WO2022015699A1 - Methods to produce very long chain fatty acids - Google Patents
Methods to produce very long chain fatty acids Download PDFInfo
- Publication number
- WO2022015699A1 WO2022015699A1 PCT/US2021/041381 US2021041381W WO2022015699A1 WO 2022015699 A1 WO2022015699 A1 WO 2022015699A1 US 2021041381 W US2021041381 W US 2021041381W WO 2022015699 A1 WO2022015699 A1 WO 2022015699A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- nucleic acid
- acid sequence
- vlcfa
- seq
- insect
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P7/00—Preparation of oxygen-containing organic compounds
- C12P7/64—Fats; Fatty oils; Ester-type waxes; Higher fatty acids, i.e. having at least seven carbon atoms in an unbroken chain bound to a carboxyl group; Oxidised oils or fats
- C12P7/6409—Fatty acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/56—Materials from animals other than mammals
- A61K35/63—Arthropods
- A61K35/64—Insects, e.g. bees, wasps or fleas
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1025—Acyltransferases (2.3)
- C12N9/1029—Acyltransferases (2.3) transferring groups other than amino-acyl groups (2.3.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y203/00—Acyltransferases (2.3)
- C12Y203/01—Acyltransferases (2.3) transferring groups other than amino-acyl groups (2.3.1)
- C12Y203/01199—Very-long-chain 3-oxoacyl-CoA synthase (2.3.1.199)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
- C07K2319/43—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a FLAG-tag
Definitions
- This disclosure relates to methods of producing very long chain fatty acids, particularly production in insects, such as cabbage looper larvae.
- VLCFAs Very-long-chain fatty acids
- VLCSFAs VLC-saturated FAs
- VLCPUFAs VLC -polyunsaturated FAs
- VLCPUFAs are structurally unique in that the carboxylic-group end is composed of 12-20 saturated carbon bonds, whereas the methyl-group end contains four or more cis double bonds, and they are known to be converted into potent signaling molecules that may be important for in retinal and neural function (Do et al., Proc. Natl. Acad. Sci. USA 116:24317- 24325, 2019).
- VLCFAs are endogenously synthesized by sequential two-carbon extension of fatty acids C22-26 by VLCFA elongases, such as ELOVL fatty acid elongase 2 (ELOVL2) and ELVOL4.
- VLCFA elongases such as ELOVL fatty acid elongase 2 (ELOVL2) and ELVOL4.
- VLCPUFA Stargardt disease type 3
- STGD3 Stargardt disease type 3
- the human retina is particularly enriched in VLCPUFAs, which are critical for normal retinal structure and function (Agbaga et al, J. Lipid Res. 51:1624-1642, 2010).
- n-6 and n-3 series of VLCFA are found in phosphatidylcholines (PCs) at the sn-l position, with n-6 series VLCPUFA being predominant (Poulos et al., Biochem. J. 253:645-650, 1988).
- PCs phosphatidylcholines
- Recessive mutations in the ELOVL4 gene are associated with seizures, intellectual disability, and spastic quadriplegia, revealing the importance of VLCPUFA in brain development and physiology (Aldahmesh et al., Am. J. Hum. Genet. 89:745-750, 2011).
- n-6 and n-3 VLCPUFA with chain-lengths of C26-C32 and 4-6 double bonds are present uniquely in sphingolipids including ceramides, sphingomyelins, and fucosylated glycosphingolipids (Sandhoff et al., J. Biol. Chem. 280:27310-27318, 2005; Furland et al, J. Biol. Chem. 282:18141-18150, 2007; Rabionet et al., J. Biol. Chem. 283:13357-13369, 2008).
- VLCPUFAs The level of VLCPUFA in these sphingolipids increases with the onset of spermatogenesis, and VLCPUFAs account for up to 15% and 40% of rat testicular ceramides and sphingomyelins, respectively (Furland et al., J. Biol. Chem. 282:18141-18150, 2007).
- loss of functional ELOVL4 displayed scaly, wrinkled skin, severely compromised epidermal permeability barrier function, and led to neonatal death, concomitant with a global decrease in VLCSFAs, suggesting the crucial role of VLCFAs in skin barrier function (Vasireddy et al., Hum. Mol. Genet. 16:471-482, 2007).
- VLCFA or other forms of VLCFA delivery could be a potential therapy for patients with disorders associated with decreased VLCFA levels or VLCFA elongase activity, but has not been tested because of the lack of availability of a VLCFA supplement.
- VLCFA supplementation there is a need for developing methods of producing VLCFAs, for example, in quantities sufficient for dietary supplementation.
- VLCPUFAs and/or VLCSFAs methods of producing one or more very long chain fatty acids (e.g., VLCPUFAs and/or VLCSFAs) including expressing one or more heterologous VLCFA elongases in an insect or insect cell (e.g., Trichoplusia ni larvae or Trichoplusia ni insect cells).
- the methods include expressing the one or more heterologous VLCFA elongases in the insect or insect cell by infecting the insect or insect cell with one or more baculoviruses including a nucleic acid encoding the one or more heterologous VLCFA elongases.
- the VLCFA elongase is ELOVL fatty acid elongase 2 (ELOVL2), ELOVL fatty acid elongase 4 (ELOVL4), ELOVL fatty acid elongase 5 (ELOVL5), ELOVL fatty acid elongase 3 (ELOVL3), or any combination of two or more thereof.
- the nucleic acid encoding the one or more VLCFA elongases in some examples, is codon-optimized for expression in insect cells.
- the nucleic acid encoding the one or more VLCFA elongases may further include a nucleic acid encoding a signal peptide (such as a bombyxin signal peptide), a tag (such as a FLAG tag), or a combination thereof.
- a signal peptide such as a bombyxin signal peptide
- a tag such as a FLAG tag
- the methods include expressing an ELOVL2 protein including an amino acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%, 97%, 98%, 99%, or 100% identity) to the amino acid sequence of SEQ ID NO: 1.
- the ELOV2 protein is encoded by a nucleic acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%, 97%, 98%, 99%, or 100% identity) to the nucleic acid sequence of SEQ ID NO: 2.
- the methods include expressing an ELOVL4 protein including an amino acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%, 97%, 98%, 99%, or 100% identity) to the amino acid sequence of SEQ ID NO: 3.
- the ELOV4 protein is encoded by a nucleic acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%, 97%, 98%, 99%, or 100% identity) to the nucleic acid sequence of SEQ ID NO:4.
- the methods also include inactivating the baculovirus following expression of the one or more VLCFA elongases in the insect or insect cell.
- inactivating the baculovirus includes treating the insect or insect cell with one or more of radiation, heat, and chemical agents.
- the methods also include purifying the one or more VLCFAs from the insect or insect cell and/or preparing bulk biomass (e.g., powdered insect biomass) from the insect or insect cell.
- compositions including one or more VLCFAs prepared by the methods disclosed herein.
- the composition includes biomass from insects expressing one or more heterologous VLCFA elongases, such as one or more of ELVOL2, ELOVL4, ELVOL5, and ELOVL3.
- the composition may be formulated as a food material (such as flour or meal prepared from the insects) or a food supplement.
- an effective amount of the composition is administered to a subject in need thereof, such as a subject with age-related macular degeneration or Stargardt disease type 3 (STGD3).
- STGD3 Stargardt disease type 3
- baculovirus vectors including one or more nucleic acids encoding a very long chain fatty acid (VLCFA) elongase.
- VLCFA elongase is ELOVL fatty acid elongase 2 (ELOVL2), ELOVL fatty acid elongase 4 (ELOVL4), ELOVL fatty acid elongase 5 (ELOVL5), and ELOVL fatty acid elongase 3 (ELOVL3), or any combination of two or more thereof.
- the nucleic acid encoding the one or more VLCFA elongases in some examples, is codon- optimized for expression in insect cells.
- the vector encoding the one or more VLCFA elongases may further include a nucleic acid encoding a signal peptide (such as a bombyxin signal peptide), a tag (such as a FLAG tag), or a combination thereof.
- a signal peptide such as a bombyxin signal peptide
- a tag such as a FLAG tag
- the vector includes a nucleic acid encoding an ELOVL2 protein including an amino acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%,
- the ELOV2 protein is encoded by a nucleic acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%, 97%, 98%, 99%, or 100% identity) to the nucleic acid sequence of SEQ ID NO: 2.
- the vector includes a nucleic acid encoding an ELOVL4 protein including an amino acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%,
- the ELOV4 protein is encoded by a nucleic acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%, 97%, 98%, 99%, or 100% identity) to the nucleic acid sequence of SEQ ID NO:4.
- FIG. 1 is a schematic diagram of synthesis of VLCPUFA.
- FIG. 2 is a schematic diagram of an exemplary construct for ELOVL2 or ELOVL4 baculovirus expression.
- pBacPAK8 - baculovirus vector pPH - polyhedrin promoter
- Bss - Bombyx mori signal peptide FLAG - FLAG tag.
- FIG. 3 is an image of Western blot analysis of recombinant ELOVL2 and ELOVL4 produced in Trichoplusia ni larvae.
- nucleic acid and amino acid sequences listed herein or in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases and amino acids, as defined in 37 C.F.R. ⁇ 1.822. In at least some cases, only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand.
- SEQ ID NO: 1 is the amino acid sequence of an exemplary ELOVL2 protein:
- SEQ ID NO: 2 is a codon-optimized nucleic acid sequence encoding the ELOVL2 protein of SEQ ID NO: 1:
- TCATGAACAAGAAGGCTCAGTAA SEQ ID NO: 3 is the amino acid sequence of an exemplary ELOVL4 protein:
- SEQ ID NO: 4 is a codon-optimized nucleic acid sequence encoding the ELOVL4 protein of SEQ ID NO: 3:
- SEQ ID NO: 5 is the amino acid sequence of a bombyxin signal peptide from Bombyx mori.
- SEQ ID NO: 6 is the amino acid sequence of a FLAG tag.
- ELOVL fatty acid elongase 2 An enzyme in the long-chain fatty acids elongation cycle.
- ELOVL2 is a transmembrane protein that catalyzes addition of two carbons to long and very long chain fatty acids per cycle.
- ELOVL2 sequences are publicly available.
- GenBank Accession Nos. NP_060240, EAW55290, BAA91096, XP_011513019, AAH60809, XP_011513018, and XP_016866474 disclose human ELOVL2 protein sequences.
- GenBank Accession Nos. NM_017770, AK000341, XM_011514717, BC060809, XM_011514716, and XM_017010985 disclose ELOVL2 human nucleic acid sequences.
- ELOVL fatty acid elongase 4 An enzyme in the long-chain fatty acids elongation cycle.
- ELOVL4 is a membrane bound protein involved in synthesis of very-long-chain saturated and polyunsaturated fatty acids with chain length of 28 carbons or more.
- ELOVL4 sequences are publicly available. For example, GenBank Accession No. NP_073563 discloses a human ELOVL4 protein sequence and GenBank Accession No. NM_022726 discloses a human ELOVL4 nucleic acid sequence.
- “Expression” refers to transcription and/or translation of a nucleic acid sequence.
- a nucleic acid molecule can be expressed when its DNA is transcribed into an RNA or RNA fragment, which in some examples is processed to become mRNA.
- a nucleic acid molecule may also be expressed when its mRNA is translated into an amino acid sequence, such as a protein or a protein fragment.
- Regulation of expression can include controls on transcription, translation, RNA transport and processing, degradation of intermediary molecules such as mRNA, or through activation, inactivation, compartmentalization or degradation of specific protein molecules after they are produced.
- Heterologous Originating from a different genetic source or species.
- a nucleic acid that is heterologous to a cell originates from an organism or species other than the cell in which it is expressed.
