WO2022108741A1 - Monitoring membrane protein trafficking for drug discovery and drug development - Google Patents

Monitoring membrane protein trafficking for drug discovery and drug development Download PDF

Info

Publication number
WO2022108741A1
WO2022108741A1 PCT/US2021/057525 US2021057525W WO2022108741A1 WO 2022108741 A1 WO2022108741 A1 WO 2022108741A1 US 2021057525 W US2021057525 W US 2021057525W WO 2022108741 A1 WO2022108741 A1 WO 2022108741A1
Authority
WO
WIPO (PCT)
Prior art keywords
cell membrane
peptide
seq
membrane protein
internalization
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/057525
Other languages
French (fr)
Inventor
Bradley K. MCCONNELL
Arfaxad Reyes ALCARAZ
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Houston System
Original Assignee
University of Houston System
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Houston System filed Critical University of Houston System
Priority to US18/037,702 priority Critical patent/US20230417736A1/en
Priority to CA3198508A priority patent/CA3198508A1/en
Publication of WO2022108741A1 publication Critical patent/WO2022108741A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/566Immunoassay; Biospecific binding assay; Materials therefor using specific carrier or receptor proteins as ligand binding reagents where possible specific carrier or receptor proteins are classified with their target compounds
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N21/00Investigating or analysing materials by the use of optical means, i.e. using sub-millimetre waves, infrared, visible or ultraviolet light
    • G01N21/75Systems in which material is subjected to a chemical reaction, the progress or the result of the reaction being investigated
    • G01N21/76Chemiluminescence; Bioluminescence
    • G01N21/763Bioluminescence
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/58Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving labelled substances
    • G01N33/581Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving labelled substances with enzyme label (including co-enzymes, co-factors, enzyme inhibitors or substrates)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value
    • G01N2500/10Screening for compounds of potential therapeutic value involving cells

