| WO2024098028A3 (en) * | 2022-11-04 | 2024-07-11 | Umoja Biopharma, Inc. | Lentiviral particles displaying fusion molecules and uses thereof |
| WO2024098038A3 (en) * | 2022-11-04 | 2024-09-06 | Umoja Biopharma, Inc. | Polynucleotide construct and related viral vectors and methods |
| WO2024215989A1 (en) | 2023-04-14 | 2024-10-17 | Sotio Biotech Inc. | ENGINEERED IMMUNE CELLS FOR TREATING CANCER IN COMBINATION WITH IL-2/IL-15 RECEPTOR βγ AGONISTS |
| WO2024215987A1 (en) | 2023-04-14 | 2024-10-17 | Sotio Biotech Inc. | IMMUNE CELLS FOR TREATING CANCER IN COMBINATION WITH IL-15/IL-15Rα CONJUGATES |
| WO2024220598A2 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Lentiviral vectors with two or more genomes |
| WO2024223847A1 (en) | 2023-04-27 | 2024-10-31 | Miltenyi Biotec B.V. & Co. KG | Pseudotyped retroviral vector particle with anti-cd3 display |
| US12144850B2 (en) | 2016-04-08 | 2024-11-19 | Purdue Research Foundation | Methods and compositions for car T cell therapy |
| WO2024238153A1 (en) * | 2023-05-15 | 2024-11-21 | Umoja Biopharma, Inc. | Lentiviral delivery of anti-cd20 chimeric antigen receptors |
| US12150981B2 (en) | 2012-12-20 | 2024-11-26 | Purdue Research Foundation | Chimeric antigen receptor-expressing T cells as anti-cancer therapeutics |
| WO2024243340A1 (en) | 2023-05-23 | 2024-11-28 | Sana Biotechnology, Inc. | Tandem fusogens and related lipid particles |
| US12215337B2 (en) | 2018-04-12 | 2025-02-04 | Umoja Biopharma, Inc. | Viral vectors and packaging cell lines |
| US12240870B2 (en) | 2018-02-23 | 2025-03-04 | Purdue Research Foundation | Sequencing method for CAR T cell therapy |
| WO2025078492A1 (en) | 2023-10-13 | 2025-04-17 | Miltenyi Biotec B.V. & Co. KG | Cd3-targeted nipah-pseudotyped lentiviral vector particles |
| WO2025176853A1 (en) | 2024-02-22 | 2025-08-28 | Miltenyi Biotec B.V. & Co. KG | Cd4- or cd8-targeted retroviral vector particles for generation of cells expressing a bispecific chimeric antigen receptor |
| US12419913B2 (en) | 2019-02-08 | 2025-09-23 | Dna Twopointo, Inc. | Modification of CAR-T cells |
| WO2025212519A1 (en) | 2024-04-01 | 2025-10-09 | Moonlight Bio, Inc. | Dll3 binding proteins and uses thereof |
| US12565529B2 (en) | 2021-05-24 | 2026-03-03 | Provention Bio, Inc. | Methods for treating type 1 diabetes |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024216227A1 (en) * | 2023-04-12 | 2024-10-17 | Vyriad | Cd3-redirected vectors, components thereof, and uses of the vectors and components thereof |
| WO2025102013A1 (en) * | 2023-11-10 | 2025-05-15 | Vyriad | Rhabdovirus g proteins having one or more cysteine-rich regions and uses thereof |
Citations (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4861719A (en) | 1986-04-25 | 1989-08-29 | Fred Hutchinson Cancer Research Center | DNA constructs for retrovirus packaging cell lines |
| US5278056A (en) | 1988-02-05 | 1994-01-11 | The Trustees Of Columbia University In The City Of New York | Retroviral packaging cell lines and process of using same |
| WO1994019478A1 (en) | 1993-02-22 | 1994-09-01 | The Rockefeller University | Production of high titer helper-free retroviruses by transient transfection |
| US5399363A (en) | 1991-01-25 | 1995-03-21 | Eastman Kodak Company | Surface modified anticancer nanoparticles |
| WO1995014785A1 (fr) | 1993-11-23 | 1995-06-01 | Rhone-Poulenc Rorer S.A. | Composition pour la production de produits therapeutiques in vivo |
| US5466468A (en) | 1990-04-03 | 1995-11-14 | Ciba-Geigy Corporation | Parenterally administrable liposome formulation comprising synthetic lipids |
