WO2021247925A1 - Structure-guided immunotherapy against sars-cov-2 - Google Patents

Structure-guided immunotherapy against sars-cov-2 Download PDF

Info

Publication number
WO2021247925A1
WO2021247925A1 PCT/US2021/035782 US2021035782W WO2021247925A1 WO 2021247925 A1 WO2021247925 A1 WO 2021247925A1 US 2021035782 W US2021035782 W US 2021035782W WO 2021247925 A1 WO2021247925 A1 WO 2021247925A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
antigen
seq
binding
cov
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/035782
Other languages
French (fr)
Inventor
Davide Corti
Gyorgy Snell
Nadine CZUDNOCHOWSKI
David VEESLER
Alexandra C. WALLS
Young-Jun Park
M. Alejandra TORTORICI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Humabs Biomed SA
University of Washington
Vir Biotechnology Inc
Original Assignee
Humabs Biomed SA
University of Washington
Vir Biotechnology Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Humabs Biomed SA, University of Washington, Vir Biotechnology Inc filed Critical Humabs Biomed SA
Publication of WO2021247925A1 publication Critical patent/WO2021247925A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/102Coronaviridae (F)
    • C07K16/104Severe acute respiratory syndrome coronavirus 2 [SARS‐CoV‐2]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • Figures 1A and IB show data from a neutralization of infection assay using SARS-CoV-2 virus.
  • Serial dilutions of human monoclonal antibodies were incubated with 10 2 focus-forming units of SARS-CoV-2 strain 2019n-CoV/USA_WAl/2020 (obtained from the CDC) for 1 hour at 37 °C.
  • SARS-CoV-2 -infected cell foci were visualized using TruBlue peroxidase substrate (KPL) and quantitated on an ImmunoSpot microanalyzer (Cellular Technologies). Data were processed using Prism software (GraphPad Prism 8.0).
  • Figure 1 A shows results for four exemplary antibodies and comparator antibody S309.
  • Figure IB shows results for six exemplary antibodies, with calculated EC50 values to the right of the graph.
  • Figure 2 shows neutralization of SARS-CoV-2 infection by monoclonal antibodies S309, S2H14, and S2X2.
  • the antibodies were tested individually (left panel), in two-antibody combinations (center panel), and in a three-antibody combination (right panel). For combinations, antibodies were used at 1 : 1 and 1:1:1 ratios. Calculated EC50 values for each antibody or antibody combination are shown below each graph.
  • Figure 3 shows neutralization of SARS-CoV-2 infection by monoclonal antibodies S309, S2H14, and S2A4.
  • the antibodies were tested individually, in two antibody combinations, and in a three-antibody combination, as shown in the legend.
  • S2H14 and/or S2A4 were used at a concentration of 5 pg/ml and S309 was used at the concentrations indicated on the x-axis.
  • Figure 4 summarizes results of quantitative epitope-specific serology studies using monoclonal antibody S309 and other anti-Spike antibodies, as determined by binding competition, cryo-EM, and crystallography data. Underlined and bolded antibodies are cross-reactive with SARS-CoV-1.
  • Figures 5A-5C show data from a neutralization of infection assay using SARS- CoV-2 virus. Serial dilutions of human monoclonal antibodies were incubated with 102 focus-forming units of SARS-CoV-2 strain 2019n-CoV/USA_WAl/2020 (obtained from the CDC) for 1 hour at 37 °C. SARS-CoV-2-infected cell foci were visualized using TruBlue peroxidase substrate (KPL) and quantitated on an ImmunoSpot microanalyzer (Cellular Technologies). Data were processed using Prism software (GraphPad Prism 8.0).
  • Figure 5A shows results for antibody S2X190 and four comparator antibodies.
  • Figure 5B shows results for antibody S2X129 and four comparator antibodies.
  • Figure 5C shows results for antibodies S2X132 and S2X127, along with 4 comparator antibodies. Calculated EC50 values are shown to the right of each graph.
  • Figure 6 shows a cryoEM structure of the prefusion SARS-CoV-2 S ectodomain trimer with three S2X259 Fab fragments bound to three open RBDs viewed along two orthogonal orientations. N-linked glycans are rendered as dark grey spheres.
  • S2X259 recognizes a glycan-free, cryptic epitope within antigenic site Ila, which was defined based on the S2X35 mAb isolated from the same donor (See Piccoli et al. Mapping Neutralizing and Immunodominant Sites on the SARS-CoV-2 Spike Receptor-Binding Domain by Structure-Guided High-Resolution Serology. Cell 183, 1024-1042.
  • S2X259 binding appears to require opening of two RBDs to grant access to the Fab in the context of the S trimer.
  • S2X259 contacts the RBD using both heavy and light chains, which contribute approximately two thirds and one third of the -950 Al paratope surface buried upon binding, respectively.
  • S2X259 uses complementary determining regions (CDRs) H1-H3, LI and L3 to contact RBD residues 369-386, which form two a-helices and an intervening b- strand belonging to the structurally conserved RBD b-sheet, as well as the residues 404- 411 and 499-508 which form a continuous surface made up of an a-helix and a loop followed by an a-helix, respectively.
  • CDRs complementary determining regions
  • Figure 7 shows a model of S2X259 binding with SARS-CoV-2 RBD.
  • the binding pose involves contacts with multiple RBD regions. Residues corresponding to prevalent RBD mutations are shown as light grey spheres. N-linked glycans are rendered as dark grey spheres.
  • Figure 8 shows selected interactions formed between S2X259 and the SARS- CoV-2 RBD.
  • Figure 9 shows a map of mutations reducing S2X259 binding using DMS.
  • Figure 10 shows selection of the G504D mutation as single neutralization escape mutant using a replicating SARS-CoV-2 S VSV system.
  • Figure 11 shows a detailed view of the S2X259/RBD interface showing G504D in RBD.
  • Figures 12A and 12B show data from neutralization tests with S2E12 and S230 control mAbs against VSV pseudotypes harbouring the S glycoprotein of SARS-CoV-
  • Figure 12A shows data for SARS-CoV-
  • Figure 12B shows data for SARS-CoV-1 and related strains.
  • Figure 13 shows representative electron micrographs (upper panels) and class averages (lower panels) of SARS-CoV-2 S in complex with the S2X259 Fab.
  • Figure 14 shows gold-standard Fourier shell correlation curves for the S trimer bound to three S2X259 Fabs (solid black line) and the locally refined reconstruction of the RBD/S2X259 variable domains.
  • the 0.143 cutoff is indicated by horizontal dashed lines.