- a heterologous nucleic acid includes a human nucleic acid or a codon-optimized nucleic acid that is present or expressed in an insect cell (such as an Sf9 cell, High FiveTM cell, or Trichoplusia ni, such as in a T. ni larvae).
- an insect cell such as an Sf9 cell, High FiveTM cell, or Trichoplusia ni, such as in a T. ni larvae.
- Isolated An “isolated” or “purified” biological component (such as a nucleic acid, peptide, protein, protein complex, or lipid) has been substantially separated, produced apart from, or purified away from other biological components e.g., other chromosomal and extrachromosomal DNA and RNA, proteins, or cells. Nucleic acids, peptides, proteins, or lipids (e.g. , VLCFAs) that have been “isolated” or “purified” thus include purification by standard purification methods.
- the term “isolated” or “purified” does not require absolute purity; rather, it is intended as a relative term.
- an isolated biological component is one in which the biological component is more enriched than the biological component is in its starting form.
- a preparation is purified such that the biological component represents at least 20%, such as at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or greater, of the total content of the preparation.
- VLCFA Very-long-chain fatty acids
- the VFCFA may be saturated (VFCSFA) or polyunsaturated (VFCPUFA).
- VFCSFA saturated
- VFCPUFA polyunsaturated
- FIG. 1 See also Sassa et al. ( Biomol . Ther. 22:83-29, 2014).
- VLCFAs in an insect or an insect cell, for example by expressing one or more enzymes involved in synthesis of VLCFAs.
- the VLCFAs have a carbon chain length of about 24-40 carbons, such as about 24, 26, 28, 30, 32, 34, 36, 38, or 40 carbons.
- the VLCFAs may be saturated or polyunsaturated.
- the methods include expressing one or more (such as 1, 2, 3, or 4) heterologous VLCFA elongases (e.g., one of more of ELOVL2, ELOVL3, ELOVL4, and ELOVL5) in an insect or insect cell.
- expressing the one or more heterologous VLCFA elongases includes infecting an insect or insect cell with one or more baculoviruses comprising a nucleic acid encoding the one or more heterologous VLCFA elongases.
- the methods include infecting an insect (such as an insect larvae) with one or more baculoviruses including a heterologous nucleic acid encoding one or more of ELOVL2, ELOVL3, ELOVL4, and ELOVL5.
- the VLCFA elongase does not include an N-terminal methionine; however, an N-terminal methionine can be present, for example as a result of expression in a bacterial or insect system, or the N-terminal methionine may subsequently be removed.
- the methods include infecting an insect or insect cells with a baculovirus including a heterologous nucleic acid encoding an ELOVL2 protein, such as an ELOVL2 protein having an activity of catalyzing addition of two carbons to fatty acids having a length of 18-22 carbons.
- the ELOVL2 protein has an amino acid sequence with at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to SEQ ID NO: 1.
- the ELOVL2 protein includes or consists of the amino acid sequence of SEQ ID NO: 1.
- the ELOVL2 protein has an amino acid sequence with at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or including or consisting of the amino acid sequence of any one of GenBank Accession Nos. NP_060240, EAW55290, BAA91096, XP_011513019, AAH60809, XP_011513018, and XP_016866474.
- One of ordinary skill in the art can identify additional ELOVL2 protein sequences, for example, from publicly available databases.
- the methods include infecting an insect or insect cells with a baculovirus including a heterologous nucleic acid encoding an ELOVL4 protein, such as an ELOVL4 protein having an activity of catalyzing addition of two carbons to fatty acids having a length of 26-36 carbons.
- the ELOVL4 protein has an amino acid sequence with at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to SEQ ID NO: 3.
- the ELOVL4 protein includes or consists of the amino acid sequence of SEQ ID NO: 3.
- the ELOVL4 protein has an amino acid sequence with at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or including or consisting of the amino acid sequence of GenBank Accession No. NP_073563.
- sequence identity for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity
- One of ordinary skill in the art can identify additional ELOVL4 protein sequences, for example, from publicly available databases.
- the methods include infecting an insect or insect cells with a baculovirus including a heterologous nucleic acid encoding an ELOVL5 protein, such as an ELOVL5 protein having an activity of catalyzing addition of two carbons to fatty acids having a length of 18-20 carbons.
- the ELOVL5 protein has an amino acid sequence with at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or including or consisting of the amino acid sequence of any one of GenBank Accession Nos.
- NP_001229759, NP_001229757, NP_068586, NP_001288785, or NP_001229760 One of ordinary skill in the art can identify additional ELOVL5 protein sequences, for example, from publicly available databases.
- the methods include infecting an insect or insect cells with a baculovirus including a heterologous nucleic acid encoding an ELOVL3 protein, such as an ELOVL3 protein having an activity of catalyzing addition of two carbons to fatty acids having a length of 18-24 carbons.
- the ELOVL3 protein has an amino acid sequence with at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or including or consisting of the amino acid sequence of any one of GenBank Accession Nos. NP_689523 or XP_011538547.
- One of ordinary skill in the art can identify additional ELOVL3 protein sequences, for example, from publicly available databases.
- the nucleic acid encoding an ELOVL2 protein has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to SEQ ID NO: 2.
- the ELOVL2 encoding nucleic acid includes or consists of the nucleic acid sequence of SEQ ID NO: 2.
- the ELOVL2 nucleic acid sequence has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of any one of GenBank Accession Nos. NM_017770, AK000341,
- XM_011514717, BC060809, XM_011514716, and XM_017010985 One of ordinary skill in the art can identify additional ELOVL2 encoding nucleic acid sequences, for example, from publicly available databases.
- the nucleic acid encoding an ELOVL4 protein has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to SEQ ID NO: 4.
- the ELOVL4 encoding nucleic acid includes or consists of the nucleic acid sequence of SEQ ID NO: 4.
- the ELOVL4 nucleic acid sequence has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of GenBank Accession No. NM_022726.
- One of ordinary skill in the art can identify additional ELOVL4 encoding nucleic acid sequences, for example, from publicly available databases.
- the nucleic acid encoding an ELOVL5 protein has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of any one of GenBank Accession Nos. NM_001242830, NM_001242828, NM_021814, NM_001301856, and NM_0012428311.
- One of ordinary skill in the art can identify additional ELOVL5 encoding nucleic acid sequences, for example, from publicly available databases.
- the nucleic acid encoding an ELOVL3 protein has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of any one of GenBank Accession Nos. XM_011540245 and NM_152310.
- sequence identity for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity
- the nucleic acid encoding the VLCFA elongase (such as any one of ELOVL2, ELOVL4, ELOVL5, or ELOVL3) is codon-optimized for the cell in which it is to be expressed (such as an insect cell).
- Codon usage bias the use of synonymous codons at unequal frequencies, is ubiquitous among genetic systems (Ikemura, J. Mol. Biol. 146:1-21, 1981; Ikemura, J. Mol. Biol. 158:573-97, 1982).
- the strength and direction of codon usage bias is typically related to genomic G + C content and the relative abundance of different isoaccepting tRNAs (Akashi, Curr. Opin. Genet. Dev.
- Codon usage can affect the efficiency of gene expression.
- Codon-optimization refers to replacement of at least one codon (such as at least 5 codons, at least 10 codons, at least 25 codons, at least 50 codons, at least 75 codons, at least 100 codons or more) in a nucleic acid sequence with a synonymous codon (one that codes for the same amino acid) more frequently used (preferred) in the organism.
- Each organism has a particular codon usage bias for each amino acid, which can be determined from publicly available codon usage tables (for example see Nakamura et al., Nucleic Acids Res. 28:292, 2000 and references cited therein), databases (e.g., kazusa.or.jp/codon), or commercial sources.
- codon usage tables for example see Nakamura et al., Nucleic Acids Res. 28:292, 2000 and references cited therein), databases (e.g., kazusa.or.jp/codon), or commercial sources.
- One of skill in the art can modify a nucleic acid encoding a particular amino acid sequence, such that it encodes the same amino acid sequence, while being optimized for expression in a particular cell type or organism.
- the ELOVL sequence is codon-optimized for expression in T. ni.
- a codon-optimized ELOVL sequence is generated using software.
- the nucleic acid encoding the ELOVL may also include a signal sequence (such as a bombyxin signal peptide from Bombyx mori, for example, SEQ ID NO: 5) to facilitate transmembrane insertion of the VLCLA elongase.
- a signal sequence such as a bombyxin signal peptide from Bombyx mori, for example, SEQ ID NO: 5
- the nucleic acid further includes tags for identification or purification of protein (such as a LLAG tag (e.g., SEQ ID NO: 6), Myc tag, or His tag).
- the disclosed methods can be used to express one or more VLCFA elongases (such as one or more of ELOVL2, ELOVL4, ELOVL5, and ELOVL3) in insects or insect cells.
- the methods include expressing the one or more VLCFA elongases in Trichoplusia ni (cabbage looper) cells or organisms.
- the methods utilize T. ni larvae.
- the methods may utilize black soldier fly cells or organisms or Tenebrio molitor (mealworm) cells or organisms (such as mealworm larvae).
- the methods include expressing the one or more VLCFA elongases in silkworm ( Bombyx mori) cells or organisms.
- the methods include expressing two or more VLCFA elongases in an insect or insect cell. In some examples, the methods include infecting an insect with two or more baculoviruses, wherein each baculovirus includes a nucleic acid encoding a different VLCFA elongase. In other examples, the methods include infecting an insect with a baculovirus including two or more VLCFA encoding nucleic acids.
- the methods include infecting an insect with a baculovirus including a nucleic acid encoding an ELOVL2 protein and a baculovirus including a nucleic acid encoding an ELOVL4 protein or a baculovirus including a nucleic acid encoding an ELOVL2 protein and a nucleic acid encoding an ELOVL4 protein.
- the methods include infecting an insect with one or more baculovirus including any combination of two or more of ELOVL2, ELOVL4, ELOVL5, and ELOVL3 encoding nucleic acids at varying ratios.
- the amount of each baculovirus used to infect the insect or insect cells can be varied to optimize VLCFA production.
- two baculoviruses are utilized and the ratio of the baculoviruses is 1:4,
- the two VLCFA elongases are ELOVL2 and ELOVL4 and the amount of the baculoviruses used are 1:3 (ELOVL2:ELOVL4), 1:1 (ELOVL2:ELOVL4), or 3:1 (ELOVL2:ELOVL4). If three or more ELOVL proteins are expressed, appropriate ratios can be determined, for example, using the methods provided in Example 2.
- the methods include infecting an insect or insect cells with one or more baculoviruses including a nucleic acid encoding a VLCFA elongase.
- the baculo virus is an Auto grapha calif ornica multiple nucleopolyhedro virus (AcMNPV) virus.
- the baculovirus is a Bombyx mori nucleopolyhedrovirus (BmNPV) vims.
- the polyhedrin protein is required for propagation of baculoviruses in nature; however, in cell culture, polyhedrin is not required, and its coding sequence can be replaced with a sequence for a target protein (such as one or more VLCFA elongase).
- Baculovirus expression vectors are constructed in two steps. First, a target gene is cloned into a modified polyhedrin locus in a transfer vector. The polyhedrin coding sequence is deleted and the target gene is cloned between the polyhedrin promoter and polyadenylation signals. Transfer vectors may also include an origin of replication and an antibiotic resistance gene for propagation in E. coli.
- the transfer vector and a viral expression vector are co-transfected into insect cells (such as Sf9 or High FiveTM cells). Double recombination between viral sequences in the transfer vector and the corresponding sequences in the viral DNA transfers the target gene to the viral genome.
- the baculovirus can then be recovered and used in the methods described herein.
- Exemplary baculovirus transfer vectors include BacPAK (e.g., pBacPAK6, pBacPAK8 (e.g., FIG. 2), pBacPAK9, BmBacPAK6).