| WO1996022378A1 (fr) | 1995-01-20 | 1996-07-25 | Rhone-Poulenc Rorer S.A. | Cellules pour la production d'adenovirus recombinants |
| US5543158A (en) | 1993-07-23 | 1996-08-06 | Massachusetts Institute Of Technology | Biodegradable injectable nanoparticles |
| US5641515A (en) | 1995-04-04 | 1997-06-24 | Elan Corporation, Plc | Controlled release biodegradable nanoparticles containing insulin |
| US5882877A (en) | 1992-12-03 | 1999-03-16 | Genzyme Corporation | Adenoviral vectors for gene therapy containing deletions in the adenoviral genome |
| US5948893A (en) | 1996-01-17 | 1999-09-07 | The United States Of America As Represented By The Secretary Of The Navy | Murine hybridoma and antibody binding to CD28 receptor secreted by the hybridoma and method of using the antibody |
| US5994136A (en) | 1997-12-12 | 1999-11-30 | Cell Genesys, Inc. | Method and means for producing high titer, safe, recombinant lentivirus vectors |
| US6013516A (en) | 1995-10-06 | 2000-01-11 | The Salk Institute For Biological Studies | Vector and method of use for nucleic acid delivery to non-dividing cells |
| US6352694B1 (en) | 1994-06-03 | 2002-03-05 | Genetics Institute, Inc. | Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells |
| US6534055B1 (en) | 1988-11-23 | 2003-03-18 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| WO2003042397A2 (en) | 2001-11-13 | 2003-05-22 | The Trustees Of The University Of Pennsylvania | A method of detecting and/or identifying adeno-associated virus (aav) sequences and isolating novel sequences identified thereby |
| US6692964B1 (en) | 1995-05-04 | 2004-02-17 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
| US7741465B1 (en) | 1992-03-18 | 2010-06-22 | Zelig Eshhar | Chimeric receptor genes and cells transformed therewith |
| WO2013078316A1 (en) | 2011-11-23 | 2013-05-30 | Nationwide Children's Hospital, Inc. | Recombinant adeno-associated virus delivery of alpha-sarcoglycan polynucleotides |
| WO2016139463A1 (en) | 2015-03-02 | 2016-09-09 | Ucl Business Plc | Retroviral and lentiviral vectors |
| US9486539B2 (en) | 2012-03-26 | 2016-11-08 | The Regents Of The University Of California | Nipah virus envelope pseudotyped lentiviruses and methods of their use |
| WO2017165245A2 (en) | 2016-03-19 | 2017-09-28 | F1 Oncology, Inc. | Methods and compositions for transducing lymphocytes and regulated expansion thereof |
| WO2018111834A1 (en) | 2016-12-13 | 2018-06-21 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Methods of exogenous drug activation of chemical-induced signaling complexes expressed in engineered cells in vitro and in vivo |
| US10196444B2 (en) * | 2013-07-29 | 2019-02-05 | Bluebird Bio, Inc. | Multipartite signaling proteins and uses thereof |
| WO2019055946A1 (en) * | 2017-09-18 | 2019-03-21 | F1 Oncology, Inc. | METHODS AND COMPOSITIONS FOR THE GENETIC MODIFICATION AND EXPANSION OF LYMPHOCYTES AND THE REGULATION OF THE ACTIVITY THEREOF |
| WO2019057124A1 (en) | 2017-09-22 | 2019-03-28 | Wuxi Biologics (Shanghai) Co., Ltd. | NEW BISPECIFIC CD3 / CD19 POLYPEPTIDE COMPLEXES |
| WO2019118885A1 (en) * | 2017-12-14 | 2019-06-20 | Bluebird Bio, Inc. | Nkg2d daric receptors |
| US20190263914A1 (en) * | 2013-12-20 | 2019-08-29 | Novartis Ag | Regulatable chimeric antigen receptor |
| WO2019200056A2 (en) | 2018-04-12 | 2019-10-17 | Vivo-Til Therapeutics Inc. | Viral vectors and packaging cell lines |
| WO2020106992A1 (en) | 2018-11-21 | 2020-05-28 | Umoja Biopharma, Inc. | Multicistronic vector for surface engineering lentiviral particles |