  • Figure 15 shows a local resolution map for the open S trimer bound to three S2X259 (left panel) and the locally refined reconstruction of the RBD/S2X259 variable domains (right panel).
  • FIG. 16 shows the cryoEM data processing flow-chart.
  • Figure 17 shows a ribbon diagram showing a superimposition of the S2X259- bound and S2A4-bound (PDB 7JVA) SARS-CoV-2 RBD (Piccoli et al 2020).
  • the SARS-CoV glycan at position N357 was modelled based on the S230-bound SARS- CoV S structure (PDB 6NB630) and is predicted to sterically hinder S2A4 binding (red star) but not S2X259.
  • a portion of the mAh heavy chains are indicated with arrows; S2X259 light chain is adjacent the S2X259 heavy chain and shown at the upper left portion of the figure; a portion of the S2A4 light chain is shown generally beneath the S2X259 light chain portion.
  • N-linked glycans are rendered as dark spheres.
  • Figure 18 shows S2X259 Fc-mediated activation of FcyRIIa and FcyRIIIa in vitro.
  • NFAT-driven luciferase signal induced in Jurkat cells stably expressing FcyRIIa H131 (left panel) variant or FcyRIIIa V158 (right panel) variant by S2X259 binding to full-length wild-type SARS-CoV-2 S on ExpiCHO target cells.
  • SE12, S2M11, S309, S309-GRLR mAbs are included as controls.
  • FIG 19 shows S2X259 Fc-mediated activation of FcyRIIa and FcyRIIIa in vitro.
  • NFAT-driven luciferase signal induced in Jurkat cells stably expressing FcyRIIa H131 (left panel) variant or FcyRIIIa V158 (right panel) variant by S2X259 binding to uncleavable full-length pre-fusion stabilized SARS-CoV-2 S (unable to release the SI subunit) transiently expressed in ExpiCHO cells.
  • SE12, S2M11, S309, and S309- GRLR mAbs are included as controls.
  • Figure 20 shows site I-targeting SE12, site II-targeting S2X259, and site IV- targeting S309 mAb binding to immobilized SARS-CoV-2 RBD.
  • Figure 21 shows RBD binding to S2X259 and ACE2.
  • S2X259 and ACE2 bind partially overlapping binding sites on the SARS-CoV-2 RBD.
  • Figures 22A and 22B show biolayer interferometry binding analysis of the S2X259 Fab to wildtype or VOC SARS-CoV-2 biotinylated RBDs immobilized at the surface of SA biosensors.
  • Figure 22A shows analysis of S2X259 Fab binding to SAR.S- CoV-2 wildtype RBD (left graph) and SARS-CoV-2 variant B.1.1.7 RBD (right graph).
  • Figure 22B shows analysis of S2X259 Fab binding to SARS-CoV-2 variant B.1.351 (left graph) and SARS-CoV-2 variant P.l (right graph).
  • Figures 23A-23C show description of cohorts of SARS-CoV-2-infected individuals.
  • A Summary of patient demographics.
  • B Age distribution of hospitalized, symptomatic and asymptomatic individuals.
  • C Time interval between the date of sample collection and the date of symptom onset.
  • Figures 24A-24G show analysis of serum/plasma IgG binding titers to SAR.S- CoV-2 and SARS-CoV antigens.
  • A-C IgG
  • B IgA
  • C binding titers to SARS-CoV-2 S, RBD and N from 67 and 154 samples collected from hospitalized and symptomatic individuals, respectively, whose date of symptom onset was known.
  • D Correlation between SARS-CoV-2 S- and N-specific IgG binding titers (ED50).
  • E and F IgG binding titers to SARS-CoV-2 and SARS-CoV S (E) and RBD (F) from 19 hospitalized, 130 symptomatic and 8 asymptomatic individuals.
  • G Ratios of SARS- CoV-2/SARS-CoV S and RBD IgG binding titers.
  • Figures 25A-25J show characteristics of six probe monoclonal antibodies used for structural and epitope-mapping studies.
  • A V(D)J usage, percentage identity to germline, number of somatic mutations, source and time interval between sample collection and mAb isolation, RBD site recognized and neutralization potency of the 6 mAbs.
  • B mem memory B cell; PC, plasma cells.
  • B Binding of the 6 mAbs to the SARS-CoV-2 (up) or SARS-CoV (down) RBD analyzed by ELISA.
  • C Competition matrix for binding of each of the six mAbs in presence of another mAb evaluated by biolayer interferometry.
  • FIG. 1 Western-blot analysis (top) of the prefusion-stabilized SARS-CoV-2 S ectodomain trimer in presence of S2A4, S304 or S2X35 Fab after incubation for the indicated amount of times. Red ponceau staining (bottom) of the SDS-PAGE gel used for carrying out the western blot confirming the presence of added Fabs when indicated.
  • H Analysis of activation of FcyRIIIa (V158 allele) expressed on Jurkat cells by SARS-CoV-2 S stably transfected CHO cells incubated with mAbs. GRLR indicates an antibody Fc variant carrying mutations that abolish binding to FcyRs.
  • Figures 26A-26B show conservation analysis across Clades of Sarbecoviruses.
  • A-l-A-4 S glycoprotein residues making contact with S304, S2H13, S2H14 or S2A4 across sarbecovirus clades. Residue numbers for both SARS-CoV-2 S and SARS-CoV S are shown. Multiple sequence alignment was performed using MAFFT. A dash represents the same residue, a strikethrough represents a gap. Asterisk (*) indicates manually aligned residues.
  • Civet SARS-CoV is SARS-CoV HC/SZ/61/03 and raccoon dog SARS-CoV is SARS-CoV A031G.
  • Figures 27A and 27B show analysis of Fab and IgG binding to the prefusion SARS-CoV-2 S ectodomain trimer and recombinant RBD at neutral and acidic pH analyzed by surface plasmon resonance.
  • a and B SARS-CoV-2 S or RBD was captured on the sensor chip surface and binding at multiple mAb concentrations was measured.
  • Neutral pH measurements were performed in multi-cycle format (A) and acidic pH measurements in single-cycle format (B). All data have been fit to a 1:1 binding model, which is an approximation for the S-binding data, since the kinetics incorporate conformational dynamics between open and closed RBD states, and because IgG binding involves avidity.
  • the solid gray horizontal line gives the predicted maximum signal (saturation) based on each fit; the dashed line shows the S309 maximum binding for comparison.
  • Asterisk indicates where a high concentration of S304 IgG was binding to the reference surface (fit was to the first two concentrations only). All mAbs bind similarly to the RBD at both pHs, but the mAbs that bind to only open RBD show a maximum below S309 in the context of the S trimer. This difference is dramatic at acidic pH where RBDs are primarily in the closed state (Zhou et ah, 2020b). S2X35 was an exception, likely because its very slow off rate allows it to bias the S equilibrium toward open RBD.