- BacPAK e.g., pBacPAK6, pBacPAK8 (e.g., FIG. 2), pBacPAK9, BmBacPAK6.
- One or more baculoviruses including a nucleic acid encoding at least one VLCFA elongase is used to infect an insect or insect cells.
- the insect such as T. ni larva
- the baculovirus is placed or coated on top of the T. ni food.
- homogenate of infected T. ni larvae containing the baculovirus(es) is placed on top of the food or sprayed on the food.
- the homogenate can be incorporated into the food.
- the homogenate of infected larvae is prepared in water at a ratio of 1:2000 (w/v).
- ratios can be selected by one of ordinary skill in the art, depending on the strength or amount of baculovirus in the infected larvae utilized for the preparation.
- the insect such as T. ni larva
- the insect is infected by injection of the baculovirus.
- about 10 5 -10 7 pfu/ml e.g., lxlO 5 , 5xl0 5 , lxlO 6 , 5xl0 6 , or lxlO 7 pfu/ml
- 10 5 -10 7 pfu/ml e.g., lxlO 5 , 5xl0 5 , lxlO 6 , 5xl0 6 , or lxlO 7 pfu/ml
- the insects are incubated under conditions sufficient for the VLCFA elongase to be expressed and for production of VLCFAs.
- the insects are incubated at about 24-29°C (e.g. about 24-26°C, about 25-27°C, about 26-28°C, or about 27- 29°C) for about 48-84 hours post-infection (such as about 48-72 hours, about 60-84 hours, for example, about 48 hours, about 54 hours, about 60 hours, about 66 hours, about 70 hours, about 72 hours, about 78 hours, about 80 hours, or about 84 hours).
- the incubation is initially at a first temperature (e.g., to encourage feeding, and thus uptake of the vims) and then at a second (lower) temperate to facilitate expression and harvesting.
- the incubation temperature affects the larval development, thus, one of ordinary skill in the art can select an appropriate combination of time and temperature(s) for baculovirus expression and larval viability.
- the methods further include inactivating baculovirus in the insects or cells, or bulk biomass from the insects or cells following expression of the one or more VLCFA elongases.
- Methods of inactivating baculoviruses include gamma irradiation, ultraviolet irradiation, heat, freeze-thaw cycles, or chemical inactivation (e.g. , detergent or binary ethylenimine).
- the disclosed methods further include recovering biomass from an organism or cells in which the one or more VLCFA elongases have been expressed.
- One method of recovering biomass includes freeze-drying insects (e.g., T. ni larvae) expressing one or more VLCFA elongases and grinding the lyophilized insects to form a powder.
- larval tissue homogenate is prepared in water-based buffer or oil or frozen larvae are ground with dry ice to form a paste.
- the powdered biomass is formulated in an edible form, such as a flour or meal.
- the powdered biomass is formulated as a food supplement, for examples, as a pill or capsule form.
- the methods further include purifying or partially purifying VLCFAs from the insects or insect cells.
- purification of VLCFAs can include ion exchange, chromatography, extraction, solvent extraction, membrane separation, electrodialysis, reverse osmosis, distillation, chemical derivatization, and/or crystallization
- compositions including one or more VLCFAs such as insects, insect cells, or biomass including one or more heterologous VLCFAs, for example, produced by the disclosed methods.
- the VLCFAs are contained in biomass of an organism or cells in which the one or more VLCFA elongases have been expressed.
- the one or more VLCFAs are purified or partially purified from the insect or insect cell in which they are produced.
- the composition includes frozen or freeze-dried biomass from the insect or insect cells expressing the one or more VLCFA elongases, for example, a powder form.
- the biomass can be formulated as a food product (e.g. , a meal or flour) or as a food supplement.
- the powdered biomass is included in a pill or capsule form, for example, encapsulated in oil (such as soy oil, grapeseed oil, coconut oil, canola oil) or in a cellulose-based matrix.
- the composition further includes additional components, such as stabilizers, preservatives, buffers, or other excipients.
- purified or partially purified VLCFAs can be formulated for injection, included in a patch (e.g., for transdermal administration), formulated for aerosolization and administration through the nose or mouth, incorporated in a cream, spray, or wash for topical administration, incorporated in a chewing gum, or added to a dissolvable film for oral administration.
- a patch e.g., for transdermal administration
- aerosolization and administration through the nose or mouth incorporated in a cream, spray, or wash for topical administration, incorporated in a chewing gum, or added to a dissolvable film for oral administration.
- compositions e.g., purified or partially purified VLCFAs or bulk biomass
- VLCFAs can be used as feed source for other organisms such as other insects, fish, poultry or animals to increase the quantity of VLCFAs in the organism.
- the organism would be subsequently harvested and used as a food source.
- compositions including one or more VLCFAs produced herein may be administered to a subject in need thereof.
- the subject has a disorder with decreased expression of one or more VLCFA elongases (e.g. , ELOVL2 or ELOVL4).
- VLCFA elongases e.g. , ELOVL2 or ELOVL4
- exemplary disorders include retinal degenerative disorders, such as age-related macular degeneration, Stargardt disease type 3 (STGD3), or other age-related retinal disease.
- the disorder is a neuro- icthyotic disorder with features of ichthyosis, seizures, developmental delay, and spasticity (Aldahmesh et al., Am. J. Hum. Genet. 89:745-750, 2011).
- the subject is a subject over 50 years, over 55 years, over 60 years, over 65 years, over 70 years, over 75 years, or older.
- the methods include administering an effective amount of the composition to the subject (e.g., an amount sufficient to reduce or inhibit one or more symptoms in the subject).
- baculovirus vectors and baculoviruses including a heterologous nucleic acid encoding a VLCFA elongase.
- the nucleic acid is included in a baculovirus transfer vector.
- the nucleic acid is included in a baculovirus (such as an AcMNPV baculovirus).
- the includes one or more nucleic acids encoding ELOVL2,
- the nucleic acid encoding the VLCFA elongase may be codon-optimized, for example for expression in insect cells.
- vector includes a nucleic acid encoding an ELOVL2 protein having at least 95% sequence identity with (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) or including or consisting of SEQ ID NO: 1.
- the ELOVL2 encoding nucleic acid has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to SEQ ID NO: 2 or includes or consists of the nucleic acid sequence of SEQ ID NO: 2.
- the ELOVL2 nucleic acid sequence has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of any one of GenBank Accession Nos. NM_017770, AK000341, XM_011514717, BC060809, XM_011514716, and XM_017010985.
- the vector includes a nucleic acid encoding an ELOVL4 protein having at least 95% sequence identity with (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) or including or consisting of SEQ ID NO: 3.
- the ELOVL4 encoding nucleic acid has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to SEQ ID NO: 4 or includes or consists of the nucleic acid sequence of SEQ ID NO: 4.
- the ELOVL4 nucleic acid sequence has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of GenBank Accession No. NM_022726.
- the vector includes a nucleic acid encoding an ELOVL5 protein wherein the nucleic acid has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of any one of GenBank Accession Nos. NM_001242830, NM_001242828, NM_021814, NM_001301856, and NM 0012428311.
- the vector includes a nucleic acid encoding an ELOVL3 protein wherein the nucleic acid has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of any one of GenBank Accession Nos. XM_011540245 and NM_152310.
- the vector may further include additional nucleic acids, for example, nucleic acids for expression of the VLCFA elongase and/or nucleic acids to facilitate incorporation of the VLCFA elongase nucleic acid into a baculovirus.
- the vector includes a promoter for expression of the VLCFA elongase, which in some examples is a polyhedrin promoter.
- the vector may also include a signal sequence (such as a bombyxin signal peptide from Bombyx mori, for example, SEQ ID NO: 5) to facilitate transmembrane insertion of the VLCFA elongase.
- the vector further includes additional elements, including cloning sites, tags for identification or purification of protein (such as a FLAG tag (e.g., SEQ ID NO: 6), Myc tag, or His tag), or transcriptional regulatory elements (such as translation start sites or polyadenylation sites).
- tags for identification or purification of protein such as a FLAG tag (e.g., SEQ ID NO: 6), Myc tag, or His tag
- transcriptional regulatory elements such as translation start sites or polyadenylation sites.
- the vector may also include elements for propagation in a bacteria (such as E. coli), for example, an origin of replication and/or an antibiotic resistance genes.
- constructs including the gene of interest, insect signal peptide, and tag were designed. Synthetic genes were codon optimized for expression in T. ni. To optimize expression, Bombyxin signal peptide (Bsp) from the insect Bombyx mori (MKIFFAIAFMFSTVMWVST; SEQ ID NO: 5) was added. To monitor expression of recombinant proteins in larval tissue by Western blot a FEAG tag (DYKDDDDK; SEQ ID NO: 6), cleavable by enterokinase was also added.
- Bsp Bombyxin signal peptide
- MKIFFAIAFMFSTVMWVST insect Bombyx mori
- N-terminal tag location was chosen based on the importance of intact C-terminal Di-lysine motif present in sequences of both elongases, which may confer endoplasmic reticulum (ER) localization.
- Resulting synthetic DNA was inserted in pBacPAK plasmid using BamHI and Notl sites (FIG. 2).
- Synthetic DNA including the coding region and signal sequence was produced and cloned into the pBacPAK plasmid by GeneWiz (South Plainfield, NJ).
- Baculovirus construction was carried out. Budded forms of the recombinant baculovirus with an insert of the ELOVL2 or ELOVL4 sequence under transcriptional control of the polyhedrin promoter were produced by standard homologous recombination procedure in Sf9 cell culture.
- AcMNPV Linearized baculovirus Autographa califomica multiple nucleopolyhedrovirus
- GLP Aequorea victoria green- fluorescent protein
- PD I protein disulfide isomerase
- helpers inserted in baculovirus DNA was based on the fact that both target proteins are located in ER and the presence of oligomeric forms of ELOVL4. Linal titer of produced recombinant viruses was ⁇ 10 6 - 10 7 pfu/mL.
- Recombinant baculovirus produced as described in Example 1 was injected into Trichoplusia ni larvae. The following lots of biomass were created:
- Infected larvae were incubated in a controlled manner in a Percival Scientific Incubator model # I36NLC8. Larvae were harvested and flash frozen at the appropriate time. These larvae were used for interim testing and can be a seed for future oral inoculation.
- Infected larvae from each batch were further processed for freeze drying and ground into a power form for further analysis by GC and GC/MS instruments. Lreeze drying is optional and was used to facilitate testing
- Seed larvae produced from one or more lots are used to orally infect T. ni larvae.
- Larvae are obtained from a supplier at the point where they are just entering their 5 th instar.
- Larvae previously infected by injection are removed from a -80°C freezer and ground in deionized water at a ratio of 1:2000 (w:v).
- These infected larvae contain pre occluded baculovirus, which is orally infectious.
- Sugar is added to the ground mixture.
- the mixture is then in placed in a container of larvae on top of the larvae food. Containers are then placed into incubator.
- the temperature and humidity is controlled in order to yield optimal results at the desired endpoint. Typically incubation temperature is controlled for a harvest at 80 hours.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Microbiology (AREA)
- Insects & Arthropods (AREA)
- General Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Biotechnology (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Animal Husbandry (AREA)
- Epidemiology (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Methods of producing very long chain fatty acids (VLCFA) including expressing one or more VLCFA elongases in an insect or insect cell are provided. In some examples, the methods include infecting an insect with a baculovirus including a nucleic acid encoding a VLCFA elongase. Compositions including VLCFA or biomass from an insect expressing the one or more VLCFA elongases and methods of their use are also provided.
Description
METHODS TO PRODUCE VERY LONG CHAIN FATTY ACIDS
CROSS REFERENCE TO RELATED APPLICATION
This application claim the benefit of U.S. Provisional Application No. 63/051,520, filed July 14, 2020, which is incorporated herein by reference in its entirety.
