WO2022016048A2 - Monoclonal antibodies against sars-cov-2 nucleocapsid phosphoprotein and sandwich elisa method - Google Patents

Monoclonal antibodies against sars-cov-2 nucleocapsid phosphoprotein and sandwich elisa method Download PDF

Info

Publication number
WO2022016048A2
WO2022016048A2 PCT/US2021/041955 US2021041955W WO2022016048A2 WO 2022016048 A2 WO2022016048 A2 WO 2022016048A2 US 2021041955 W US2021041955 W US 2021041955W WO 2022016048 A2 WO2022016048 A2 WO 2022016048A2
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
seq
cov
sars
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/041955
Other languages
French (fr)
Other versions
WO2022016048A3 (en
Inventor
David D. Ho
Lihong Liu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Columbia University in the City of New York
Original Assignee
Columbia University in the City of New York
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Columbia University in the City of New York filed Critical Columbia University in the City of New York
Priority to CA3186215A priority Critical patent/CA3186215A1/en
Priority to US18/005,581 priority patent/US20240003880A1/en
Publication of WO2022016048A2 publication Critical patent/WO2022016048A2/en
Publication of WO2022016048A3 publication Critical patent/WO2022016048A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56983Viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/102Coronaviridae (F)
    • C07K16/104Severe acute respiratory syndrome coronavirus 2 [SARS‐CoV‐2]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/005Assays involving biological materials from specific organisms or of a specific nature from viruses
    • G01N2333/08RNA viruses
    • G01N2333/165Coronaviridae, e.g. avian infectious bronchitis virus
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2469/00Immunoassays for the detection of microorganisms
    • G01N2469/10Detection of antigens from microorganism in sample from host
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2470/00Immunochemical assays or immunoassays characterised by the reaction format or reaction type
    • G01N2470/04Sandwich assay format