  • Figures 28A-28I shows analysis of the specificity of IgG, IgA, and IgM serum/plasma Abs from a panel of 647 hospitalized, symptomatic, and asymptomatic SAR.S-CoV-2-infected individuals.
  • (D) Binding titers (ED50) of S- and N-specific IgGs measured in sera from symptomatic and asymptomatic SAR.S-CoV-2-infected individuals from the Ticino healthcare workers cohort (n 459) categorized according to symptoms severity, as described in the methods.
  • Figures 29A-29H show kinetics of IgG Responses Specific for the SARS-CoV- 2 RBD and Blocking RBD Attachment to ACE2.
  • A Binding titers (ED50) of serum or plasma IgG to the SARS-CoV-2 RBD measured at two time points separated by an average time of 44 days in 368 subjects. Tl, time of first blood draw; T2, time of second blood draw.
  • B Variation of RBD-specific IgG binding titers from Tl to T2.
  • C Kinetics of RBD- and N-specific IgG responses in serum or plasma from 24 convalescent individuals (red, hospitalized; blue, symptomatic non-hospitalized). The starting time point corresponds to the date of collection of the first sample.
  • D Model predicted longitudinal decline of RBD- and N-specific IgG binding titers from 18 convalescent individuals with respect to the onset of symptoms from infection.
  • E Serum or plasma titers of Abs blocking RBD attachment to ACE2 (BD80) measured at Tl and T2.
  • F Variation of RBD-specific IgG binding titers and titers of Abs blocking RBD attachment to ACE2 (BD80) from Tl to T2.
  • G Avidity index of serum IgG binding to RBD (%) measured at Tl and T2.
  • H Variation of avidity index of IgG binding to RBD (%) from Tl to T2.
  • Figures 30A-30H show that S2H13 mAb inhibits SARS-CoV-2 by blocking attachment to ACE2 via recognition of an epitope accessible in the open and closed S conformations.
  • SARS-CoV-2 S pseudovirus neutralization assay indicating an IC50 of 500 ng/mL.
  • B and C Molecular surface representation of the SARS-CoV-2 S/S2H13 Fab complex structure with three RBDs closed shown in two orthogonal orientations.
  • D Molecular surface representation of the SARS-CoV-2 S/S2H13 Fab complex structure with one RBD open. Each SARS-CoV-2 protomer of the trimer is shaded differently, and N-linked glycans are rendered as dark spheres.
  • the S2H13 light and heavy chain variable domains are identified - light chain variable domain with lighter shading, heavy chain variable domain with darker shading.
  • S2H13 recognizes a crevice formed by the SARS-CoV-2 RBM. Selected side chains at the interface are shown.
  • S2H13 and ACE2 (dark green) bind overlapping RBM epitope. The star indicates steric clashes.
  • G BLI binding competition between S2H13 and ACE2 for binding to the SARS-CoV-2 RBD.
  • H Molecular surface representation of the SARS-CoV-2 RBD (gray) with the S2H13 epitope colored by residue conservation across SARS-CoV-2 isolates and SARS-CoV.
  • Figures 31A-31I show that S2H14 mAh inhibits SARS-CoV-2 by blocking attachment to the ACE2 receptor.
  • A SARS-CoV-2 S pseudovirus neutralization assay indicating an IC50 of 900 ng/mL.
  • B and C Molecular surface representation of the SARS-CoV-2 S/S2H14 Fab complex structure with two RBDs open and one RBD closed viewed along two orthogonal orientations.
  • D and E Molecular surface representation of the SARS-CoV-2 S/S2H14 Fab complex structure with three RBDs open shown in two orthogonal orientations. Each SARS-CoV-2 protomer is shaded distinctly, and N-linked glycans are rendered as dark spheres.
  • S2H14 light and heavy chain variable domains are shaded distinctly.
  • S2H14 binds to an epitope within the SARS-CoV-2 RBM.
  • S2H14 and ACE2 bind overlapping RBM epitope. The red star indicates steric clashes.
  • H BLI binding competition between S2H14 and ACE2 for binding to the SAR.S-CoV-2 RBD.
  • I Molecular surface representation of the SAR.S-CoV-2 RBD (gray) with the S2H14 epitope colored by residue conservation across SAR.S-CoV-2 isolates and SARS-CoV.
  • Figures 32A-32H show that S2A4 mAh promotes SAR.S-CoV-2 S opening through binding to a cryptic epitope.
  • A SAR.S-CoV-2 S pseudovirus neutralization assay indicating an IC50 of 3.5 mg/mL.
  • B and C Molecular surface representation of the SARS-CoV-2 S/S2A4 Fab complex cryo-EM structure with three RBDs open viewed along two orthogonal orientations. Each SARS-CoV-2 protomer is shaded distinctly, and N-linked glycans are rendered as dark spheres. The S2A4 light and heavy chain variable domains are shaded differently, as shown in the figure key.
  • Figures 33A-33H show that S304 mAh promotes SARS CoV-2 S Opening through binding to a cryptic epitope conserved within the Sarbecovirus subgenus.
  • a and B Molecular surface representation of the SARS-CoV-2 S/S304 Fab complex cryo-EM structure with three RBDs opened viewed along two orthogonal orientations. Each SARS-CoV-2 S protomer is shaded distinctly (see figure key), and N-linked glycans are rendered as dark spheres. The S304 light and heavy chains are shaded differently, as shown in the figure key.
  • C Cryo-EM reconstruction of the SI subunit trimer (with disordered S2) bound to three S304 Fabs viewed along two orthogonal orientations and the corresponding atomic model fit in density.
  • Each SAR.S- CoV-2 SI protomer is shaded distinctly.
  • the S304 light and heavy chain variable domains are shaded distinctly.
  • D Ribbon diagram of the crystal structure of S304, S2H14, and S309 in complex with the SARS-CoV-2 RBD. Only the S304 variable domains are shown, whereas S2H14 and S309 were omitted for clarity.
  • E Positioning of ACE2 relative to the S304 Fab bound to the SARS-CoV-2 RBD.
  • ACE2 N-linked glycans at position N322 and N546 are indicated, as they could putatively clash with S304.
  • F Molecular surface representation of the SARS CoV-2 RBD (gray) with the S304 epitope colored by residue conservation with SARS-CoV.
  • G and H Positioning of ACE2 (relative to the S2A4 (G) and S2X35 (H) Fabs bound to the SARS-CoV-2 RBD. The stars indicate steric clashes.