FIELD OF THE DISCLOSURE
This disclosure relates to methods of producing very long chain fatty acids, particularly production in insects, such as cabbage looper larvae.
PARTIES TO JOINT RESEARCH AGREEMENT
This application describes and claims certain subject matter that was developed under a written research collaboration agreement between The National Heart, Lung, and Blood Institute (an entity of The United States of America, as represented by the Secretary, Department of Health and Human Services) and Allotropic Tech, LLC, having an effective date of March 6, 2020.
BACKGROUND
Fatty acids are critical components of plasma membranes, and dietary fatty acids, which are incorporated into tissues, are known to affect cardiovascular risk by altering plasma lipoprotein levels. Very-long-chain fatty acids (VLCFAs) contain 24-40 carbons and are very scarce in most food sources, except some seeds and fish. VLC-saturated FAs (VLCSFAs) are found in skin, hair, and wax glands (Rezenka, Prog. Lipid Res. 28:147-187, 1989), whereas VLC -polyunsaturated FAs (VLCPUFAs) are found in the retina, brain, testis, and spermatozoa (Agbaga et al, J. Lipid Res. 51:1624-1642, 2010). VLCPUFAs are structurally unique in that the carboxylic-group end is composed of 12-20 saturated carbon bonds, whereas the methyl-group end contains four or more cis double bonds, and they are known to be converted into potent signaling molecules that may be important for in retinal and neural function (Do et al., Proc. Natl. Acad. Sci. USA 116:24317- 24325, 2019).
VLCFAs are endogenously synthesized by sequential two-carbon extension of fatty acids C22-26 by VLCFA elongases, such as ELOVL fatty acid elongase 2 (ELOVL2) and ELVOL4.
This process, however, is inefficient because of the low tissue substrate levels for eicosapentaenoic acid (EPA) and docosahexaenoic acid (DHA) and because the promoter for ELOVL2 undergoes extensive age-dependent methylation (Skowronska-Krawczyk et al. Adv. Exp. Med. Biol. 1185:39- 43, 2019; Skowronska-Krawczyk et al., Exp. Gerontol. 131:110817, 2019). ELOVL2 activity
decreases with age, and retinal depletion of VLCPUFA has been proposed to be a cause of age- related macular degeneration (AMD) (Skowronska-Krawczyk et al. Adv. Exp. Med. Biol. 1185:39- 43, 2019; Skowronska-Krawczyk et al., Exp. Gerontol. 131:110817, 2019). Genetic mutations in ELOVL4 also cause retinal depletion of VLCPUFA and lead to Stargardt disease type 3 (STGD3), a progressive form of juvenile blindness (Hopiavuori et al, Prog. Retin. Eye Res. 69:137-158, 2019). The human retina is particularly enriched in VLCPUFAs, which are critical for normal retinal structure and function (Agbaga et al, J. Lipid Res. 51:1624-1642, 2010).
In the brain, n-6 and n-3 series of VLCFA, with chain- lengths of C26-C38 and 4-6 double bonds, are found in phosphatidylcholines (PCs) at the sn-l position, with n-6 series VLCPUFA being predominant (Poulos et al., Biochem. J. 253:645-650, 1988). Recessive mutations in the ELOVL4 gene are associated with seizures, intellectual disability, and spastic quadriplegia, revealing the importance of VLCPUFA in brain development and physiology (Aldahmesh et al., Am. J. Hum. Genet. 89:745-750, 2011). In the mammalian testis and spermatozoa, n-6 and n-3 VLCPUFA with chain-lengths of C26-C32 and 4-6 double bonds, are present uniquely in sphingolipids including ceramides, sphingomyelins, and fucosylated glycosphingolipids (Sandhoff et al., J. Biol. Chem. 280:27310-27318, 2005; Furland et al, J. Biol. Chem. 282:18141-18150, 2007; Rabionet et al., J. Biol. Chem. 283:13357-13369, 2008). The level of VLCPUFA in these sphingolipids increases with the onset of spermatogenesis, and VLCPUFAs account for up to 15% and 40% of rat testicular ceramides and sphingomyelins, respectively (Furland et al., J. Biol. Chem. 282:18141-18150, 2007). In mice, loss of functional ELOVL4 displayed scaly, wrinkled skin, severely compromised epidermal permeability barrier function, and led to neonatal death, concomitant with a global decrease in VLCSFAs, suggesting the crucial role of VLCFAs in skin barrier function (Vasireddy et al., Hum. Mol. Genet. 16:471-482, 2007).
SUMMARY
Dietary supplementation with VLCFA or other forms of VLCFA delivery could be a potential therapy for patients with disorders associated with decreased VLCFA levels or VLCFA elongase activity, but has not been tested because of the lack of availability of a VLCFA supplement. Thus, there is a need for developing methods of producing VLCFAs, for example, in quantities sufficient for dietary supplementation.
Provided herein are methods of producing one or more very long chain fatty acids (e.g., VLCPUFAs and/or VLCSFAs) including expressing one or more heterologous VLCFA elongases in an insect or insect cell (e.g., Trichoplusia ni larvae or Trichoplusia ni insect cells). In some embodiments, the methods include expressing the one or more heterologous VLCFA elongases in
the insect or insect cell by infecting the insect or insect cell with one or more baculoviruses including a nucleic acid encoding the one or more heterologous VLCFA elongases. In some examples, the VLCFA elongase is ELOVL fatty acid elongase 2 (ELOVL2), ELOVL fatty acid elongase 4 (ELOVL4), ELOVL fatty acid elongase 5 (ELOVL5), ELOVL fatty acid elongase 3 (ELOVL3), or any combination of two or more thereof. The nucleic acid encoding the one or more VLCFA elongases in some examples, is codon-optimized for expression in insect cells. The nucleic acid encoding the one or more VLCFA elongases may further include a nucleic acid encoding a signal peptide (such as a bombyxin signal peptide), a tag (such as a FLAG tag), or a combination thereof.
In some embodiments, the methods include expressing an ELOVL2 protein including an amino acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%, 97%, 98%, 99%, or 100% identity) to the amino acid sequence of SEQ ID NO: 1. In further embodiments, the ELOV2 protein is encoded by a nucleic acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%, 97%, 98%, 99%, or 100% identity) to the nucleic acid sequence of SEQ ID NO: 2.
In other embodiments, the methods include expressing an ELOVL4 protein including an amino acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%, 97%, 98%, 99%, or 100% identity) to the amino acid sequence of SEQ ID NO: 3. In additional embodiments, the ELOV4 protein is encoded by a nucleic acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%, 97%, 98%, 99%, or 100% identity) to the nucleic acid sequence of SEQ ID NO:4.
In some embodiments, the methods also include inactivating the baculovirus following expression of the one or more VLCFA elongases in the insect or insect cell. In some examples, inactivating the baculovirus includes treating the insect or insect cell with one or more of radiation, heat, and chemical agents. In further embodiments, the methods also include purifying the one or more VLCFAs from the insect or insect cell and/or preparing bulk biomass (e.g., powdered insect biomass) from the insect or insect cell.
Also provided herein are compositions including one or more VLCFAs (e.g., VLCFAs with 24-40 carbons, such as VLCPUFAs), for example, prepared by the methods disclosed herein. In some embodiments, the composition includes biomass from insects expressing one or more heterologous VLCFA elongases, such as one or more of ELVOL2, ELOVL4, ELVOL5, and ELOVL3. The composition may be formulated as a food material (such as flour or meal prepared from the insects) or a food supplement. In some embodiments, an effective amount of the composition is administered to a subject in need thereof, such as a subject with age-related macular degeneration or Stargardt disease type 3 (STGD3).
Also provided are baculovirus vectors including one or more nucleic acids encoding a very long chain fatty acid (VLCFA) elongase. In some examples, the VLCFA elongase is ELOVL fatty acid elongase 2 (ELOVL2), ELOVL fatty acid elongase 4 (ELOVL4), ELOVL fatty acid elongase 5 (ELOVL5), and ELOVL fatty acid elongase 3 (ELOVL3), or any combination of two or more thereof. The nucleic acid encoding the one or more VLCFA elongases in some examples, is codon- optimized for expression in insect cells. The vector encoding the one or more VLCFA elongases may further include a nucleic acid encoding a signal peptide (such as a bombyxin signal peptide), a tag (such as a FLAG tag), or a combination thereof.
In some embodiments, the vector includes a nucleic acid encoding an ELOVL2 protein including an amino acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%,
97%, 98%, 99%, or 100% identity) to the amino acid sequence of SEQ ID NO: 1. In further embodiments, the ELOV2 protein is encoded by a nucleic acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%, 97%, 98%, 99%, or 100% identity) to the nucleic acid sequence of SEQ ID NO: 2.
In other embodiments, the vector includes a nucleic acid encoding an ELOVL4 protein including an amino acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%,
97%, 98%, 99%, or 100% identity) to the amino acid sequence of SEQ ID NO: 3. In additional embodiments, the ELOV4 protein is encoded by a nucleic acid sequence with at least 95% sequence identity (e.g., at least 95%, 96%, 97%, 98%, 99%, or 100% identity) to the nucleic acid sequence of SEQ ID NO:4.
The foregoing and other features of the disclosure will become more apparent from the following detailed description which proceeds with reference to the accompanying figures.
BRIEF DESCRIPTION OF THE FIGURES
FIG. 1 is a schematic diagram of synthesis of VLCPUFA.
FIG. 2 is a schematic diagram of an exemplary construct for ELOVL2 or ELOVL4 baculovirus expression. pBacPAK8 - baculovirus vector; pPH - polyhedrin promoter; Bss - Bombyx mori signal peptide; FLAG - FLAG tag.
FIG. 3 is an image of Western blot analysis of recombinant ELOVL2 and ELOVL4 produced in Trichoplusia ni larvae. Elo2 = ELOVL2 (34.5 kDa); A = co-infection with 75% Elo2 + 25% Elo4; B = co-infection with 50% Elo2 + 50% Elo4; C = co-infection with 25% Elo2 + 75% Elo4; Elo4 = ELOVL4 (37.7 kDa).
SEQUENCE LISTING
Any nucleic acid and amino acid sequences listed herein or in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases and amino acids, as defined in 37 C.F.R. § 1.822. In at least some cases, only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand.