| US20200216502A1 (en) | 2017-09-22 | 2020-07-09 | Centre National De La Recherche Scientifique (Cnrs) | Mutated Glycoprotein of Vesicular Stomatitis Virus |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2895203A4 (en) * | 2012-06-15 | 2016-09-28 | Imaginab Inc | ANTIGENBINDING CONSTRUCTS FOR CD3 |
| CA3091490A1 (en) * | 2018-04-27 | 2019-10-31 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Rapamycin resistant cells |
-
2022
- 2022-01-26 MX MX2023008831A patent/MX2023008831A/es unknown
- 2022-01-26 EP EP22706707.1A patent/EP4284821A1/en active Pending
- 2022-01-26 AU AU2022212952A patent/AU2022212952A1/en active Pending
- 2022-01-26 US US18/262,859 patent/US20240141375A1/en active Pending
- 2022-01-26 CA CA3206009A patent/CA3206009A1/en active Pending
- 2022-01-26 WO PCT/US2022/013947 patent/WO2022164935A1/en not_active Ceased
- 2022-01-26 KR KR1020237028818A patent/KR20230143150A/ko active Pending
- 2022-01-26 BR BR112023014980A patent/BR112023014980A2/pt unknown
- 2022-01-26 JP JP2023545274A patent/JP2024505887A/ja active Pending
-
2023
- 2023-07-17 IL IL304506A patent/IL304506A/en unknown
Patent Citations (33)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4861719A (en) | 1986-04-25 | 1989-08-29 | Fred Hutchinson Cancer Research Center | DNA constructs for retrovirus packaging cell lines |
| US5278056A (en) | 1988-02-05 | 1994-01-11 | The Trustees Of Columbia University In The City Of New York | Retroviral packaging cell lines and process of using same |
| US6534055B1 (en) | 1988-11-23 | 2003-03-18 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US6887466B2 (en) | 1988-11-23 | 2005-05-03 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US5466468A (en) | 1990-04-03 | 1995-11-14 | Ciba-Geigy Corporation | Parenterally administrable liposome formulation comprising synthetic lipids |
| US5399363A (en) | 1991-01-25 | 1995-03-21 | Eastman Kodak Company | Surface modified anticancer nanoparticles |
| US7741465B1 (en) | 1992-03-18 | 2010-06-22 | Zelig Eshhar | Chimeric receptor genes and cells transformed therewith |
| US5882877A (en) | 1992-12-03 | 1999-03-16 | Genzyme Corporation | Adenoviral vectors for gene therapy containing deletions in the adenoviral genome |
| WO1994019478A1 (en) | 1993-02-22 | 1994-09-01 | The Rockefeller University | Production of high titer helper-free retroviruses by transient transfection |
| US5543158A (en) | 1993-07-23 | 1996-08-06 | Massachusetts Institute Of Technology | Biodegradable injectable nanoparticles |
| WO1995014785A1 (fr) | 1993-11-23 | 1995-06-01 | Rhone-Poulenc Rorer S.A. | Composition pour la production de produits therapeutiques in vivo |
| US6905681B1 (en) | 1994-06-03 | 2005-06-14 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US6352694B1 (en) | 1994-06-03 | 2002-03-05 | Genetics Institute, Inc. | Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells |
| WO1996022378A1 (fr) | 1995-01-20 | 1996-07-25 | Rhone-Poulenc Rorer S.A. | Cellules pour la production d'adenovirus recombinants |
| US5641515A (en) | 1995-04-04 | 1997-06-24 | Elan Corporation, Plc | Controlled release biodegradable nanoparticles containing insulin |
| US6692964B1 (en) | 1995-05-04 | 2004-02-17 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
| US6013516A (en) | 1995-10-06 | 2000-01-11 | The Salk Institute For Biological Studies | Vector and method of use for nucleic acid delivery to non-dividing cells |