  • Figures 34A-34L show structure-guided high-resolution serology.
  • A Composite model of the SARS-CoV-2 S trimer with three open RBDs viewed along two orientations with all six mAbs used for competition ELISA shown bound to one RBD.
  • B-G Epitopes recognized by each mAh are shown on the surface of the RBD for S2H14 (teal, B), S2H13 (orange, C), S2X35 (red, D), S2A4 (yellow, E), S304 (magenta, F), and S309 (purple, G).
  • the glycan at position N343 is rendered as blue spheres and the RBM is shown as a black outline.
  • H-J Competition ELISA (blockade-of-binding) between individual mAbs and sera or plasma from hospitalized (H), symptomatic (I), and asymptomatic (J) COVID-19 convalescent subjects.
  • H symptomatic
  • J asymptomatic
  • K Correlation analysis of titers of serum Abs blocking RBD binding to ACE2 and Abs blocking each of the six probe mAbs.
  • L Comparison of RBD-specific IgG titers between sera containing Ab blocking at least one probe mAb and sera that do not contain Ab blocking any of the six probe mAbs.
  • Figures 35A-35G show that S2E12 and S2M11 neutralize SARS-CoV-2 via targeting the RBD.
  • A-B Neutralization of authentic SARS-CoV-2 (SARS-CoV-2-Nluc) by S2E12 (A) and S2M11 (B) IgG or Fab. Symbols are means+SD of triplicates. Dotted lines indicate ICso and IC90 values. Average IC50 values are indicated in parentheses below the graphs (determined from two independent experiments).
  • C-F The number of the number of SARS-CoV-2-Nluc.
  • Figures 36A-36D show that S2E12 neutralizing mAb recognizes the SARS- CoV-2 RBM.
  • A-B CryoEM structure of the prefusion SARS-CoV-2 S ectodomain trimer with three S2E12 Fab fragments bound to three open RBDs viewed along two orthogonal orientations.
  • C The S2E12 concave paratope recognizes the convex RBM tip.
  • D Close-up views showing selected interactions formed between S2E12 and the SARS-CoV-2 RBD.
  • each SARS-CoV-2 S protomer is shaded distinctly whereas the S2E12 light and heavy chain variable domains are also shaded differently from one another.
  • N-linked glycans are rendered as dark spheres in (A)-(C).
  • Figures 37A-37F show that S2M11 neutralizing mAh recognizes a quaternary epitope spanning two RBDs and stabilizes S in the closed state.
  • A-B CryoEM structure of the prefusion SARS-CoV-2 S ectodomain trimer bound to three S2M11 Fab fragments viewed along two orthogonal orientations.
  • C-D The S2M11 binding pose, which involves a quaternary epitope spanning two neighboring RBDs.
  • E-F Close-up views showing selected interactions formed between S2M11 and the SARS-CoV-2 RBDs.
  • each SARS-CoV-2 S protomer is shaded distinctly whereas the S2M11 light and heavy chain variable domains are also shaded distinctly.
  • N-linked glycans are rendered as dark spheres in (A)-(D) and as sticks in (E)-(F).
  • FR framework.
  • Figures 38A-38I show that S2E12 and S2M11 prevent SARS-CoV-2 S attachment to ACE2, inhibit membrane fusion and S2M11 triggers effector functions.
  • S2E12 and ACE2 bind overlapping binding sites on the SARS-CoV-2 RBD.
  • S2M11 and ACE2 bind overlapping binding sites on the SARS-CoV-2 RBD.
  • the stars indicate steric clashes.
  • S309* in the figure is an engineered version of the parent S309 mAh , and comprises the VH amino acid sequence of SEQ ID NO.:93 and the VL amino acid sequence of SEQ ID NO.:97.
  • KB kinetic buffer (negative control).
  • E Binding of varying concentrations of S2E12 (blue), S2M11 (red) or S309 (yellow) mAbs to full-length S expressed at the surface of CHO cells in the presence of 20 pg/mL of the ACE2 ectodomain analyzed by flow cytometry (one measurement per condition).
  • F Cell-cell fusion inhibition assay with VeroE6 cells transfected with SARS-CoV-2 S and incubated with varying concentrations of S2E12 (blue), S2M11 (red) or S309 (yellow) mAbs and a control mAh. The values are normalized to the percentage of fusion without mAh and to the percentage of fusion of non-transfected cells.
  • concentration of the constant mAh was 5 mg/ml.
  • concentration of the diluted mAh is indicated on the x axis.
  • H ADCC using primary NK cells as effectors and SARS-CoV-2 S-expressing CHO cells as targets.
  • the magnitude of NK cells-mediated killing is expressed as the area under the curve (AUC) for each mAh used at concentrations ranging between 0.1 ng/ml and 20 pg/ml.
  • AUC area under the curve
  • Figures 39A-39C show in vivo protection of S2E12, S2M11 or cocktails of these two mAbs against SARS-CoV-2 challenge.
  • Syrian hamsters were injected with the indicated amount of mAh 48 h before intra-nasal challenge with SARS-CoV-2.
  • A Quantification of viral RNA in the lungs 4 days post infection.
  • B The concentration of mAbs measured in the serum before infection (day 0) inversely correlates with the viral RNA load in the lung 4 days post infection.
  • C Quantification of replicating virus in lung homogenates harvested 4 days post infection using a TCID50 assay. For mAh cocktails, the total dose of an equimolar mixture of both mAbs is indicated.
  • Figures 40A-40C show neutralization of SARS-CoV-2 S pseudotyped and authentic viruses by S2E12 and S2M11.
  • A Neutralization assay with SARS-CoV-2 S- VSV. Symbols represent means+SD of triplicates.
  • B Neutralization assay with SAR.S- CoV-2 S-MLV. Symbols represent means of duplicates.
  • C Neutralization of authentic virus using a focus-forming-assay. The determined mean and range of ICso and IC90 values for each mAh tested are indicated. Symbols represent means of duplicates. Results are combined from one to seven individual experiments for each mAh and (pseudotyped) virus.
  • Figures 41A-41C show binding analysis of monoclonal antibodies (mAbs) S2M11, S2E12 and S309.
  • mAbs monoclonal antibodies
  • S2M11, S2E12 and S309 mAb binding to the immobilized SARS-CoV-2 RBD or the S ectodomain trimer was evaluated by SPR at pH7.4 and pH5.4. The order of addition of the first and second mAb is indicated above and below the graph, respectively. The experiment was performed once.
  • B mAb binding to SARS-CoV-2 S expressed at the surface of ExpiCHO cells analyzed by flow cytometry.