Definitions

  • Embodiments of the present disclosure pertain to systems for use in screening at least one binding agent for binding to at least one cell membrane protein.
  • the systems of the present disclosure include one or more cells that include the cell membrane protein.
  • the cell membrane protein is genetically engineered to express a first peptide capable of generating a luminescent signal upon interaction with a second peptide.
  • the first peptide is separated from the cell membrane protein by a flexible amino acid linker, where a majority of the peptide residues include glycine residues, serine residues, or combinations thereof.
  • the systems of the present disclosure also include the second peptide.
  • the first peptide includes Small fragment of Nano Luciferase (SmBiT) and the second peptide includes Large fragment of Nano Luciferase (LgBit).
  • SmBiT Small fragment of Nano Luciferase
  • LgBit Large fragment of Nano Luciferase
  • the methods of the present disclosure include: (a) associating the binding agent with a cell that includes the cell membrane protein, where the cell membrane protein is genetically engineered to express a first peptide capable of generating a luminescent signal upon interaction with a second peptide; (b) detecting a presence or an absence of an internalization of the cell membrane protein by the presence or absence of the luminescent signal, respectively; and (c) correlating the presence or absence of the internalization to the binding or lack of binding of the binding agent to the cell membrane protein, respectively.
  • FIG. 1A depicts a system for screening a binding agent for binding to a cell membrane protein.
  • FIG. IB illustrates a method of screening a binding agent for binding to a cell membrane protein.
  • FIGS. 2A-F illustrate G protein-coupled receptor (GPCR) internalization via early endosomes.
  • FIG. 2A provides a schematic of the overall concept of a structural complementation assay to monitor internalization in real-time living cells.
  • FIG. 2B is a schematic of a structural complementation system based on Nano Luciferase showing the LgBiT (Large fragment of Nano Luciferase) and SmBiT (Small fragment of Nano Luciferase).
  • FIG. 2C shows different internalization rates across different GPCRs.
  • FIG. 2D shows dose-dependent internalization of human [32AR in early endosomes in cardiomyocytes using different concentrations of epinephrine.
  • FIG. 2E shows validation of the GPCR internalization assay using 10 p M of endocytosis inhibitors, cmpdlOl, PiTStop, and Dynasore.
  • FIG. 2F shows dose-response curve stimulation for internalization of P2AR. The results are expressed as mean ⁇ s.e.m.
  • FIGS. 3A-B show monitoring in real-time the internalization and recycling of a prototypical GPCR. Shown in FIGS. 3A-B are recycling of [32AR in HEK293 cells using 10 pM epinephrine; Number “1 ” indicates the receptor being removed from the plasma membrane, Number “2 ” corresponds to the receptor being localized in early endosomes, and Number “3 ” indicates the washout of the ligand and return of the receptor to the cell surface. The arrows indicate the time at which the cells were treated with the corresponding ligand. The results are expressed as mean ⁇ s.e.m. of three experiments performed in triplicate; each triplicate was averaged before calculating the s.e.m.
  • FIGS. 4A-F show schematics of the Proximity Ligation Assay (PLA).
  • PPA Proximity Ligation Assay
  • FIG. 4A shows [32AR-SmBiT and Early Endosome Antigen 1 (EEA1).
  • FIG. 4D shows LgBiT-FYVE and Early Endosome Antigen 1.
  • PAG probes secondary antibodies coupled with oligonucleotides
  • PLA probes bind to the primary antibodies.
  • connector oligos join the PLA probes and become ligated.
  • the resulting closed, circular DNA template becomes amplified by DNA polymerase.
  • complementary detection oligos coupled to fluorochromes hybridize to repeating sequences in the amplicons.
  • PLA signals are detected by fluorescent microscopy as discrete spots and provide the intracellular localization of the protein or protein interaction. Confocal images were obtained from the PLA of the early endosomes (FIGS. 4B, 4C, 4E, and 4F).
  • FIG. 4B shows the PLA assay using antibodies targeting [32 AR and EEA1 in the absence of ligand (vehicle control).
  • FIG. 4C shows the PLA assay using the same antibodies as in FIG. 4C but where the sample was incubated for 5 minutes in the presence of 10 pM epinephrine.
  • FIG. 4E shows the PLA assay using antibodies targeting the LgBiT-FYVE and EEA1 in the absence of ligand (vehicle control).
  • FIG. 5 illustrates visualization of receptor localization in HEK293 cells using a bioluminescence LV200 Olympus microscope.
  • HEK293 cells were transfected with [32AR- SmBiT and LgBiT-FYVE.
  • the luminescence images were acquired after the addition of the luciferase substrate, furimazine, and 10
  • FIGS. 6A-6B provides illustrations of non-GPCR HER 2 receptors.
  • FIG. 6A shows a schematic representation for monitoring internalization of the HER2 receptor.
  • FIG. 6B shows HER2 receptor time course internalization of cells expressing the receptor treated with 10 pM (final concentration) human epidermal growth factor (hEGF). The arrow indicates the time when the cells were treated with the virus. The results are expressed as mean ⁇ s.e.m. of three experiments performed in triplicate; each triplicate was averaged before calculating the s.e.m. The corresponding Z’ factor was 0.70.
  • FIGS. 7A-C illustrate membrane protein internalization by binding with two monoclonal antibodies.
  • FIG. 7A provides a schematic of a membrane protein being internalized by the binding with an antibody via early endosomes.
  • FIGS. 7B-1 and 7B-2 show the membrane protein (FAM19A5 Isoform II) being internalized when cells expressing FAM19A5 Isoform II were treated with 10 nM and 100 nM of two antibodies (these antibodies are currently under development). 1 pM IgG antibody was used as a control.
  • the top panel shows antibody A and the botom panel shows antibody B.
  • FIG. 7C shows dose-response curves for both antibodies.
  • the corresponding EC50 value for antibody A was 7.08 ⁇ 0.2 nM (Z’ factor of 0.92) and for antibody B (Z’ factor of 0.943) was 10.54 ⁇ 0.5 nM.
  • the arrow indicates the time when the cells were treated with the virus. The results are expressed as mean ⁇ s.e.m. of three experiments performed in triplicate; each triplicate was averaged before calculating the s.e.m.
  • FIGS. 8A-8B show monitoring SARS-CoV2 infection in real-time in living HEK293 cells.
  • FIG. 8A shows a schematic representation of how the Lentivirus expressing the SARS- CoV2 Spike protein is internalized by binding with Angiotensin-Converting Enzyme 2 (ACE2) via early endosomes.
  • FIG. 8B shows real-time monitoring of viral entry into HEK293 cells expressing human ACE2 when treated with the Lentivirus. The arrow indicates the time when the cells were treated with the virus. The results are expressed as mean ⁇ s.e.m. of three experiments performed in triplicate; each triplicate was averaged before calculating the s.e.m.
  • the corresponding Z’ score was 0.50.
  • FIG. 9 shows amino acid sequences of the constructs used to monitor receptor internalization and SARS-CoV2 infection.
  • FIG. 10 shows amino acid sequences of the constructs used to monitor antibody mediated internalization of FAM19A5 isoform II.
  • HTS high-throughput screening
  • membrane proteins that comprise 22% of the proteins encoded by the genome and are targeted by 60% of the approved drugs available today. Almost half of these drugs are directed at the rhodopsin-like class A G protein-coupled receptor (GPCR) superfamily. Many of these receptors have underlying roles in a myriad of diseases, including cancer, heart disease, diabetes, metabolic diseases, pulmonary diseases, renal diseases, hepatic disease, drug addiction, alcoholism, chronic pain, autoimmune diseases, mood disorders, and mental illness. Therefore, membrane proteins represent a goldmine of targets that must be screened to fully exploit their rich therapeutic potential.
  • HTS platforms for plasma membrane receptors have had success due to reliable cell-based systems for monitoring the diversity of downstream messenger pathways, such as cAMP signaling, calcium mobilization, and Rho GTPase activation.
  • downstream messenger pathways such as cAMP signaling, calcium mobilization, and Rho GTPase activation.
  • these assays are highly idiosyncratic and consequently require the development of specialized protocols.
  • HTS becomes particularly challenging for those receptors that are of great therapeutic interest but have non- canonical signaling or remain uncharacterized.
  • plasma membrane trafficking is the single universal feature of membrane receptor protein regulation.
  • HTS trafficking screens are not more often utilized include a lack of reagent universality, high costs of imaging equipment, and confounding background fluorescence that, in many instances, requires sophisticated deconvolution algorithms to identify subpopulations of membrane proteins. Accordingly, a need exists for more effective methods of screening potential binding agents to membrane receptors. Numerous embodiments of the present disclosure address the aforementioned need.
  • the present disclosure pertains to systems for use in screening at least one binding agent for binding to at least one cell membrane protein.
  • the systems of the present disclosure include one or more cells that include at least one cell membrane protein.
  • the systems of the present disclosure also include a second peptide.
  • the systems of the present disclosure include one or more cells that include at least one cell membrane protein 12.
  • cell membrane protein 12 is embedded in cellular membrane 14 and genetically engineered to express a first peptide 16, which is separated from the cell membrane protein by a flexible amino acid linker 18.
  • the systems of the present disclosure also include candidate binding agents 10 and second peptides 20.
  • candidate binding agents 10 are associated with cell membrane protein 12. Thereafter, internalization occurs if binding agent 10 binds to cell membrane protein 12. Such internalization is detectable by the presence of a luminescent signal, which occurs when first peptide 16 interacts with second peptide 20.
  • the present disclosure pertains to methods of screening at least one binding agent for binding to at least one cell membrane protein.
  • the methods of the present disclosure utilize the systems of the present disclosure.
  • the methods of the present disclosure include: associating a binding agent with a cell that includes at least one cell membrane protein that is genetically engineered to express a first peptide capable of generating a luminescent signal upon interaction with a second peptide (step 10); detecting a presence or absence of an internalization of the cell membrane protein by detecting the presence or absence of the luminescent signal, respectively (step 12); and correlating the presence or absence of the internalization to the binding or lack of binding of the binding agent to the cell membrane protein, respectively (step 14).
  • the methods and systems of the present disclosure can have numerous embodiments.
  • the methods and systems of the present disclosure can be utilized in various manners to screen numerous binding agents for binding to numerous cell membrane proteins of numerous cells.
  • the methods and systems of the present disclosure may be utilized to screen numerous binding agents for binding to cell membrane proteins.
  • the binding agents include, without limitation, small molecules, macromolecules, peptides, proteins (including large proteins), antibodies, aptamers, drugs, drug candidates, odors, pheromones, hormones, neurotransmitters, catecholamines, growth factors, fatty acids, proteases, antivirals, and combinations thereof.
  • the binding agent is a drug or a drug candidate for a disease.
  • the methods and systems of the present disclosure may be utilized to screen or evaluate drugs or drug candidates for the treatment or prevention of various diseases.
  • the disease includes, without limitation, cancer, diabetes, metabolic diseases, pulmonary diseases, renal diseases, hepatic disease, drug addiction, alcoholism, chronic pain, autoimmune diseases, mood disorders, heart disease, mental illness, microbial infections, HIV, eye diseases, or combinations thereof.
  • the disease includes microbial infections, such as viral infections.
  • the disease includes a microbial infection caused by a coronavirus.
  • the coronavirus includes, without limitation, severe acute respiratory syndrome coronavirus (SARS-CoV), severe acute respiratory syndrome-related coronavirus (SARSr-CoV), human coronavirus 229E (HCoV-229E), human coronavirus NL63 (HCoV-NL63), human coronavirus OC43 (HCoV-OC43), human coronavirus HKU1 (HCoV-HKUl), Middle East respiratory syndrome-related coronavirus (MERS-CoV), severe acute respiratory syndrome -related coronavirus 2 (SARS-CoV2), variants of SARS-CoV2, or combinations thereof.
  • the disease includes COVID- 19.
  • the disease includes a cancer.
  • the cancer includes, without limitation, tracheal cancer, lung cancer, bronchial cancer, epithelial cancer, blood cancer, breast cancer, melanoma, ovarian cancer, leukemia, lymphomas, prostate cancer, bladder cancer, colon cancer, gliomas, sarcomas, glioblastoma, or combinations thereof.
  • the cancer includes lung cancer.
  • the methods and systems of the present disclosure may be utilized to screen binding agents for binding to numerous types of cell membrane proteins.
  • the cell membrane protein includes, without limitation, cell membrane receptors, G-protein coupled receptors (GPCRs), plasma membrane proteins, human beta 2 adrenergic receptors, viral receptors such as Angiotensin Converting Enzyme 2, HER 2 receptors, or combinations thereof.
  • GPCRs G-protein coupled receptors
  • the cell membrane protein is an endogenously expressed cell membrane protein.
  • the cell membrane proteins of the present disclosure are genetically engineered to express a first peptide.
  • the first peptide is capable of generating a luminescent signal upon interaction with a second peptide.
  • the second peptide is not embedded with the cell membrane.
  • the luminescent signal is the only readout to detect the presence or absence of an internalization of the cell membrane.
  • the methods of the present disclosure may utilize various first and second peptides.
  • the first peptide includes Small fragment of Nano Luciferase (SmBiT).
  • SmBiT includes a sequence of VTGYRLFEEIL (SEQ ID NO: 1).
  • SmBIT includes a sequence that shares at least 65% sequence identity to SEQ ID NO:1.
  • SmBIT includes a sequence that shares at least 70% sequence identity to SEQ ID NO:1.
  • SmBIT includes a sequence that shares at least 75% sequence identity to SEQ ID NO:1.
  • SmBIT includes a sequence that shares at least 80% sequence identity to SEQ ID NO:1.
  • SmBIT includes a sequence that shares at least 85% sequence identity to SEQ ID NO:1. In some embodiments, SmBIT includes a sequence that shares at least 90% sequence identity to SEQ ID NO:1. In some embodiments, SmBIT includes a sequence that shares at least 95% sequence identity to SEQ ID NO:1. In some embodiments, SmBIT includes a sequence that shares at least 99% sequence identity to SEQ ID NO:1.
  • SmBIT includes a peptide no longer than 11 amino acids. In some embodiments, SmBIT includes a peptide longer than 11 amino acids. In some embodiments, SmBIT includes a peptide no greater than 1.4KDa.
  • the second peptide includes Large fragment of Nano Luciferase (LgBit).
  • LgBiT includes a sequence of VFTLEDFVGDWEQTAAYNLDQVLEQGGVSSLLQNLAVSVTPIQRIVRSGENALKIDIHVI IPYEGLSADQMAQIEEVFKVVYPVDDHHFKVILPYGTLVIDGVTPNMLNYFGRPYEGIA VFDGKKITVTGTLWNGNKIIDERLITPDGSMLFRVTINS (SEQ ID NO:2).
  • LgBiT includes a sequence that shares at least 65% sequence identity to SEQ ID NO:2.
  • LgBiT includes a sequence that shares at least 70% sequence identity to SEQ ID NO:2. In some embodiments, LgBiT includes a sequence that shares at least 75% sequence identity to SEQ ID NO:2. In some embodiments, LgBiT includes a sequence that shares at least 80% sequence identity to SEQ ID NO:2. In some embodiments, LgBiT includes a sequence that shares at least 85% sequence identity to SEQ ID NO:2. In some embodiments, LgBiT includes a sequence that shares at least 90% sequence identity to SEQ ID NO:2. In some embodiments, LgBiT includes a sequence that shares at least 95% sequence identity to SEQ ID NO:2.
  • LgBiT includes a sequence that shares at least 99% sequence identity to SEQ ID NO:2. [0039] In some embodiments, LgBiT includes a protein no greater than 18KDa. In some embodiments, LgBiT includes a protein with no lower affinity towards the SmBiT (SEQ ID NO: 1) than 150pM.
  • the first peptide is separated from the cell membrane protein by a flexible amino acid linker.
  • the second peptide includes a flexible amino acid linker.
  • a majority of the flexible amino acid linker residues include glycine residues, serine residues, or combinations thereof.
  • at least 90% of the flexible amino acid linker residues include glycine residues, serine residues, or combinations thereof.
  • at least 85% of the flexible amino acid linker residues include glycine residues, serine residues, or combinations thereof.
  • at least 80% of the flexible amino acid linker residues include glycine residues, serine residues, or combinations thereof.
  • At least 75% of the flexible amino acid linker residues include glycine residues, serine residues, or combinations thereof. In some embodiments, at least 70% of the flexible amino acid linker residues include glycine residues, serine residues, or combinations thereof. In some embodiments, at least 65% of the flexible amino acid linker residues include glycine residues, serine residues, or combinations thereof.
  • the flexible amino acid linker includes at least 18 residues. In some embodiments, the flexible amino acid linker includes at least 15 residues. In some embodiments, the flexible amino acid linker includes at least 10 residues. In some embodiments, the flexible amino acid linker includes at least 5 residues.
  • the flexible amino acid linker includes, without limitation, GSSGGGGSGGGGSSGGAQGNS (SEQ ID NOG), GNSGSSGGGGSGGGGSSG (SEQ ID NO:4), GSSGGGGSGGGGSSG (SEQ ID NOG), GSSGGGGSGGGGSSGGAQGNS (SEQ ID NOG), a sequence that shares at least 65% sequence identity to any one of SEQ ID NOS: 3-6, or combinations thereof.
  • the flexible amino acid linker shares at least 70% sequence identity to any one of SEQ ID NOS: 3-6. In some embodiments, the flexible amino acid linker shares at least 75% sequence identity to any one of SEQ ID NOS: 3-6. In some embodiments, the flexible amino acid linker shares at least 80% sequence identity to any one of SEQ ID NOS: 3-6. In some embodiments, the flexible amino acid linker shares at least 85% sequence identity to any one of SEQ ID NOS: 3-6. In some embodiments, the flexible amino acid linker shares at least 90% sequence identity to any one of SEQ ID NOS: 3-6. In some embodiments, the flexible amino acid linker shares at least 95% sequence identity to any one of SEQ ID NOS: 3-6. In some embodiments, the flexible amino acid linker shares at least 99% sequence identity to any one of SEQ ID NOS: 3-6.
  • the second peptide also includes a cell membrane insertion domain.
  • the cell membrane insertion domain inserts onto an internalized cell membrane in a pH dependent manner.
  • the cell membrane insertion domain is separated from the second peptide by a flexible amino acid linker.
  • the cell membrane insertion domain includes a sequence of MQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVCCNRKCKLQYLEKE ARVCVVCYETISK (SEQ ID NO: 7). In some embodiments, the cell membrane insertion domain shares at least 65% sequence identity to SEQ ID NO: 7. In some embodiments, the cell membrane insertion domain shares at least 70% sequence identity to SEQ ID NO: 7. In some embodiments, the cell membrane insertion domain shares at least 75% sequence identity to SEQ ID NO: 7. In some embodiments, the cell membrane insertion domain shares at least 80% sequence identity to SEQ ID NO: 7.
  • the cell membrane insertion domain shares at least 85% sequence identity to SEQ ID NO: 7. In some embodiments, the cell membrane insertion domain shares at least 90% sequence identity to SEQ ID NO: 7. In some embodiments, the cell membrane insertion domain shares at least 95% sequence identity to SEQ ID NO: 7. In some embodiments, the cell membrane insertion domain shares at least 99% sequence identity to SEQ ID NO: 7.