Definitions

  • the present invention relates generally to monoclonal antibodies against SARS- CoV-2 nucleocapsid phosphoprotein. More particularly, the present invention relates to systems and methods for sandwich (or capture) enzyme-linked immunosorbent assays (ELISAs) for the detection of SARS-CoV-2 nucleocapsid phosphoprotein antigens.
  • sandwich (or capture) enzyme-linked immunosorbent assays ELISAs
  • SARS-CoV-2 severe acute respiratory syndrome coronavirus 2
  • COVID-19 coronavirus disease 2019
  • PCR polymerase chain reaction
  • FDA Food and Drug Administration
  • Sofia 2 SARS Antigen FIA test which is an immunofluorescent sandwich assay intended for the qualitative detection of the nucleocapsid protein antigen from SARS-CoV-2 in nasopharyngeal and nasal swab specimens directly or after the swabs have been added to viral transport media from individuals who are suspected of COVID-19 by their healthcare provider.
  • Sofia 2 has been reported to have false negative rate of 20 %. Therefore, there exists a need for a specific, sensitive, and rapid diagnostic test for SARS-CoV-2 infection. Further, there exists a need for antibodies against SARS-CoV-2 proteins that could be used in the development of diagnostic testing.
  • the invention provides for a kit for detecting or quantifying a SARS-CoV-2 nucleocapsid phosphoprotein, the kit comprising a first antibody, wherein a variable heavy chain domain of the first antibody comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21, and a variable light chain domain of the first antibody comprising the amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO:6, SEQ ID NO: 8, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, and SEQ ID NO: 22; and a second antibody, wherein a variable heavy chain domain of the second antibody comprises the amino acid sequence selected from the group consisting of SEQ ID NO:
  • the kit includes an ELISA plate having a plurality of compartments.
  • the plurality of compartments includes a reaction chamber and one or more of the plurality of compartments further includes one of the first antibody or the second antibody described herein.
  • the kit includes a third antibody, wherein the third antibody is an anti-human antibody having a detectable marker.
  • the kit includes an enzyme linked to one of the first antibody or the second antibody.
  • the kit includes a substrate capable of detecting the detectable marker.
  • the first antibody is a capture antibody and the second antibody is a detection antibody.
  • the second antibody is a capture antibody and the first antibody is a detection antibody.
  • variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 1 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 2. In some embodiments, the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO:
  • variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 5 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 6.
  • variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 7 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 8.
  • the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO:
  • variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 12
  • variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 13 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 14.
  • variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 15 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 16.
  • the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 17 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 18.
  • variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 19 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 20.
  • variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 21 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 22.
  • variable heavy chain domain of the second antibody comprises the amino acid sequence of SEQ ID NO: 9 and the variable light chain domain of the second antibody comprises the amino acid sequence of SEQ ID NO: 10.
  • variable heavy chain domain of the second antibody comprises the amino acid sequence of SEQ ID NO: 13 and the variable light chain domain of the second antibody comprises the amino acid sequence of SEQ ID NO: 14.
  • each of the first antibody and the second antibody bind to different epitopes of the SARS-CoV-2 nucleocapsid phosphoprotein.
  • the kit is configured to detect, in a biological sample, the presence of a SARS- CoV-2 nucleocapsid phosphoprotein.
  • the invention provides for an immunoassay method to detect or quantitate a SARS-CoV-2 nucleocapsid phosphoprotein, the method including coating a first solid surface with a coating antibody selected from one of the first antibody or the second antibody described herein (above), contacting the coated first solid surface with the biological sample to form a complex between a SARS-CoV-2 nucleocapsid phosphoprotein in the sample and the coating antibody, removing unbound biological sample, contacting the coated first solid surface with a detection antibody selected from one of the first antibody and the second antibody to form a complex between the SARS-CoV-2 nucleocapsid phosphoprotein in the sample and the detection antibody, contacting the coated first solid surface with an anti-human antibody having a detectable marker to form a complex between the anti-human antibody and the detection antibody, washing the coated first solid surface, contacting the coated first solid surface with a substrate capable of detecting the detectable marker, and detecting or quantitating the detectable marker of the anti-
  • the capture antibody is the first antibody described herein (above) and the detection antibody is the second antibody described herein (above). In some embodiments, the capture antibody is the second antibody described herein (above) and the detection antibody is the first antibody described herein (above). In some embodiments, each of the first antibody and the second antibody bind to different epitopes of the SARS-CoV-2 nucleocapsid phosphoprotein. In some embodiments, the detectable marker is horseradish peroxidase. In some embodiments, the substrate is 3, 3',5,5'-Tetramethylbenzidine (TMB). In some embodiments, the biological sample is human serum.
  • TMB 3, 3',5,5'-Tetramethylbenzidine
  • the detecting or quantitating includes measuring optical density at a wavelength of around 450nm.
  • the method includes generating a positive test result for a SARS-CoV-2 infection in a subject wherein the measured optical density is above a predetermined value.
  • the method includes generating a negative test result for a SARS-CoV-2 infection in a subject wherein the measured optical density is below a predetermined value.
  • the method is capable of detecting the SARS- CoV-2 nucleocapsid phosphoprotein when present in the biological sample at between about 0.001 ng and 0.02 ng.
  • the detection or quantitation of the SARS-CoV- 2 nucleocapsid phosphoprotein is completed within about 4 hours and within about 1 hour. In some embodiments, the detection or quantitation of the SARS-CoV-2 nucleocapsid phosphoprotein is completed within less than about 1 hour. In some embodiments, the method further includes amplifying a signal using Tyramide Signal Amplification (TSA) before detecting or quantitating the detectable marker of the anti-human antibody.
  • TSA Tyramide Signal Amplification
  • the invention provides for an immunoassay method to detect or quantitate a SARS-CoV-2 nucleocapsid phosphoprotein, the method including coating a first solid surface with a coating antibody selected from one of the first antibody or the second antibody described herein (above), contacting the coated first solid surface with the biological sample to form a complex between a SARS-CoV-2 nucleocapsid phosphoprotein in the sample and the coating antibody, removing unbound biological sample, contacting the coated first solid surface with a detection antibody selected from one of the first antibody and the second antibody described herein (above) to form a complex between the SARS-CoV-2 nucleocapsid phosphoprotein in the sample and the detection antibody, wherein the detection antibody further having a detectable marker, washing the coated first solid surface, contacting the coated first solid surface with a substrate capable of detecting the detectable marker, and detecting or quantitating the detectable marker of the detection antibody.
  • the capture antibody is the first antibody described herein (above) and the detection antibody is the second antibody described herein (above). In some embodiments, the capture antibody is the second antibody described herein (above) and the detection antibody is the first antibody described herein (above). In some embodiments, each of the first antibody and the second antibody bind to different epitopes of the SARS-CoV-2 nucleocapsid phosphoprotein. In some embodiments, the detectable marker is horseradish peroxidase. In some embodiments, the substrate is 3, 3',5,5'-Tetramethylbenzidine (TMB). In some embodiments, the biological sample is human serum.
  • TMB 3, 3',5,5'-Tetramethylbenzidine
  • the detecting or quantitating includes measuring optical density at a wavelength of around 450nm.
  • the method includes generating a positive test result for a SARS-CoV-2 infection in a subject, wherein the measured optical density is above a predetermined value.
  • the method includes generating a negative test result for a SARS-CoV-2 infection in a subject, wherein the measured optical density is below a predetermined value.
  • the method is capable of detecting the SARS-CoV-2 nucleocapsid phosphoprotein when present in the biological sample at between about 0.001 ng and 0.02 ng.
  • the detection or quantitation of the SARS-CoV-2 nucleocapsid phosphoprotein is completed within about 4 hours and within about 1 hour. In some embodiments, the detection or quantitation of the SARS-CoV-2 nucleocapsid phosphoprotein is completed within less than about 1 hour. In some embodiments, the method further includes amplifying a signal using Tyramide Signal Amplification (TSA) before detecting or quantitating the detectable marker of the detection antibody.
  • TSA Tyramide Signal Amplification
  • the invention provides for a purified chimeric monoclonal antibody, or a functional fragment thereof, capable of specifically binding to a SARS-CoV-2 nucleocapsid phosphoprotein, wherein said monoclonal antibody, or functional fragment thereof, comprises any one amino acid sequence selected from the group consisting of heavy chain variable region comprising SEQ ID NO: 17, light chain variable region comprising SEQ ID NO: 18, heavy chain variable region comprising SEQ ID NO: 19, light chain variable region comprising SEQ ID NO: 20, heavy chain variable region comprising SEQ ID NO: 21, and light chain variable region comprising SEQ ID NO: 22.
  • the monoclonal antibody comprises heavy chain variable region comprising SEQ ID NO: 17 and light chain variable region comprising SEQ ID NO: 18. In some embodiments, the monoclonal antibody comprises heavy chain variable region comprising SEQ ID NO: 19 and light chain variable region comprising SEQ ID NO: 20. In some embodiments, the monoclonal antibody comprises heavy chain variable region comprising SEQ ID NO: 21 and light chain variable region comprising SEQ ID NO: 22. BRIEF DESCRIPTION OF THE DRAWINGS
  • FIGS. 1 A-B depict ELISA binding of plasma samples from severe (FIG. 1 A) and non-severe (FIG. IB) COVID-19 patients, specifically of patients’ antibody responses to SARS-CoV-2 nucleocapsid phosphoprotein (NP).