  • Figures 42A-42G show cryo-electron microscopy data processing and validation of the S/S2E12 complex dataset.
  • A-B Representative electron micrograph (A) and class averages (B) of SARS-CoV-2 S in complex with the S2E12 Fab embedded in vitreous ice. Scale bar: 500 A.
  • C Gold-standard Fourier shell correlation curves for the open S trimer bound to three S2E12 Fabs (solid black line) and the locally refined reconstruction of the RBD/S2E12 variable domains. The 0.143 cutoff is indicated by horizontal dashed lines.
  • D-E Local resolution map calculated using cryoSPARC for the open S trimer bound to three S2E12 Fabs (D) and the locally refined reconstruction of the RBD/S2E12 variable domains (E).
  • E the RBD/S2E12 variable domains
  • F Close-up view showing selected interactions formed between S2E12 (light and heavy chain are shaded lighter and darker, respectively) and the SARS-CoV-2 RBD with the corresponding region of cryoEM density (transparent grey surface).
  • G CryoEM data processing flow chart.
  • Figures 43A-43D show epitopes targeted by S2E12 and S2M11 on the SARS- CoV-2 S trimer.
  • A-B The S2E12 footprint is shown in purple on one protomer of the closed (A) or open (B) SARS-CoV-2 S trimer.
  • C-D The quaternary S2M11 footprint is shown in purple on two neighboring protomers of the closed (A) or open (B) SARS- CoV-2 S trimer.
  • the SARS-CoV-2 S is rendered as a molecular surface colored distinctly for each protomer (cyan, pink and gold).
  • Figures 44A-44G show cryo-electron microscopy data processing and validation of the S/S2M11 complex dataset.
  • A-B Representative electron micrograph (A) and class averages (B) of SARS-CoV-2 S in complex with the S2M11 Fab embedded in vitreous ice. Scale bar: 500 A.
  • C Gold-standard Fourier shell correlation curves for the closed S2M11-bound trimer. The 0.143 cutoff is indicated by horizontal dashed lines.
  • D Local resolution map calculated using cryoSPARC.
  • Figures 45A-45E show effector functions of individual monoclonal antibodies and monoclonal antibody cocktails.
  • A-B Binding of S2E12, S2M11 and S309 to the surface of VeroE6 cells infected with authentic SARS-CoV-2.
  • Flow cytometry graphs showing the binding of mAbs at a concentration of 10 pg/ml or the secondary Ab only as a negative control (2ry Ab only) (A).
  • Data for the binding of mAbs at 0.1, 1 and 10pg/ml (B). Results are from one out of two independent experiments with similar results.
  • Figures 46A-46J shows neutralization of known SARS-CoV-2 S variants by monoclonal antibody cocktails.
  • A-F S2M11 (A and B) and S2E12 (C and D)- mediated neutralization of SARS-CoV-2 S-VSV variants.
  • SARS-CoV-2 S mutations in the variants tested are indicated in the legend. Symbols show means+SD of triplicates for A-D and means of duplicates for E and F.
  • G Variant prevalence of amino acids targeted by S2M11 based on 90,287 complete genome sequences reported by GISAID as of September 12th 2020. At least 4 supporting sequences were required to define a variant.
  • Figure 47 shows ACE2 binding to variant SARS-CoV-2 S corresponding to circulating isolates. Binding of fluorescently labeled recombinant ACE2 ectodomain to ExpiCHO cells transiently transfected with SARS-CoV-2 S variants. The experiment was performed twice with similar results.
  • Figures 48A-48F shows data evaluating neutralization potency of monoclonal antibody cocktails.
  • A Neutralization matrix to assess the synergistic activity of S2M11 and S2E12 mAh cocktails in vitro with authentic SARS-CoV-2 -Nluc.
  • B-C Neutralization matrix for S2M11 in combination with S2E12 tested with SARS-CoV-2 VSV (B) and SARS-CoV-2 MLV (C).
  • D-E Neutralization matrix for S309 in combination with S2M11 tested with SARS-CoV-2-MLV (D) and SARS-CoV-2 VSV (E).
  • F Neutralization matrix for S309 in combination with S2E12, tested with SARS- CoV-2 VSV.
  • Figure 50 shows cryoEM data collection and refinement statistics for investigating binding of S2M11 and S2E12 to S glycoprotein.
  • Figure 51 shows x-ray crystallography data collection and refinement statistics for investigating binding of S2E12 Fab to S glycoprotein.
  • Figure 52 shows binding of S2M11, S2E12 and S309 mAbs to SARS-CoV-2 S variants expressed at the surface of CHO cells and assessed by flow cytometry +: no loss of binding. loss of binding.
  • Figures 53A-53K show cryo-EM data processing and validation of the S/S2H13 and S/S2H14 complex datasets.
  • a and B Representative electron micrograph (A) and class averages (B) of SARS-CoV-2 S in complex with the S2H13 Fab embedded in vitreous ice. Scale bar: 400 A.
  • C Gold-standard Fourier shell correlation curves for the closed S2H13-bound trimer (black solid line), partially open S2H13-bound trimer (gray solid line) and locally refined RBM/S2H13 variable domains (black dashed line). The 0.143 cutoff is indicated by horizontal dashed lines.
  • G and H Representative electron micrograph (G) and class averages (H) of SARS-CoV-2 S in complex with the S2H14 Fab embedded in vitreous ice. Scale bar: 400A.
  • Figures 54A-540 show cryo-EM data processing and validation of the S/S2A4 and S/S304 complex datasets.
  • a and B Representative electron micrograph (A) and class averages (B) of SARS-CoV-2 S in complex with the S2A4 Fab embedded in vitreous ice. Scale bar: 400A.
  • a 2D class average corresponding to an SI subunit trimer (with disordered S2) bound to three S2A4 Fabs is highlighted in red.
  • C Gold-standard Fourier shell correlation curves for the S2A4-bound trimer (black solid line) and locally refined RBD/S2A4 variable domains (black dashed line). The 0.143 cutoff is indicated by a horizontal dashed line.
  • antibodies and antigen-binding fragments that are capable of binding to a SARS-CoV-2 S glycoprotein, for example, a S glycoprotein of a S glycoprotein trimer.
  • Presently disclosed antibodies and antigen-binding fragments can, for example, bind by contacting one or more amino acid residues of the S glycoprotein or trimer, recognize an epitope formed by specified amino acid residues of the S glycoprotein or trimer, and/or bind to a S glycoprotein of a trimer wherein the three RBDs of a trimer comprise various conformations (e.g, one RBD up ("open") and two RBDs down ("closed"), two RBDs up and one RBD down, three RBDs up, and/or three RBDs down).