  • the cell membrane proteins and second peptides of the present disclosure are expressed in cells by plasmids.
  • the plasmids utilize low expression promoters in order to prevent non-specific interactions.
  • the low expression promoters include Herpes simplex virus (HSV) thymidine kinase promoters.
  • Cells may utilize various types of cells. Suitable cells generally include cells that express the cell membrane proteins of the present disclosure.
  • the cells include live cells.
  • the cells are cultivated in vitro, such as in a petri dish.
  • the cells are genetically engineered to express cell membrane proteins with a first peptide (e.g., SmBiT) that is capable of generating a luminescent signal upon interaction with a second peptide (e.g., a protein fragment, such as LgBit).
  • a first peptide e.g., SmBiT
  • a second peptide e.g., a protein fragment, such as LgBit
  • the cells express the second peptide (e.g., a protein fragment, such as LgBit). In some embodiments, the cells express the second peptide such that the second peptide is covalently linked to an early endosome marker.
  • the second peptide e.g., a protein fragment, such as LgBit.
  • the cells express the second peptide such that the second peptide is covalently linked to an early endosome marker.
  • the cells include, without limitation, Human Embryonic Kidney Cells, Chinese Ovary Hamster Cells, Mouse embryonic fibroblasts, Human Epithelial Carcinoma, Human T-Cell Leukemia, Human breast cancer cell lines, human colorectal adenocarcinoma cell lines, Human neuroblastoma cell lines, Human Hepatoma cell lines, Human promyelocytic leukemia cell lines, Glioma cell lines, Pancreas cancer cell lines, PC-3 prostate cell lines, Human Stem Cells, COS-1, COS-7, AC16 Cardiomyocytes, HeLa cells, BEAS-2B epithelial cells, Spodoptera Frugiperda insect cells, SK-UT-1 Uterus cell lines, and combinations thereof.
  • Human Embryonic Kidney Cells Chinese Ovary Hamster Cells
  • Mouse embryonic fibroblasts Human Epithelial Carcinoma
  • Human T-Cell Leukemia Human breast cancer cell lines
  • association occurs through the addition of binding agents to the cells.
  • association occurs by mixing the binding agents with the cells.
  • the association lacks any washing steps.
  • the association occurs without the use of automated equipment.
  • the association occurs without the need for reagent washes or automated equipment.
  • Various methods may also be utilized to detect the internalization of cell membrane proteins after association with binding agents. For instance, in some embodiments, the internalization is detected by detecting an endocytosis of a cell membrane protein. In some embodiments, the internalization is detected by detecting a receptor-mediated endocytosis of a cell membrane protein.
  • the internalization of a cell membrane protein is detected by monitoring the internalization of the cell membrane protein through an increase in luminescence emitted by the cell membrane protein after internalization.
  • the luminescence includes bioluminescence.
  • the increase in luminescence occurs when a first peptide fused to a cell membrane protein interacts with a second peptide (e.g., protein fragment) associated with an early endosome marker or an internalized cell membrane.
  • a second peptide e.g., protein fragment
  • the first peptide is SmBiT
  • the second peptide e.g., a protein fragment
  • the second peptide (e.g., protein fragment) is covalently linked to a membrane protein.
  • the first peptide is covalently attached to an early endosome marker or an internalized cell membrane.
  • the internalization is detected in real-time. In some embodiments, the absence of internalization is correlated to the lack of binding of a binding agent to a cell membrane protein. In some embodiments, the presence of internalization is correlated to a binding of the binding agent to a cell membrane protein.
  • a single binding agent is screened against a single type of cell membrane protein associated with one or more cells.
  • a single binding agent is screened against a plurality of different types of cell membrane proteins associated with one or more cells.
  • a plurality of different binding agents is screened against a single type of cell membrane protein associated with one or more cells.
  • a plurality of different binding agents is screened against a plurality of different types of cell membrane proteins associated with one or more cells.
  • the methods and systems of the present disclosure may be utilized to screen binding agents against cell membrane proteins in various environments.
  • the screening occurs in vitro.
  • the screening occurs in real-time.
  • the screening occurs in an array.
  • the screening occurs through high throughput screening, preclinical screening, automated and fast screening, or combinations thereof.
  • the methods and systems of the present disclosure can have numerous applications and advantages. For instance, in some embodiments, the methods and systems of the present disclosure can be utilized to characterize the pharmacological properties of one or more binding agents. In some embodiments, the methods and systems of the present disclosure can be utilized to screen different types of binding agents (e.g., hormones, drug candidates, and antibodies) for binding to a cell membrane on a same platform. Moreover, in some embodiments, the methods and systems of the present disclosure can be utilized to perform real-time screening of binding agents in live cells. In some embodiments, the methods and systems of the present disclosure mimic physiological conditions of cell membrane proteins by evaluating the binding of endogenously expressed cell membrane proteins to binding agents.
  • binding agents e.g., hormones, drug candidates, and antibodies
  • the methods and systems of the present disclosure provide a powerful, unrestricted, and universal technology of drug discovery and drug development that is based on trafficking properties of plasma membrane proteins.
  • current HTS technologies are restricted and not universal for the following reasons: lack of reagent universality, high costs of imaging equipment, and confounding high background fluorescence that complicates data interpretation.
  • the methods and systems of the present disclosure can be utilized for plasma membrane protein drug discovery. In most cases, current plasma membrane protein drug discovery assays are highly idiosyncratic and consequently require specialized protocol development. HTS becomes especially challenging for those receptors that are therapeutically relevant but have non-canonical signaling or remain uncharacterized. Thus, the methods and systems of the present disclosure facilitate drug discovery through detecting plasma membrane protein trafficking, which can be the single universal feature of membrane receptor protein regulation.
  • Example 1 An Assay to Monitor Membrane Proteins Trafficking for Drug Discovery and Drug Development
  • Applicant reports a methodology based on bioluminescence, produced by the fragment complementation of Nano Luciferase (NLuc).
  • NLuc Nano Luciferase
  • Example 1.1 GPCR trafficking
  • GPCRs G- protein coupled receptors
  • GAL receptors Galanin
  • CCR Chemokine receptors
  • PAR P-adrenergic receptors
  • Applicant devised a strategy to monitor how the GPCR bound to its corresponding ligand is removed from the cell surface, subsequently localized in early endosomes, and then finally recycled into the cell membrane.
  • Applicant covalently linked a small fragment of NLuc (SmBiT) to the C-terminal of the receptor, where a flexible linker is located between the two proteins (FIGS. 9-10).
  • This linker was designed to be composed mainly of glycine and alanine amino acids to provide flexibility and not to alter the pharmacological properties of the native receptor (FIGS. 2A-2B).
  • FYVE domains bind phosphatidylinositol 3-phosphate from early endosomes, in a manner that is dependent on its metal ion coordination and basic amino acids.
  • This FYVE domain inserts into cell membranes in a pH-dependent manner, where it is composed of two small beta hairpins (or zinc knuckles) and followed by an alpha helix.
  • the FYVE finger binds two zinc ions where this FYVE finger has eight potential zinc coordinating cysteine positions and is characterized by having basic amino acids around the cysteines.
  • the gene of the FYVE domain of the human Endofin was synthesized and covalently attached by molecular cloning into a large fragment of NLuc (LgBiT) at the N-termini (FIGS. 2A-2B).
  • Applicant observed an increase in luminescence in the P-adrenergic receptor 2 (P2AR) and two additional GPCRs upon agonist-mediated stimulation (FIG. 2C), reaching a maximum in luminescence intensity at 30 minutes after agonist treatment.
  • P2AR P-adrenergic receptor 2
  • FOG. 2C P-adrenergic receptor 2
  • Applicant used epinephrine to cause epinephrine-mediated sequestration of receptors from the plasma membrane and translocate them into early endosomes. This increased the blue luminescent signal in a concentration-dependent manner in response to the agonist (FIG. 2D).
  • HEK293 cells were treated with increasing concentrations of agonists.
  • the time course graph displayed an increase in normalized luminescence over time with increasing agonist concentrations.
  • the curve analysis of this response demonstrates a clear concentration-dependent response of human P2AR internalization (FIGS. 2D-F).
  • FIG. 2E To show the specificity of the internalization processes, Applicant then validated the approach by using inhibitors targeting the vital elements involved in receptor endocytosis (FIG. 2E). Internalization of GPCRs was inhibited by using the GPCR kinase 2/3 inhibitor (CmpdlOl), a selective inhibitor of clathrin-mediated endocytosis (PiTStop) and dynamin inhibitor (Dynasore), consistent with the role that P-arrestins have in agonist-dependent and mediated internalization of GPCRs. Finally, a dose-response stimulation curve was obtained (FIG. 2D) to quantify the internalization potency for the epinephrine at the P2AR (FIG. 2F).
  • Example 1.2 Assessing recycling and forward trafficking of a prototypical GPCR
  • Example 1.3 Luminescent signal is originated from early endosomes
  • PLA assay is a powerful tool to detect close proximity (about 30 nm) between two entities with high specificity and sensitivity.
  • the protein targets Applicant used were (1) NLuc, attached to the FYVE domain, (2) EEA1, at the early endosome, and (3) the P2AR (FIG. 4).
  • Applicant then used two primary antibodies, raised in different species (rabbit and mouse), to detect two unique protein targets (NLuc and EEA1 or P2AR and EEA1).
  • a pair of oligonucleotide-labeled secondary antibodies (PLA probes) were bound to the primary antibodies (FIGS. 4A-D).
  • hybridizing connector oligos joined the PLA probes. If the PLA probes were in close proximity to each other and, the ligation process formed a closed circle, serving as the DNA template required for the rolling-circle amplification (RCA). This allowed up to a 1000-fold amplified signal that was still tethered to the PLA probe, allowing localization of the signal. Lastly, labeled oligos hybridized to the complementary sequences within the amplicon which were then visualized and quantified as discrete red spots (PLA signals) by microscopy image analysis (FIGS. 3C and 3F).
  • PLA signals discrete red spots
  • P2AR prototypical GPCR
  • FAM19A5 Isoform II also called TAFA5
  • FAM19A5 Isoform II also called TAFA5
  • Applicant aimed to develop a universal drug discovery tool that can be applied to nearly any membrane receptor. After studying different physiological processes where membrane receptors are involved, Applicant conclude that almost any membrane protein expressed at the cell surface undergoes internalization, and therefore, Applicant hypothesize that it would be possible to monitor the activity of a particular receptor by observing, in real-time, its trafficking in living systems. [00100] For this purpose, Applicant used the FYVE domain of endofin since this domain binds to early endosomes. Applicant covalently linked the FYVE domain to the large fragment of NLuc (FIG. 9).
  • this technique is useful in the de-orphanization of GPCRs, especially in cases where the receptor signaling is unknown, as well as in the development and characterization of agonists and antagonists for GPCRs.
  • this internalization assay also can be applied to other classes of membrane receptors beyond the study and characterization of the GPCRs-where GPCRs account for approximately 35% of the Federal Drug Administration (FDA) approved drugs.
  • FDA Federal Drug Administration
  • RTKs receptor tyrosine kinases
  • FAM19A5 is a novel gene with multiple physiological functions (i.e., neurokine, adipokine) recently being discovered.
  • adipokine a physiological function
  • Applicant was able to study antibody-mediated internalization of FAM19A5 by two newly develop monoclonal antibodies (FIGS. 7A-B).
  • Applicant sought to extend the membrane protein internalization assay to monitor viral infections.
  • Applicant set out to monitor SARS-CoV2 the seventh coronavirus known to infect humans and able to cause severe respiratory disease, can cause multiorgan infection and cell tropism in the human body.
  • the SARS-CoV2-mediated receptor trafficking can be studied and characterized for drug discovery.
  • the virus/plasma membrane receptor can be monitored as an internalization process mediated by virus particles (FIG. 8A).
  • Applicant produced lentivirus expressing the SARS-CoV2 spike protein.
  • Applicant then added the viral suspension containing the SARS-CoV2 spike protein to cells expressing the ACE2 receptor and then covalently linked to the small domain of NLuc.
  • This design strategy enabled the simulation of the SARS-CoV2 infection in real-time and in living cells.
  • Applicant’s results demonstrate that Applicant can monitor membrane protein trafficking of SARS-CoV2 spike protein with a good signal-noise ratio and where the entire infection process takes approximately three hours and this virus-receptor complex continues to be internalized for some time thereafter. As such, Applicant envisions that this assay will enable the studying of neutralizing antibodies or antivirals.
  • this technology can also be extended to other infection systems using other viruses like those mediated by a GPCR, as in the case of the C-C chemokine receptor type 5 (CCR5) and C-X-C chemokine receptor type 4 (CXCR4), members of the chemokine receptor family, during an HIV-1 infection.
  • CCR5 C-C chemokine receptor type 5
  • CXCR4 C-X-C chemokine receptor type 4
  • Applicant’s method is that the internalization of the receptor can be monitored in real-time and the versatility to study a wide range of internalization mechanisms, ranging from GPCRs, RTKs, antibody to viral entry into the cell.
  • Applicant’s assay shows a dynamic range between 1.5 to 3, which was similar to other approaches using the structural complementation of NLuc and slightly lower as compared to other approaches measuring receptorarrestin interactions in real-time.
  • Cell culture medium and cell culture additives were from Life Technologies. All chemicals were obtained from Sigma-Aldrich (St. Louis, MO, USA) unless otherwise stated. The restriction enzymes were obtained from New England Bio Labs (Ipswich, MA, USA). All ligand peptides were synthesized by AnyGen (Gwangju, Korea). The synthesized peptide purity was greater than 98% as determined by high-performance liquid chromatography analysis. All peptides were dissolved in dimethyl sulfoxide and then diluted in media to the desired working concentrations.
  • NanoBit starter kit containing the plasmids and the necessary reagents for the development of the structural complementation assays used in this study were obtained from Promega Company (Madison, Wisconsin, USA).
  • Applicant designed primers to introduce genes of interest into pBiTl.l-C [TK/LgBiT], pBiT2.1-C [TK/SmBiT], pBiT 1.1 -N [TK/LgBiT] and pBiT2.1-N [TK/SmBiT] vectors.
  • Applicant selected at least one of these three sites as one of the two unique restriction enzymes needed for directional cloning due to the presence of an in-frame stop codon that divides the multi-cloning site.
  • Applicant incorporated nucleotide sequences into the primers to encode the linker residues shown in FIGS. 9-10.
  • Applicant prepared a 1% agarose gel to run the digested DNA plasmid and insert and proceed to cut the corresponding bands. Once the corresponding vector and insert bands were purified, Applicant determined the DNA concentration using a spectrophotometer. Applicant performed DNA ligation to fuse the insert to the recipient plasmid. Applicant prepared ligation reactions of around 100 ng of total DNA including 50 ng of plasmid vector. Applicant set up a recipient plasmid-insert ratio of approximately 1:3. Applicant also set up negative controls in parallel. For instance, ligation of the recipient plasmid DNA without any insert provided information about how much background of undigested or self-ligating recipient plasmid was present.
  • Applicant picked 3-10 individual bacterial colonies and transferred them into 1 mL of LB medium containing ampicillin (100 pg/mL) and incubated them for 6 hours. Then, Applicant used 200 pL of bacterial suspension and transferred it to 5 mL of LB medium containing the same concentration of ampicillin and incubated overnight at 37.5 °C with shaking at 200 rpm. Applicant performed miniprep DNA purifications using 5 mL of LB grown overnight following the manufacturer's instructions (Life Technologies). To identify successful ligations, Applicant set up PCR reactions using the DNA obtained from mini-preps as a template with the same primers as during the first PCR used for cloning. Positive clones produced the PCR products with the corresponding insert size. Applicant verified the construct sequence by sequencing using primers. [00123] Example 1.11. Primary ligation assays
  • HEK293 cells were seeded in an 8 well Lab-Tek II Chamber Slide (Life Technologies) with a density of 2xl0 5 cells per well. The next morning, cells were transfected with 200ng of p2AR-SmBiT and 200ng of LgBiT-FYVE constructs using Viafect (Promega Corporation). The next day, samples were treated with 10 pM epinephrine final concentration for 5 minutes, and immediately after, cells were incubated with 4% paraformaldehyde for 15 minutes at room temperature. Thereafter, the cells were rinsed with PBS and permeabilized with PBS containing 0.1% Tween 20 (PBST).
  • PBST Tween 20
  • HEK293 cells were maintained in Dulbecco’s modified Eagle’s medium (DMEM) supplemented with 10% fetal bovine serum (FBS), 100 U/ml penicillin G, and 100 pg/ml streptomycin (Invitrogen; Carlsbad, CA, USA). At 1 day before transfection, the cells were seeded in 96-well plates at a density of 2.5xl0 4 cells per well. A mixture containing 100 ng receptor construct containing the LgBit or SmBit and 50 ng of the Endofin domain containing one of the two domains of Nano luciferase and 0.3 pl Viafect (Promega) was prepared and added to each well.
  • DMEM Dulbecco’s modified Eagle’s medium
  • FBS fetal bovine serum
  • streptomycin Invitrogen; Carlsbad, CA, USA
  • the medium was aspirated and replaced with 100 pl OPTIMEM (Life Technologies, Grand Island, NY, USA). After a 10 minute incubation, 25 pl substrate (furimazine) was added, and once every minute subsequent luminescence measurements were taken for 5-10 minutes for signal stabilization. A total of 10 pl of ligand, antibody, or viral suspension was then added to each well and luminescence measurements were recorded immediately and once every minute for 1-3 hours (Synergy 2 Multi-Mode Microplate Reader BioTek, Winooski, VT, USA).
  • Example 1.13 Lentivirus -mediated Expression of the Spike Protein of SARS-CoV2
  • HEK293 cells were transfected with the plasmids containing SARS-CoV-2, Wuhan-Hu-1 (GenBank: NC_045512), spike-pseudo typed lentiviral kit (NR-52948, from Bei Resources) designed to generate pseudotyped lentiviral particles expressing the spike (S) glycoprotein gene, as well as luciferase (Luc2) and green fluorescent protein (GFP). Seventy-two hours after transfection, the medium was collected in a 50 ml tube and store at -80 °C for further applications.
  • S spike glycoprotein gene
  • Luc2 luciferase
  • GFP green fluorescent protein