SEQ ID NO: 1 is the amino acid sequence of an exemplary ELOVL2 protein:
EHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYM
KNRPAFSFRGIFTFYNFGITFFSAYMFAEFIFSTWEGGYNFQCQDFTSAGEADIRVA
KVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQS
FFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTMSAVV
KPCGFPFGCLIFQS S YMLTLVILFLNFYV QTYRKKPMKKDMQEPPAGKEVKN GFS K
A YFT A AN G VMNKKAQ
SEQ ID NO: 2 is a codon-optimized nucleic acid sequence encoding the ELOVL2 protein of SEQ ID NO: 1:
GAACATCTGAAGGCCTTCGACGACGAGATCAATGCCTTTCTGGACAACATGTTC
GGTCCTCGTGACAGCCGTGTGAGAGGCTGGTTCATGCTGGACTCTTATCTGCCC
ACTTTCTTCCTCACCGTGATGTATCTGCTGAGCATCTGGCTGGGTAACAAGTAC
ATGAAGAACCGTCCCGCTCTGTCTCTGAGAGGCATTCTGACTCTCTACAATCTG
GGCATCACTCTGCTCAGCGCTTACATGCTGGCTGAGCTGATCCTCAGCACTTGG
GAGGGTGGCTACAATCTGCAGTGCCAAGACCTCACTAGCGCCGGTGAAGCCGA
CATCAGAGTCGCCAAGGTGCTGTGGTGGTACTACTTCAGCAAGAGCGTCGAGTT
TCTGGACACCATCTTCTTTGTCCTCAGAAAGAAAACCAGCCAGATTACCTTCCT
CCACGTCTACCACCACGCCAGCATGTTCAACATCTGGTGGTGCGTGCTGAACTG
GATTCCTTGCGGCCAGTCTTTCTTCGGCCCCACTCTGAACAGCTTCATCCACATT
CTGATGTACAGCTACTACGGTCTGTCTGTCTTTCCCAGCATGCACAAGTATCTGT
GGTGGAAGAAGTACCTCACCCAAGCTCAGCTGGTCCAATTCGTGCTGACTATCA
CCCACACCATGTCTGCTGTGGTGAAGCCTTGCGGTTTCCCCTTCGGTTGCCTCAT
CTTCCAGAGCTCTTACATGCTGACTCTGGTCATTCTGTTCCTCAATTTCTACGTG
CAGACCTACAGAAAGAAGCCTATGAAGAAGGATATGCAAGAACCCCCCGCTGG
CAAAGAAGTCAAGAACGGCTTCAGCAAGGCCTACTTCACCGCCGCTAACGGTG
TCATGAACAAGAAGGCTCAGTAA
SEQ ID NO: 3 is the amino acid sequence of an exemplary ELOVL4 protein:
GLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYL
LFVWLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSV
D Y S NNVHE VRIA A ALWWYFV S KG VE YLDT VFFILRKKNN Q VSFLH V YHHCTMFTL
WWIGIKWVAGGQAFFGAQLNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQ
LIQFHVTIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKPKAGK
TAMN GIS AN GV S KSEKQLMIEN GKKQKN GKAKGD
SEQ ID NO: 4 is a codon-optimized nucleic acid sequence encoding the ELOVL4 protein of SEQ ID NO: 3:
GGTCTGCTGGATTCTGAACCCGGTTCTGTCCTCAACGTGGTCTCTACCGCTCTGA
ACGACACCGTCGAGTTCTACCGTTGGACTTGGTCTATCGCCGACAAAAGAGTGG
AGAACTGGCCTCTCATGCAGTCTCCTTGGCCTACTCTGAGCATCAGCACTCTGT
ATCTGCTGTTCGTCTGGCTGGGTCCTAAGTGGATGAAGGACCGTGAACCCTTCC
AGATGCGTCTCGTCCTCATCATCTACAACTTCGGCATGGTGCTCCTCAATCTGTT
CATCTTCCGTGAGCTGTTCATGGGCAGCTACAATGCTGGCTACAGCTACATTTG
CCAGAGCGTCGACTACAGCAACAACGTCCACGAGGTCAGATCGCTGCCGCTCT
GTGGTGGTACTTCGTCAGCAAGGGTGTCGAATATCTGGACACCGTGTTCTTCAT
CCTCAGAAAGAAGAACAACCAAGTCAGCTTTCTGCACGTGTATCACCACTGCAC
CATGTTCACTCTGTGGTGGATCGGTATCAAGTGGGTCGCCGGTGGTCAAGCCTT
TTTCGGTGCTCAGCTCAACAGCTTCATCCACGTGATCATGTACAGCTATTACGG
CCTCACCGCCTTCGGCCCTTGGATTCAGAAGTACCTCTGGTGGAAGCGTTATCT
GACCATGCTGCAGCTGATCCAGTTCCACGTGACCATTGGCCACACTGCCCTCTC
TCTGTATACTGACTGCCCTTTCCCCAAGTGGATGCACTGGGCTCTGATCGCCTAC
GCCATCAGCTTCATCTTTCTGTTCCTCAACTTCTATATCCGTACCTACAAGGAAC
CTAAGAAGCCCAAGGCCGGCAAAACTGCCATGAACGGCATCAGCGCTAACGGC
GTCAGCAAGAGCGAGAAGCAGCTCATGATCGAGAACGGCAAGAAGCAAAAAA
ACGGCAAGGCCAAGGGCGACTAA
SEQ ID NO: 5 is the amino acid sequence of a bombyxin signal peptide from Bombyx mori.
SEQ ID NO: 6 is the amino acid sequence of a FLAG tag.
DETAILED DESCRIPTION
I. Terms
The following explanations of terms and methods are provided to better describe the present disclosure and to guide those of ordinary skill in the art in the practice of the present disclosure.
The singular forms “a,” “an,” and “the” refer to one or more than one, unless the context clearly dictates otherwise. The term “or” refers to a single element of stated alternative elements or a combination of two or more elements, unless the context clearly indicates otherwise. As used herein, “comprises” means “includes.” Thus, “comprising A or B,” means “including A, B, or A and B,” without excluding additional elements. All references, including patents and patent applications cited herein, are incorporated by reference in their entirety, unless otherwise specified. All GenBank Accession numbers are incorporated by reference as present on July 14, 2020.
Unless otherwise indicated, all numbers expressing quantities of components, molecular weights, percentages, temperatures, times, and so forth, as used in the specification or claims, are to be understood as being modified by the term “about.” Accordingly, unless otherwise indicated, implicitly or explicitly, the numerical parameters set forth are approximations that may depend on the desired properties sought and/or limits of detection under standard test conditions/methods.
Unless explained otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure pertains. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, suitable methods and materials are described below. The materials, methods, and examples are illustrative only and not intended to be limiting.
ELOVL fatty acid elongase 2 (ELOVL2): An enzyme in the long-chain fatty acids elongation cycle. ELOVL2 is a transmembrane protein that catalyzes addition of two carbons to long and very long chain fatty acids per cycle. ELOVL2 sequences are publicly available. For example, GenBank Accession Nos. NP_060240, EAW55290, BAA91096, XP_011513019, AAH60809, XP_011513018, and XP_016866474 disclose human ELOVL2 protein sequences. GenBank Accession Nos. NM_017770, AK000341, XM_011514717, BC060809, XM_011514716, and XM_017010985 disclose ELOVL2 human nucleic acid sequences.
ELOVL fatty acid elongase 4 (ELOVL4): An enzyme in the long-chain fatty acids elongation cycle. ELOVL4 is a membrane bound protein involved in synthesis of very-long-chain saturated and polyunsaturated fatty acids with chain length of 28 carbons or more. ELOVL4 sequences are publicly available. For example, GenBank Accession No. NP_073563 discloses a
human ELOVL4 protein sequence and GenBank Accession No. NM_022726 discloses a human ELOVL4 nucleic acid sequence.
Expression: “Expression” refers to transcription and/or translation of a nucleic acid sequence. For example, a nucleic acid molecule can be expressed when its DNA is transcribed into an RNA or RNA fragment, which in some examples is processed to become mRNA. A nucleic acid molecule may also be expressed when its mRNA is translated into an amino acid sequence, such as a protein or a protein fragment. Regulation of expression can include controls on transcription, translation, RNA transport and processing, degradation of intermediary molecules such as mRNA, or through activation, inactivation, compartmentalization or degradation of specific protein molecules after they are produced.
Heterologous: Originating from a different genetic source or species. For example, a nucleic acid that is heterologous to a cell originates from an organism or species other than the cell in which it is expressed. In one specific, non-limiting example, a heterologous nucleic acid includes a human nucleic acid or a codon-optimized nucleic acid that is present or expressed in an insect cell (such as an Sf9 cell, High Five™ cell, or Trichoplusia ni, such as in a T. ni larvae). Methods for introducing a heterologous nucleic acid into insect cells are known in the art, for example infection with a virus, such as a baculovirus.
Isolated: An “isolated” or “purified” biological component (such as a nucleic acid, peptide, protein, protein complex, or lipid) has been substantially separated, produced apart from, or purified away from other biological components e.g., other chromosomal and extrachromosomal DNA and RNA, proteins, or cells. Nucleic acids, peptides, proteins, or lipids (e.g. , VLCFAs) that have been “isolated” or “purified” thus include purification by standard purification methods. The term “isolated” or “purified” does not require absolute purity; rather, it is intended as a relative term. Thus, for example, an isolated biological component is one in which the biological component is more enriched than the biological component is in its starting form. Preferably, a preparation is purified such that the biological component represents at least 20%, such as at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or greater, of the total content of the preparation.
Very-long-chain fatty acids (VLCFA): Fatty acids containing 24 or more carbons, for examples 24-40 carbons. The VFCFA may be saturated (VFCSFA) or polyunsaturated (VFCPUFA). An exemplary pathway for production of VFCPUFAs is shown in FIG. 1. See also Sassa et al. ( Biomol . Ther. 22:83-29, 2014).
II. Methods of Producing Very-Long-Chain Fatty Acids
Provided herein are methods of producing VLCFAs in an insect or an insect cell, for example by expressing one or more enzymes involved in synthesis of VLCFAs. In some examples, the VLCFAs have a carbon chain length of about 24-40 carbons, such as about 24, 26, 28, 30, 32, 34, 36, 38, or 40 carbons. The VLCFAs may be saturated or polyunsaturated.
In some embodiments, the methods include expressing one or more (such as 1, 2, 3, or 4) heterologous VLCFA elongases (e.g., one of more of ELOVL2, ELOVL3, ELOVL4, and ELOVL5) in an insect or insect cell. In some examples, expressing the one or more heterologous VLCFA elongases includes infecting an insect or insect cell with one or more baculoviruses comprising a nucleic acid encoding the one or more heterologous VLCFA elongases. In particular non-limiting examples, the methods include infecting an insect (such as an insect larvae) with one or more baculoviruses including a heterologous nucleic acid encoding one or more of ELOVL2, ELOVL3, ELOVL4, and ELOVL5. In some examples, the VLCFA elongase does not include an N-terminal methionine; however, an N-terminal methionine can be present, for example as a result of expression in a bacterial or insect system, or the N-terminal methionine may subsequently be removed.
In some embodiments, the methods include infecting an insect or insect cells with a baculovirus including a heterologous nucleic acid encoding an ELOVL2 protein, such as an ELOVL2 protein having an activity of catalyzing addition of two carbons to fatty acids having a length of 18-22 carbons. In some examples, the ELOVL2 protein has an amino acid sequence with at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to SEQ ID NO: 1. In particular examples, the ELOVL2 protein includes or consists of the amino acid sequence of SEQ ID NO: 1. In other embodiments, the ELOVL2 protein has an amino acid sequence with at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or including or consisting of the amino acid sequence of any one of GenBank Accession Nos. NP_060240, EAW55290, BAA91096, XP_011513019, AAH60809, XP_011513018, and XP_016866474. One of ordinary skill in the art can identify additional ELOVL2 protein sequences, for example, from publicly available databases.
In other embodiments, the methods include infecting an insect or insect cells with a baculovirus including a heterologous nucleic acid encoding an ELOVL4 protein, such as an ELOVL4 protein having an activity of catalyzing addition of two carbons to fatty acids having a length of 26-36 carbons. In some examples, the ELOVL4 protein has an amino acid sequence with at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to SEQ ID NO: 3. In particular examples, the ELOVL4 protein includes or
consists of the amino acid sequence of SEQ ID NO: 3. In other embodiments, the ELOVL4 protein has an amino acid sequence with at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or including or consisting of the amino acid sequence of GenBank Accession No. NP_073563. One of ordinary skill in the art can identify additional ELOVL4 protein sequences, for example, from publicly available databases.
In additional embodiments, the methods include infecting an insect or insect cells with a baculovirus including a heterologous nucleic acid encoding an ELOVL5 protein, such as an ELOVL5 protein having an activity of catalyzing addition of two carbons to fatty acids having a length of 18-20 carbons. In some examples, the ELOVL5 protein has an amino acid sequence with at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or including or consisting of the amino acid sequence of any one of GenBank Accession Nos. NP_001229759, NP_001229757, NP_068586, NP_001288785, or NP_001229760. One of ordinary skill in the art can identify additional ELOVL5 protein sequences, for example, from publicly available databases.