  • antibodies and antigen-binding fragments are useful to target SAR.S-CoV-2 S glycoprotein in a variety of conformations.
  • presently disclosed antibodies and antigen-binding fragments include those that compete with a specified antibody or antigen-binding fragment for binding to a SARS-CoV-2 S glycoprotein.
  • Antibodies were isolated from survivors of SAR.S-C0V or SAR.S-CoV-2 and used to elucidate different antigenic sites and epitopes in SAR.S-CoV-2 S glycoprotein.
  • Mechanisms for binding to and/or neutralizing SAR.S-CoV-2 infection e.g, by binding to SAR.S-CoV-2 S glycoprotein receptor binding domain (RBD) in open, closed, or open and closed conformations; by interfering with S glycoprotein interaction with human ACE2; by locking S glycoprotein RBDs (of a trimer) in a closed conformation
  • High-resolution serology studies of the human antibody response to SAR.S-CoV-2 infection were performed.
  • compositions and combinations that comprise any two or more of the presently disclosed antibodies or antigen-binding fragments.
  • Theantibodies or antigen-binding fragments, compositions, and combinations can, in certain embodiments, provide multiple mechanisms for binding to and, optionally, neutralizing, a SAR.S-CoV-2.
  • Antibody or antigen-binding fragment-encoding polynucleotides and vectors are also provided, as well as host cells that comprise the same and/or that express an antibody or antigen-binding fragment.
  • immunogenic compositions comprising a SAR.S-CoV-2 S polypeptide (i.e., a complete S glycoprotein or a portion thereof, optionally which is comprised in a multimer such as a trimer or a dimer) that is capable of being bound by a presently disclosed antibody or antigen-binding fragment, as well as immunogenic compositions that comprise two or more different such S polypeptides (e.g ., such that two or more different presently disclosed antibodies or antigen-binding fragments can bind to the immunogenic composition). Methods of using the immunogenic compositions are also provided.
  • SAR.S-CoV-2 S polypeptide i.e., a complete S glycoprotein or a portion thereof, optionally which is comprised in a multimer such as a trimer or a dimer
  • immunogenic compositions that comprise two or more different such S polypeptides (e.g ., such that two or more different presently disclosed antibodies or antigen-binding fragments can bind to the immunogenic composition).
  • SARS-CoV-2 also referred to herein as "Wuhan seafood market phenomia virus", or “Wuhan coronavirus” or “Wuhan CoV”, or “novel CoV”, or “nCoV”, or “2019 nCoV”, or “Wuhan nCoV” is a betacoronavirus believed to be of lineage B (sarbecovirus).
  • SARS-CoV-2 was first identified in Wuhan, Hubei province, China, in late 2019 and spread within China and to other parts of the world by early 2020. Symptoms of SARS-CoV-2 infection include fever, dry cough, and dyspnea.
  • SARS-CoV-2 comprises a "spike” or surface (“S") type I transmembrane glycoprotein containing a receptor binding domain (RBD).
  • SARS-CoV-2 comprises a "spike” or surface (“S") type I transmembrane glycoprotein containing a receptor binding domain (RBD).
  • RBD is believed to mediate entry of the lineage B SARS coronavirus to respiratory epithelial cells by binding to the cell surface receptor angiotensin-converting enzyme 2 (ACE2).
  • ACE2 cell surface receptor angiotensin-converting enzyme 2
  • RBM receptor binding motif
  • SARS CoV-2 S glycoproteins naturally form trimers.
  • the RBDs can undergo hinge-like conformational movements between an "open” (receptor-accessible) conformation that generally points “up”, away from the C- terminal end of the S glycoprotein, and a "closed” (receptor-inaccessible) conformation.
  • RBDs of a trimer in an open conformation are depicted in, for example, Figures 33A-33C and 36A-36B.
  • RBDs of a trimer in a closed conformation are depicted in, for example, Figures 37A and 37B.
  • Figures 43A and 43B shown top-down views of a closed S trimer and an open S trimer, respectively.
  • Figures 43C and 43D show top-down views of a closed S trimer and an open S trimer, respectively.
  • certain epitopes may be available for binding only when an RBD is in an open conformation. Certain other epitopes may be available for binding only when an RBD is in a closed conformation. Some epitopes may be available for binding only when one or more RBDs of a trimer is present in an open conformation. Some other epitopes may be available for binding only when one or more RBDs of a trimer is present in a closed conformation. Some epitopes are available when an RBD is in an open conformation or a closed conformation.
  • the amino acid sequence of the Wuhan-Hu-1 surface glycoprotein is provided in SEQ ID NO.:3.
  • the amino acid sequence of SARS-CoV-2 RBD is provided in SEQ ID NO.:4.
  • SARS-CoV-2 S protein has approximately 73% amino acid sequence identity with SARS-CoV-1.
  • the amino acid sequence of SARS-CoV-2 RBM is provided in SEQ ID NO.:5.
  • SARS-CoV-2 RBD has approximately 75% to 77% amino acid sequence similarity to SARS-CoV-1 RBD
  • SARS-CoV-2 RBM has approximately 50% amino acid sequence similarity to SARS-CoV-1 RBM.
  • SARS-CoV-2 includes a virus comprising the amino acid sequence set forth in any one or more of SEQ ID NOs.:2, 3, and 4, optionally with the genomic sequence set forth in SEQ ID NO. : 1.
  • SARS-CoV-2 variants There have been a number of emerging SARS-CoV-2 variants. Some SARS-CoV-2 variants contain an N439K mutation, which has enhanced binding affinity to the human ACE2 receptor (Thomson, E.C., et al., The circulating SAR.S- CoV-2 spike variant N439K maintains fitness while evading antibody-mediated immunity. bioRxiv, 2020).
  • SARS-CoV-2 variants contain an N501 Y mutation, which is associated with increased transmissibility, including the lineages B.l.1.7 (also known as 20E501Y.V1 and VOC 202012/01; (del69-70, dell44, N501Y, A570D, D614G, P681H, T716I, S982A, and D1118H mutations)) and B.1.351 (also known as 20H/501Y.V2; L18F, D80A, D215G, R246I, K417N, E484K, N501Y, D614G, and A701 V mutations), which were discovered in the United Kingdom and South Africa, respectively (Tegally, FL, et al., Emergence and rapid spread of a new severe acute respiratory syndrome-related coronavirus 2 (SARS-CoV-2) lineage with multiple spike mutations in South Africa.