  • FIGS 2A-B depict a process for identifying and synthesizing binding antibodies against SARS-CoV-2 NP (FIG. 2A) and the sorting results of the isolation of NP-specific memory B cells using flow cytometry (FIG. 2B).
  • FIG. 3 depicts ELISA monoclonal antibody binding against SARS-CoV-2 NP.
  • FIG. 4 depicts Western blotting analysis of linear epitope recognition by monoclonal antibody against SARS-CoV-2 NP.
  • FIGS. 5A-B depict competition ELISA binding of pairs of monoclonal antibodies against SARS-CoV-2 NP (FIG. 5A) and corresponding area under the curve (FIG. 5B).
  • FIGS. 6A-B depict sandwich ELISA binding for pairs of monoclonal antibodies against SARS-CoV-2 NP that recognize different NP epitopes.
  • FIG. 6A shows ELISA binding for class 1 antibody (9-24) used for capture and class 2 antibodies (9-11, 9-16, 9-17) used as detectors.
  • FIG. 6B shows ELISA binding for class 2 antibodies (9-11, 9-16, 9-17) used for capture and class 1 antibody (9-24) used as a detector (9-24).
  • FIGS. 7A-B depict SPR sensorgrams of SARS-CoV-2 NP antibodies binding to NP (FIG. 7A) and binding rate constants of the NP antibodies (FIG. 7B).
  • FIGS. 8A-B depict sandwich ELISA binding for pairs of monoclonal antibodies against SARS-CoV-2 NP that recognize different NP epitopes.
  • FIG. 8A shows ELISA binding for human antibody pairs.
  • FIG. 8B shows ELISA binding for human and chimeric antibody pairs.
  • FIGS. 9A-C depict sandwich ELISA binding for class 1 antibody (9-24) used for capture and class 2 antibody (chimeric 9-11) used for detection of NP.
  • FIG. 9A shows ELISA binding performed on Vero cell media supernatant (left panel) or lysate (right panel) samples.
  • FIG. 9B shows ELISA binding performed on saliva samples from healthy donors.
  • FIG. 9C shows ELISA binding using purified SARS-CoV-2 NP.
  • FIGS. 10A-B depict sandwich ELISA binding for class 1 antibody (9-24) used for capture and class 2 antibody (chimeric 9-11) used for detection of NP.
  • FIG. 10A shows ELISA binding performed on samples spiked with purified SARS-CoV-2 NP with and without saliva.
  • FIG. 10B shows ELISA binding performed on samples spiked with SARS- CoV-2 viral particles (prepared by 1% NP-40 inactivation) with and without saliva.
  • FIGS. 11 A-B depict sandwich ELISA binding for class 1 antibody (9-24) used for capture and class 2 antibody (chimeric 9-11) used for detection of NP.
  • FIG. 11 A shows ELISA binding performed according to standard incubation procedures that take about 4 hours to conduct.
  • FIG. 1 IB shows ELISA binding performed according to shortened incubation procedures that take about 1 hour to conduct.
  • FIG. 12 depicts mechanisms of Tyramide Signal Amplification (TSA) technology.
  • FIGS. 13A-B depict sandwich ELISA binding for detection of NP using a standard unamplified procedure (FIG. 13 A) and using amplification by TSA technology (FIG. 13B).
  • FIGS. 14A-C depict the sensitivity and specificity of an antibody pair for detection of SARS-CoV-2 NP.
  • FIG.14A shows a phylogenetic tree of coronavirus species
  • FIG. 14B shows a Western blot analysis of various coronavirus NPs
  • FIG. 14C shows sandwich ELISA binding for detection of NP for various coronavirus species.
  • FIGS. 15 A-B depict detection of NP from SARS-CoV-2 infected cells (antibody pair: 9-24 and chimeric 9-11).
  • FIG. 15A shows a standard detection curve with dilution and
  • FIG. 15B shows the results of sandwich ELISA binding for detection of SARS- CoV-2 NP across different multiplicities of infection.
  • the invention provides for an improved antigen sandwich (also known as “capture”) ELISA for the detection of SARS-CoV-2 infection using antibodies against SARS-CoV-2 nucleocapsid phosphoprotein (“NP”) antigens.
  • Antibodies provide strong binding to antigens requiring less amounts of antigens for detection and therefore increased assay sensitivity.
  • An advantage of the disclosed systems and methods is the ability to provide an antigen test that is faster and easier to perform compared to PCR tests yet overcomes the inaccuracy issue regarding false negative readings of other antigen tests.
  • the present disclosure is directed to the isolation and characterization of sequences of a panel of monoclonal antibodies targeting SARS-CoV-2 NP, the most abundantly expressed immunodominant protein that interacts with RNA.
  • the present disclosure provides for an improved sandwich ELISA method of detecting SARS-CoV-2 NP antigens by using monoclonal antibodies that target multiple epitopes of the nucleocapsid, thus allowing for the selection of one or more antibody pairs for assay optimization, resulting in high sensitivity and specificity.
  • the monoclonal against SARS-CoV-2 NP are used for capture assays to detect the presence of SARS-CoV-2 NP antigens in various clinical samples.
  • the disclosed assays and antibody pairs are used for commercial rapid test kits for COVID-19 antigen detection.
  • FIG. 1 two graphs are depicted which show ELISA binding data of plasma samples from COVID-19 patients to SARS-CoV-2 NP.
  • FIG. 1 A shows the ELISA binding data for COVID-19 patients having severe disease
  • FIG. IB shows the ELISA binding data for COVID-19 patients having non-severe disease.
  • FIG. 1 demonstrates that both severe and non-severe COVID-19 patients develop robust antibody responses to the SARS-CoV-2 NP.
  • FIG. 2 a diagram is depicted showing the process for identifying strong binding antibodies against the SARS-CoV-2 NP.
  • Plasma samples from severe and non-severe COVID-19 patients are isolated and evaluated for the ability to bind SARS-CoV-2 NP. From those COVID-19 patients who develop robust antibody responses against NP, plasma samples are subjected to the experimental schema depicted in FIG. 2 in order to identify monoclonal antibodies that could recognize the SARS-CoV-2 NP.
  • FIG. 2A peripheral blood mononuclear cells are extracted from COVID-19 patients and antibody-producing cells known as CD19+CD27+ memory B cells are isolated.
  • FIG. 2B depicts the sorting results of the isolation of NP-specific memory B cells using flow cytometry. Inset numbers indicate the absolute number and the percentage of NP trimer-specific memory B cells isolated from a COVID-19 patient.
  • FIG. 3 monoclonal antibody binding (using ELISA) is depicted for a panel of monoclonal antibodies against SARS-CoV-2 NP which were synthesized using the methods described herein.
  • FIG. 3 shows robust binding of the synthesized monoclonal antibodies to SARS-CoV-2 NP.
  • FIG. 4 Western blotting analyses were performed to test whether synthesized SARS-CoV-2 NP-specific antibodies recognize linear epitopes on the SARS- CoV-2 NP. Synthesized human antibodies are indicated as 9-8, 9-9, 9-11, 9-15, 9-16, 9-17, 9-24 and 9-29. Before blotting with each antibody, SARS-CoV-2 NP was denatured and linearized by treating with dithiothreitol (DTT) and heat, and then running NuPAGE®. CR3022 is a SARS-CoV-2 spike trimer-specific antibody binding the receptor binding domain (RBD) region.
  • DTT dithiothreitol
  • RGD receptor binding domain
  • the synthesized NP antibodies recognize the linear epitope of NP and are specific as they do not recognize the spike protein (CR3022).
  • the synthesized antibodies are able to detect the SARS-CoV-2 NP from the physically and chemically inactivated SARS-CoV-2 virus.
  • FIG. 5 depicts competition ELISA curves for six synthesized antibodies: 9-9, 9-11, 9-16, 9-15, 9-17 and 9- 24. For each graph, competition is shown between the biotinylated antibody (labeled at the top of each graph) and the other five antibodies.
  • FIG. 5B shows the area under the curve (AUC) from FIG. 5A.
  • the NP-specific antibodies are categorized into three classes: class 1 only contains antibody 9-24, class 2 contains antibodies 9-11, 9-15, 9-16 and 9-17, and class 3 only contains antibody 9-9, There is no competition between the three classes of antibodies, meaning that antibodies in the three classes bind noncompetitively to different epitopes on the SARS-CoV-2 NP. This allows for selection of pairs of antibodies across the three classes for development of a sandwich ELISA with high sensitivity as described herein.
  • the monoclonal antibodies are capable of specifically binding a N-terminal domain of the SARS-CoV-2 virus. In some embodiments, the monoclonal antibodies are incapable of specifically binding a N-terminal domain of the SARS-CoV-2 virus. In some embodiments, antibodies capable of specifically binding a N- terminal domain and antibodies incapable of specifically binding a N-terminal domain do not compete for epitope binding.
  • FIG. 6 ELISA binding is shown for sandwich ELIS As of human antibodies of the current disclosure.
  • the graphs show the limit of NP that can be detected by some embodiments of the sandwich ELISA using the different combinations of SARS-CoV-2 NP-specific antibodies targeting different epitopes.
  • FIG. 6A shows ELISA binding for class 1 antibody 9-24 which was coated on the ELISA plate and used to capture NP, and biotinylated class 2 antibodies that were applied as detectors (9-11, 9-15, 9-16, and 9-17).
  • FIG. 6B shows the converse in which class 2 antibodies (9-11, 9-15, 9-16, and 9-17) were used as capture antibodies and class 1 antibody 9-24 was used as the detector.
  • the sandwich ELISA can detect as low as less than 0.138 ng of purified NP.
  • FIG. 7A shows Surface Plasmon Resonance (SPR) sensorgrams of SARS-CoV-2 NP antibodies binding to NP.
  • the NP was immobilized onto CM5 sensor chip at a concentration of 20 pg/ml and NP antibodies were injected at concentrations of 300 nM, 100 nM, 33.3 nM, 11.1 nM, 3.3 nM, and 1.1 nM.
  • FIG. 8A shows sandwich ELISA binding for the detection of NP using human antibody 9-24 (left panel; class 1) or human antibodies 9-11, 9-15, 9-16 and 9-17 (right panel; class 2) as the capture antibodies paired with biotinylated human antibodies 9-11, 9-15, 9-16 and 9-17 (left panel; class 2) or biotinylated human antibody 9-24 (right panel; class 1) as the detection antibodies.
  • the minimal detection of NP was defined as the value corresponding to 3 -fold higher optical density (OD) value than background.
  • FIG. 8B shows sandwich ELISA binding for the detection of NP where the capture antibody is human antibody 9-24 (class 1) and the detector antibodies were chimeric antibodies (chimeric 9-11, chimeric 9-15, and chimeric 9-16; class 2) bearing human variable regions and mouse constant regions.
  • the minimal detection of NP is calculated as the OD value corresponding to 3 -fold higher than background.
  • FIG. 8B demonstrates that ELIS As using chimeric detection antibodies provide for increased NP detection sensitivity.
  • FIG. 9 ELISA binding is shown for detection of NP using human antibody 9-24 (class 1) as the capture antibody and chimeric antibody 9-11 (class 2) as the detection antibody.
  • FIG. 9A shows ELISA binding performed on Vero cell growth media supernatant (left panel) or lysate of cells (right panel) treated with 1% NP-40 or used after freeze/thaw without treatment (i.e., no NP-40).
  • FIG. 9B shows ELISA binding for detection of NP performed on saliva samples from ten healthy donors treated with 1% NP-40.
  • FIG. 9C shows ELISA binding for detection of NP performed on purified SARS-CoV-2 NP as a positive assay control.