In further embodiments, the methods include infecting an insect or insect cells with a baculovirus including a heterologous nucleic acid encoding an ELOVL3 protein, such as an ELOVL3 protein having an activity of catalyzing addition of two carbons to fatty acids having a length of 18-24 carbons. In some examples, the ELOVL3 protein has an amino acid sequence with at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or including or consisting of the amino acid sequence of any one of GenBank Accession Nos. NP_689523 or XP_011538547. One of ordinary skill in the art can identify additional ELOVL3 protein sequences, for example, from publicly available databases.
In some embodiments the nucleic acid encoding an ELOVL2 protein has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to SEQ ID NO: 2. In particular examples, the ELOVL2 encoding nucleic acid includes or consists of the nucleic acid sequence of SEQ ID NO: 2. In other embodiments, the ELOVL2 nucleic acid sequence has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of any one of GenBank Accession Nos. NM_017770, AK000341,
XM_011514717, BC060809, XM_011514716, and XM_017010985. One of ordinary skill in the art can identify additional ELOVL2 encoding nucleic acid sequences, for example, from publicly available databases.
In other embodiments the nucleic acid encoding an ELOVL4 protein has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least
99% identity) to SEQ ID NO: 4. In particular examples, the ELOVL4 encoding nucleic acid includes or consists of the nucleic acid sequence of SEQ ID NO: 4. In other embodiments, the ELOVL4 nucleic acid sequence has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of GenBank Accession No. NM_022726. One of ordinary skill in the art can identify additional ELOVL4 encoding nucleic acid sequences, for example, from publicly available databases.
In further embodiments, the nucleic acid encoding an ELOVL5 protein has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of any one of GenBank Accession Nos. NM_001242830, NM_001242828, NM_021814, NM_001301856, and NM_0012428311. One of ordinary skill in the art can identify additional ELOVL5 encoding nucleic acid sequences, for example, from publicly available databases.
In other embodiments, the nucleic acid encoding an ELOVL3 protein has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of any one of GenBank Accession Nos. XM_011540245 and NM_152310. One of ordinary skill in the art can identify additional ELOVL3 encoding nucleic acid sequences, for example, from publicly available databases.
In some examples, the nucleic acid encoding the VLCFA elongase (such as any one of ELOVL2, ELOVL4, ELOVL5, or ELOVL3) is codon-optimized for the cell in which it is to be expressed (such as an insect cell). Codon usage bias, the use of synonymous codons at unequal frequencies, is ubiquitous among genetic systems (Ikemura, J. Mol. Biol. 146:1-21, 1981; Ikemura, J. Mol. Biol. 158:573-97, 1982). The strength and direction of codon usage bias is typically related to genomic G + C content and the relative abundance of different isoaccepting tRNAs (Akashi, Curr. Opin. Genet. Dev. 11:660-666, 2001; Duret, Curr. Opin. Genet. Dev. 12:640-9, 2002; Osawa et ai, Microbiol. Rev. 56:229-264, 1992). Codon usage can affect the efficiency of gene expression. Codon-optimization refers to replacement of at least one codon (such as at least 5 codons, at least 10 codons, at least 25 codons, at least 50 codons, at least 75 codons, at least 100 codons or more) in a nucleic acid sequence with a synonymous codon (one that codes for the same amino acid) more frequently used (preferred) in the organism. Each organism has a particular codon usage bias for each amino acid, which can be determined from publicly available codon usage tables (for example see Nakamura et al., Nucleic Acids Res. 28:292, 2000 and references cited therein), databases (e.g., kazusa.or.jp/codon), or commercial sources. One of skill in the art
can modify a nucleic acid encoding a particular amino acid sequence, such that it encodes the same amino acid sequence, while being optimized for expression in a particular cell type or organism. In particular examples, the ELOVL sequence is codon-optimized for expression in T. ni. In some examples, a codon-optimized ELOVL sequence is generated using software.
The nucleic acid encoding the ELOVL may also include a signal sequence (such as a bombyxin signal peptide from Bombyx mori, for example, SEQ ID NO: 5) to facilitate transmembrane insertion of the VLCLA elongase. In other examples, the nucleic acid further includes tags for identification or purification of protein (such as a LLAG tag (e.g., SEQ ID NO: 6), Myc tag, or His tag).
The disclosed methods can be used to express one or more VLCFA elongases (such as one or more of ELOVL2, ELOVL4, ELOVL5, and ELOVL3) in insects or insect cells. In some examples, the methods include expressing the one or more VLCFA elongases in Trichoplusia ni (cabbage looper) cells or organisms. In particular examples, the methods utilize T. ni larvae. In other examples, the methods may utilize black soldier fly cells or organisms or Tenebrio molitor (mealworm) cells or organisms (such as mealworm larvae). In another example, the methods include expressing the one or more VLCFA elongases in silkworm ( Bombyx mori) cells or organisms.
In some embodiments, the methods include expressing two or more VLCFA elongases in an insect or insect cell. In some examples, the methods include infecting an insect with two or more baculoviruses, wherein each baculovirus includes a nucleic acid encoding a different VLCFA elongase. In other examples, the methods include infecting an insect with a baculovirus including two or more VLCFA encoding nucleic acids. In one non-limiting example, the methods include infecting an insect with a baculovirus including a nucleic acid encoding an ELOVL2 protein and a baculovirus including a nucleic acid encoding an ELOVL4 protein or a baculovirus including a nucleic acid encoding an ELOVL2 protein and a nucleic acid encoding an ELOVL4 protein. In other examples, the methods include infecting an insect with one or more baculovirus including any combination of two or more of ELOVL2, ELOVL4, ELOVL5, and ELOVL3 encoding nucleic acids at varying ratios.
In embodiments where two or more VLCFA elongases are expressed, the amount of each baculovirus used to infect the insect or insect cells can be varied to optimize VLCFA production. Thus, in some examples, two baculoviruses are utilized and the ratio of the baculoviruses is 1:4,
1:3, 1:2, 1:1, 2:1, 3:1, or 4:1. In some non-limiting examples, the two VLCFA elongases are ELOVL2 and ELOVL4 and the amount of the baculoviruses used are 1:3 (ELOVL2:ELOVL4), 1:1 (ELOVL2:ELOVL4), or 3:1 (ELOVL2:ELOVL4). If three or more ELOVL proteins are
expressed, appropriate ratios can be determined, for example, using the methods provided in Example 2.
In embodiments, the methods include infecting an insect or insect cells with one or more baculoviruses including a nucleic acid encoding a VLCFA elongase. In one example, the baculo virus is an Auto grapha calif ornica multiple nucleopolyhedro virus (AcMNPV) virus. In another example, the baculovirus is a Bombyx mori nucleopolyhedrovirus (BmNPV) vims. The polyhedrin protein is required for propagation of baculoviruses in nature; however, in cell culture, polyhedrin is not required, and its coding sequence can be replaced with a sequence for a target protein (such as one or more VLCFA elongase). Baculovirus expression vectors are constructed in two steps. First, a target gene is cloned into a modified polyhedrin locus in a transfer vector. The polyhedrin coding sequence is deleted and the target gene is cloned between the polyhedrin promoter and polyadenylation signals. Transfer vectors may also include an origin of replication and an antibiotic resistance gene for propagation in E. coli. Second, the transfer vector and a viral expression vector are co-transfected into insect cells (such as Sf9 or High Five™ cells). Double recombination between viral sequences in the transfer vector and the corresponding sequences in the viral DNA transfers the target gene to the viral genome. The baculovirus can then be recovered and used in the methods described herein. Exemplary baculovirus transfer vectors include BacPAK (e.g., pBacPAK6, pBacPAK8 (e.g., FIG. 2), pBacPAK9, BmBacPAK6). One of ordinary skill in the art can select appropriate transfer vectors and baculovirus systems, based on the insect system being used and the gene(s) to be expressed.
One or more baculoviruses including a nucleic acid encoding at least one VLCFA elongase is used to infect an insect or insect cells. In some examples, the insect (such as T. ni larva) is orally infected. In some examples, the baculovirus is placed or coated on top of the T. ni food. In a non limiting example, homogenate of infected T. ni larvae containing the baculovirus(es) is placed on top of the food or sprayed on the food. In other examples, the homogenate can be incorporated into the food. In one non-limiting example the homogenate of infected larvae is prepared in water at a ratio of 1:2000 (w/v). Other ratios can be selected by one of ordinary skill in the art, depending on the strength or amount of baculovirus in the infected larvae utilized for the preparation. In other examples, the insect (such as T. ni larva) is infected by injection of the baculovirus. In some examples, about 105-107 pfu/ml (e.g., lxlO5, 5xl05, lxlO6, 5xl06, or lxlO7 pfu/ml) of baculovirus is injected per larvae.
Following infection of the insects, they are incubated under conditions sufficient for the VLCFA elongase to be expressed and for production of VLCFAs. In some examples, the insects are incubated at about 24-29°C (e.g. about 24-26°C, about 25-27°C, about 26-28°C, or about 27-
29°C) for about 48-84 hours post-infection (such as about 48-72 hours, about 60-84 hours, for example, about 48 hours, about 54 hours, about 60 hours, about 66 hours, about 70 hours, about 72 hours, about 78 hours, about 80 hours, or about 84 hours). In some examples, the incubation is initially at a first temperature (e.g., to encourage feeding, and thus uptake of the vims) and then at a second (lower) temperate to facilitate expression and harvesting. The incubation temperature affects the larval development, thus, one of ordinary skill in the art can select an appropriate combination of time and temperature(s) for baculovirus expression and larval viability.
In certain embodiments, the methods further include inactivating baculovirus in the insects or cells, or bulk biomass from the insects or cells following expression of the one or more VLCFA elongases. Methods of inactivating baculoviruses include gamma irradiation, ultraviolet irradiation, heat, freeze-thaw cycles, or chemical inactivation (e.g. , detergent or binary ethylenimine).
In some embodiments, the disclosed methods further include recovering biomass from an organism or cells in which the one or more VLCFA elongases have been expressed. One method of recovering biomass includes freeze-drying insects (e.g., T. ni larvae) expressing one or more VLCFA elongases and grinding the lyophilized insects to form a powder. In other examples, larval tissue homogenate is prepared in water-based buffer or oil or frozen larvae are ground with dry ice to form a paste. In some examples, the powdered biomass is formulated in an edible form, such as a flour or meal. In other examples, the powdered biomass is formulated as a food supplement, for examples, as a pill or capsule form.
In some embodiments, the methods further include purifying or partially purifying VLCFAs from the insects or insect cells. In some examples, purification of VLCFAs can include ion exchange, chromatography, extraction, solvent extraction, membrane separation, electrodialysis, reverse osmosis, distillation, chemical derivatization, and/or crystallization
III. Compositions and Methods of Use
Provided herein are compositions including one or more VLCFAs, such as insects, insect cells, or biomass including one or more heterologous VLCFAs, for example, produced by the disclosed methods. In some examples, the VLCFAs are contained in biomass of an organism or cells in which the one or more VLCFA elongases have been expressed. In other examples, the one or more VLCFAs are purified or partially purified from the insect or insect cell in which they are produced.
In some embodiments, the composition includes frozen or freeze-dried biomass from the insect or insect cells expressing the one or more VLCFA elongases, for example, a powder form. The biomass can be formulated as a food product (e.g. , a meal or flour) or as a food supplement. In
some examples, the powdered biomass is included in a pill or capsule form, for example, encapsulated in oil (such as soy oil, grapeseed oil, coconut oil, canola oil) or in a cellulose-based matrix. In some examples, the composition further includes additional components, such as stabilizers, preservatives, buffers, or other excipients.