  • SARS-CoV-2 severe acute respiratory syndrome-related coronavirus 2
  • B.1.351 also include two other mutations in the RBD domain of SARS-CoV2 spike protein, K417N and E484K (Tegally, H., et al., Emergence and rapid spread of a new severe acute respiratory syndrome-related coronavirus 2 (SARS-CoV-2) lineage with multiple spike mutations in South Africa. medRxiv, 2020: p. 2020.12.21.20248640).
  • SARS-CoV-2 variants include the Lineage B.1.1.28, which was first reported in Brazil; the Variant P.1, lineage B.1.1.28 (also known as 20J/501Y.V3), which was first reported in Japan; Variant L452R, which was first reported in California in the United States (Pan American Health Organization, Epidemiological update: Occurrence of variants of SARS-CoV-2 in the Americas, January 20, 2021, available at reliefweb.int/sites/reliefweb.int/files/resources/2021-jan-20-phe-epi-update-SARS- CoV-2.pdf).
  • SARS-CoV-2 variants include a SARS CoV-2 of clade 19A; SARS CoV-2 of clade 19B; a SARS CoV-2 of clade 20A; a SARS CoV-2 of clade 20B; a SARS CoV-2 of clade 20C; a SARS CoV-2 of clade 20D; a SARS CoV-2 of clade 20E (EU1); a SARS CoV-2 of clade 20F; a SARS CoV-2 of clade 20G; and SARS CoV-2 Bl.1.207; and other SARS CoV-2 lineages described in Rambaut, A., et al., A dynamic nomenclature proposal for SARS-CoV-2 lineages to assist genomic epidemiology. Nat Microbiol 5, 1403-1407 (2020).
  • SARS-CoV-2 variants, and the amino acid and nucleotide sequences thereof, are incorporated herein by reference.
  • SARS-CoV is another betacoronavirus of lineage B (sarbecovirus) that causes respiratory symptoms in infected individuals.
  • the genomic sequence of SARS-CoV Urbani strain has GenBank accession number AAP 13441.1.
  • any concentration range, percentage range, ratio range, or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated.
  • any number range recited herein relating to any physical feature, such as polymer subunits, size or thickness are to be understood to include any integer within the recited range, unless otherwise indicated.
  • the term “about” means ⁇ 20% of the indicated range, value, or structure, unless otherwise indicated. It should be understood that the terms “a” and “an” as used herein refer to “one or more" of the enumerated components.
  • a protein domain, region, or module e.g., a binding domain
  • a protein "consists essentially of a particular amino acid sequence when the amino acid sequence of a domain, region, module, or protein includes extensions, deletions, mutations, or a combination thereof (e.g., amino acids at the amino- or carboxy -terminus or between domains) that, in combination, contribute to at most 20% (e.g., at most 15%, 10%, 8%, 6%, 5%, 4%, 3%, 2% or 1%) of the length of a domain, region, module, or protein and do not substantially affect (i.e., do not reduce the activity by more than 50%, such as no more than 40%, 30%, 25%, 20%, 15%, 10%, 5%, or 1%) the activity of the domain(s), region(s
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g ., hydroxyproline, g-carboxyglutamate, and O-phosphoserine.
  • Amino acid analogs refer to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a-carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g.
  • amino acid mimetics refer to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
  • mutation refers to a change in the sequence of a nucleic acid molecule or polypeptide molecule as compared to a reference or wild-type nucleic acid molecule or polypeptide molecule, respectively.
  • a mutation can result in several different types of change in sequence, including substitution, insertion or deletion of nucleotide(s) or amino acid(s).
  • a “conservative substitution” refers to amino acid substitutions that do not significantly affect or alter binding characteristics of a particular protein. Generally, conservative substitutions are ones in which a substituted amino acid residue is replaced with an amino acid residue having a similar side chain. Conservative substitutions include a substitution found in one of the following groups: Group 1 : Alanine (Ala or A), Glycine (Gly or G), Serine (Ser or S), Threonine (Thr or T); Group 2: Aspartic acid (Asp or D), Glutamic acid (Glu or Z); Group 3 : Asparagine (Asn or N), Glutamine (Gin or Q); Group 4: Arginine (Arg or R), Lysine (Lys or K), Histidine (His or H); Group 5: Isoleucine (lie or I), Leucine (Leu or L), Methionine (Met or M), Valine (Val or V); and Group 6: Phenylalanine (Phe or F), Tyrosine (Tyr or
  • amino acids can be grouped into conservative substitution groups by similar function, chemical structure, or composition (e.g., acidic, basic, aliphatic, aromatic, or sulfur-containing).
  • an aliphatic grouping may include, for purposes of substitution, Gly, Ala, Val, Leu, and He.
  • substitutions groups include: sulfur-containing: Met and Cysteine (Cys or C); acidic: Asp, Glu, Asn, and Gin; small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, Pro, and Gly; polar, negatively charged residues and their amides: Asp, Asn, Glu, and Gin; polar, positively charged residues: His, Arg, and Lys; large aliphatic, nonpolar residues: Met, Leu, lie, Val, and Cys; and large aromatic residues: Phe, Tyr, and Trp. Additional information can be found in Creighton (1984) Proteins, W.H. Freeman and Company.
  • protein or “polypeptide” refers to a polymer of amino acid residues. Proteins apply to naturally occurring amino acid polymers, as well as to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, and non-naturally occurring amino acid polymers. Variants of proteins, peptides, and polypeptides of this disclosure are also contemplated.
  • variant proteins, peptides, and polypeptides comprise or consist of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9% identical to an amino acid sequence of a defined or reference amino acid sequence as described herein.
  • Nucleic acid molecule or “polynucleotide” or “polynucleic acid” refers to a polymeric compound including covalently linked nucleotides, which can be made up of natural subunits (e.g ., purine or pyrimidine bases) or non-natural subunits (e.g, morpholine ring).
  • Purine bases include adenine, guanine, hypoxanthine, and xanthine
  • pyrimidine bases include uracil, thymine, and cytosine.
  • Nucleic acid molecules include polyribonucleic acid (RNA), which includes mRNA, microRNA, siRNA, viral genomic RNA, and synthetic RNA, and polydeoxyribonucleic acid (DNA), which includes cDNA, genomic DNA, and synthetic DNA, either of which may be single or double stranded. If single-stranded, the nucleic acid molecule may be the coding strand or non-coding (anti-sense) strand.
  • a nucleic acid molecule encoding an amino acid sequence includes all nucleotide sequences that encode the same amino acid sequence. Some versions of the nucleotide sequences may also include intron(s) to the extent that the intron(s) would be removed through co- or post-transcriptional mechanisms. In other words, different nucleotide sequences may encode the same amino acid sequence as the result of the redundancy or degeneracy of the genetic code, or by splicing.