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Chemical & Material Sciences (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Molecular Biology (AREA)
  • Urology & Nephrology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Cell Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Toxicology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Plasma & Fusion (AREA)
  • Peptides Or Proteins (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

Embodiments of the present disclosure pertain to systems for use in screening at least one binding agent for binding to at least one cell membrane protein. The systems include one or more cells that include the cell membrane protein. The cell membrane protein is genetically engineered to express a first peptide capable of generating a luminescent signal upon interaction with a second peptide. The systems may also include the second peptide. Additional embodiments of the present disclosure pertain to methods of utilizing the systems to screen at least one binding agent for binding to at least one cell membrane protein.

Description

TITLE
MONITORING MEMBRANE PROTEIN TRAFFICKING FOR DRUG DISCOVERY AND DRUG DEVELOPMENT
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority to U.S. Provisional Patent Application No. 63/115,827, filed on November 19, 2020. The entirety of the aforementioned application is incorporated herein by reference.
BACKGROUND
[0002] Current methods of screening potential binding agents for binding to cell membrane receptors have numerous limitations, including a lack of reagent universality, high costs of imaging equipment, and confounding background fluorescence. Numerous embodiments of the present disclosure address the aforementioned limitations.
SUMMARY
[0003] Embodiments of the present disclosure pertain to systems for use in screening at least one binding agent for binding to at least one cell membrane protein. In some embodiments, the systems of the present disclosure include one or more cells that include the cell membrane protein. In some embodiments, the cell membrane protein is genetically engineered to express a first peptide capable of generating a luminescent signal upon interaction with a second peptide. In some embodiments, the first peptide is separated from the cell membrane protein by a flexible amino acid linker, where a majority of the peptide residues include glycine residues, serine residues, or combinations thereof. In some embodiments, the systems of the present disclosure also include the second peptide. In some embodiments, the first peptide includes Small fragment of Nano Luciferase (SmBiT) and the second peptide includes Large fragment of Nano Luciferase (LgBit). [0004] Additional embodiments of the present disclosure pertain to methods of utilizing the systems of the present disclosure to screen at least one binding agent for binding to at least one cell membrane protein. In some embodiments, the methods of the present disclosure include: (a) associating the binding agent with a cell that includes the cell membrane protein, where the cell membrane protein is genetically engineered to express a first peptide capable of generating a luminescent signal upon interaction with a second peptide; (b) detecting a presence or an absence of an internalization of the cell membrane protein by the presence or absence of the luminescent signal, respectively; and (c) correlating the presence or absence of the internalization to the binding or lack of binding of the binding agent to the cell membrane protein, respectively.
DESCRIPTION OF THE DRAWINGS
[0005] FIG. 1A depicts a system for screening a binding agent for binding to a cell membrane protein.
[0006] FIG. IB illustrates a method of screening a binding agent for binding to a cell membrane protein.
[0007] FIGS. 2A-F illustrate G protein-coupled receptor (GPCR) internalization via early endosomes. FIG. 2A provides a schematic of the overall concept of a structural complementation assay to monitor internalization in real-time living cells. FIG. 2B is a schematic of a structural complementation system based on Nano Luciferase showing the LgBiT (Large fragment of Nano Luciferase) and SmBiT (Small fragment of Nano Luciferase). FIG. 2C shows different internalization rates across different GPCRs. Galanin receptors were stimulated using 10 pM Galanin (GALi and GAL2 receptors) whereas, in the case of chemokine receptor 4 (CCR4), 100 ng/ml of SDF-la was used. FIG. 2D shows dose-dependent internalization of human [32AR in early endosomes in cardiomyocytes using different concentrations of epinephrine. FIG. 2E shows validation of the GPCR internalization assay using 10 p M of endocytosis inhibitors, cmpdlOl, PiTStop, and Dynasore. FIG. 2F shows dose-response curve stimulation for internalization of P2AR. The results are expressed as mean ± s.e.m. of three experiments performed in triplicate; each triplicate was averaged before calculating the s.e.m. The corresponding Z’ factor was 0.63. [0008] FIGS. 3A-B show monitoring in real-time the internalization and recycling of a prototypical GPCR. Shown in FIGS. 3A-B are recycling of [32AR in HEK293 cells using 10 pM epinephrine; Number “1 ” indicates the receptor being removed from the plasma membrane, Number “2 ” corresponds to the receptor being localized in early endosomes, and Number “3 ” indicates the washout of the ligand and return of the receptor to the cell surface. The arrows indicate the time at which the cells were treated with the corresponding ligand. The results are expressed as mean ± s.e.m. of three experiments performed in triplicate; each triplicate was averaged before calculating the s.e.m.
[0009] FIGS. 4A-F show schematics of the Proximity Ligation Assay (PLA). Two primary antibodies recognize specific proteins in the cell. FIG. 4A shows [32AR-SmBiT and Early Endosome Antigen 1 (EEA1). FIG. 4D shows LgBiT-FYVE and Early Endosome Antigen 1. In both cases, secondary antibodies coupled with oligonucleotides (PLA probes) bind to the primary antibodies. When the PLA probes are in close proximity, connector oligos join the PLA probes and become ligated. The resulting closed, circular DNA template becomes amplified by DNA polymerase. Then, complementary detection oligos coupled to fluorochromes hybridize to repeating sequences in the amplicons. PLA signals are detected by fluorescent microscopy as discrete spots and provide the intracellular localization of the protein or protein interaction. Confocal images were obtained from the PLA of the early endosomes (FIGS. 4B, 4C, 4E, and 4F). FIG. 4B shows the PLA assay using antibodies targeting [32 AR and EEA1 in the absence of ligand (vehicle control). FIG. 4C shows the PLA assay using the same antibodies as in FIG. 4C but where the sample was incubated for 5 minutes in the presence of 10 pM epinephrine. FIG. 4E shows the PLA assay using antibodies targeting the LgBiT-FYVE and EEA1 in the absence of ligand (vehicle control). FIG. 4F shows the PLA assay using the same antibodies as in FIG. 4E but where the sample was incubated for 5 minutes in the presence of 10 p M epinephrine. High magnification (scale bar = 10 pm) or FIG. 4C and FIG.4F are shown in the inserts to the far right, respectively.
[0010] FIG. 5 illustrates visualization of receptor localization in HEK293 cells using a bioluminescence LV200 Olympus microscope. HEK293 cells were transfected with [32AR- SmBiT and LgBiT-FYVE. The luminescence images were acquired after the addition of the luciferase substrate, furimazine, and 10 |aM epinephrine (final concentration) by capturing total luminescence for 2 minutes at each of the indicated times. Scale bar represents 20 pm.
[0011] FIGS. 6A-6B provides illustrations of non-GPCR HER 2 receptors. FIG. 6A shows a schematic representation for monitoring internalization of the HER2 receptor. FIG. 6B shows HER2 receptor time course internalization of cells expressing the receptor treated with 10 pM (final concentration) human epidermal growth factor (hEGF). The arrow indicates the time when the cells were treated with the virus. The results are expressed as mean ± s.e.m. of three experiments performed in triplicate; each triplicate was averaged before calculating the s.e.m. The corresponding Z’ factor was 0.70.
[0012] FIGS. 7A-C illustrate membrane protein internalization by binding with two monoclonal antibodies. FIG. 7A provides a schematic of a membrane protein being internalized by the binding with an antibody via early endosomes. FIGS. 7B-1 and 7B-2 show the membrane protein (FAM19A5 Isoform II) being internalized when cells expressing FAM19A5 Isoform II were treated with 10 nM and 100 nM of two antibodies (these antibodies are currently under development). 1 pM IgG antibody was used as a control. The top panel shows antibody A and the botom panel shows antibody B. FIG. 7C shows dose-response curves for both antibodies. The corresponding EC50 value for antibody A was 7.08 ± 0.2 nM (Z’ factor of 0.92) and for antibody B (Z’ factor of 0.943) was 10.54 ± 0.5 nM. The arrow indicates the time when the cells were treated with the virus. The results are expressed as mean ± s.e.m. of three experiments performed in triplicate; each triplicate was averaged before calculating the s.e.m.
[0013] FIGS. 8A-8B show monitoring SARS-CoV2 infection in real-time in living HEK293 cells. FIG. 8A shows a schematic representation of how the Lentivirus expressing the SARS- CoV2 Spike protein is internalized by binding with Angiotensin-Converting Enzyme 2 (ACE2) via early endosomes. FIG. 8B shows real-time monitoring of viral entry into HEK293 cells expressing human ACE2 when treated with the Lentivirus. The arrow indicates the time when the cells were treated with the virus. The results are expressed as mean ± s.e.m. of three experiments performed in triplicate; each triplicate was averaged before calculating the s.e.m.
The corresponding Z’ score was 0.50.
[0014] FIG. 9 shows amino acid sequences of the constructs used to monitor receptor internalization and SARS-CoV2 infection.
[0015] FIG. 10 shows amino acid sequences of the constructs used to monitor antibody mediated internalization of FAM19A5 isoform II.
DETAILED DESCRIPTION
[0016] It is to be understood that both the foregoing general description and the following detailed description are illustrative and explanatory, and are not restrictive of the subject matter, as claimed. In this application, the use of the singular includes the plural, the word “a” or “an” means “at least one”, and the use of “or” means “and/or”, unless specifically stated otherwise. Furthermore, the use of the term “including”, as well as other forms, such as “includes” and “included”, is not limiting. Also, terms such as “element” or “component” encompass both elements or components comprising one unit and elements or components that comprise more than one unit unless specifically stated otherwise.
[0017] The section headings used herein are for organizational purposes and are not to be construed as limiting the subject matter described. All documents, or portions of documents, cited in this application, including, but not limited to, patents, patent applications, articles, books, and treatises, are hereby expressly incorporated herein by reference in their entirety for any purpose. In the event that one or more of the incorporated literature and similar materials define a term in a manner that contradicts the definition of that term in this application, this application controls.
[0018] The advent of high-throughput screening (HTS) has enabled successful unbiased drugdiscovery and fostered the development of novel therapies. Arguably, the most fruitful targets in HTS platforms have been membrane proteins that comprise 22% of the proteins encoded by the genome and are targeted by 60% of the approved drugs available today. Almost half of these drugs are directed at the rhodopsin-like class A G protein-coupled receptor (GPCR) superfamily. Many of these receptors have underlying roles in a myriad of diseases, including cancer, heart disease, diabetes, metabolic diseases, pulmonary diseases, renal diseases, hepatic disease, drug addiction, alcoholism, chronic pain, autoimmune diseases, mood disorders, and mental illness. Therefore, membrane proteins represent a goldmine of targets that must be screened to fully exploit their rich therapeutic potential.
[0019] HTS platforms for plasma membrane receptors have had success due to reliable cell-based systems for monitoring the diversity of downstream messenger pathways, such as cAMP signaling, calcium mobilization, and Rho GTPase activation. However, in most cases, these assays are highly idiosyncratic and consequently require the development of specialized protocols. HTS becomes particularly challenging for those receptors that are of great therapeutic interest but have non- canonical signaling or remain uncharacterized. Thus, plasma membrane trafficking is the single universal feature of membrane receptor protein regulation.
[0020] The reasons why HTS trafficking screens are not more often utilized include a lack of reagent universality, high costs of imaging equipment, and confounding background fluorescence that, in many instances, requires sophisticated deconvolution algorithms to identify subpopulations of membrane proteins. Accordingly, a need exists for more effective methods of screening potential binding agents to membrane receptors. Numerous embodiments of the present disclosure address the aforementioned need.
[0021] In some embodiments, the present disclosure pertains to systems for use in screening at least one binding agent for binding to at least one cell membrane protein. In some embodiments, the systems of the present disclosure include one or more cells that include at least one cell membrane protein. In some embodiments, the systems of the present disclosure also include a second peptide.
[0022] In some embodiments illustrated in FIG. 1A, the systems of the present disclosure include one or more cells that include at least one cell membrane protein 12. In this embodiment, cell membrane protein 12 is embedded in cellular membrane 14 and genetically engineered to express a first peptide 16, which is separated from the cell membrane protein by a flexible amino acid linker 18. In some embodiments, the systems of the present disclosure also include candidate binding agents 10 and second peptides 20.
[0023] In operation, candidate binding agents 10 are associated with cell membrane protein 12. Thereafter, internalization occurs if binding agent 10 binds to cell membrane protein 12. Such internalization is detectable by the presence of a luminescent signal, which occurs when first peptide 16 interacts with second peptide 20.
[0024] In additional embodiments, the present disclosure pertains to methods of screening at least one binding agent for binding to at least one cell membrane protein. In some embodiments, the methods of the present disclosure utilize the systems of the present disclosure. In some embodiments illustrated in FIG. IB, the methods of the present disclosure include: associating a binding agent with a cell that includes at least one cell membrane protein that is genetically engineered to express a first peptide capable of generating a luminescent signal upon interaction with a second peptide (step 10); detecting a presence or absence of an internalization of the cell membrane protein by detecting the presence or absence of the luminescent signal, respectively (step 12); and correlating the presence or absence of the internalization to the binding or lack of binding of the binding agent to the cell membrane protein, respectively (step 14).