  • FIG. 9 demonstrates that NP detection using sandwich ELISAs of the current disclosure is specific since NP was not detected using Vero cell media (FIG. 9A) or saliva from healthy patients (FIG. 9B), and was only detected in samples containing SARS-CoV-2 NP (FIG. 9C).
  • sandwich ELISAs are shown as performed on saliva samples using an antibody pair consisting of human antibody 9-24 (class 1) as the capture antibody and chimeric antibody 9-11 (class 2) as the detection antibody.
  • SARS-CoV-2 NP (FIG. 10A) or viral particles (FIG. 10B) were spiked into the saliva (“with saliva”).
  • Purified NP or viral particles (without saliva) were used as controls (“w/o saliva”).
  • Viral particles were prepared by 1% NP-40 inactivation of the SARS-CoV-2 virus.
  • FIG. 10 demonstrates that the presence of saliva does not interference with the ability of the sandwich ELISAs to detect SARS-CoV- 2 NP.
  • FIG. 11 A shows ELISA binding for detection of NP using a standard incubation procedure (which takes approximately 4 hours in total to perform) including antigen incubation for 1 hour, detection antibody incubation for 1 hour, second antibody (against the detection antibody) incubation for 1 hour, and wash steps performed for 1 hour.
  • FIG. 11 A shows ELISA binding for detection of NP using a standard incubation procedure (which takes approximately 4 hours in total to perform) including antigen incubation for 1 hour, detection antibody incubation for 1 hour, second antibody (against the detection antibody) incubation for 1 hour, and wash steps performed for 1 hour.
  • 1 IB shows ELISA binding for detection of NP using a shorter incubation procedure (which takes approximately 1 hour in total to perform) including combination of antigen and detection antibody incubation for 25 minutes, second antibody incubation for 25 minutes, and wash steps for 10 minutes.
  • the minimal detection of viral particles was compared between the two procedures (FIGS. 11 A and 1 IB) and is shown to be similar.
  • FIGS. 12 and 13 optimization of the sandwich ELIS As by signal amplification was tested using Tyramide Signal Amplification (TSA) technology.
  • FIG. 12 is a schematic showing the mechanisms of TSA technology.
  • FIG. 13 shows ELISA binding for the detection of NP and resulting minimal sensitivity obtained using read-out from a conventional strategy (“unamplified,” FIG. 13 A) or using TSA which adds gain in sensitivity (“amplified,” FIG. 13B).
  • 13A and 13B show OD values for various levels of SARS-CoV-2 NP measured in ng/well concentration, while the bottom panels show OD values for various levels of SARS-CoV-2 NP measured in terms of fifty-percent-tissue- culture-infective-dose (TCIDso).
  • the minimal detection of NP is calculated as the OD value corresponding to 3-fold higher than background. While the background is enhanced, the enhancement in sensitivity using TSA (FIG. 13B) of the detection is between 7-fold (purified NP) to 39-fold (viral particle) for the samples.
  • FIGS. 14A-C the sensitivity and specificity of the antibody pair for detection of SARS-CoV-2 NP is shown.
  • FIG. 14A shows a phylogenetic tree of various coronavirus species relative to SARS-CoV-2 (WH01), based on the alignment of spike protein sequences.
  • FIG. 14B shows phylogenetic analysis that was conducted by the neighbor-joining method using MEGA 5.0. SDS-PAGE analysis of different Coronavirus NPs. The protein molecular weight marker (kDa) is indicated on the right.
  • FIG. 14C shows a sandwich ELISA employing a pair of monoclonal antibodies (9-24 and chimeric 9-11) to test specificity for different Coronavirus NPs. As shown in FIG.
  • this antibody pair shows high specificity and sensitivity for SARS-CoV-2 NP, but not for the NPs of the other coronavirus species. While SARS-CoV-1 could also be detected, it was detected at higher concentrations of NP relative to the detection of SARS-CoV-2, thus showing that the ELISA is more sensitive for SARS-CoV-2 compared to any other tested coronavirus species.
  • FIGS. 15A-B the detection of NP from SARS-CoV-2 infected cells (antibody pair: 9-24 & chimeric 9-11) is shown. 0.5M cells were infected with SARS-CoV-2 at different multiplicity of infection (MOI).
  • the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 1. (SEQ ID NO: 1).
  • the corresponding variable light chain domain of the anti- SARS-CoV-2 NP antibody comprises SEQ ID NO: 2. (SEQ ID NO: 2).
  • the antibody comprising SEQ ID NO: 1 and SEQ ID NO: 2 is represented by antibody “9- 11” in embodiments described and depicted in this disclosure.
  • variable heavy or light chain domains of the anti- ⁇ are identical to the variable heavy or light chain domains of the anti- ⁇
  • SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 1 or SEQ ID NO:
  • the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 3. (SEQ ID NO: 3).
  • the corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 4. (SEQ ID NO: 4).
  • the antibody comprising SEQ ID NO: 3 and SEQ ID NO: 4 is represented by antibody “9-15” in embodiments described in this disclosure.
  • variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 3 or SEQ ID NO:
  • the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 5. (SEQ ID NO: 5).
  • the corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 6.
  • SEQ ID NO: 6 The antibody comprising SEQ ID NO: 5 and SEQ ID NO: 6 is represented by antibody “9-16” in embodiments described and depicted in this disclosure.
  • variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 5 or SEQ ID NO:
  • the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 7. (SEQ ID NO: 7).
  • the corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 8. (SEQ ID NO: 8).
  • the antibody comprising SEQ ID NO: 7 and SEQ ID NO: 8 is represented by antibody “9-17” in embodiments described and depicted in this disclosure.
  • variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 7 or SEQ ID NO:
  • the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 9. (SEQ ID NO: 9).
  • the corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 10. (SEQ ID NO: 10).
  • the antibody comprising SEQ ID NO: 9 and SEQ ID NO: 10 is represented by antibody “9-24” in embodiments described and depicted in this disclosure.
  • variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87,
  • the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 11. (SEQ ID NO: 11).
  • the corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 12. (SEQ ID NO: 12).
  • the antibody comprising SEQ ID NO: 11 and SEQ ID NO: 12 is represented by antibody “9-8” in embodiments described and depicted in this disclosure.
  • variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87,
  • the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 13. (SEQ ID NO: 13).
  • the corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 14. (SEQ ID NO: 14).
  • the antibody comprising SEQ ID NO: 13 and SEQ ID NO: 14 is represented by antibody “9-9” in embodiments described and depicted in this disclosure.
  • variable heavy or light chain domains of the anti- ⁇ are identical to the variable heavy or light chain domains of the anti- ⁇
  • SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 13 or SEQ ID NO: 14.
  • the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 15. (SEQ ID NO: 15).
  • the corresponding variable light chain domain of the anti- SARS-CoV-2 NP antibody comprises SEQ ID NO: 16. (SEQ ID NO: 16).
  • the antibody comprising SEQ ID NO: 15 and SEQ ID NO: 16 is represented by antibody “9-29” in embodiments described and depicted in this disclosure.
  • variable heavy or light chain domains of the anti- ⁇ are identical to the variable heavy or light chain domains of the anti- ⁇
  • SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 15 or SEQ ID NO: 16.
  • the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP chimeric antibody comprises SEQ ID NO: 17. (SEQ ID NO: 17).
  • the corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 18. (SEQ ID NO: 18).
  • the antibody comprising SEQ ID NO: 17 and SEQ ID NO: 18 is represented by antibody “chimeric 9-11” in embodiments described and depicted in this disclosure.
  • variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 17 or SEQ ID NO: 18.
  • the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP chimeric antibody comprises SEQ ID NO: 19. (SEQ ID NO: 19).
  • the corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 20.
  • SSFLHLTSDQWRSHNSFTCQVTHEGDTVEKSLSPAECL SEQ ID NO: 20.
  • the antibody comprising SEQ ID NO: 19 and SEQ ID NO: 20 is represented by antibody “chimeric 9-15” in embodiments described and depicted in this disclosure.
  • variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87,
  • the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP chimeric antibody comprises SEQ ID NO: 21. (SEQ ID NO: 21).
  • the corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 22. (SEQ ID NO: 22).
  • the antibody comprising SEQ ID NO: 21 and SEQ ID NO: 22 is represented by antibody “chimeric 9-16” in embodiments described and depicted in this disclosure.
  • variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87,
  • a sandwich ELISA method is used to detect the presence of SARS-CoV-2 NP in a biological sample.
  • the ELISA plate may be coated with the class 1 human antibody 9-24 to capture the SARS-CoV-2 NP and one of the antibodies from class 2 (human antibodies 9-11, 9-15, 9-16, or 9-17; or chimeric antibodies 9-11, 9-15, or 9-16) is used as a detection antibody.
  • the antibody classes are reversed such that one of the antibodies from class 2 (human antibodies 9-11, 9-15, 9-16, or 9-17; or chimeric antibodies 9-11, 9-15, or 9-16) is coated on the ELISA plate to capture the SARS- CoV-2 NP, and the class 1 human antibody 9-24 is used as a detection antibody.
  • the detection antibody (either from class 1 or 2) is enzyme-linked (e.g ., horseradish peroxidase) such that a substrate (e.g., 3, 3', 5 ,5'-Tetramethylbenzidine) can be applied to detect the presence of SARS-CoV-2 NP.
  • the detection antibody is not enzyme-linked and an anti human antibody that is enzyme-linked (e.g, horseradish peroxidase) is used to bind to the detection antibody (from class 1 or 2) such that a substrate (e.g, 3, 3', 5 ,5'- Tetramethylbenzidine) can be applied to detect the presence of SARS-CoV-2 NP.
  • a sandwich ELISA would require three antibodies: a capture antibody (selected from class 1 or 2), a detection antibody (selected from the opposite class: class 1 or 2), and an enzyme-linked anti -human antibody (i.e., an antibody with a detectable marker) which binds to the detection antibody.
  • the methods and systems described herein can be used to sequence antibodies against the SARS-CoV-2 spike protein.
  • antibodies against the spike protein can be used to develop a sandwich ELISA method as described herein to detect a SARS-CoV-2 infection in a subject.
  • the methods and systems described herein can also be used to sequence and synthesize neutralizing antibodies against SARS-CoV-2 NP and spike protein.
  • the invention provides for a nucleic acid encoding the any of the antibodies described above.
  • the nucleic acid is operably linked to a promoter inserted in an expression vector.
  • the expression vector is a bacterial expression vector.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Virology (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Organic Chemistry (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • Pathology (AREA)
  • Microbiology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Peptides Or Proteins (AREA)
  • Pulmonology (AREA)