In other embodiments, purified or partially purified VLCFAs can be formulated for injection, included in a patch (e.g., for transdermal administration), formulated for aerosolization and administration through the nose or mouth, incorporated in a cream, spray, or wash for topical administration, incorporated in a chewing gum, or added to a dissolvable film for oral administration.
In additional embodiments, the compositions (e.g., purified or partially purified VLCFAs or bulk biomass) disclosed herein can be used as feed source for other organisms such as other insects, fish, poultry or animals to increase the quantity of VLCFAs in the organism. The organism would be subsequently harvested and used as a food source.
The compositions including one or more VLCFAs produced herein may be administered to a subject in need thereof. In some embodiments, the subject has a disorder with decreased expression of one or more VLCFA elongases (e.g. , ELOVL2 or ELOVL4). Exemplary disorders include retinal degenerative disorders, such as age-related macular degeneration, Stargardt disease type 3 (STGD3), or other age-related retinal disease. In another example, the disorder is a neuro- icthyotic disorder with features of ichthyosis, seizures, developmental delay, and spasticity (Aldahmesh et al., Am. J. Hum. Genet. 89:745-750, 2011). In other examples, the subject is a subject over 50 years, over 55 years, over 60 years, over 65 years, over 70 years, over 75 years, or older. The methods include administering an effective amount of the composition to the subject (e.g., an amount sufficient to reduce or inhibit one or more symptoms in the subject).
IV. Vectors and Viruses
Also provided are baculovirus vectors and baculoviruses including a heterologous nucleic acid encoding a VLCFA elongase. In some embodiments, the nucleic acid is included in a baculovirus transfer vector. In other embodiments, the nucleic acid is included in a baculovirus (such as an AcMNPV baculovirus).
In some embodiments, the includes one or more nucleic acids encoding ELOVL2,
ELOVL4, ELOVL5, and ELOVL3. The nucleic acid encoding the VLCFA elongase may be codon-optimized, for example for expression in insect cells.
In some embodiments vector includes a nucleic acid encoding an ELOVL2 protein having at least 95% sequence identity with (for example, at least 95%, at least 96%, at least 97%, at least
98%, or at least 99% identity) or including or consisting of SEQ ID NO: 1. In particular examples, the ELOVL2 encoding nucleic acid has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to SEQ ID NO: 2 or includes or consists of the nucleic acid sequence of SEQ ID NO: 2. In other embodiments, the ELOVL2 nucleic acid sequence has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of any one of GenBank Accession Nos. NM_017770, AK000341, XM_011514717, BC060809, XM_011514716, and XM_017010985.
In other embodiments the vector includes a nucleic acid encoding an ELOVL4 protein having at least 95% sequence identity with (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) or including or consisting of SEQ ID NO: 3. In particular examples, the ELOVL4 encoding nucleic acid has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to SEQ ID NO: 4 or includes or consists of the nucleic acid sequence of SEQ ID NO: 4. In other embodiments, the ELOVL4 nucleic acid sequence has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of GenBank Accession No. NM_022726.
In further embodiments, the vector includes a nucleic acid encoding an ELOVL5 protein wherein the nucleic acid has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of any one of GenBank Accession Nos. NM_001242830, NM_001242828, NM_021814, NM_001301856, and NM 0012428311.
In further embodiments, the vector includes a nucleic acid encoding an ELOVL3 protein wherein the nucleic acid has at least 95% sequence identity (for example, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity) to or includes or consists of the nucleic acid sequence of any one of GenBank Accession Nos. XM_011540245 and NM_152310.
The vector may further include additional nucleic acids, for example, nucleic acids for expression of the VLCFA elongase and/or nucleic acids to facilitate incorporation of the VLCFA elongase nucleic acid into a baculovirus. In some examples, the vector includes a promoter for expression of the VLCFA elongase, which in some examples is a polyhedrin promoter. The vector may also include a signal sequence (such as a bombyxin signal peptide from Bombyx mori, for example, SEQ ID NO: 5) to facilitate transmembrane insertion of the VLCFA elongase. In other examples, the vector further includes additional elements, including cloning sites, tags for identification or purification of protein (such as a FLAG tag (e.g., SEQ ID NO: 6), Myc tag, or His
tag), or transcriptional regulatory elements (such as translation start sites or polyadenylation sites). The vector may also include elements for propagation in a bacteria (such as E. coli), for example, an origin of replication and/or an antibiotic resistance genes.
EXAMPLES
The following examples are provided to illustrate certain features and/or embodiments. These examples should not be construed to limit the disclosure to the particular features or embodiments described.
Example 1
Baculoviruses for Expression of Recombinant Elongase 2 and Elongase 4 in Trichoplusia ni
Larvae
Constructs for expression of ELOVL2 and ELOVL4 in T. ni larvae were designed.
Analysis of available isoforms and variants for Gene ID: 54898 encoding ELOVL2 identified seven protein sequences: GenBank Accession Nos. NP_060240, EAW55290, BAA91096, XP_011513019, AAH60809, XP_011513018, and XP_016866474. Further analysis of literature and alignments with related species led to selection of NP_060240, which is currently the most typical sequence and well- annotated sequence. For Gene ID: 6785 encoding ELOVL4, the only available protein sequence was GenBank Accession No. NP_073563.
For both target proteins, constructs including the gene of interest, insect signal peptide, and tag were designed. Synthetic genes were codon optimized for expression in T. ni. To optimize expression, Bombyxin signal peptide (Bsp) from the insect Bombyx mori (MKIFFAIAFMFSTVMWVST; SEQ ID NO: 5) was added. To monitor expression of recombinant proteins in larval tissue by Western blot a FEAG tag (DYKDDDDK; SEQ ID NO: 6), cleavable by enterokinase was also added. N-terminal tag location was chosen based on the importance of intact C-terminal Di-lysine motif present in sequences of both elongases, which may confer endoplasmic reticulum (ER) localization. Resulting synthetic DNA was inserted in pBacPAK plasmid using BamHI and Notl sites (FIG. 2). Synthetic DNA including the coding region and signal sequence was produced and cloned into the pBacPAK plasmid by GeneWiz (South Plainfield, NJ).
Baculovirus construction was carried out. Budded forms of the recombinant baculovirus with an insert of the ELOVL2 or ELOVL4 sequence under transcriptional control of the polyhedrin promoter were produced by standard homologous recombination procedure in Sf9 cell culture. Linearized baculovirus Autographa califomica multiple nucleopolyhedrovirus (AcMNPV) DNA
modified by insertion of Aequorea victoria green- fluorescent protein (GLP) as a marker and protein disulfide isomerase (PD I), which improves oligomerization, and molecular chaperone calreticulin, which facilitates folding of target proteins in the ER was used. The choice of these helpers inserted in baculovirus DNA was based on the fact that both target proteins are located in ER and the presence of oligomeric forms of ELOVL4. Linal titer of produced recombinant viruses was ~106- 107 pfu/mL.
Example 2
Production of Biomass from Infected T. ni Larvae
Recombinant baculovirus produced as described in Example 1 was injected into Trichoplusia ni larvae. The following lots of biomass were created:
Lot 1: expressing ELVOL2
Lot 2: expressing ELOVL4
Lot 3: co-expressing ELVOL2 (25%) / ELVOL4 (75%)
Lot 4: co-expressing ELVOL2 (50%) / ELVOL4 (50%)
Lot 5: co-expressing ELVOL2 (75%) / ELVOL4 (25%)
Infected larvae were incubated in a controlled manner in a Percival Scientific Incubator model # I36NLC8. Larvae were harvested and flash frozen at the appropriate time. These larvae were used for interim testing and can be a seed for future oral inoculation.
One frozen larvae from each lot was used for sample preparation (total homogenate) and tested by Western blot to confirm expression of recombinant protein. ELOVL4 showed oligomeric forms, as previously noted in the literature. Co-infection showed the presence of both recombinant proteins (LIG. 3).
Infected larvae from each batch were further processed for freeze drying and ground into a power form for further analysis by GC and GC/MS instruments. Lreeze drying is optional and was used to facilitate testing
Example 3
Production of Bulk Biomass
Seed larvae produced from one or more lots (e.g., one or more lots described in Example 2) are used to orally infect T. ni larvae. Larvae are obtained from a supplier at the point where they are just entering their 5th instar. Larvae previously infected by injection are removed from a -80°C freezer and ground in deionized water at a ratio of 1:2000 (w:v). These infected larvae contain pre occluded baculovirus, which is orally infectious. Sugar is added to the ground mixture. The
mixture is then in placed in a container of larvae on top of the larvae food. Containers are then placed into incubator. The temperature and humidity is controlled in order to yield optimal results at the desired endpoint. Typically incubation temperature is controlled for a harvest at 80 hours.
At harvest, larvae are removed from the containers and inspected for morbidity and florescence by black light. Larvae that pass inspection are then flash frozen and placed into storage containers. This process constitutes the bulk biomass production. Further processing of bulk biomass can include freeze drying, chromatography, lipid extraction and/or lipid purification separating desired species. In view of the many possible embodiments to which the principles of the disclosure may be applied, it should be recognized that the illustrated embodiments are only examples of the and should not be taken as limiting the scope of the invention. Rather, the scope of the invention is defined by the following claims. We therefore claim as our invention all that comes within the scope and spirit of these claims.
Claims
1. A method of producing one or more very long chain fatty acids (VLCFA), comprising expressing one or more heterologous VLCFA elongases in an insect or an insect cell.
2. The method of claim 1, wherein expressing the one or more heterologous VLCFA elongases in the insect or insect cell comprises infecting the insect or insect cell with one or more baculoviruses comprising a nucleic acid encoding the one or more heterologous VLCFA elongases.
3. The method of claim 1 or claim 2, wherein the one or more VLCFA elongases comprise one or more of ELOVL fatty acid elongase 2 (ELOVL2), ELOVL fatty acid elongase 4 (ELOVL4), ELOVL fatty acid elongase 5 (ELOVL5), and ELOVL fatty acid elongase 3 (ELOVL3).
4. The method of any one of claims 1 to 3, wherein the nucleic acid encoding the one or more VLCFA elongases is codon-optimized for expression in insect cells.
5. The method of claim 3 or claim 4, wherein the VLCFA elongase is ELOVL2 and comprises an amino acid sequence with at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 1.
6. The method of claim 5, wherein the ELOVL2 comprises the amino acid sequence of SEQ ID NO: 1.
7. The method of claim 5, wherein the ELOV2 is encoded by a nucleic acid sequence with at least 95% sequence identity to the nucleic acid sequence of SEQ ID NO: 2.
8. The method of claim 7, wherein the ELOVL2 is encoded by a nucleic acid comprising the nucleic acid sequence of SEQ ID NO: 2.
9. The method of claim 3 or claim 4, wherein the VLCFA elongase is ELOVL4 and comprises an amino acid sequence with at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 3.
10. The method of claim 9, wherein the ELOVL4 comprises the amino acid sequence of SEQ
ID NO: 3.
11. The method of claim 9, wherein the ELOV4 is encoded by a nucleic acid sequence with at least 95% sequence identity to the nucleic acid sequence of SEQ ID NO: 4.
12. The method of claim 11, wherein the ELOVL4 is encoded by a nucleic acid comprising the nucleic acid sequence of SEQ ID NO: 4.
13. The method of any one of claims 2 to 12, wherein the nucleic acid encoding the one or more heterologous VLCFA elongases further comprises a nucleic acid encoding a signal peptide, a tag, or a combination thereof.
14. The method of claim 13, wherein the signal peptide comprises a bombyxin signal peptide.
15. The method of claim 14, wherein the bombyxin signal peptide comprises the amino acid sequence of SEQ ID NO: 5.
16. The method of claim 13, wherein the tag comprises a FLAG tag.
17. The method of claim 16, wherein the FLAG tag comprises the amino acid sequence of SEQ
ID NO: 6.