[0025] The methods and systems of the present disclosure can have numerous embodiments. For instance, the methods and systems of the present disclosure can be utilized in various manners to screen numerous binding agents for binding to numerous cell membrane proteins of numerous cells.
[0026] Binding agents
[0027] The methods and systems of the present disclosure may be utilized to screen numerous binding agents for binding to cell membrane proteins. For instance, in some embodiments, the binding agents include, without limitation, small molecules, macromolecules, peptides, proteins (including large proteins), antibodies, aptamers, drugs, drug candidates, odors, pheromones, hormones, neurotransmitters, catecholamines, growth factors, fatty acids, proteases, antivirals, and combinations thereof.
[0028] In some embodiments, the binding agent is a drug or a drug candidate for a disease. As such, in some embodiments, the methods and systems of the present disclosure may be utilized to screen or evaluate drugs or drug candidates for the treatment or prevention of various diseases.
[0029] In some embodiments, the disease includes, without limitation, cancer, diabetes, metabolic diseases, pulmonary diseases, renal diseases, hepatic disease, drug addiction, alcoholism, chronic pain, autoimmune diseases, mood disorders, heart disease, mental illness, microbial infections, HIV, eye diseases, or combinations thereof. In some embodiments, the disease includes microbial infections, such as viral infections.
[0030] In some embodiments, the disease includes a microbial infection caused by a coronavirus. In some embodiments, the coronavirus includes, without limitation, severe acute respiratory syndrome coronavirus (SARS-CoV), severe acute respiratory syndrome-related coronavirus (SARSr-CoV), human coronavirus 229E (HCoV-229E), human coronavirus NL63 (HCoV-NL63), human coronavirus OC43 (HCoV-OC43), human coronavirus HKU1 (HCoV-HKUl), Middle East respiratory syndrome-related coronavirus (MERS-CoV), severe acute respiratory syndrome -related coronavirus 2 (SARS-CoV2), variants of SARS-CoV2, or combinations thereof. In some embodiments, the disease includes COVID- 19.
[0031] In some embodiments, the disease includes a cancer. In some embodiments, the cancer includes, without limitation, tracheal cancer, lung cancer, bronchial cancer, epithelial cancer, blood cancer, breast cancer, melanoma, ovarian cancer, leukemia, lymphomas, prostate cancer, bladder cancer, colon cancer, gliomas, sarcomas, glioblastoma, or combinations thereof. In some embodiments, the cancer includes lung cancer.
[0032] Cell membrane proteins
[0033] The methods and systems of the present disclosure may be utilized to screen binding agents for binding to numerous types of cell membrane proteins. For instance, in some embodiments, the cell membrane protein includes, without limitation, cell membrane receptors, G-protein coupled receptors (GPCRs), plasma membrane proteins, human beta 2 adrenergic receptors, viral receptors such as Angiotensin Converting Enzyme 2, HER 2 receptors, or combinations thereof. In some embodiments, the cell membrane protein is an endogenously expressed cell membrane protein.
[0034] First and second peptides
[0035] In some embodiments, the cell membrane proteins of the present disclosure are genetically engineered to express a first peptide. In some embodiments, the first peptide is capable of generating a luminescent signal upon interaction with a second peptide. In some embodiments, the second peptide is not embedded with the cell membrane. In some embodiments, the luminescent signal is the only readout to detect the presence or absence of an internalization of the cell membrane.
[0036] The methods of the present disclosure may utilize various first and second peptides. For instance, in some embodiments, the first peptide includes Small fragment of Nano Luciferase (SmBiT). In some embodiments, SmBiT includes a sequence of VTGYRLFEEIL (SEQ ID NO: 1). In some embodiments, SmBIT includes a sequence that shares at least 65% sequence identity to SEQ ID NO:1. In some embodiments, SmBIT includes a sequence that shares at least 70% sequence identity to SEQ ID NO:1. In some embodiments, SmBIT includes a sequence that shares at least 75% sequence identity to SEQ ID NO:1. In some embodiments, SmBIT includes a sequence that shares at least 80% sequence identity to SEQ ID NO:1. In some embodiments, SmBIT includes a sequence that shares at least 85% sequence identity to SEQ ID NO:1. In some embodiments, SmBIT includes a sequence that shares at least 90% sequence identity to SEQ ID NO:1. In some embodiments, SmBIT includes a sequence that shares at least 95% sequence identity to SEQ ID NO:1. In some embodiments, SmBIT includes a sequence that shares at least 99% sequence identity to SEQ ID NO:1.
[0037] In some embodiments, SmBIT includes a peptide no longer than 11 amino acids. In some embodiments, SmBIT includes a peptide longer than 11 amino acids. In some embodiments, SmBIT includes a peptide no greater than 1.4KDa.
[0038] In some embodiments, the second peptide includes Large fragment of Nano Luciferase (LgBit). In some embodiments, LgBiT includes a sequence of VFTLEDFVGDWEQTAAYNLDQVLEQGGVSSLLQNLAVSVTPIQRIVRSGENALKIDIHVI IPYEGLSADQMAQIEEVFKVVYPVDDHHFKVILPYGTLVIDGVTPNMLNYFGRPYEGIA VFDGKKITVTGTLWNGNKIIDERLITPDGSMLFRVTINS (SEQ ID NO:2). In some embodiments, LgBiT includes a sequence that shares at least 65% sequence identity to SEQ ID NO:2. In some embodiments, LgBiT includes a sequence that shares at least 70% sequence identity to SEQ ID NO:2. In some embodiments, LgBiT includes a sequence that shares at least 75% sequence identity to SEQ ID NO:2. In some embodiments, LgBiT includes a sequence that shares at least 80% sequence identity to SEQ ID NO:2. In some embodiments, LgBiT includes a sequence that shares at least 85% sequence identity to SEQ ID NO:2. In some embodiments, LgBiT includes a sequence that shares at least 90% sequence identity to SEQ ID NO:2. In some embodiments, LgBiT includes a sequence that shares at least 95% sequence identity to SEQ ID NO:2. In some embodiments, LgBiT includes a sequence that shares at least 99% sequence identity to SEQ ID NO:2. [0039] In some embodiments, LgBiT includes a protein no greater than 18KDa. In some embodiments, LgBiT includes a protein with no lower affinity towards the SmBiT (SEQ ID NO: 1) than 150pM.
[0040] In some embodiments, the first peptide is separated from the cell membrane protein by a flexible amino acid linker. In some embodiments, the second peptide includes a flexible amino acid linker. In some embodiments, a majority of the flexible amino acid linker residues include glycine residues, serine residues, or combinations thereof. In some embodiments, at least 90% of the flexible amino acid linker residues include glycine residues, serine residues, or combinations thereof. In some embodiments, at least 85% of the flexible amino acid linker residues include glycine residues, serine residues, or combinations thereof. In some embodiments, at least 80% of the flexible amino acid linker residues include glycine residues, serine residues, or combinations thereof. In some embodiments, at least 75% of the flexible amino acid linker residues include glycine residues, serine residues, or combinations thereof. In some embodiments, at least 70% of the flexible amino acid linker residues include glycine residues, serine residues, or combinations thereof. In some embodiments, at least 65% of the flexible amino acid linker residues include glycine residues, serine residues, or combinations thereof.
[0041] In some embodiments, the flexible amino acid linker includes at least 18 residues. In some embodiments, the flexible amino acid linker includes at least 15 residues. In some embodiments, the flexible amino acid linker includes at least 10 residues. In some embodiments, the flexible amino acid linker includes at least 5 residues.
[0042] In some embodiments, the flexible amino acid linker includes, without limitation, GSSGGGGSGGGGSSGGAQGNS (SEQ ID NOG), GNSGSSGGGGSGGGGSSG (SEQ ID NO:4), GSSGGGGSGGGGSSG (SEQ ID NOG), GSSGGGGSGGGGSSGGAQGNS (SEQ ID NOG), a sequence that shares at least 65% sequence identity to any one of SEQ ID NOS: 3-6, or combinations thereof.
[0043] In some embodiments, the flexible amino acid linker shares at least 70% sequence identity to any one of SEQ ID NOS: 3-6. In some embodiments, the flexible amino acid linker shares at least 75% sequence identity to any one of SEQ ID NOS: 3-6. In some embodiments, the flexible amino acid linker shares at least 80% sequence identity to any one of SEQ ID NOS: 3-6. In some embodiments, the flexible amino acid linker shares at least 85% sequence identity to any one of SEQ ID NOS: 3-6. In some embodiments, the flexible amino acid linker shares at least 90% sequence identity to any one of SEQ ID NOS: 3-6. In some embodiments, the flexible amino acid linker shares at least 95% sequence identity to any one of SEQ ID NOS: 3-6. In some embodiments, the flexible amino acid linker shares at least 99% sequence identity to any one of SEQ ID NOS: 3-6.
[0044] In some embodiments, the second peptide also includes a cell membrane insertion domain. In some embodiments, the cell membrane insertion domain inserts onto an internalized cell membrane in a pH dependent manner. In some embodiments, the cell membrane insertion domain is separated from the second peptide by a flexible amino acid linker.
[0045] In some embodiments, the cell membrane insertion domain includes a sequence of MQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVCCNRKCKLQYLEKE ARVCVVCYETISK (SEQ ID NO: 7). In some embodiments, the cell membrane insertion domain shares at least 65% sequence identity to SEQ ID NO: 7. In some embodiments, the cell membrane insertion domain shares at least 70% sequence identity to SEQ ID NO: 7. In some embodiments, the cell membrane insertion domain shares at least 75% sequence identity to SEQ ID NO: 7. In some embodiments, the cell membrane insertion domain shares at least 80% sequence identity to SEQ ID NO: 7. In some embodiments, the cell membrane insertion domain shares at least 85% sequence identity to SEQ ID NO: 7. In some embodiments, the cell membrane insertion domain shares at least 90% sequence identity to SEQ ID NO: 7. In some embodiments, the cell membrane insertion domain shares at least 95% sequence identity to SEQ ID NO: 7. In some embodiments, the cell membrane insertion domain shares at least 99% sequence identity to SEQ ID NO: 7.
[0046] In some embodiments, the cell membrane proteins and second peptides of the present disclosure are expressed in cells by plasmids. In some embodiments, the plasmids utilize low expression promoters in order to prevent non-specific interactions. In some embodiments, the low expression promoters include Herpes simplex virus (HSV) thymidine kinase promoters.
[0047] Cells [0048] The systems and methods of the present disclosure may utilize various types of cells. Suitable cells generally include cells that express the cell membrane proteins of the present disclosure.
[0049] In some embodiments, the cells include live cells. In some embodiments, the cells are cultivated in vitro, such as in a petri dish. In some embodiments, the cells are genetically engineered to express cell membrane proteins with a first peptide (e.g., SmBiT) that is capable of generating a luminescent signal upon interaction with a second peptide (e.g., a protein fragment, such as LgBit).
[0050] In some embodiments, the cells express the second peptide (e.g., a protein fragment, such as LgBit). In some embodiments, the cells express the second peptide such that the second peptide is covalently linked to an early endosome marker.
[0051] The methods and systems of the present disclosure may utilize various types of cells. For instance, in some embodiments, the cells include, without limitation, Human Embryonic Kidney Cells, Chinese Ovary Hamster Cells, Mouse embryonic fibroblasts, Human Epithelial Carcinoma, Human T-Cell Leukemia, Human breast cancer cell lines, human colorectal adenocarcinoma cell lines, Human neuroblastoma cell lines, Human Hepatoma cell lines, Human promyelocytic leukemia cell lines, Glioma cell lines, Pancreas cancer cell lines, PC-3 prostate cell lines, Human Stem Cells, COS-1, COS-7, AC16 Cardiomyocytes, HeLa cells, BEAS-2B epithelial cells, Spodoptera Frugiperda insect cells, SK-UT-1 Uterus cell lines, and combinations thereof.
[0052] Association of binding agents with cells
[0053] Various methods may be utilized to associate binding agents with cells in order to screen the binding of the binding agents to cell membrane proteins of cells. For instance, in some embodiments, the association occurs through the addition of binding agents to the cells. In some embodiments, the association occurs by mixing the binding agents with the cells. In some embodiments, the association lacks any washing steps. In some embodiments, the association occurs without the use of automated equipment. In some embodiments, the association occurs without the need for reagent washes or automated equipment.
[0054] Detecting internalization of cell membrane proteins [0055] Internalization of cell membrane proteins is generally characterized by the presence of a luminescent signal. Similarly, the absence of internalization of cell membrane proteins is generally characterized by the absence of luminescent signals.
[0056] Various methods may also be utilized to detect the internalization of cell membrane proteins after association with binding agents. For instance, in some embodiments, the internalization is detected by detecting an endocytosis of a cell membrane protein. In some embodiments, the internalization is detected by detecting a receptor-mediated endocytosis of a cell membrane protein.
[0057] In some embodiments, the internalization of a cell membrane protein is detected by monitoring the internalization of the cell membrane protein through an increase in luminescence emitted by the cell membrane protein after internalization. In some embodiments, the luminescence includes bioluminescence.
[0058] In some embodiments, the increase in luminescence occurs when a first peptide fused to a cell membrane protein interacts with a second peptide (e.g., protein fragment) associated with an early endosome marker or an internalized cell membrane. In some embodiments, the first peptide is SmBiT, and the second peptide (e.g., a protein fragment) is LgBit.
[0059] In some embodiments, the second peptide (e.g., protein fragment) is covalently linked to a membrane protein. In some embodiments, the first peptide is covalently attached to an early endosome marker or an internalized cell membrane.
[0060] In some embodiments, the internalization is detected in real-time. In some embodiments, the absence of internalization is correlated to the lack of binding of a binding agent to a cell membrane protein. In some embodiments, the presence of internalization is correlated to a binding of the binding agent to a cell membrane protein.
[0061] Screening
[0062] The methods and systems of the present disclosure may be utilized to screen binding agents against cell membrane proteins in various manners. For instance, in some embodiments, a single binding agent is screened against a single type of cell membrane protein associated with one or more cells. In some embodiments, a single binding agent is screened against a plurality of different types of cell membrane proteins associated with one or more cells. In some embodiments, a plurality of different binding agents is screened against a single type of cell membrane protein associated with one or more cells. In some embodiments, a plurality of different binding agents is screened against a plurality of different types of cell membrane proteins associated with one or more cells.