Abstract

Disclosed herein is a kit for detecting or quantifying a SARS-CoV-2 nucleocapsid phosphoprotein, including a first antibody, wherein a variable heavy chain domain comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 1, 3, 5, 7, 11, 13, 15, 17, 19, and 21, and a variable light chain domain comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 2, 4, 6, 8, 12, 14, 16, 18, 20, and 22; and a second antibody, wherein a variable heavy chain domain comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 9 and 13, and a variable light hain domain comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 10 and 14.

Description

MONOCLONAL ANTIBODIES AGAINST SARS-COV-2 NUCLEOCAPSID PHOSPHOPROTEIN AND SANDWICH ELISA METHOD
[0001] This application claims the benefit of U.S. Provisional Application No.
63/058,751, filed July 30, 2020 and U.S. Provisional Application No. 63/053,112, filed July 17, 2020, the contents of all of which are incorporated by reference.
[0002] This patent disclosure contains material that is subject to copyright protection.
The copyright owner has no objection to the facsimile reproduction of the patent document or the patent disclosure as it appears in the U.S. Patent and Trademark Office patent file or records, but otherwise reserves any and all copyright rights.
INCORPORATION BY REFERENCE
[0003] All documents cited herein are incorporated herein by reference in their entirety.
TECHNICAL FIELD
[0004] The present invention relates generally to monoclonal antibodies against SARS- CoV-2 nucleocapsid phosphoprotein. More particularly, the present invention relates to systems and methods for sandwich (or capture) enzyme-linked immunosorbent assays (ELISAs) for the detection of SARS-CoV-2 nucleocapsid phosphoprotein antigens.
BACKGROUND
[0005] A novel coronavirus emerged in December 2019 in Wuhan, China and devasted Hubei Province in early 2020 before spreading to every province within China and every country in the world. This pathogen, now termed severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), has caused a global pandemic, with -12.5 million cases and -550,000 deaths reported through July 10, 2020. The disease caused by SARS-CoV-2 infection is called coronavirus disease 2019 (COVID-19).
[0006] Testing by polymerase chain reaction (PCR) has been the mainstay for confirming SARS-CoV-2 infection worldwide. However, PCR is an inadequate diagnostic tool because it is complex and slow to perform and analyze. PCR tests also suffer from a high false negative rate which has been estimated to be about 20 %. See Xiao, A. T., et al ., False- negative of RT-PCR and Prolonged Nucleic Acid Conversion in COVID-19: Rather than Recurrence. Journal of Medical Virology (2020). The U.S. Food and Drug Administration (FDA) has approved the Sofia 2 SARS Antigen FIA test which is an immunofluorescent sandwich assay intended for the qualitative detection of the nucleocapsid protein antigen from SARS-CoV-2 in nasopharyngeal and nasal swab specimens directly or after the swabs have been added to viral transport media from individuals who are suspected of COVID-19 by their healthcare provider. However, the Sofia 2 has been reported to have false negative rate of 20 %. Therefore, there exists a need for a specific, sensitive, and rapid diagnostic test for SARS-CoV-2 infection. Further, there exists a need for antibodies against SARS-CoV-2 proteins that could be used in the development of diagnostic testing.
SUMMARY
[0007] In one aspect, the invention provides for a kit for detecting or quantifying a SARS-CoV-2 nucleocapsid phosphoprotein, the kit comprising a first antibody, wherein a variable heavy chain domain of the first antibody comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21, and a variable light chain domain of the first antibody comprising the amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO:6, SEQ ID NO: 8, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, and SEQ ID NO: 22; and a second antibody, wherein a variable heavy chain domain of the second antibody comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 9, and SEQ ID NO: 13, and a variable light chain domain of the second antibody comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 10, and SEQ ID NO: 14.
[0008] In some embodiments, the kit includes an ELISA plate having a plurality of compartments. In some embodiments, the plurality of compartments includes a reaction chamber and one or more of the plurality of compartments further includes one of the first antibody or the second antibody described herein. In some embodiments, the kit includes a third antibody, wherein the third antibody is an anti-human antibody having a detectable marker. In some embodiments, the kit includes an enzyme linked to one of the first antibody or the second antibody. In some embodiments, the kit includes a substrate capable of detecting the detectable marker. In some embodiments, the first antibody is a capture antibody and the second antibody is a detection antibody. In some embodiments, the second antibody is a capture antibody and the first antibody is a detection antibody. In some embodiments, the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 1 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 2. In some embodiments, the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO:
3 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 4. In some embodiments, the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 5 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 6. In some embodiments, the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 7 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 8. In some embodiments, the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO:
11 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 12. In some embodiments, the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 13 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 14. In some embodiments, the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 15 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 16. In some embodiments, the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 17 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 18. In some embodiments, the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 19 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 20. In some embodiments, the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 21 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 22. In some embodiments, the variable heavy chain domain of the second antibody comprises the amino acid sequence of SEQ ID NO: 9 and the variable light chain domain of the second antibody comprises the amino acid sequence of SEQ ID NO: 10. In some embodiments, the variable heavy chain domain of the second antibody comprises the amino acid sequence of SEQ ID NO: 13 and the variable light chain domain of the second antibody comprises the amino acid sequence of SEQ ID NO: 14. In some embodiments, each of the first antibody and the second antibody bind to different epitopes of the SARS-CoV-2 nucleocapsid phosphoprotein. In some embodiments, the kit is configured to detect, in a biological sample, the presence of a SARS- CoV-2 nucleocapsid phosphoprotein. [0009] In another aspect, the invention provides for an immunoassay method to detect or quantitate a SARS-CoV-2 nucleocapsid phosphoprotein, the method including coating a first solid surface with a coating antibody selected from one of the first antibody or the second antibody described herein (above), contacting the coated first solid surface with the biological sample to form a complex between a SARS-CoV-2 nucleocapsid phosphoprotein in the sample and the coating antibody, removing unbound biological sample, contacting the coated first solid surface with a detection antibody selected from one of the first antibody and the second antibody to form a complex between the SARS-CoV-2 nucleocapsid phosphoprotein in the sample and the detection antibody, contacting the coated first solid surface with an anti-human antibody having a detectable marker to form a complex between the anti-human antibody and the detection antibody, washing the coated first solid surface, contacting the coated first solid surface with a substrate capable of detecting the detectable marker, and detecting or quantitating the detectable marker of the anti-human antibody.
[0010] In some embodiments, the capture antibody is the first antibody described herein (above) and the detection antibody is the second antibody described herein (above). In some embodiments, the capture antibody is the second antibody described herein (above) and the detection antibody is the first antibody described herein (above). In some embodiments, each of the first antibody and the second antibody bind to different epitopes of the SARS-CoV-2 nucleocapsid phosphoprotein. In some embodiments, the detectable marker is horseradish peroxidase. In some embodiments, the substrate is 3, 3',5,5'-Tetramethylbenzidine (TMB). In some embodiments, the biological sample is human serum. In some embodiments, the detecting or quantitating includes measuring optical density at a wavelength of around 450nm. In some embodiments, the method includes generating a positive test result for a SARS-CoV-2 infection in a subject wherein the measured optical density is above a predetermined value. In some embodiments, the method includes generating a negative test result for a SARS-CoV-2 infection in a subject wherein the measured optical density is below a predetermined value. In some embodiments, the method is capable of detecting the SARS- CoV-2 nucleocapsid phosphoprotein when present in the biological sample at between about 0.001 ng and 0.02 ng. In some embodiments, the detection or quantitation of the SARS-CoV- 2 nucleocapsid phosphoprotein is completed within about 4 hours and within about 1 hour. In some embodiments, the detection or quantitation of the SARS-CoV-2 nucleocapsid phosphoprotein is completed within less than about 1 hour. In some embodiments, the method further includes amplifying a signal using Tyramide Signal Amplification (TSA) before detecting or quantitating the detectable marker of the anti-human antibody.
[0011] In another aspect, the invention provides for an immunoassay method to detect or quantitate a SARS-CoV-2 nucleocapsid phosphoprotein, the method including coating a first solid surface with a coating antibody selected from one of the first antibody or the second antibody described herein (above), contacting the coated first solid surface with the biological sample to form a complex between a SARS-CoV-2 nucleocapsid phosphoprotein in the sample and the coating antibody, removing unbound biological sample, contacting the coated first solid surface with a detection antibody selected from one of the first antibody and the second antibody described herein (above) to form a complex between the SARS-CoV-2 nucleocapsid phosphoprotein in the sample and the detection antibody, wherein the detection antibody further having a detectable marker, washing the coated first solid surface, contacting the coated first solid surface with a substrate capable of detecting the detectable marker, and detecting or quantitating the detectable marker of the detection antibody.
[0012] In some embodiments, the capture antibody is the first antibody described herein (above) and the detection antibody is the second antibody described herein (above). In some embodiments, the capture antibody is the second antibody described herein (above) and the detection antibody is the first antibody described herein (above). In some embodiments, each of the first antibody and the second antibody bind to different epitopes of the SARS-CoV-2 nucleocapsid phosphoprotein. In some embodiments, the detectable marker is horseradish peroxidase. In some embodiments, the substrate is 3, 3',5,5'-Tetramethylbenzidine (TMB). In some embodiments, the biological sample is human serum. In some embodiments, the detecting or quantitating includes measuring optical density at a wavelength of around 450nm. In some embodiments, the method includes generating a positive test result for a SARS-CoV-2 infection in a subject, wherein the measured optical density is above a predetermined value. In some embodiments, the method includes generating a negative test result for a SARS-CoV-2 infection in a subject, wherein the measured optical density is below a predetermined value. In some embodiments, the method is capable of detecting the SARS-CoV-2 nucleocapsid phosphoprotein when present in the biological sample at between about 0.001 ng and 0.02 ng. In some embodiments, the detection or quantitation of the SARS-CoV-2 nucleocapsid phosphoprotein is completed within about 4 hours and within about 1 hour. In some embodiments, the detection or quantitation of the SARS-CoV-2 nucleocapsid phosphoprotein is completed within less than about 1 hour. In some embodiments, the method further includes amplifying a signal using Tyramide Signal Amplification (TSA) before detecting or quantitating the detectable marker of the detection antibody.
[0013] In another aspect, the invention provides for a purified chimeric monoclonal antibody, or a functional fragment thereof, capable of specifically binding to a SARS-CoV-2 nucleocapsid phosphoprotein, wherein said monoclonal antibody, or functional fragment thereof, comprises any one amino acid sequence selected from the group consisting of heavy chain variable region comprising SEQ ID NO: 17, light chain variable region comprising SEQ ID NO: 18, heavy chain variable region comprising SEQ ID NO: 19, light chain variable region comprising SEQ ID NO: 20, heavy chain variable region comprising SEQ ID NO: 21, and light chain variable region comprising SEQ ID NO: 22.
[0014] In some embodiments, the monoclonal antibody comprises heavy chain variable region comprising SEQ ID NO: 17 and light chain variable region comprising SEQ ID NO: 18. In some embodiments, the monoclonal antibody comprises heavy chain variable region comprising SEQ ID NO: 19 and light chain variable region comprising SEQ ID NO: 20. In some embodiments, the monoclonal antibody comprises heavy chain variable region comprising SEQ ID NO: 21 and light chain variable region comprising SEQ ID NO: 22. BRIEF DESCRIPTION OF THE DRAWINGS