18. The method of any one of claims 2 to 17, further comprising inactivating the baculovirus following expression of the one or more VLCFA elongases in the insect or insect cell.
19. The method of claim 18, wherein inactivating the baculovirus comprises treating the insect or insect cell with one or more of radiation, heat, and chemical agents.
20. The method of any one of claims 1 to 19, further comprising purifying the one or more VLCFAs from the insect or insect cell.
21. The method of any one of claims 1 to 20, further comprising preparing bulk biomass from the insect or insect cell.
22. The method of claim 21, wherein the bulk biomass comprises powdered insect or insect cell biomass.
23. The method of any one of claims 1 to 22, wherein the insect or insect cells comprise Trichoplusia ni larvae or Trichoplusia ni insect cells.
24. A composition comprising one or more very long chain fatty acids (VLCFA) prepared by the method of any one of claims 1 to 23.
25. A composition comprising biomass from an insect or an insect cell expressing one or more heterologous VLCFA elongases.
26. The composition of claim 24 or claim 25, wherein the VLCFA comprises 24-40 carbons.
27. The composition of any one of claims 24 to 26, wherein the composition is formulated as a food material or a food supplement.
28. A method of treating a subject with age-related macular degeneration or Stargardt disease type 3, comprising administering to the subject an effective amount of the composition of any one of claims 24 to 27.
29. A baculovirus vector comprising one or more nucleic acids encoding a very long chain fatty acid (VLCFA) elongase.
30. The vector of claim 29, wherein the one or more nucleic acids encoding the VLCFA elongase comprise a nucleic acid encoding one or more of ELOVL fatty acid elongase 2 (ELOVL2), ELOVL fatty acid elongase 4 (ELOVL4), ELOVL fatty acid elongase 5 (ELOVL5), and ELOVL fatty acid elongase 3 (ELOVL3).
31. The vector of claim 29 or claim 30, wherein the nucleic acid encoding the VLCFA elongase is codon-optimized for expression in insect cells.
32. The vector of claim 29 or claim 30, wherein the VLCFA elongase is ELOVL2 and the nucleic acid encodes an amino acid sequence with at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 1.
33. The vector of claim 32, wherein the nucleic acid encodes an ELOVL2 comprising the amino acid sequence of SEQ ID NO: 1.
34. The vector of claim 33, wherein the ELOV2 is encoded by a nucleic acid sequence with at least 95% sequence identity to the nucleic acid sequence of SEQ ID NO: 2.
35. The method of claim 34, wherein the ELOVL2 is encoded by the nucleic acid sequence of SEQ ID NO: 2.
36. The vector of claim 29 or claim 30, wherein the VLCFA elongase is ELOVL4 and the nucleic acid encodes an amino acid sequence with at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 3.
37. The vector of claim 36, wherein the nucleic acid encodes an ELOVL4 comprising the amino acid sequence of SEQ ID NO: 3.
38. The vector of claim 37, wherein the ELOV4 is encoded by a nucleic acid sequence with at least 95% sequence identity to the nucleic acid sequence of SEQ ID NO: 4.
39. The vector of claim 38, wherein the ELOVL4 is encoded by the nucleic acid sequence of SEQ ID NO: 4.
40. The vector of any one of claims 30 to 39, wherein the nucleic acid encoding the one or more heterologous VLCFA elongases further comprises a nucleic acid encoding a signal peptide, a tag, or a combination thereof.
41. The vector of claim 40, wherein the signal peptide comprises a bombyxin signal peptide.
42. The vector of claim 41, wherein the bombyxin signal peptide comprises the amino acid sequence of SEQ ID NO: 5.
43. The vector of claim 40, wherein the tag comprises a FLAG tag.
44. The vector of claim 43, wherein the FLAG tag comprises the amino acid sequence of SEQ
ID NO 6.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063051520P | 2020-07-14 | 2020-07-14 | |
| US63/051,520 | 2020-07-14 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022015699A1 true WO2022015699A1 (en) | 2022-01-20 |
Family
ID=77519740
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/041381 Ceased WO2022015699A1 (en) | 2020-07-14 | 2021-07-13 | Methods to produce very long chain fatty acids |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2022015699A1 (en) |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009097331A1 (en) * | 2008-01-28 | 2009-08-06 | The Board Of Regents Of The University Of Oklahoma | Very long chain polyunsaturated fatty acids, methods of production, and uses |
| WO2010057246A1 (en) * | 2008-11-18 | 2010-05-27 | Commonwealth Scientific Industrial Research Organisation | Enzymes and methods for producing omega-3 fatty acids |
| WO2011053892A1 (en) * | 2009-10-31 | 2011-05-05 | Martek Biosciences Corporation | Synthesis and use of omega-3 and omega-6 very long chain polyunsaturated fatty acids (vlc-pufa) |
| WO2019241728A1 (en) * | 2018-06-15 | 2019-12-19 | Youhealth Biotech, Limited | Composition and methods for modulation of elovl2 |
-
2021
- 2021-07-13 WO PCT/US2021/041381 patent/WO2022015699A1/en not_active Ceased
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009097331A1 (en) * | 2008-01-28 | 2009-08-06 | The Board Of Regents Of The University Of Oklahoma | Very long chain polyunsaturated fatty acids, methods of production, and uses |
| WO2010057246A1 (en) * | 2008-11-18 | 2010-05-27 | Commonwealth Scientific Industrial Research Organisation | Enzymes and methods for producing omega-3 fatty acids |
| WO2011053892A1 (en) * | 2009-10-31 | 2011-05-05 | Martek Biosciences Corporation | Synthesis and use of omega-3 and omega-6 very long chain polyunsaturated fatty acids (vlc-pufa) |
| WO2019241728A1 (en) * | 2018-06-15 | 2019-12-19 | Youhealth Biotech, Limited | Composition and methods for modulation of elovl2 |
Non-Patent Citations (23)
| Title |
|---|
| "GenBan", Database accession no. NM_022726 |
| "GenBank", Database accession no. NM 0012428311 |
| AGBAGA ET AL., J. LIPID RES., vol. 51, 2010, pages 1624 - 1642 |
| AKASHI, CURR. OPIN. GENET. DEV., vol. 11, 2001, pages 660 - 666 |
| ALDAHMESH E, AM. J. HUM. GENET., vol. 89, 2011, pages 745 - 750 |
| ALDAHMESH ET AL., , AM. J. HUM. GENET., vol. 89, 2011, pages 745 - 750 |
| DO ET AL., PROC. NATL. ACAD. SCI. USA, vol. 116, 2019, pages 24317 - 24325 |
| DURET, CURR. OPIN. GENET. DEV., vol. 12, 2002, pages 640 - 9 |
| FURLAND ET AL., J. BIOL. CHEM., vol. 282, 2007, pages 18141 - 18150 |
| HOPIAVUORI ET AL., , PROG. RETIN. EYE RES., vol. 69, 2019, pages 137 - 158 |
| IKEMUR, J. MOL. BIOL., vol. 158, 1982, pages 573 - 97 |
| IKEMURA, J. MOL. BIOL., vol. 146, no. 1-21, 1981 |
| NAKAMURA ET AL., NUCLEIC ACIDS RES., vol. 28, 2000, pages 292 |
| OSAWA ET AL., , MICROBIOL. REV., vol. 56, 1992, pages 229 - 264 |
| POULOS ET AL., BIOCHEM. J., vol. 253, 1988, pages 645 - 650 |
| RABIONET ET AL., J. BIOL. CHEM., vol. 283, 2008, pages 13357 - 13369 |
| REZENKA, PROG. LIPID RES., vol. 28, 1989, pages 147 - 187 |
| SANDHOFF ET AL., J. BIOL. CHEM., vol. 280, 2005, pages 27310 - 27318 |
| SASSA ET AL., BIOMOL. THER., vol. 22, 2014, pages 83 - 29 |
| SKOWRONSKA-KRAWCZYK ET AL., , EXP. GERONTOL., vol. 131, 2019, pages 110817 |
| SKOWRONSKA-KRAWCZYK ET AL., ADV. EXP. MED. BIOL., vol. 1185, 2019, pages 39 - 43 |
| VASIREDDY ET AL., , HUM. MOL. GENET., vol. 16, 2007, pages 471 - 482 |
| WITKOWSKI A. ET AL: "FATTY ACID SYNTHASE: IN VITRO COMPLEMENTATION OF INACTIVE MUTANTS", BIOCHEMISTRY, vol. 35, 1996, pages 10569 - 10575, XP000953495, ISSN: 0006-2960, DOI: 10.1021/BI960910M * |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP4317181A1 (en) | Recombinant type-i humanized collagen polypeptide, and preparation method therefor and use thereof | |
| US9637751B2 (en) | Recombinant protein body-inducing polypeptides | |
| US10117433B2 (en) | Pesticides | |
| KR20140117257A (en) | Novel Bacillus thuringiensis gene encoding crystal protein having improved insecticidal activity against lepidopteran insects and preparing method thereof | |
| BRPI0708260A2 (en) | eukaryotic host cell, recombinant protein body-like assemblies, method for preparing a biologically active polypeptide and vaccine or inoculum | |
| Donohue et al. | Heme-binding storage proteins in the Chelicerata | |
| US5501976A (en) | Methods and compositions for the control of the flesh fly | |
| Arenas et al. | A novel antifungal peptide designed from the primary structure of a natural antimicrobial peptide purified from Argopecten purpuratus hemocytes | |
| Zhao et al. | Effect of tandem repeats of antimicrobial peptide CC34 on production of target proteins and activity of Pichia pastoris | |
| Li et al. | Expressional analysis of the silkworm storage protein 1 and identification of its interacting proteins | |
| KR102420699B1 (en) | Novel antimicrobial peptide from starry flounder and uses thereof | |
| KR20010043627A (en) | Recombinant Baculovirus-Based Insecticides | |
| Sumida et al. | Fibroin and sericin-derived bioactive peptides and hydrolysates as alternative sources of food additive for promotion of human health: A review | |
| EP3412772B1 (en) | Transgenic silkworm having mammalian-type sugar chain attached thereto | |
| Yu et al. | Neprilysin, a novel recombinant venom protein from Habrobracon hebetor, influenced host immunity in vitro | |
| Fisch et al. | Flo antibacterial peptide from the tropical tree Moringa oleifera: A template for novel antibacterial agents | |
| WO1998042748A1 (en) | New synthetic polypeptide | |
| KR102569795B1 (en) | Ubiquitin-related novel antimicrobial peptide derived from starry flounder and uses thereof | |
| KR102569799B1 (en) | Novel antimicrobial peptide from ubiquitin of starry flounder and uses thereof | |
| Chen et al. | Manduca sexta Perilipin 1B: A new PLIN1 isoform linked to fat storage prior to pupation | |
| CN101675167B (en) | Production of recombinant insulin-like growth factor-i (igf-i) and insulin-like growth factor binding protein-3 (igfbp-3) in transgenic monocots | |
| KR20230141307A (en) | Growth-blocking peptide of Apis mellifera and use thereof | |
| FR2810993A1 (en) | ANTIMICROBIAL PEPTIDES OF THE FAMILY OF DEFENSINS, POLYNUCLEOTIDES ENCODING THESE PEPTIDES, VECTORS AND TRANSFORMED ORGANISMS CONTAINING THEM | |
| WO2022221299A1 (en) | Insect products and methods of producing same | |
| Goo et al. | Effect of a Bombyx mori Protein Disulfide Isomerase on Production of Recombinant Antibacterial Peptides |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21762164 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 21762164 Country of ref document: EP Kind code of ref document: A1 |