[0063] The methods and systems of the present disclosure may be utilized to screen binding agents against cell membrane proteins in various environments. For instance, in some embodiments, the screening occurs in vitro. In some embodiments, the screening occurs in real-time. In some embodiments, the screening occurs in an array. In some embodiments, the screening occurs through high throughput screening, preclinical screening, automated and fast screening, or combinations thereof.
[0064] Applications and Advantages
[0065] The methods and systems of the present disclosure can have numerous applications and advantages. For instance, in some embodiments, the methods and systems of the present disclosure can be utilized to characterize the pharmacological properties of one or more binding agents. In some embodiments, the methods and systems of the present disclosure can be utilized to screen different types of binding agents (e.g., hormones, drug candidates, and antibodies) for binding to a cell membrane on a same platform. Moreover, in some embodiments, the methods and systems of the present disclosure can be utilized to perform real-time screening of binding agents in live cells. In some embodiments, the methods and systems of the present disclosure mimic physiological conditions of cell membrane proteins by evaluating the binding of endogenously expressed cell membrane proteins to binding agents.
[0066] In some embodiments, the methods and systems of the present disclosure provide a powerful, unrestricted, and universal technology of drug discovery and drug development that is based on trafficking properties of plasma membrane proteins. On the other hand, current HTS technologies are restricted and not universal for the following reasons: lack of reagent universality, high costs of imaging equipment, and confounding high background fluorescence that complicates data interpretation. [0067] In some embodiments, the methods and systems of the present disclosure can be utilized for plasma membrane protein drug discovery. In most cases, current plasma membrane protein drug discovery assays are highly idiosyncratic and consequently require specialized protocol development. HTS becomes especially challenging for those receptors that are therapeutically relevant but have non-canonical signaling or remain uncharacterized. Thus, the methods and systems of the present disclosure facilitate drug discovery through detecting plasma membrane protein trafficking, which can be the single universal feature of membrane receptor protein regulation.
[0068] Additional Embodiments
[0069] Reference will now be made to more specific embodiments of the present disclosure and experimental results that provide support for such embodiments. However, Applicants note that the disclosure below is for illustrative purposes only and is not intended to limit the scope of the claimed subject matter in any way.
[0070] Example 1. An Assay to Monitor Membrane Proteins Trafficking for Drug Discovery and Drug Development
[0071] Internalization of membrane proteins plays a key role in many physiological functions. However, highly sensitive and versatile technologies are lacking to study such processes in realtime living systems. Here, Applicant describes an assay based on bioluminescence able to quantify membrane receptor trafficking for a wide variety of internalization mechanisms such as GPCR internalization and recycling, antibody-mediated internalization, and S ARS-CoV2 viral infections. This study represents an alternative drug discovery tool to accelerate the drug development for a wide range of physiological processes, such as cancer, neurological, cardiopulmonary, metabolic, and infectious diseases including COVID-19.
[0072] In this Example, Applicant hypothesized that, due to the high sensitivity of bioluminescence, Applicant could devise an assay using blue light emission to monitor a wide variety of internalization processes by targeting the early endosomes and using NanoLuc Binary Technology (NanoBiT). Bioluminescence resonance energy transfer (BRET) between a Renilla luciferase-inserted GPCR and a GFPlO-fused FYVE domain was previously developed to measure GPCR internalization. Therefore, Applicant replaced the BRET pair with a split luciferase (NanoBiT) and added flexible amino acid linkers in between.
[0073] Here, Applicant reports a methodology based on bioluminescence, produced by the fragment complementation of Nano Luciferase (NLuc). This assay allows for quantifying realtime membrane protein internalization and recycling in living systems by using bioluminescence. Moreover, this method can universally be applied to monitor the internalization of a wide range of membrane proteins and be used in the elucidation of novel molecular mechanisms as well as the development of therapeutic agents for cancer, cardiopulmonary and infectious diseases including COVID-19.
[0074] Example 1.1. GPCR trafficking
[0075] Applicant initially focused on studying the different internalization rates of class A G- protein coupled receptors (GPCRs). For this, Applicant first established a set of GPCRs involved in a wide variety of physiological functions and diseases such as Galanin (GAL receptors), Chemokine receptors (CCR), and P-adrenergic receptors (PAR). Applicant devised a strategy to monitor how the GPCR bound to its corresponding ligand is removed from the cell surface, subsequently localized in early endosomes, and then finally recycled into the cell membrane. To accomplish this, Applicant covalently linked a small fragment of NLuc (SmBiT) to the C-terminal of the receptor, where a flexible linker is located between the two proteins (FIGS. 9-10). This linker was designed to be composed mainly of glycine and alanine amino acids to provide flexibility and not to alter the pharmacological properties of the native receptor (FIGS. 2A-2B).
[0076] To detect light emission when the receptor is being localized at the early endosomes, Applicant focused on the interaction between the early endosome and the FYVE zinc finger domain, where the FYVE zinc finger domain is named after the four cysteine-rich proteins: Fab 1 (yeast orthologue of PIKfyve), YOTB, Vac 1 (vesicle transport protein), and EEAl(Early Endosome Antigen 1).
[0077] FYVE domains bind phosphatidylinositol 3-phosphate from early endosomes, in a manner that is dependent on its metal ion coordination and basic amino acids. This FYVE domain inserts into cell membranes in a pH-dependent manner, where it is composed of two small beta hairpins (or zinc knuckles) and followed by an alpha helix. Additionally, the FYVE finger binds two zinc ions where this FYVE finger has eight potential zinc coordinating cysteine positions and is characterized by having basic amino acids around the cysteines. To achieve this, the gene of the FYVE domain of the human Endofin (residues from Q739 to K806) was synthesized and covalently attached by molecular cloning into a large fragment of NLuc (LgBiT) at the N-termini (FIGS. 2A-2B).
[0078] Applicant observed an increase in luminescence in the P-adrenergic receptor 2 (P2AR) and two additional GPCRs upon agonist-mediated stimulation (FIG. 2C), reaching a maximum in luminescence intensity at 30 minutes after agonist treatment. In the case of P2AR, Applicant used epinephrine to cause epinephrine-mediated sequestration of receptors from the plasma membrane and translocate them into early endosomes. This increased the blue luminescent signal in a concentration-dependent manner in response to the agonist (FIG. 2D).
[0079] Regarding the quantitative pharmacological analysis of GPCRs, HEK293 cells were treated with increasing concentrations of agonists. The time course graph displayed an increase in normalized luminescence over time with increasing agonist concentrations. The curve analysis of this response demonstrates a clear concentration-dependent response of human P2AR internalization (FIGS. 2D-F).
[0080] To show the specificity of the internalization processes, Applicant then validated the approach by using inhibitors targeting the vital elements involved in receptor endocytosis (FIG. 2E). Internalization of GPCRs was inhibited by using the GPCR kinase 2/3 inhibitor (CmpdlOl), a selective inhibitor of clathrin-mediated endocytosis (PiTStop) and dynamin inhibitor (Dynasore), consistent with the role that P-arrestins have in agonist-dependent and mediated internalization of GPCRs. Finally, a dose-response stimulation curve was obtained (FIG. 2D) to quantify the internalization potency for the epinephrine at the P2AR (FIG. 2F).
[0081] Example 1.2. Assessing recycling and forward trafficking of a prototypical GPCR
[0082] By using the same approach, Applicant was able to study not only GPCR internalization but also receptor recycling (FIG. 3A). After treating the cells expressing p2AR-SmBiT with the final concentration of lOpM epinephrine, the internalization process occurred. This internalization process was observed by a rapid increase in luminescence, indicating the receptor was being removed from the cell surface (FIG. 3A, number- 7). This was then followed by a maximum in the luminescent signal being reached, suggesting the receptor was localized at the endosome (FIG. 3A, number-2).
[0083] After a few minutes of signal stability, Applicant took the plate out of the luminometer, removed the medium containing the ligand and replaced it with fresh medium in the absence of epinephrine, and continued measuring the luminescence signal. Applicant observed a gradual decay of signal in the absence of ligand, indicating the ligand-receptor complex was being dissociated and the receptor and localized back to the plasma membrane (FIG. 3A, number-3). It is interesting to note that the P2AR recycling back to the cell surface was slightly slower as compared to its internalization kinetics.
[0084] Example 1.3. Luminescent signal is originated from early endosomes
[0085] To demonstrate that the luminescent signal is generated from early endosomes, Applicant performed a proximity ligation assay (PLA). The PLA assay is a powerful tool to detect close proximity (about 30 nm) between two entities with high specificity and sensitivity. In this case, the protein targets Applicant used were (1) NLuc, attached to the FYVE domain, (2) EEA1, at the early endosome, and (3) the P2AR (FIG. 4). Applicant then used two primary antibodies, raised in different species (rabbit and mouse), to detect two unique protein targets (NLuc and EEA1 or P2AR and EEA1). A pair of oligonucleotide-labeled secondary antibodies (PLA probes) were bound to the primary antibodies (FIGS. 4A-D).
[0086] Next, hybridizing connector oligos joined the PLA probes. If the PLA probes were in close proximity to each other and, the ligation process formed a closed circle, serving as the DNA template required for the rolling-circle amplification (RCA). This allowed up to a 1000-fold amplified signal that was still tethered to the PLA probe, allowing localization of the signal. Lastly, labeled oligos hybridized to the complementary sequences within the amplicon which were then visualized and quantified as discrete red spots (PLA signals) by microscopy image analysis (FIGS. 3C and 3F).
[0087] Example 1.4. Live cell imaging: GPCR internalization [0088] To visualize the GPCR internalization in live cells, Applicant used a bioluminescent microscope to characterize the receptor localization within the cells. This trafficking visualization is unique in that being able to measure receptor internalization in living cells and in real-time by using luminescence. Most other technologies that quantify receptor internalization do not offer information on spatiotemporal live-cell imaging since they are not performed in real-time and living systems. Thus, Applicant was able to visualize the trafficking of a prototypical GPCR (P2AR) in real-time and in living cells (FIG. 5). This trafficking was observed as small luminescent spots moving through the cytosol (highlighted in arrows).
[0089] After ligand addition, Applicant recorded the P2AR internalization by capturing total luminescence every 2 minutes. Applicant observed a decrease in signal intensity along with the experiment as a consequence of furimazine (NLuc substrate) depletion
[0090] Example 1.5. Non-GPCR membrane receptor internalization
[0091] To continue exploring potential applications of Applicant’s technology, Applicant next used a prototypical non-GPCR receptor, the human epidermal growth factor receptor 2 (EGFR2), also referred to as the HER2 receptor (FIG. 6A). In this study, Applicant was able to observe that the internalization rate was slightly slower compared to some GPCRs, suggesting that agonists that activate membrane receptors follow similar internalization kinetics (FIG. 6B).
[0092] Example 1.6. Antibody-mediated internalization
[0093] Being able to measure antibody-mediated internalization is currently one of the most exciting receptor trafficking mechanisms to study in medicine. To test the versatility of Applicant’s methodology, Applicant set up a strategy to monitor antibody-mediated internalization. Applicant used a membrane protein recently discovered termed FAM19A5 Isoform II (also called TAFA5). It has been described that FAM19A5 plays a key role in neurological disorders. Applicant decided to use FAM19A5 Isoform II as a prototypical system to study antibody-mediated internalization using two antibodies currently under development. Applicant tagged FAM19A5 Isoform II with SmBiT at the N-termini. SmBiT-FAM19A5 isoform II was co-expressed with the FYVE domain tagged with the LgBiT at the N-termini (FIG. 7A). In this experiment, Applicant observed slower internalization kinetics than observed for the GPCRs (FIG. 2). This slower internalization kinetics suggested a slow conformational change in the receptor induced by the binding with the antibody (FIGS. 7B-1 and 7B-2). Applicant achieved to quantify and compare the internalization potencies for the two antibodies, highlighting that antibody A was slightly more potent than antibody B (FIG. 7C).
[0094] Example 1.7. SARS-CoV2 viral entry
[0095] Finally, since internalization also encompasses viral infection, Applicant devised a system to monitor, in real-time, viral entry into the cell by using the SARS-CoV2 Spike protein as a prototypical system of viral infection (FIG. 8A). In this experimental approach, Applicant observed viral entry into the cells is mediated by early endosomes and that its kinetics is also much slower as compared to ligand-activated receptors (FIG. 2).
[0096] The viral entry trafficking, using the SARS-CoV2 Spike protein (FIG. 8B), was similar to the antibody-mediated receptor trafficking (FIGS. 7B-1, 7B-2 and 7C). In ongoing experiments, Applicant is exploring whether new variants (delta and mu) of SARS-CoV2, increase the internalization rate and kinetics of the Angiotensin Converting Enzyme 2 (ACE2) internalization. [0097] Example 1.8. Discussion
[0098] In this study, Applicant described several strategies to accurately quantify membrane receptor internalization across different systems by setting up a structural complementation assay based on NLuc. Other studies have been reported in the literature that also used the structural complementation of NLuc but adapted to different physiological contexts such as GPCR dimerization and oligomerization. The approach of structural complementation has great potential in drug discovery and structural biology. It has been successfully applied for several applications in biological research.