[0015] The following figures depict illustrative embodiments of the invention.
[0016] FIGS. 1 A-B depict ELISA binding of plasma samples from severe (FIG. 1 A) and non-severe (FIG. IB) COVID-19 patients, specifically of patients’ antibody responses to SARS-CoV-2 nucleocapsid phosphoprotein (NP).
[0017] FIGS 2A-B depict a process for identifying and synthesizing binding antibodies against SARS-CoV-2 NP (FIG. 2A) and the sorting results of the isolation of NP-specific memory B cells using flow cytometry (FIG. 2B).
[0018] FIG. 3 depicts ELISA monoclonal antibody binding against SARS-CoV-2 NP. [0019] FIG. 4 depicts Western blotting analysis of linear epitope recognition by monoclonal antibody against SARS-CoV-2 NP.
[0020] FIGS. 5A-B depict competition ELISA binding of pairs of monoclonal antibodies against SARS-CoV-2 NP (FIG. 5A) and corresponding area under the curve (FIG. 5B). [0021] FIGS. 6A-B depict sandwich ELISA binding for pairs of monoclonal antibodies against SARS-CoV-2 NP that recognize different NP epitopes. FIG. 6A shows ELISA binding for class 1 antibody (9-24) used for capture and class 2 antibodies (9-11, 9-16, 9-17) used as detectors. FIG. 6B shows ELISA binding for class 2 antibodies (9-11, 9-16, 9-17) used for capture and class 1 antibody (9-24) used as a detector (9-24).
[0022] FIGS. 7A-B depict SPR sensorgrams of SARS-CoV-2 NP antibodies binding to NP (FIG. 7A) and binding rate constants of the NP antibodies (FIG. 7B).
[0023] FIGS. 8A-B depict sandwich ELISA binding for pairs of monoclonal antibodies against SARS-CoV-2 NP that recognize different NP epitopes. FIG. 8A shows ELISA binding for human antibody pairs. FIG. 8B shows ELISA binding for human and chimeric antibody pairs.
[0024] FIGS. 9A-C depict sandwich ELISA binding for class 1 antibody (9-24) used for capture and class 2 antibody (chimeric 9-11) used for detection of NP. FIG. 9A shows ELISA binding performed on Vero cell media supernatant (left panel) or lysate (right panel) samples. FIG. 9B shows ELISA binding performed on saliva samples from healthy donors. FIG. 9C shows ELISA binding using purified SARS-CoV-2 NP.
[0025] FIGS. 10A-B depict sandwich ELISA binding for class 1 antibody (9-24) used for capture and class 2 antibody (chimeric 9-11) used for detection of NP. FIG. 10A shows ELISA binding performed on samples spiked with purified SARS-CoV-2 NP with and without saliva. FIG. 10B shows ELISA binding performed on samples spiked with SARS- CoV-2 viral particles (prepared by 1% NP-40 inactivation) with and without saliva.
[0026] FIGS. 11 A-B depict sandwich ELISA binding for class 1 antibody (9-24) used for capture and class 2 antibody (chimeric 9-11) used for detection of NP. FIG. 11 A shows ELISA binding performed according to standard incubation procedures that take about 4 hours to conduct. FIG. 1 IB shows ELISA binding performed according to shortened incubation procedures that take about 1 hour to conduct.
[0027] FIG. 12 depicts mechanisms of Tyramide Signal Amplification (TSA) technology. [0028] FIGS. 13A-B depict sandwich ELISA binding for detection of NP using a standard unamplified procedure (FIG. 13 A) and using amplification by TSA technology (FIG. 13B).
[0029] FIGS. 14A-C depict the sensitivity and specificity of an antibody pair for detection of SARS-CoV-2 NP. FIG.14A shows a phylogenetic tree of coronavirus species, FIG. 14B shows a Western blot analysis of various coronavirus NPs, and FIG. 14C shows sandwich ELISA binding for detection of NP for various coronavirus species.
[0030] FIGS. 15 A-B depict detection of NP from SARS-CoV-2 infected cells (antibody pair: 9-24 and chimeric 9-11). FIG. 15A shows a standard detection curve with dilution and FIG. 15B shows the results of sandwich ELISA binding for detection of SARS- CoV-2 NP across different multiplicities of infection.
DETAILED DESCRIPTION
[0031] In one aspect, the invention provides for an improved antigen sandwich (also known as “capture”) ELISA for the detection of SARS-CoV-2 infection using antibodies against SARS-CoV-2 nucleocapsid phosphoprotein (“NP”) antigens. Antibodies provide strong binding to antigens requiring less amounts of antigens for detection and therefore increased assay sensitivity. An advantage of the disclosed systems and methods is the ability to provide an antigen test that is faster and easier to perform compared to PCR tests yet overcomes the inaccuracy issue regarding false negative readings of other antigen tests.
[0032] The present disclosure is directed to the isolation and characterization of sequences of a panel of monoclonal antibodies targeting SARS-CoV-2 NP, the most abundantly expressed immunodominant protein that interacts with RNA. In some embodiments, the present disclosure provides for an improved sandwich ELISA method of detecting SARS-CoV-2 NP antigens by using monoclonal antibodies that target multiple epitopes of the nucleocapsid, thus allowing for the selection of one or more antibody pairs for assay optimization, resulting in high sensitivity and specificity. In some embodiments, the monoclonal against SARS-CoV-2 NP are used for capture assays to detect the presence of SARS-CoV-2 NP antigens in various clinical samples. In some embodiments, the disclosed assays and antibody pairs are used for commercial rapid test kits for COVID-19 antigen detection.
[0033] Referring to FIG. 1, two graphs are depicted which show ELISA binding data of plasma samples from COVID-19 patients to SARS-CoV-2 NP. FIG. 1 A shows the ELISA binding data for COVID-19 patients having severe disease and FIG. IB shows the ELISA binding data for COVID-19 patients having non-severe disease. FIG. 1 demonstrates that both severe and non-severe COVID-19 patients develop robust antibody responses to the SARS-CoV-2 NP.
[0034] Referring to FIG. 2, a diagram is depicted showing the process for identifying strong binding antibodies against the SARS-CoV-2 NP. Plasma samples from severe and non-severe COVID-19 patients (see FIG. 1) are isolated and evaluated for the ability to bind SARS-CoV-2 NP. From those COVID-19 patients who develop robust antibody responses against NP, plasma samples are subjected to the experimental schema depicted in FIG. 2 in order to identify monoclonal antibodies that could recognize the SARS-CoV-2 NP. Referring to FIG. 2A, peripheral blood mononuclear cells are extracted from COVID-19 patients and antibody-producing cells known as CD19+CD27+ memory B cells are isolated. The focus is on the subset of cells that bind the SARS-CoV-2 NP. Cutting-edge genomics technology ( e.g ., high throughput sequencing) is used to extract, amplify, and sequence each set of antibody genes allowing for the reconstruction of each monoclonal antibody against SARS- CoV-2 NP. The antibody genes are cloned into expression vectors. In some embodiments, the variable regions of the identified human antibodies are combined with constant regions from mouse antibodies to create chimeric antibodies. The monoclonal antibodies are expressed in vitro and purified for subsequent characterization experiments. FIG. 2B depicts the sorting results of the isolation of NP-specific memory B cells using flow cytometry. Inset numbers indicate the absolute number and the percentage of NP trimer-specific memory B cells isolated from a COVID-19 patient.
[0035] Referring to FIG. 3, monoclonal antibody binding (using ELISA) is depicted for a panel of monoclonal antibodies against SARS-CoV-2 NP which were synthesized using the methods described herein. FIG. 3 shows robust binding of the synthesized monoclonal antibodies to SARS-CoV-2 NP.
[0036] Referring to FIG. 4, Western blotting analyses were performed to test whether synthesized SARS-CoV-2 NP-specific antibodies recognize linear epitopes on the SARS- CoV-2 NP. Synthesized human antibodies are indicated as 9-8, 9-9, 9-11, 9-15, 9-16, 9-17, 9-24 and 9-29. Before blotting with each antibody, SARS-CoV-2 NP was denatured and linearized by treating with dithiothreitol (DTT) and heat, and then running NuPAGE®. CR3022 is a SARS-CoV-2 spike trimer-specific antibody binding the receptor binding domain (RBD) region. FIG. 4 shows that the synthesized NP antibodies recognize the linear epitope of NP and are specific as they do not recognize the spike protein (CR3022). In some embodiments, the synthesized antibodies are able to detect the SARS-CoV-2 NP from the physically and chemically inactivated SARS-CoV-2 virus.
[0037] Referring to FIG. 5, epitope mapping is depicted for SARS-CoV-2 NP-specific human antibodies by competition ELISA. In order to determine the epitope of the binding antibodies on SARS-CoV-2 NP, competition ELISAs were performed. FIG. 5A depicts competition ELISA curves for six synthesized antibodies: 9-9, 9-11, 9-16, 9-15, 9-17 and 9- 24. For each graph, competition is shown between the biotinylated antibody (labeled at the top of each graph) and the other five antibodies. FIG. 5B shows the area under the curve (AUC) from FIG. 5A. Based on the competition ELISA data, the NP-specific antibodies are categorized into three classes: class 1 only contains antibody 9-24, class 2 contains antibodies 9-11, 9-15, 9-16 and 9-17, and class 3 only contains antibody 9-9, There is no competition between the three classes of antibodies, meaning that antibodies in the three classes bind noncompetitively to different epitopes on the SARS-CoV-2 NP. This allows for selection of pairs of antibodies across the three classes for development of a sandwich ELISA with high sensitivity as described herein.
[0038] In some embodiments, the monoclonal antibodies are capable of specifically binding a N-terminal domain of the SARS-CoV-2 virus. In some embodiments, the monoclonal antibodies are incapable of specifically binding a N-terminal domain of the SARS-CoV-2 virus. In some embodiments, antibodies capable of specifically binding a N- terminal domain and antibodies incapable of specifically binding a N-terminal domain do not compete for epitope binding.
[0039] Referring to FIG. 6, ELISA binding is shown for sandwich ELIS As of human antibodies of the current disclosure. The graphs show the limit of NP that can be detected by some embodiments of the sandwich ELISA using the different combinations of SARS-CoV-2 NP-specific antibodies targeting different epitopes. FIG. 6A shows ELISA binding for class 1 antibody 9-24 which was coated on the ELISA plate and used to capture NP, and biotinylated class 2 antibodies that were applied as detectors (9-11, 9-15, 9-16, and 9-17). FIG. 6B shows the converse in which class 2 antibodies (9-11, 9-15, 9-16, and 9-17) were used as capture antibodies and class 1 antibody 9-24 was used as the detector. The sandwich ELISA can detect as low as less than 0.138 ng of purified NP.
[0040] Referring to FIG. 7, binding affinities of monoclonal antibodies 9-11, 9-15, 9-16, 9-17, and 9-24 to SARS-CoV-2 NP are shown. FIG. 7A shows Surface Plasmon Resonance (SPR) sensorgrams of SARS-CoV-2 NP antibodies binding to NP. The NP was immobilized onto CM5 sensor chip at a concentration of 20 pg/ml and NP antibodies were injected at concentrations of 300 nM, 100 nM, 33.3 nM, 11.1 nM, 3.3 nM, and 1.1 nM. FIG. 7B shows the binding rate constants and affinities of NP antibodies (ka = association rate constant; kd = dissociation rate constant; KD = equilibrium constant). Binding affinities were strong for all five antibodies.
[0041] Referring to FIG. 8, ELISA binding is shown for sandwich ELIS As of human and chimeric antibodies of the current disclosure. FIG. 8A shows sandwich ELISA binding for the detection of NP using human antibody 9-24 (left panel; class 1) or human antibodies 9-11, 9-15, 9-16 and 9-17 (right panel; class 2) as the capture antibodies paired with biotinylated human antibodies 9-11, 9-15, 9-16 and 9-17 (left panel; class 2) or biotinylated human antibody 9-24 (right panel; class 1) as the detection antibodies. The minimal detection of NP was defined as the value corresponding to 3 -fold higher optical density (OD) value than background. FIG. 8B shows sandwich ELISA binding for the detection of NP where the capture antibody is human antibody 9-24 (class 1) and the detector antibodies were chimeric antibodies (chimeric 9-11, chimeric 9-15, and chimeric 9-16; class 2) bearing human variable regions and mouse constant regions. The minimal detection of NP is calculated as the OD value corresponding to 3 -fold higher than background. FIG. 8B demonstrates that ELIS As using chimeric detection antibodies provide for increased NP detection sensitivity.
[0042] Referring to FIG. 9, ELISA binding is shown for detection of NP using human antibody 9-24 (class 1) as the capture antibody and chimeric antibody 9-11 (class 2) as the detection antibody. FIG. 9A shows ELISA binding performed on Vero cell growth media supernatant (left panel) or lysate of cells (right panel) treated with 1% NP-40 or used after freeze/thaw without treatment (i.e., no NP-40). FIG. 9B shows ELISA binding for detection of NP performed on saliva samples from ten healthy donors treated with 1% NP-40. FIG. 9C shows ELISA binding for detection of NP performed on purified SARS-CoV-2 NP as a positive assay control. In all cases, the minimal detection of NP is calculated as the OD value corresponding to 3 -fold higher than background. FIG. 9 demonstrates that NP detection using sandwich ELISAs of the current disclosure is specific since NP was not detected using Vero cell media (FIG. 9A) or saliva from healthy patients (FIG. 9B), and was only detected in samples containing SARS-CoV-2 NP (FIG. 9C).
[0043] Referring to FIG. 10, sandwich ELISAs are shown as performed on saliva samples using an antibody pair consisting of human antibody 9-24 (class 1) as the capture antibody and chimeric antibody 9-11 (class 2) as the detection antibody. SARS-CoV-2 NP (FIG. 10A) or viral particles (FIG. 10B) were spiked into the saliva (“with saliva”). Purified NP or viral particles (without saliva) were used as controls (“w/o saliva”). Viral particles were prepared by 1% NP-40 inactivation of the SARS-CoV-2 virus. FIG. 10 demonstrates that the presence of saliva does not interference with the ability of the sandwich ELISAs to detect SARS-CoV- 2 NP.