| US5948893A (en) | 1996-01-17 | 1999-09-07 | The United States Of America As Represented By The Secretary Of The Navy | Murine hybridoma and antibody binding to CD28 receptor secreted by the hybridoma and method of using the antibody |
| US5994136A (en) | 1997-12-12 | 1999-11-30 | Cell Genesys, Inc. | Method and means for producing high titer, safe, recombinant lentivirus vectors |
| WO2003042397A2 (en) | 2001-11-13 | 2003-05-22 | The Trustees Of The University Of Pennsylvania | A method of detecting and/or identifying adeno-associated virus (aav) sequences and isolating novel sequences identified thereby |
| WO2013078316A1 (en) | 2011-11-23 | 2013-05-30 | Nationwide Children's Hospital, Inc. | Recombinant adeno-associated virus delivery of alpha-sarcoglycan polynucleotides |
| US9486539B2 (en) | 2012-03-26 | 2016-11-08 | The Regents Of The University Of California | Nipah virus envelope pseudotyped lentiviruses and methods of their use |
| US10196444B2 (en) * | 2013-07-29 | 2019-02-05 | Bluebird Bio, Inc. | Multipartite signaling proteins and uses thereof |
| US20190263914A1 (en) * | 2013-12-20 | 2019-08-29 | Novartis Ag | Regulatable chimeric antigen receptor |
| WO2016139463A1 (en) | 2015-03-02 | 2016-09-09 | Ucl Business Plc | Retroviral and lentiviral vectors |
| WO2017165245A2 (en) | 2016-03-19 | 2017-09-28 | F1 Oncology, Inc. | Methods and compositions for transducing lymphocytes and regulated expansion thereof |
| WO2018111834A1 (en) | 2016-12-13 | 2018-06-21 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Methods of exogenous drug activation of chemical-induced signaling complexes expressed in engineered cells in vitro and in vivo |
| WO2019055946A1 (en) * | 2017-09-18 | 2019-03-21 | F1 Oncology, Inc. | METHODS AND COMPOSITIONS FOR THE GENETIC MODIFICATION AND EXPANSION OF LYMPHOCYTES AND THE REGULATION OF THE ACTIVITY THEREOF |
| WO2019057124A1 (en) | 2017-09-22 | 2019-03-28 | Wuxi Biologics (Shanghai) Co., Ltd. | NEW BISPECIFIC CD3 / CD19 POLYPEPTIDE COMPLEXES |
| US20200216502A1 (en) | 2017-09-22 | 2020-07-09 | Centre National De La Recherche Scientifique (Cnrs) | Mutated Glycoprotein of Vesicular Stomatitis Virus |
| WO2019118885A1 (en) * | 2017-12-14 | 2019-06-20 | Bluebird Bio, Inc. | Nkg2d daric receptors |
| WO2019200056A2 (en) | 2018-04-12 | 2019-10-17 | Vivo-Til Therapeutics Inc. | Viral vectors and packaging cell lines |
| WO2020106992A1 (en) | 2018-11-21 | 2020-05-28 | Umoja Biopharma, Inc. | Multicistronic vector for surface engineering lentiviral particles |
Non-Patent Citations (20)
| Title |
|---|
| "Current Protocols in Molecular Biology", 1995 |
| "Remington: The Science and Practice of Pharmacy", 2005, LIPPINCOTT WILLIAMS & WILKINS |
| "Remington's Pharmaceutical Sciences", 1980 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1977, pages 3389 - 3402 |
| BENDER ET AL., PLOS PATHOG, vol. 12, no. 6, January 2016 (2016-01-01), pages e1005641 |
| GAERERTS ET AL.: "Comparison of retroviral vector titration methods", BMC BIOTECHNOL, vol. 6, 2006, pages 34, XP021017061, DOI: 10.1186/1472-6750-6-34 |
| HUMBERT ET AL.: "Development of Third-generation Cocal Envelope Producer Cell Lines for Robust Retroviral Gene Transfer into Hematopoietic Stem Cells and T-cells", MOLECULAR THERAPY, vol. 24, 2016, pages 1237 - 1246, XP055659688, DOI: 10.1038/mt.2016.70 |
| JOGLEKAR ET AL., HUMAN GENE THERAPY METHODS, vol. 28, 2017, pages 291 - 301 |
| KLOSS ET AL., MOL. THERAPY, vol. 26, no. 7, 2018, pages 1855 - 1866 |
| MOL. THER., vol. 27, no. 4, 10 April 2019 (2019-04-10), pages 710 - 728 |
| NALDINI ET AL., SCIENCE, vol. 272, 1996, pages 263 - 7 |
| NEEDLEMANWUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| PEARSONLIPMAN, PROC. NAT'L. ACAD. SCI. USA, vol. 85, 1988, pages 2444 |
| RUELLA M ET AL., NAT MED, vol. 24, no. 10, 2018, pages 1499 - 1503 |
| SMITHWATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482 |
| STADLER ET AL., NAT. MED., 2017 |
| WAI-HANG LEUNG ET AL: "Sensitive and adaptable pharmacological control of CAR T cells through extracellular receptor dimerization", JCI INSIGHT, vol. 4, no. 11, 6 June 2019 (2019-06-06), XP055634520, DOI: 10.1172/jci.insight.124430 * |
| WU CHIA-YUNG ET AL: "Remote control of therapeutic T cells through a small molecule?gated chimeric receptor", SCIENCE, vol. 350, no. 6258, 16 October 2015 (2015-10-16), US, XP055853676, ISSN: 0036-8075, DOI: 10.1126/science.aab4077 * |
| ZUFFEREY ET AL., J. VIROL., vol. 72, 1998, pages 8150 - 8471 |
Cited By (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12150981B2 (en) | 2012-12-20 | 2024-11-26 | Purdue Research Foundation | Chimeric antigen receptor-expressing T cells as anti-cancer therapeutics |
| US12144850B2 (en) | 2016-04-08 | 2024-11-19 | Purdue Research Foundation | Methods and compositions for car T cell therapy |
| US11759480B2 (en) | 2017-02-28 | 2023-09-19 | Endocyte, Inc. | Compositions and methods for CAR T cell therapy |
| US11850262B2 (en) | 2017-02-28 | 2023-12-26 | Purdue Research Foundation | Compositions and methods for CAR T cell therapy |
| US11779602B2 (en) | 2018-01-22 | 2023-10-10 | Endocyte, Inc. | Methods of use for CAR T cells |
| US12269862B2 (en) | 2018-01-22 | 2025-04-08 | Endocyte, Inc. | Methods of use for CAR T cells |
| US12240870B2 (en) | 2018-02-23 | 2025-03-04 | Purdue Research Foundation | Sequencing method for CAR T cell therapy |
| US12215337B2 (en) | 2018-04-12 | 2025-02-04 | Umoja Biopharma, Inc. | Viral vectors and packaging cell lines |
| US12419913B2 (en) | 2019-02-08 | 2025-09-23 | Dna Twopointo, Inc. | Modification of CAR-T cells |
| CN114981441A (zh) * | 2019-10-16 | 2022-08-30 | 优莫佳生物制药股份有限公司 | 用于通用受体疗法的逆转录病毒载体 |
| US12006366B2 (en) | 2020-06-11 | 2024-06-11 | Provention Bio, Inc. | Methods and compositions for preventing type 1 diabetes |
| US12565529B2 (en) | 2021-05-24 | 2026-03-03 | Provention Bio, Inc. | Methods for treating type 1 diabetes |
| WO2023133595A2 (en) | 2022-01-10 | 2023-07-13 | Sana Biotechnology, Inc. | Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses |
| WO2024081820A1 (en) | 2022-10-13 | 2024-04-18 | Sana Biotechnology, Inc. | Viral particles targeting hematopoietic stem cells |
| WO2024098038A3 (en) * | 2022-11-04 | 2024-09-06 | Umoja Biopharma, Inc. | Polynucleotide construct and related viral vectors and methods |
| WO2024098028A3 (en) * | 2022-11-04 | 2024-07-11 | Umoja Biopharma, Inc. | Lentiviral particles displaying fusion molecules and uses thereof |
| WO2024215987A1 (en) | 2023-04-14 | 2024-10-17 | Sotio Biotech Inc. | IMMUNE CELLS FOR TREATING CANCER IN COMBINATION WITH IL-15/IL-15Rα CONJUGATES |
| WO2024215989A1 (en) | 2023-04-14 | 2024-10-17 | Sotio Biotech Inc. | ENGINEERED IMMUNE CELLS FOR TREATING CANCER IN COMBINATION WITH IL-2/IL-15 RECEPTOR βγ AGONISTS |
| WO2024220598A2 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Lentiviral vectors with two or more genomes |
| WO2024223847A1 (en) | 2023-04-27 | 2024-10-31 | Miltenyi Biotec B.V. & Co. KG | Pseudotyped retroviral vector particle with anti-cd3 display |
| WO2024238153A1 (en) * | 2023-05-15 | 2024-11-21 | Umoja Biopharma, Inc. | Lentiviral delivery of anti-cd20 chimeric antigen receptors |