[0099] At the beginning of this study, Applicant aimed to develop a universal drug discovery tool that can be applied to nearly any membrane receptor. After studying different physiological processes where membrane receptors are involved, Applicant conclude that almost any membrane protein expressed at the cell surface undergoes internalization, and therefore, Applicant hypothesize that it would be possible to monitor the activity of a particular receptor by observing, in real-time, its trafficking in living systems. [00100] For this purpose, Applicant used the FYVE domain of endofin since this domain binds to early endosomes. Applicant covalently linked the FYVE domain to the large fragment of NLuc (FIG. 9).
[00101] As the first application of Applicant’s methodology, Applicant decided to explore how internalization occurs across class A GPCRs, the largest class of GPCRs, accounting for nearly 85% of the GPCR genes that encode for rhodopsin-like receptors (i.e., P2AR), olfactory and orphan receptors. Applicant were able to observe that the internalization kinetics reached a maximum within about 10 minutes after ligand stimulation and the fold induction of bioluminescence was between 2 and 3, depending on the GPCR (FIG. 2C).
[00102] To validate Applicant’s methodology, Applicant pretreated the cells expressing the system with internalization inhibitors (FIG. 2E). Applicant was able to verify that the luminescent signal was abolished in the presence of those inhibitors. Such observation suggests that the increase in the luminescent signal after ligand stimulation is originated from the GPCR internalization.
[00103] One of the advantages of a real-time assay is that Applicant can study different conditions in the same well of the assay plate. To illustrate this, Applicant monitored the GPCR internalization and recycling in the same sample (FIGS. 3A-B).
[00104] Moreover, this technique is useful in the de-orphanization of GPCRs, especially in cases where the receptor signaling is unknown, as well as in the development and characterization of agonists and antagonists for GPCRs.
[00105] The potential application of this internalization assay also can be applied to other classes of membrane receptors beyond the study and characterization of the GPCRs-where GPCRs account for approximately 35% of the Federal Drug Administration (FDA) approved drugs. In addition to GPCRs, Applicant set out to apply the assay to receptor tyrosine kinases (RTKs), another class of membrane receptors. Specifically, Applicant applied the methodology to the human epidermal growth factor receptor 2 (HER2), a member of the receptor tyrosine-protein kinase ErbB family of receptors that promote cell proliferation and opposes apoptosis.
[00106] The application of this technology to the HER2 receptor is highly significant since HER2 is known to have therapeutic importance in breast and ovarian cancers. Thus, Applicant studied HER2 receptor internalization, recycling, or degradation in late endosomes where this membrane receptor trafficking pattern represents pivotal internalization steps towards the development of treatments of HER2 positive cancer patients. Applicant’s results demonstrate that Applicant can monitor membrane protein trafficking of RTKs, specifically HER2, using an approach similar to the methodology described for GPCRs.
[00107] As further validation regarding the universality of Applicant’s membrane protein internalization assay, Applicant applied this technology to monitor antibody-mediated internalization. As such, Applicant studied the Family with sequence similarity 19 (chemokine (C-C motif)-like) member A5 (FAM19A5) receptor protein, a member of the TAFA family a chemokine-like protein that regulates cell proliferation and migration.
[00108] Specifically, FAM19A5 is a novel gene with multiple physiological functions (i.e., neurokine, adipokine) recently being discovered. For this membrane protein, Applicant was able to study antibody-mediated internalization of FAM19A5 by two newly develop monoclonal antibodies (FIGS. 7A-B).
[00109] In contrast to GPCRs or RTK receptors, antibody-mediated internalization of FAM19A5 displayed much slower kinetics, reaching a maximum of internalization at two hours after antibody treatment. The fold induction was slightly lower than previously seen in GPCRs or RTK receptors, presumably because the binding between the antibody and FAM19A5 induced minor conformational changes on the receptor as compared to the ligand-receptor interactions observed for p2AR and HER2.
[00110] Finally, Applicant sought to extend the membrane protein internalization assay to monitor viral infections. Specifically, Applicant set out to monitor SARS-CoV2, the seventh coronavirus known to infect humans and able to cause severe respiratory disease, can cause multiorgan infection and cell tropism in the human body. Moreover, the SARS-CoV2-mediated receptor trafficking can be studied and characterized for drug discovery. Thus, when SARS-CoV2 binds into the cell, the virus/plasma membrane receptor can be monitored as an internalization process mediated by virus particles (FIG. 8A). For this purpose, Applicant produced lentivirus expressing the SARS-CoV2 spike protein. [00111] Applicant then added the viral suspension containing the SARS-CoV2 spike protein to cells expressing the ACE2 receptor and then covalently linked to the small domain of NLuc. This design strategy enabled the simulation of the SARS-CoV2 infection in real-time and in living cells. Applicant’s results demonstrate that Applicant can monitor membrane protein trafficking of SARS-CoV2 spike protein with a good signal-noise ratio and where the entire infection process takes approximately three hours and this virus-receptor complex continues to be internalized for some time thereafter. As such, Applicant envisions that this assay will enable the studying of neutralizing antibodies or antivirals. Furthermore, this technology can also be extended to other infection systems using other viruses like those mediated by a GPCR, as in the case of the C-C chemokine receptor type 5 (CCR5) and C-X-C chemokine receptor type 4 (CXCR4), members of the chemokine receptor family, during an HIV-1 infection.
[00112] In general, the main advantage of Applicant’s method is that the internalization of the receptor can be monitored in real-time and the versatility to study a wide range of internalization mechanisms, ranging from GPCRs, RTKs, antibody to viral entry into the cell. Applicant’s assay shows a dynamic range between 1.5 to 3, which was similar to other approaches using the structural complementation of NLuc and slightly lower as compared to other approaches measuring receptorarrestin interactions in real-time.
[00113] Some aspects remain to be studied in Applicant’s methodology, such as to evaluate whether if tagging the receptors with the SmBiT alters its native pharmacology and distribution at the plasma membrane as well as expressing the tagged receptors at endogenous levels.
[00114] In conclusion, Applicant both theoretically and experimentally illustrated the universality of Applicant’s structural complementation approach to study a wide range of membrane protein internalization mechanisms. Furthermore, Applicant defined a comprehensive set of cell-based assays and demonstrated their ability of monitoring membrane protein trafficking. These assays have direct application to drug discovery and drug development. The internalization rates vary dramatically ranging from a few minutes (in the case of GPCRs) to a few hours (in the case of viral entry into the cells). Altogether, a universal methodology such as that illustrated in this work will accelerate drug discovery and drug development for numerous types of diseases that are based on membrane protein trafficking.
[00115] Example 1.9. Methods
[00116] The ability to monitor internalization in response to ligand stimulation was assessed in HEK293 cells expressing the corresponding human receptor. In the case of GPCRs, the assay was performed using the corresponding endogenous ligands (i.e., epinephrine).
[00117] Cell culture medium and cell culture additives were from Life Technologies. All chemicals were obtained from Sigma-Aldrich (St. Louis, MO, USA) unless otherwise stated. The restriction enzymes were obtained from New England Bio Labs (Ipswich, MA, USA). All ligand peptides were synthesized by AnyGen (Gwangju, Korea). The synthesized peptide purity was greater than 98% as determined by high-performance liquid chromatography analysis. All peptides were dissolved in dimethyl sulfoxide and then diluted in media to the desired working concentrations.
[00118] Example 1.10. NanoBit Technolo y
[00119] The NanoBit starter kit containing the plasmids and the necessary reagents for the development of the structural complementation assays used in this study were obtained from Promega Company (Madison, Wisconsin, USA).
[00120] Applicant designed primers to introduce genes of interest into pBiTl.l-C [TK/LgBiT], pBiT2.1-C [TK/SmBiT], pBiT 1.1 -N [TK/LgBiT] and pBiT2.1-N [TK/SmBiT] vectors. Applicant selected at least one of these three sites as one of the two unique restriction enzymes needed for directional cloning due to the presence of an in-frame stop codon that divides the multi-cloning site. Applicant incorporated nucleotide sequences into the primers to encode the linker residues shown in FIGS. 9-10. ForpBiTl.l-C [TK/LgBiT] andpBiT2.1-C [TK/SmBiT] vectors, Applicant made sure that the 5 primer contained an ATG codon and a potent Kozak consensus sequence (GCCGCCACC). For pBiTl.l-N [TK/LgBiT] and pBiT2.1-N [TK/SmBiT] vectors, Applicant ensured that the 3 primer contained a stop codon.
[00121] Applicant prepared a 1% agarose gel to run the digested DNA plasmid and insert and proceed to cut the corresponding bands. Once the corresponding vector and insert bands were purified, Applicant determined the DNA concentration using a spectrophotometer. Applicant performed DNA ligation to fuse the insert to the recipient plasmid. Applicant prepared ligation reactions of around 100 ng of total DNA including 50 ng of plasmid vector. Applicant set up a recipient plasmid-insert ratio of approximately 1:3. Applicant also set up negative controls in parallel. For instance, ligation of the recipient plasmid DNA without any insert provided information about how much background of undigested or self-ligating recipient plasmid was present.
[00122] Applicant picked 3-10 individual bacterial colonies and transferred them into 1 mL of LB medium containing ampicillin (100 pg/mL) and incubated them for 6 hours. Then, Applicant used 200 pL of bacterial suspension and transferred it to 5 mL of LB medium containing the same concentration of ampicillin and incubated overnight at 37.5 °C with shaking at 200 rpm. Applicant performed miniprep DNA purifications using 5 mL of LB grown overnight following the manufacturer's instructions (Life Technologies). To identify successful ligations, Applicant set up PCR reactions using the DNA obtained from mini-preps as a template with the same primers as during the first PCR used for cloning. Positive clones produced the PCR products with the corresponding insert size. Applicant verified the construct sequence by sequencing using primers. [00123] Example 1.11. Primary ligation assays
[00124] For primary ligation assays, HEK293 cells were seeded in an 8 well Lab-Tek II Chamber Slide (Life Technologies) with a density of 2xl05 cells per well. The next morning, cells were transfected with 200ng of p2AR-SmBiT and 200ng of LgBiT-FYVE constructs using Viafect (Promega Corporation). The next day, samples were treated with 10 pM epinephrine final concentration for 5 minutes, and immediately after, cells were incubated with 4% paraformaldehyde for 15 minutes at room temperature. Thereafter, the cells were rinsed with PBS and permeabilized with PBS containing 0.1% Tween 20 (PBST). Then, cells were incubated with blocking buffer (Duolink blocking buffer for PLA) at 37.5 °C for 1 hour and followed by incubation with the primary antibodies, anti-p2AR (Abeam catalog number), anti-NLuc (Abeam catalog number), or anti-Early Endosome Antigen 1 (Abeam catalog number) at 1 : 1000 by diluting in the Duolink antibody dilution buffer at 4°C overnight. After three washes (5 minutes each) with PBST, the cells were incubated with PLA probes (PLUS and MINUS PLA probes) in a pre-heated humidity chamber for 1 hour at 37.5 °C. Three washes (5 minutes each) were then performed. Ligation of the two PLA probes was performed by incubation of the slides in a pre-heated humidity chamber for 30 minutes at 37°C in the presence of ligase and lx ligation buffer.
[00125] Example 1.12. Internalization Assay using NanoBit Technology
[00126] HEK293 cells were maintained in Dulbecco’s modified Eagle’s medium (DMEM) supplemented with 10% fetal bovine serum (FBS), 100 U/ml penicillin G, and 100 pg/ml streptomycin (Invitrogen; Carlsbad, CA, USA). At 1 day before transfection, the cells were seeded in 96-well plates at a density of 2.5xl04 cells per well. A mixture containing 100 ng receptor construct containing the LgBit or SmBit and 50 ng of the Endofin domain containing one of the two domains of Nano luciferase and 0.3 pl Viafect (Promega) was prepared and added to each well. Applicant tested four Endofin-receptor spatial orientations. The one with the highest signal was chosen for further experiments to obtain maximum sensitivity. At 24 hours post-transfection, the medium was aspirated and replaced with 100 pl OPTIMEM (Life Technologies, Grand Island, NY, USA). After a 10 minute incubation, 25 pl substrate (furimazine) was added, and once every minute subsequent luminescence measurements were taken for 5-10 minutes for signal stabilization. A total of 10 pl of ligand, antibody, or viral suspension was then added to each well and luminescence measurements were recorded immediately and once every minute for 1-3 hours (Synergy 2 Multi-Mode Microplate Reader BioTek, Winooski, VT, USA).
[00127] Example 1.13. Lentivirus -mediated Expression of the Spike Protein of SARS-CoV2
[00128] All manipulations were taking place in a biosafety cabinet at all times. HEK293 cells were transfected with the plasmids containing SARS-CoV-2, Wuhan-Hu-1 (GenBank: NC_045512), spike-pseudo typed lentiviral kit (NR-52948, from Bei Resources) designed to generate pseudotyped lentiviral particles expressing the spike (S) glycoprotein gene, as well as luciferase (Luc2) and green fluorescent protein (GFP). Seventy-two hours after transfection, the medium was collected in a 50 ml tube and store at -80 °C for further applications. This protocol only requires Biosafety Level 1 (BSL1) conditions and the viruses used in this protocol were replicationdefective. [00129] Without further elaboration, it is believed that one skilled in the art can, using the description herein, utilize the present disclosure to its fullest extent. The embodiments described herein are to be construed as illustrative and not as constraining the remainder of the disclosure in any way whatsoever. While the embodiments have been shown and described, many variations and modifications thereof can be made by one skilled in the art without departing from the spirit and teachings of the invention. Accordingly, the scope of protection is not limited by the description set out above but is only limited by the claims, including all equivalents of the subject matter of the claims. The disclosures of all patents, patent applications, and publications cited herein are hereby incorporated herein by reference, to the extent that they provide procedural or other details consistent with and supplementary to those set forth herein.