[0044] Referring to FIG. 11, viral particles were quantified by two sandwich ELISAs using an antibody pair consisting of human antibody 9-24 (class 1) as the capture antibody and chimeric antibody 9-11 (class 2) as the detection antibody. FIG. 11 A shows ELISA binding for detection of NP using a standard incubation procedure (which takes approximately 4 hours in total to perform) including antigen incubation for 1 hour, detection antibody incubation for 1 hour, second antibody (against the detection antibody) incubation for 1 hour, and wash steps performed for 1 hour. FIG. 1 IB shows ELISA binding for detection of NP using a shorter incubation procedure (which takes approximately 1 hour in total to perform) including combination of antigen and detection antibody incubation for 25 minutes, second antibody incubation for 25 minutes, and wash steps for 10 minutes. The minimal detection of viral particles was compared between the two procedures (FIGS. 11 A and 1 IB) and is shown to be similar.
[0045] Referring to FIGS. 12 and 13, optimization of the sandwich ELIS As by signal amplification was tested using Tyramide Signal Amplification (TSA) technology. FIG. 12 is a schematic showing the mechanisms of TSA technology. FIG. 13 shows ELISA binding for the detection of NP and resulting minimal sensitivity obtained using read-out from a conventional strategy (“unamplified,” FIG. 13 A) or using TSA which adds gain in sensitivity (“amplified,” FIG. 13B). The top panels of FIGS. 13A and 13B show OD values for various levels of SARS-CoV-2 NP measured in ng/well concentration, while the bottom panels show OD values for various levels of SARS-CoV-2 NP measured in terms of fifty-percent-tissue- culture-infective-dose (TCIDso). The minimal detection of NP is calculated as the OD value corresponding to 3-fold higher than background. While the background is enhanced, the enhancement in sensitivity using TSA (FIG. 13B) of the detection is between 7-fold (purified NP) to 39-fold (viral particle) for the samples.
[0046] Referring to FIGS. 14A-C, the sensitivity and specificity of the antibody pair for detection of SARS-CoV-2 NP is shown. FIG. 14A shows a phylogenetic tree of various coronavirus species relative to SARS-CoV-2 (WH01), based on the alignment of spike protein sequences. FIG. 14B shows phylogenetic analysis that was conducted by the neighbor-joining method using MEGA 5.0. SDS-PAGE analysis of different Coronavirus NPs. The protein molecular weight marker (kDa) is indicated on the right. FIG. 14C shows a sandwich ELISA employing a pair of monoclonal antibodies (9-24 and chimeric 9-11) to test specificity for different Coronavirus NPs. As shown in FIG. 14C, this antibody pair shows high specificity and sensitivity for SARS-CoV-2 NP, but not for the NPs of the other coronavirus species. While SARS-CoV-1 could also be detected, it was detected at higher concentrations of NP relative to the detection of SARS-CoV-2, thus showing that the ELISA is more sensitive for SARS-CoV-2 compared to any other tested coronavirus species. [0047] Referring to FIGS. 15A-B, the detection of NP from SARS-CoV-2 infected cells (antibody pair: 9-24 & chimeric 9-11) is shown. 0.5M cells were infected with SARS-CoV-2 at different multiplicity of infection (MOI). Cells were harvested at 1.5 hours after infection, washed in PBS, then lysed in PBS with 1% TritonX-100. After lysis, soluble NP was measured by a sandwich ELISA as described herein. Referring to FIG. 15 A, the standard was diluted from 250 pg/ml to 0 pg/ml. Referring to FIG. 15B, the NPs of the infected cells were measured by the sandwich assay. SARS-CoV-2 NP was detectable for MOIs of 100 and 33.333 (Groups 1 and 2), but not for the other, lower MOIs.
Sequences of human monoclonal antibodies to SARS-CoV-2 NP
[0048] Underlined and italicized amino acids represent the respective complementarity determining regions (CDRs).
[0049] In some embodiments, the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 1.
Figure imgf000014_0001
(SEQ ID NO: 1). The corresponding variable light chain domain of the anti- SARS-CoV-2 NP antibody comprises SEQ ID NO: 2. (SEQ ID NO: 2).
Figure imgf000014_0002
The antibody comprising SEQ ID NO: 1 and SEQ ID NO: 2 is represented by antibody “9- 11” in embodiments described and depicted in this disclosure.
[0050] In some embodiments, the variable heavy or light chain domains of the anti-
SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 1 or SEQ ID NO:
2
[0051] In some embodiments, the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 3. (SEQ ID NO: 3). The corresponding variable light chain domain of the
Figure imgf000014_0003
anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 4.
Figure imgf000014_0004
(SEQ ID NO:
Figure imgf000015_0001
4). The antibody comprising SEQ ID NO: 3 and SEQ ID NO: 4 is represented by antibody “9-15” in embodiments described in this disclosure.
[0052] In some embodiments, the variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 3 or SEQ ID NO:
4.
[0053] In some embodiments, the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 5.
Figure imgf000015_0002
(SEQ ID NO: 5). The corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 6.
O S VLT OPP S ASGTPGORVTISCAGAAXV7GXV7T7VW Y OOLPGT APKLLIY TNNORPSGVP DRF SGSKSGTS ASL AISGLOSEDEAD YY CAA WDDSLNGRYWF GGGTKLTVL (SEQ ID NO: 6). The antibody comprising SEQ ID NO: 5 and SEQ ID NO: 6 is represented by antibody “9-16” in embodiments described and depicted in this disclosure.
[0054] In some embodiments, the variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 5 or SEQ ID NO:
6
[0055] In some embodiments, the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 7.
Figure imgf000015_0003
(SEQ ID NO: 7). The corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 8. (SEQ
Figure imgf000015_0004
ID NO: 8). The antibody comprising SEQ ID NO: 7 and SEQ ID NO: 8 is represented by antibody “9-17” in embodiments described and depicted in this disclosure.
[0056] In some embodiments, the variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 7 or SEQ ID NO:
8
[0057] In some embodiments, the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 9.
Figure imgf000016_0001
(SEQ ID NO: 9). The corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 10.
Figure imgf000016_0002
(SEQ ID NO:
Figure imgf000016_0003
10). The antibody comprising SEQ ID NO: 9 and SEQ ID NO: 10 is represented by antibody “9-24” in embodiments described and depicted in this disclosure.
[0058] In some embodiments, the variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87,
88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 9 or SEQ ID NO: 10
[0059] In some embodiments, the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 11.
Figure imgf000016_0004
(SEQ ID NO: 11). The corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 12.
Figure imgf000016_0005
(SEQ ID NO: 12). The antibody comprising SEQ ID NO: 11 and SEQ ID NO: 12 is represented by antibody “9-8” in embodiments described and depicted in this disclosure.
[0060] In some embodiments, the variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87,
88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 11 or SEQ ID NO: 12
[0061] In some embodiments, the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 13.
Figure imgf000016_0006
(SEQ ID NO: 13). The corresponding variable light chain
Figure imgf000017_0001
domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 14. (SEQ ID NO:
Figure imgf000017_0002
14). The antibody comprising SEQ ID NO: 13 and SEQ ID NO: 14 is represented by antibody “9-9” in embodiments described and depicted in this disclosure.
[0062] In some embodiments, the variable heavy or light chain domains of the anti-
SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 13 or SEQ ID NO: 14.
[0063] In some embodiments, the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 15. (SEQ ID NO: 15). The corresponding variable light chain domain of the anti-
Figure imgf000017_0003
SARS-CoV-2 NP antibody comprises SEQ ID NO: 16. (SEQ
Figure imgf000017_0004
ID NO: 16). The antibody comprising SEQ ID NO: 15 and SEQ ID NO: 16 is represented by antibody “9-29” in embodiments described and depicted in this disclosure.
[0064] In some embodiments, the variable heavy or light chain domains of the anti-
SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 15 or SEQ ID NO: 16.
Sequences of chimeric monoclonal antibodies to SARS-CoV-2 NP
[0065] Underlined and italicized amino acids represent the respective complementarity determining regions (CDRs).
[0066] In some embodiments, the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP chimeric antibody comprises SEQ ID NO: 17.
Figure imgf000017_0005
Figure imgf000018_0001
(SEQ ID NO: 17). The corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 18. (SEQ ID NO: 18). The
Figure imgf000018_0002
antibody comprising SEQ ID NO: 17 and SEQ ID NO: 18 is represented by antibody “chimeric 9-11” in embodiments described and depicted in this disclosure.
[0067] In some embodiments, the variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 17 or SEQ ID NO: 18.
[0068] In some embodiments, the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP chimeric antibody comprises SEQ ID NO: 19.
Figure imgf000018_0003
(SEQ ID NO: 19). The corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 20.
Figure imgf000018_0004
SSFLHLTSDQWRSHNSFTCQVTHEGDTVEKSLSPAECL (SEQ ID NO: 20). The antibody comprising SEQ ID NO: 19 and SEQ ID NO: 20 is represented by antibody “chimeric 9-15” in embodiments described and depicted in this disclosure.
[0069] In some embodiments, the variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87,
88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 19 or SEQ ID NO: 20
[0070] In some embodiments, the amino acid sequence of the variable heavy chain domain of an anti-SARS-CoV-2 NP chimeric antibody comprises SEQ ID NO: 21.
Figure imgf000019_0001
(SEQ ID NO: 21). The corresponding variable light chain domain of the anti-SARS-CoV-2 NP antibody comprises SEQ ID NO: 22. (SEQ ID NO: 22). The
Figure imgf000019_0002
antibody comprising SEQ ID NO: 21 and SEQ ID NO: 22 is represented by antibody “chimeric 9-16” in embodiments described and depicted in this disclosure.
[0071] In some embodiments, the variable heavy or light chain domains of the anti- SARS-CoV-2 NP antibody comprise an amino acid sequence 80, 81, 82, 83, 84, 85, 86, 87,
88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99 % identical to SEQ ID NO: 21 or SEQ ID NO: 22
[0072] In some embodiments, a sandwich ELISA method is used to detect the presence of SARS-CoV-2 NP in a biological sample. The ELISA plate may be coated with the class 1 human antibody 9-24 to capture the SARS-CoV-2 NP and one of the antibodies from class 2 (human antibodies 9-11, 9-15, 9-16, or 9-17; or chimeric antibodies 9-11, 9-15, or 9-16) is used as a detection antibody. In some embodiments, the antibody classes are reversed such that one of the antibodies from class 2 (human antibodies 9-11, 9-15, 9-16, or 9-17; or chimeric antibodies 9-11, 9-15, or 9-16) is coated on the ELISA plate to capture the SARS- CoV-2 NP, and the class 1 human antibody 9-24 is used as a detection antibody. In some embodiments, the detection antibody (either from class 1 or 2) is enzyme-linked ( e.g ., horseradish peroxidase) such that a substrate (e.g., 3, 3', 5 ,5'-Tetramethylbenzidine) can be applied to detect the presence of SARS-CoV-2 NP.
[0073] In some embodiments, the detection antibody is not enzyme-linked and an anti human antibody that is enzyme-linked (e.g, horseradish peroxidase) is used to bind to the detection antibody (from class 1 or 2) such that a substrate (e.g, 3, 3', 5 ,5'- Tetramethylbenzidine) can be applied to detect the presence of SARS-CoV-2 NP. In such an embodiment, a sandwich ELISA would require three antibodies: a capture antibody (selected from class 1 or 2), a detection antibody (selected from the opposite class: class 1 or 2), and an enzyme-linked anti -human antibody (i.e., an antibody with a detectable marker) which binds to the detection antibody.
[0074] In some embodiments, the methods and systems described herein can be used to sequence antibodies against the SARS-CoV-2 spike protein. In such embodiments, antibodies against the spike protein can be used to develop a sandwich ELISA method as described herein to detect a SARS-CoV-2 infection in a subject. In some embodiments, the methods and systems described herein can also be used to sequence and synthesize neutralizing antibodies against SARS-CoV-2 NP and spike protein.
[0075] In some embodiments, the invention provides for a nucleic acid encoding the any of the antibodies described above. In some embodiments, the nucleic acid is operably linked to a promoter inserted in an expression vector. In some embodiments, the expression vector is a bacterial expression vector.
References:
[0076] Ankur Garg, Lihong Liu, David D. Ho, and Leemor Joshua-Tor. (2020). Heterologous Expression and Purification of SARS-CoV2 Nucleocapsid Protein. Bio-101: e5005. DOI: 10.21769/BioProtoc.5005.
[0077] Pengfei Wang, Lihong Liu, Manoj S. Nair, Michael T. Yin, Yang Luo, Qian Wang, Ting Yuan, Kanako Mori, Axel Guzman Solis, Masahiro Yamashita, Lawrence J. Purpura, Justin C. Laracy, Jian Yu, Joseph Sodroski, Yaoxing Huang, David D. Ho, (2020). SARS-CoV-2 Neutralizing Antibody Responses Are More Robust in Patients with Severe Disease, doi: https://doi.org/10.1101/2020.06.13.150250.
[0078] Lihong Liu, Pengfei Wang, Manoj S. Nair, Jian Yu, Yaoxing Huang, Micah A. Rapp, Qian Wang, Yang Luo, Vincent Sahi, Amir Figueroa, Xinzheng V. Guo, Gabriele Cerutti, Jude Bimela, Jason Gorman, Tongqing Zhou, Peter D. Kwong, Joseph G. Sodroski, Michael T. Yin, Zizhang Sheng, Lawrence Shapiro, David D. Ho, (2020). Potent Neutralizing Monoclonal Antibodies Directed to Multiple Epitopes on the SARS-CoV-2 Spike. Doi: https://doi.org/10.1101/2020.06.17.153486
[0079] The devices, systems, and methods disclosed herein are not to be limited in scope to the specific embodiments described herein. Indeed, various modifications of the devices, systems, and methods in addition to those described will become apparent to those of skill in the art from the foregoing description.