| WO2024243340A1 (en) | 2023-05-23 | 2024-11-28 | Sana Biotechnology, Inc. | Tandem fusogens and related lipid particles |
| WO2025078492A1 (en) | 2023-10-13 | 2025-04-17 | Miltenyi Biotec B.V. & Co. KG | Cd3-targeted nipah-pseudotyped lentiviral vector particles |
| WO2025176853A1 (en) | 2024-02-22 | 2025-08-28 | Miltenyi Biotec B.V. & Co. KG | Cd4- or cd8-targeted retroviral vector particles for generation of cells expressing a bispecific chimeric antigen receptor |
| WO2025212519A1 (en) | 2024-04-01 | 2025-10-09 | Moonlight Bio, Inc. | Dll3 binding proteins and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| EP4284821A1 (en) | 2023-12-06 |
| IL304506A (en) | 2023-09-01 |
| CA3206009A1 (en) | 2022-08-04 |
| BR112023014980A2 (pt) | 2023-10-10 |
| AU2022212952A1 (en) | 2023-08-10 |
| MX2023008831A (es) | 2023-10-19 |
| KR20230143150A (ko) | 2023-10-11 |
| JP2024505887A (ja) | 2024-02-08 |
| US20240141375A1 (en) | 2024-05-02 |
| AU2022212952A9 (en) | 2024-07-18 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240141375A1 (en) | Lentivirus for generating cells expressing anti-cd19 chimeric antigen receptor | |
| US20250051801A1 (en) | Viral particle with surface stimulating molecules | |
| US11542488B2 (en) | Sortase synthesized chimeric antigen receptors | |
| ES2781175T3 (es) | Subconjunto optimizado de células T que contienen un receptor de antígeno quimérico | |
| US20230348624A1 (en) | Bispecific transduction enhancer | |
| KR20220153604A (ko) | 가공된 바이러스 입자를 사용하는 유전자 전달을 위한 방법 및 조성물 | |
| CN106687483A (zh) | 使用人源化抗‑bcma嵌合抗原受体治疗癌症 | |
| CA2958553A1 (en) | Anti-cd123 chimeric antigen receptor (car) for use in cancer treatment | |
| CN114621969A (zh) | 用于过继免疫疗法的具有嵌合受体的靶向细胞毒性细胞 | |
| TW202434735A (zh) | 展示黏著分子融合的顆粒 | |
| RU2852533C2 (ru) | Вирусная частица с поверхностными стимулирующими молекулами | |
| RU2848216C2 (ru) | Лентивирус для получения клеток, экспрессирующих химерный антигенный рецептор против cd19 | |
| CN116997565A (zh) | 用于产生表达抗cd19嵌合抗原受体的细胞的慢病毒 | |
| JP2026500896A (ja) | 接着分子融合物を呈示する粒子 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22706707 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3206009 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023545274 Country of ref document: JP Ref document number: MX/A/2023/008831 Country of ref document: MX |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112023014980 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2022212952 Country of ref document: AU Date of ref document: 20220126 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20237028818 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202317057038 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022706707 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202305402Y Country of ref document: SG |
|
| ENP | Entry into the national phase |
Ref document number: 2022706707 Country of ref document: EP Effective date: 20230828 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280022238.7 Country of ref document: CN |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112023014980 Country of ref document: BR Free format text: APRESENTAR NOVO CONTEUDO ELETRONICO DE LISTAGEM DE SEQUENCIAS BIOLOGICAS, COM BASE NA PORTARIA INPI 56, DE 27/12/2021, ANEXO I, ITEM 5.5, PARA INCLUSAO DOS CAMPOS OBRIGATORIOS 140-141. |
|
| ENP | Entry into the national phase |
Ref document number: 112023014980 Country of ref document: BR Kind code of ref document: A2 Effective date: 20230726 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 2023122150 Country of ref document: RU |