Claims

WHAT IS CLAIMED IS:
1. A method of screening at least one binding agent for binding to at least one cell membrane protein, said method comprising:
(a) associating the binding agent with a cell comprising the cell membrane protein, wherein the cell membrane protein is genetically engineered to express a first peptide, wherein the first peptide is separated from the cell membrane protein by a flexible amino acid linker, wherein a majority of the flexible amino acid linker residues comprise glycine residues, serine residues, or combinations thereof, and wherein the first peptide is capable of generating a luminescent signal upon interaction with a second peptide;
(b) detecting a presence or an absence of an internalization of the cell membrane protein after the associating step, wherein the internalization is characterized by the presence of the luminescent signal, and wherein the absence of the internalization is characterized by the absence of the luminescent signal; and
(c) correlating the presence of the internalization to the binding of the binding agent to the cell membrane protein, or correlating the absence of the internalization to the lack of binding of the binding agent to the cell membrane protein.
29
2. The method of claim 1, wherein the binding agent is selected from the group consisting of small molecules, macromolecules, peptides, proteins, antibodies, aptamers, drugs, drug candidates, odors, pheromones, hormones, neurotransmitters, catecholamines, growth factors, fatty acids, proteases, antivirals, and combinations thereof.
3. The method of claim 1, wherein the binding agent is a drug or a drug candidate for a disease.
4. The method of claim 3, wherein the method is utilized to screen or evaluate a drug or a drug candidate for the treatment or prevention of the disease.
5. The method of claim 3, wherein the disease is selected from the group consisting of cancer, diabetes, metabolic diseases, pulmonary diseases, renal diseases, hepatic disease, drug addiction, alcoholism, chronic pain, autoimmune diseases, mood disorders, heart disease, mental illness, microbial infections, HIV, eye diseases, and combinations thereof.
6. The method of claim 3, wherein the disease is COVID- 19.
7. The method of claim 1, wherein the cell membrane protein is selected from the group consisting of cell membrane receptors, G-protein coupled receptors (GPCRs), plasma membrane proteins, human beta 2 adrenergic receptor, viral receptors, Angiotensin Converting Enzyme 2, HER 2 receptors, or combinations thereof.
8. The method of claim 1, wherein the cell membrane protein is an endogenously expressed cell membrane protein.
30
9. The method of claim 1, wherein the first peptide comprises Small fragment of Nano Luciferase (SmBiT), and wherein the second peptide comprises Large fragment of Nano Luciferase (LgBit).
10. The method of claim 9, wherein SmBiT comprises VTGYRLFEEIL (SEQ ID NO:1), or a sequence that shares at least 65% sequence identity to SEQ ID NO:1.
11. The method of claim 9, wherein LgBiT comprises
VFTLEDFVGDWEQTAAYNLDQVLEQGGVSSLLQNLAVSVTPIQRIVRSGENALKIDIHVI IPYEGLSADQMAQIEEVFKVVYPVDDHHFKVILPYGTLVIDGVTPNMLNYFGRPYEGIA VFDGKKITVTGTLWNGNKIIDERLITPDGSMLFRVTINS (SEQ ID NO:2), or a sequence that shares at least 65% sequence identity to SEQ ID NO:2.
12. The method of claim 1, wherein at least 90% of the flexible amino acid linker residues comprise glycine residues, serine residues, or combinations thereof.
13. The method of claim 1, wherein the second peptide comprises a flexible amino acid linker.
14. The method of claim 13, wherein the second peptide further comprises a cell membrane insertion domain, wherein the cell membrane insertion domain inserts onto an internalized cell membrane in a pH dependent manner, and wherein the cell membrane insertion domain is separated from the second peptide by the flexible amino acid linker.
15. The method of any one of claims 1, wherein the flexible amino acid linker comprises a sequence selected from the group consisting of GSSGGGGSGGGGSSGGAQGNS (SEQ ID NOG), GNSGSSGGGGSGGGGSSG (SEQ ID NO:4), GSSGGGGSGGGGSSG (SEQ ID NOG), GSSGGGGSGGGGSSGGAQGNS (SEQ ID NOG), a sequence that shares at least 65% sequence identity to any one of SEQ ID NOS: 3-6, or combinations thereof.
16. The method of claim 14, wherein the cell membrane insertion domain comprises a sequence of
MQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVCCNRKCKLQYLEKE ARVCVVCYETISK (SEQ ID NO: 7), or a sequence that shares at least 65% sequence identity to SEQ ID NO: 7.
17. The method of claim 1, wherein the flexible amino acid linker comprises at least 18 residues.
18. The method of claim 1, wherein the second peptide is expressed in the cell.
19. The method of claim 1, wherein the second peptide is added to the cell.
20. The method of claim 1, wherein the cells comprise live cells.
21. The method of claim 1, wherein the associating occurs by adding the binding agent to the cells.
22. The method of claim 1, wherein the detecting comprises detecting endocytosis of the cell membrane protein.
23. The method of claim 1, wherein the detecting comprises detecting receptor-mediated endocytosis of the cell membrane protein.
24. The method of claim 1, wherein the detecting occurs in real-time.
25. The method of claim 1, wherein the detecting occurs by monitoring the internalization of the membrane protein through an increase in luminescence emitted by the cell membrane protein after internalization.
26. The method of claim 25, wherein the luminescence comprises bioluminescence.
27. The method of claim 25, wherein the increase in luminescence occurs when a first peptide fused to the cell membrane protein interacts with a second peptide associated with the internalized cell membrane or an early endosome marker.
33
28. The method of claim 1, wherein a single binding agent is screened against a single type of cell membrane protein associated with the cell.
29. The method of claim 1, wherein a single binding agent is screened against a plurality of different types of cell membrane proteins associated with the cell.
30. The method of claim 1, wherein a plurality of different binding agents is screened against a single type of cell membrane protein associated with the cell.
31. The method of claim 1, wherein a plurality of different binding agents is screened against a plurality of different types of cell membrane proteins associated with the cell.
32. The method of claim 1, wherein the method is utilized to characterize the pharmacological properties of the binding agent.
33. A system for use in screening at least one binding agent for binding to at least one cell membrane protein, wherein the system comprises: one or more cells comprising the at least one cell membrane protein, wherein the cell membrane protein is genetically engineered to express a first peptide,
34 wherein the first peptide is separated from the cell membrane protein by a flexible amino acid linker, and wherein a majority of the flexible amino acid linker residues comprise glycine residues, serine residues, or combinations thereof; and a second peptide, wherein the first peptide is capable of generating a luminescent signal upon interaction with the second peptide.
34. The system of claim 33, wherein the cell membrane protein is an endogenously expressed cell membrane protein.
35. The system of claim 33, wherein the first peptide comprises Small fragment of Nano Luciferase (SmBiT).
36. The system of claim 35, wherein SmBiT comprises VTGYRLFEEIL (SEQ ID NO:1), or a sequence that shares at least 65% sequence identity to SEQ ID NO:1.
37. The system of claim 33, wherein the second peptide comprises Large fragment of Nano Luciferase (LgBit).
35
38. The system of claim 37, wherein LgBiT comprises VFTLEDFVGDWEQTAAYNLDQVLEQGGVSSLLQNLAVSVTPIQRIVRSGENALKIDIHVI IPYEGLSADQMAQIEEVFKVVYPVDDHHFKVILPYGTLVIDGVTPNMLNYFGRPYEGIA VFDGKKITVTGTLWNGNKIIDERLITPDGSMLFR VEINS (SEQ ID NOG), or a sequence that shares at least 65% sequence identity to SEQ ID NO:2.
39. The system of claim 33, wherein at least 90% of the flexible amino acid linker residues comprise glycine residues, serine residues, or combinations thereof.
40. The system of claim 33, wherein the second peptide comprises a flexible amino acid linker.
41. The system of claim 40, wherein the second peptide further comprises a cell membrane insertion domain, wherein the cell membrane insertion domain inserts onto an internalized cell membrane in a pH dependent manner, and wherein the cell membrane insertion domain is separated from the second peptide by the flexible amino acid linker.
42. The system of claim 33, wherein the flexible amino acid linker comprises a sequence selected from the group consisting of GSSGGGGSGGGGSSGGAQGNS (SEQ ID NOG), GNSGSSGGGGSGGGGSSG (SEQ ID NO:4), GSSGGGGSGGGGSSG (SEQ ID NOG), GSSGGGGSGGGGSSGGAQGNS (SEQ ID NOG), a sequence that shares at least 65% sequence identity to any one of SEQ ID NOS: 3-6, or combinations thereof.
36
43. The system of claim 41, wherein the cell membrane insertion domain comprises a sequence of
MQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVCCNRKCKLQYLEKE ARVCVVCYETISK (SEQ ID NO: 7), or a sequence that shares at least 65% sequence identity to SEQ ID NO: 7.
44. The system of claim 33, wherein the flexible amino acid linker comprises at least 18 residues.
45. The system of claim 33, wherein the second peptide is expressed in the cells.
46. The system of claim 33, wherein the cells comprise live cells.
47. The system of claim 33, wherein the cell membrane protein is selected from the group consisting of cell membrane receptors, G-protein coupled receptors (GPCRs), plasma membrane proteins, human beta 2 adrenergic receptor, viral receptors, Angiotensin Converting Enzyme 2, HER 2 receptors, or combinations thereof.
48. The system of claim 33, wherein the system further comprises one or more candidate binding agents.
37
PCT/US2021/057525 2020-11-19 2021-11-01 Monitoring membrane protein trafficking for drug discovery and drug development Ceased WO2022108741A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US18/037,702 US20230417736A1 (en) 2020-11-19 2021-11-01 Monitoring membrane protein trafficking for drug discovery and drug development
CA3198508A CA3198508A1 (en) 2020-11-19 2021-11-01 Monitoring membrane protein trafficking for drug discovery and drug development

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202063115827P 2020-11-19 2020-11-19
US63/115,827 2020-11-19

Publications (1)

Publication Number Publication Date
WO2022108741A1 true WO2022108741A1 (en) 2022-05-27

Family

ID=81709637

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/057525 Ceased WO2022108741A1 (en) 2020-11-19 2021-11-01 Monitoring membrane protein trafficking for drug discovery and drug development

Country Status (3)

Country Link
US (1) US20230417736A1 (en)
CA (1) CA3198508A1 (en)
WO (1) WO2022108741A1 (en)

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8211655B2 (en) * 2009-02-12 2012-07-03 Discoverx Corporation Wild-type receptor assays
US20170313762A1 (en) * 2014-09-19 2017-11-02 The Royal Institution For The Advancement Of Learning/Mcgill University Biosensors for monitoring biomolecule localization and trafficking in cells

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8211655B2 (en) * 2009-02-12 2012-07-03 Discoverx Corporation Wild-type receptor assays
US20170313762A1 (en) * 2014-09-19 2017-11-02 The Royal Institution For The Advancement Of Learning/Mcgill University Biosensors for monitoring biomolecule localization and trafficking in cells

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
CéLINE LASCHET, NADINE DUPUIS, JULIEN HANSON: "A dynamic and screening-compatible nanoluciferase-based complementation assay enables profiling of individual GPCR–G protein interactions", JOURNAL OF BIOLOGICAL CHEMISTRY, AMERICAN SOCIETY FOR BIOCHEMISTRY AND MOLECULAR BIOLOGY, US, vol. 294, no. 11, 15 March 2019 (2019-03-15), US , pages 4079 - 4090, XP055672874, ISSN: 0021-9258, DOI: 10.1074/jbc.RA118.006231 *
NAMKUNG YOON, LE GOUILL CHRISTIAN, LUKASHOVA VIKTORIA, KOBAYASHI HIROYUKI, HOGUE MIREILLE, KHOURY ETIENNE, SONG MIDEUM, BOUVIER MI: "Monitoring G protein-coupled receptor and β-arrestin trafficking in live cells using enhanced bystander BRET", NATURE COMMUNICATIONS, vol. 7, no. 1, 25 November 2016 (2016-11-25), XP055932276, DOI: 10.1038/ncomms12178 *
SOAVE MARK, BARRIE KELLAM, JEANETTE WOOLARD, STEPHEN J. BRIDDON, AND STEPHEN J. HILL: "Society for Laboratory Automation and Screening", SLAS DISCOVERY: ADVANCING LIFE SCIENCES R&D, MARY ANN LIEBERT, vol. 25, no. 2, 4 October 2019 (2019-10-04), pages 186 - 194, XP055932285, ISSN: 2472-5552, DOI: 10.1177/2472555219880475 *

Also Published As

Publication number Publication date
US20230417736A1 (en) 2023-12-28
CA3198508A1 (en) 2022-05-27

Similar Documents

Publication Publication Date Title
CN100399028C (en) Method for identifying compounds that interact with transmembrane proteins
CN113501881B (en) fusion protein
CA1328419C (en) Receptors for efficient determination of ligands and their antagonists or agonists
Reyes-Alcaraz et al. A NanoBiT assay to monitor membrane proteins trafficking for drug discovery and drug development
US11226339B2 (en) Methods for high throughput receptor:ligand identification
EP1187928A2 (en) Virus like particles, preparation and use in screening and functional genomics
US20150010932A1 (en) Methods for assaying protein-protein interactions
CN102449476B (en) Screening suppresses the new drug candidates of target protein-protein interaction to develop the method for a class medicine
US20200400567A1 (en) Fusion polypeptide
CN102449147B (en) Method for highly sensitive detection of protein-protein interaction
Chandrasekaran et al. HIV-1 Nef down-modulates CC and CXC chemokine receptors via ubiquitin and ubiquitin-independent mechanism
Lotze et al. Time-resolved tracking of separately internalized neuropeptide Y2 receptors by two-color pulse-chase
Song et al. Monitoring G protein-coupled receptor activation using an adenovirus-based β-arrestin bimolecular fluorescence complementation assay
US20230417736A1 (en) Monitoring membrane protein trafficking for drug discovery and drug development
US20020052040A1 (en) Virus like particles, their preparation and their use preferably in pharmaceutical screening and functional genomics
CN104781667B (en) Fluorescent fusion polypeptide, biosensor comprising said polypeptide and use thereof
EP1219705B1 (en) Virus like particles, their preparation and their use preferably in pharmaceutical screening and functional genomics
US11860166B2 (en) Red fluorescent protein-based biosensor for measuring activity of dopamine receptor D1
US12613237B2 (en) Biosensors for detecting arrestin signaling
V Vasilev et al. Novel biosensor of membrane protein proximity based on fluorogen activated proteins
JP6525199B2 (en) Insulin detection method and insulin detection kit
US20260036580A1 (en) Use of stem cell-based biosensors for real-time, non-invasive monitoring of neuronal differentiation
US7476517B2 (en) Virus like particles, their preparation and their use preferably in pharmaceutical screening and functional genomics
Kriechbaumer et al. Quantification of ligand binding to G-protein coupled receptors on cell membranes by ellipsometry
Anaya et al. A multiplex extracellular interactome screening method employing high-avidity nanoparticles

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21895336

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3198508

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 18037702

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 21895336

Country of ref document: EP

Kind code of ref document: A1