Claims

What is claimed is:
1. A kit for detecting or quantifying a SARS-CoV-2 nucleocapsid phosphoprotein, the kit comprising: a first antibody, wherein a variable heavy chain domain of the first antibody comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21, and a variable light chain domain of the first antibody comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, and SEQ ID NO: 22; and a second antibody, wherein a variable heavy chain domain of the second antibody comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 9, and SEQ ID NO: 13, and a variable light chain domain of the second antibody comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 10, and SEQ ID NO: 14.
2. The kit of claim 1, further comprising an ELISA plate having a plurality of compartments.
3. The kit of claim 2, wherein the plurality of compartments comprises a reaction chamber and one or more of the plurality of compartments further comprises one of the first antibody or the second antibody.
4. The kit of claim 1, further comprising a third antibody, wherein the third antibody is an anti-human antibody comprising a detectable marker.
5. The kit of claim 1, further comprising an enzyme linked to one of the first antibody or the second antibody.
6. The kit of claims 4 or 5, further comprising a substrate capable of detecting the detectable marker.
7. The kit of claim 1, wherein the first antibody is a capture antibody and the second antibody is a detection antibody.
8. The kit of claim 1, wherein the second antibody is a capture antibody and the first antibody is a detection antibody.
9. The kit of claim 1, wherein the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 1 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 2.
10. The kit of claim 1, wherein the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 3 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 4.
11. The kit of claim 1, wherein the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 5 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 6.
12. The kit of claim 1, wherein the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 7 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 8.
13. The kit of claim 1, wherein the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 11 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 12.
14. The kit of claim 1, wherein the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 13 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 14.
15. The kit of claim 1, wherein the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 15 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 16.
16. The kit of claim 1, wherein the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 17 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 18.
17. The kit of claim 1, wherein the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 19 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 20.
18. The kit of claim 1, wherein the variable heavy chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 21 and the variable light chain domain of the first antibody comprises the amino acid sequence of SEQ ID NO: 22.
19. The kit of claim 1, wherein the variable heavy chain domain of the second antibody comprises the amino acid sequence of SEQ ID NO: 9 and the variable light chain domain of the second antibody comprises the amino acid sequence of SEQ ID NO: 10.
20. The kit of claim 1, wherein the variable heavy chain domain of the second antibody comprises the amino acid sequence of SEQ ID NO: 13 and the variable light chain domain of the second antibody comprises the amino acid sequence of SEQ ID NO: 14.
21. The kit of claim 1, wherein each of the first antibody and the second antibody bind to different epitopes of the SARS-CoV-2 nucleocapsid phosphoprotein.
22. The kit of claim 1, wherein the kit is configured to detect, in a biological sample, the presence of a SARS-CoV-2 nucleocapsid phosphoprotein.
23. An immunoassay method to detect or quantitate a SARS-CoV-2 nucleocapsid phosphoprotein, the method comprising: coating a first solid surface with a coating antibody selected from one of the first antibody or the second antibody of claim 1; contacting the coated first solid surface with the biological sample to form a complex between a SARS-CoV-2 nucleocapsid phosphoprotein in the sample and the coating antibody; removing unbound biological sample; contacting the coated first solid surface with a detection antibody selected from one of the first antibody and the second antibody to form a complex between the SARS-CoV-2 nucleocapsid phosphoprotein in the sample and the detection antibody; contacting the coated first solid surface with an anti-human antibody comprising a detectable marker to form a complex between the anti-human antibody and the detection antibody; washing the coated first solid surface; contacting the coated first solid surface with a substrate capable of detecting the detectable marker; and detecting or quantitating the detectable marker of the anti-human antibody.
24. The method of claim 23, wherein the capture antibody is the first antibody of claim 1 and the detection antibody is the second antibody of claim 1.
25. The method of claim 24, wherein the capture antibody is the second antibody of claim 1 and the detection antibody is the first antibody of claim 1.
26. The method of claim 25, wherein each of the first antibody and the second antibody bind to different epitopes of the SARS-CoV-2 nucleocapsid phosphoprotein.
27. The method of claim 23, wherein the detectable marker is horseradish peroxidase.
28. The method of claim 23, wherein the substrate is 3, 3', 5, 5'- Tetramethylbenzidine (TMB).
29. The method of claim 23, wherein the biological sample is human serum.
30. The method of claim 23, wherein the detecting or quantitating comprises measuring optical density at a wavelength of around 450nm.
31. The method of claim 30, further comprising generating a positive test result for a SARS-CoV-2 infection in a subject wherein the measured optical density is above a predetermined value.
32. The method of claim 30, further comprising generating a negative test result for a SARS-CoV-2 infection in a subject wherein the measured optical density is below a predetermined value.
33. The method of claim 23, wherein the method is configured to detect the SARS-CoV-2 nucleocapsid phosphoprotein when present in the biological sample at between about 0.001 ng and 0.02 ng.
34. The method of claim 23, wherein the detection or quantitation of the SARS- CoV-2 nucleocapsid phosphoprotein is completed within about 4 hours and within about 1 hour.
35. The method of claim 23, wherein the detection or quantitation of the SARS- CoV-2 nucleocapsid phosphoprotein is completed within less than about 1 hour.
36. The method of claim 23, further comprising amplifying a signal using Tyramide Signal Amplification (TSA) before detecting or quantitating the detectable marker of the anti-human antibody.
37. An immunoassay method to detect or quantitate a SARS-CoV-2 nucleocapsid phosphoprotein, the method comprising: coating a first solid surface with a coating antibody selected from one of the first antibody or the second antibody of claim 1; contacting the coated first solid surface with the biological sample to form a complex between a SARS-CoV-2 nucleocapsid phosphoprotein in the sample and the coating antibody; removing unbound biological sample; contacting the coated first solid surface with a detection antibody selected from one of the first antibody and the second antibody to form a complex between the SARS-CoV-2 nucleocapsid phosphoprotein in the sample and the detection antibody, wherein the detection antibody further comprises a detectable marker; washing the coated first solid surface; contacting the coated first solid surface with a substrate capable of detecting the detectable marker; and detecting or quantitating the detectable marker of the detection antibody.
38. The method of claim 37, wherein the capture antibody is the first antibody of claim 1 and the detection antibody is the second antibody of claim 1.
39. The method of claim 37, wherein the capture antibody is the second antibody of claim 1 and the detection antibody is the first antibody of claim 1.
40. The method of claim 39, wherein each of the first antibody and the second antibody bind to different epitopes of the SARS-CoV-2 nucleocapsid phosphoprotein.
41. The method of claim 40, wherein the detectable marker is horseradish peroxidase.
42. The method of claim 37, wherein the substrate is 3, 3', 5, 5'- Tetramethylbenzidine (TMB).
43. The method of claim 37, wherein the biological sample is human serum.
44. The method of claim 37, wherein the detecting or quantitating comprises measuring optical density at a wavelength of around 450nm.
45. The method of claim 44, further comprising generating a positive test result for a SARS-CoV-2 infection in a subject, wherein the measured optical density is above a predetermined value.
46. The method of claim 44, further comprising generating a negative test result for a SARS-CoV-2 infection in a subject, wherein the measured optical density is below a predetermined value.
47. The method of claim 37, wherein the method is configured to detect the SARS-CoV-2 nucleocapsid phosphoprotein when present in the biological sample at between about 0.001 ng and 0.02 ng.
48. The method of claim 37, wherein the detection or quantitation of the SARS- CoV-2 nucleocapsid phosphoprotein is completed within about 4 hours and within about 1 hour.
49. The method of claim 37, wherein the detection or quantitation of the SARS- CoV-2 nucleocapsid phosphoprotein is completed within less than about 1 hour.
50. The method of claim 49, further comprising amplifying a signal using Tyramide Signal Amplification (TSA) before detecting or quantitating the detectable marker of the detection antibody.
51. A purified chimeric monoclonal antibody, or a functional fragment thereof, capable of specifically binding to a SARS-CoV-2 nucleocapsid phosphoprotein, wherein said monoclonal antibody, or functional fragment thereof, comprises any one polypeptide sequence selected from the group consisting of heavy chain variable region comprising SEQ ID NO: 17, light chain variable region comprising SEQ ID NO: 18, heavy chain variable region comprising SEQ ID NO: 19, light chain variable region comprising SEQ ID NO: 20, heavy chain variable region comprising SEQ ID NO: 21, and light chain variable region comprising SEQ ID NO: 22.
52. The monoclonal antibody of claim 51, comprising heavy chain variable region comprising SEQ ID NO: 17 and light chain variable region comprising SEQ ID NO: 18.
53. The monoclonal antibody of claim 52, comprising heavy chain variable region comprising SEQ ID NO: 19 and light chain variable region comprising SEQ ID NO: 20.
54. The monoclonal antibody of claim 51, comprising heavy chain variable region comprising SEQ ID NO: 21 and light chain variable region comprising SEQ ID NO: 22.
PCT/US2021/041955 2020-07-17 2021-07-16 Monoclonal antibodies against sars-cov-2 nucleocapsid phosphoprotein and sandwich elisa method Ceased WO2022016048A2 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
CA3186215A CA3186215A1 (en) 2020-07-17 2021-07-16 Monoclonal antibodies against sars-cov-2 nucleocapsid phosphoprotein and sandwich elisa method
US18/005,581 US20240003880A1 (en) 2020-07-17 2021-07-16 Monoclonal antibodies against sars-cov-2 nucleocapsid phosphoprotein and sandwich elisa method

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202063053112P 2020-07-17 2020-07-17
US63/053,112 2020-07-17
US202063058751P 2020-07-30 2020-07-30
US63/058,751 2020-07-30

Publications (2)

Publication Number Publication Date
WO2022016048A2 true WO2022016048A2 (en) 2022-01-20
WO2022016048A3 WO2022016048A3 (en) 2022-02-24

Family

ID=79554355

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/041955 Ceased WO2022016048A2 (en) 2020-07-17 2021-07-16 Monoclonal antibodies against sars-cov-2 nucleocapsid phosphoprotein and sandwich elisa method

Country Status (3)

Country Link
US (1) US20240003880A1 (en)
CA (1) CA3186215A1 (en)
WO (1) WO2022016048A2 (en)

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
NZ543467A (en) * 2003-04-10 2008-07-31 Novartis Vaccines & Diagnostic The severe acute respiratory syndrome coronavirus
WO2015109212A1 (en) * 2014-01-17 2015-07-23 Pfizer Inc. Anti-il-2 antibodies and compositions and uses thereof
WO2020078568A1 (en) * 2018-10-19 2020-04-23 Humabs Biomed Sa Antibodies and methods for treatment of lyssavirus infection
EP4133114A4 (en) * 2020-04-06 2024-06-19 The Trustees of Columbia University in the City of New York PEPTIDES FOR DETECTION AND DIFFERENTIATION OF ANTIBODY REACTIONS TO SARS-COV-2 AND OTHER HUMAN CORONAVIRUS
IN202041016724A (en) * 2020-04-18 2020-06-05

Also Published As

Publication number Publication date
CA3186215A1 (en) 2022-01-20
WO2022016048A3 (en) 2022-02-24
US20240003880A1 (en) 2024-01-04

Similar Documents

Publication Publication Date Title
Huang et al. Detection of severe acute respiratory syndrome (SARS) coronavirus nucleocapsid protein in human serum using a localized surface plasmon coupled fluorescence fiber-optic biosensor
CN105891491A (en) Kit and application thereof
CN113791212A (en) Novel magnetic bead fluorescence detection kit for coronavirus neutralizing antibody and detection method thereof
WO2022265065A1 (en) Sars-cov-2 immunoassay method and immunoassay kit, and monoclonal antibody or antibody fragment thereof
Schuster et al. Coupling immuno-magnetic capture with LC–MS/MS (MRM) as a sensitive, reliable, and specific assay for SARS-CoV-2 identification from clinical samples
WO2011098484A1 (en) Trichodysplasia spinulosa- associated polyomavirus (tsv)
Aita et al. Salivary proteomic analysis in asymptomatic and symptomatic SARS-CoV-2 infection: Innate immunity, taste perception and FABP5 proteins make the difference
Ma et al. Development of an indirect ELISA using a novel linear epitope at the C-terminal region of the VP2 protein to specifically detect antibodies against Senecavirus A
CA2753873A1 (en) Method for detecting substance in biological sample
JP5033127B2 (en) Methods and compositions for detecting herpes simplex virus type 2
US20240103002A1 (en) Orthopoxvirus serology assays
EP4059959A1 (en) Antibody recognizing anti-rs virus, and immunoassay method and immunoassay instrument using same
KR102793620B1 (en) Monoclonal antibody for nucleocapsid protein of SARS-CoV-2 and uses thereof
Zhang et al. Development of a new immunochromatographic strip mediated by colloidal Gold-MAb nanoparticles for rapid detection of subgroup K Avian leukemia virus
TWI867090B (en) Antibodies for identifying N protein of RS virus, and immunoassay method and immunoassay device using the antibodies
Wang et al. A novel luciferase immunosorbent assay performs better than a commercial enzyme-linked immunosorbent assay to detect MERS-CoV specific IgG in humans and animals
US20240003880A1 (en) Monoclonal antibodies against sars-cov-2 nucleocapsid phosphoprotein and sandwich elisa method
CN106153935A (en) A kind of enzyme linked immunological kit of detection by quantitative CD79 α
EP3919503A1 (en) Method for identifying helicobacter pylori strain and kit for identification
CN102221619A (en) ELISA (Enzyme-Linked Immuno Sorbent Assay) detection method and kit of cryptosporidium virus capsid protein antibody
KR101032956B1 (en) Rapid Diagnostic Kit for Detection of Renal Syndrome Hemorrhagic Fever-specific IgM and IgG Using Nucleocapsid Protein Derived from a Hearing Virus
Karki et al. Optimization of lateral flow assay for canine morbillivirus detection and the application of the strip as sample substitute
JP5093087B2 (en) Method for enhancing immune response with polyethylene glycol and urea
Yadav et al. Optimization of competitive lateral flow assay for detection of canine distemper virus antibody
Yoshii et al. Establishment of enterotype-specific antibodies for various diagnostic systems

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21843045

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 3186215

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 21843045

Country of ref document: EP

Kind code of ref document: A2