  • Variants of nucleic acid molecules of this disclosure are also contemplated. Variant nucleic acid molecules are at least 70%, 75%, 80%, 85%, 90%, and are preferably 95%, 96%, 97%, 98%, 99%, or 99.9% identical a nucleic acid molecule of a defined or reference polynucleotide as described herein, or that hybridize to a polynucleotide under stringent hybridization conditions of 0.015M sodium chloride, 0.0015M sodium citrate at about 65-68°C or 0.015M sodium chloride, 0.0015M sodium citrate, and 50% formamide at about 42°C. Nucleic acid molecule variants retain the capacity to encode a binding domain thereof having a functionality described herein, such as binding a target molecule.
  • Percent sequence identity refers to a relationship between two or more sequences, as determined by comparing the sequences. Preferred methods to determine sequence identity are designed to give the best match between the sequences being compared. For example, the sequences are aligned for optimal comparison purposes (e.g ., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment). Further, non-homologous sequences may be disregarded for comparison purposes. The percent sequence identity referenced herein is calculated over the length of the reference sequence, unless indicated otherwise. Methods to determine sequence identity and similarity can be found in publicly available computer programs.
  • Sequence alignments and percent identity calculations may be performed using a BLAST program (e.g., BLAST 2.0, BLASTP, BLASTN, or BLASTX).
  • BLAST program e.g., BLAST 2.0, BLASTP, BLASTN, or BLASTX.
  • the mathematical algorithm used in the BLAST programs can be found in Altschul et al., Nucleic Acids Res. 25: 3389-3402, 1997.
  • sequence analysis software is used for analysis, the results of the analysis are based on the "default values" of the program referenced. "Default values" mean any set of values or parameters which originally load with the software when first initialized.
  • isolated means that the material is removed from its original environment (e.g, the natural environment if it is naturally occurring).
  • a naturally occurring nucleic acid or polypeptide present in a living animal is not isolated, but the same nucleic acid or polypeptide, separated from some or all of the co-existing materials in the natural system, is isolated.
  • nucleic acid could be part of a vector and/or such nucleic acid or polypeptide could be part of a composition ( e.g ., a cell lysate), and still be isolated in that such vector or composition is not part of the natural environment for the nucleic acid or polypeptide.
  • gene means the segment of DNA or RNA involved in producing a polypeptide chain; in certain contexts, it includes regions preceding and following the coding region (e.g., 5’ untranslated region (UTR) and 3’ UTR) as well as intervening sequences (introns) between individual coding segments (exons).
  • regions preceding and following the coding region e.g., 5’ untranslated region (UTR) and 3’ UTR
  • intervening sequences introns between individual coding segments (exons).
  • a “functional variant” refers to a polypeptide or polynucleotide that is structurally similar or substantially structurally similar to a parent or reference compound of this disclosure, but differs slightly in composition (e.g., one base, atom or functional group is different, added, or removed), such that the polypeptide or encoded polypeptide is capable of performing at least one function of the parent polypeptide with at least 50% efficiency, preferably at least 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.9%, or 100% level of activity of the parent polypeptide.
  • a functional variant of a polypeptide or encoded polypeptide of this disclosure has "similar binding,” “similar affinity” or “similar activity” when the functional variant displays no more than a 50% reduction in performance in a selected assay as compared to the parent or reference polypeptide, such as an assay for measuring binding affinity (e.g., Biacore® or tetramer staining measuring an association (Ka) or a dissociation (KD) constant).
  • binding affinity e.g., Biacore® or tetramer staining measuring an association (Ka) or a dissociation (KD) constant.
  • a “functional portion” or “functional fragment” refers to a polypeptide or polynucleotide that comprises only a domain, portion or fragment of a parent or reference compound, and the polypeptide or encoded polypeptide retains at least 50% activity associated with the domain, portion or fragment of the parent or reference compound, preferably at least 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.9%, or 100% level of activity of the parent polypeptide, or provides a biological benefit (e.g., effector function).
  • a biological benefit e.g., effector function
  • a “functional portion” or “functional fragment” of a polypeptide or encoded polypeptide of this disclosure has “similar binding” or “similar activity” when the functional portion or fragment displays no more than a 50% reduction in performance in a selected assay as compared to the parent or reference polypeptide (preferably no more than 20% or 10%, or no more than a log difference as compared to the parent or reference with regard to affinity).
  • the term "engineered,” “recombinant,” or “non-natural” refers to an organism, microorganism, cell, nucleic acid molecule, or vector that includes at least one genetic alteration or has been modified by introduction of an exogenous or heterologous nucleic acid molecule, wherein such alterations or modifications are introduced by genetic engineering (i.e., human intervention).
  • Genetic alterations include, for example, modifications introducing expressible nucleic acid molecules encoding functional RNA, proteins, fusion proteins or enzymes, or other nucleic acid molecule additions, deletions, substitutions, or other functional disruption of a cell’s genetic material. Additional modifications include, for example, non-coding regulatory regions in which the modifications alter expression of a polynucleotide, gene, or operon.
  • heterologous or non-endogenous or exogenous refers to any gene, protein, compound, nucleic acid molecule, or activity that is not native to a host cell or a subject, or any gene, protein, compound, nucleic acid molecule, or activity native to a host cell or a subject that has been altered.
  • Heterologous, non-endogenous, or exogenous includes genes, proteins, compounds, or nucleic acid molecules that have been mutated or otherwise altered such that the structure, activity, or both is different as between the native and altered genes, proteins, compounds, or nucleic acid molecules.
  • heterologous, non-endogenous, or exogenous genes, proteins, or nucleic acid molecules may not be endogenous to a host cell or a subject, but instead nucleic acids encoding such genes, proteins, or nucleic acid molecules may have been added to a host cell by conjugation, transformation, transfection, electroporation, or the like, wherein the added nucleic acid molecule may integrate into a host cell genome or can exist as extra-chromosomal genetic material (e.g., as a plasmid or other self-replicating vector).
  • homologous or homolog refers to a gene, protein, compound, nucleic acid molecule, or activity found in or derived from a host cell, species, or strain.
  • a heterologous or exogenous polynucleotide or gene encoding a polypeptide may be homologous to a native polynucleotide or gene and encode a homologous polypeptide or activity, but the polynucleotide or polypeptide may have an altered structure, sequence, expression level, or any combination thereof.
  • a non-endogenous polynucleotide or gene, as well as the encoded polypeptide or activity may be from the same species, a different species, or a combination thereof.
  • a nucleic acid molecule or portion thereof native to a host cell will be considered heterologous to the host cell if it has been altered or mutated, or a nucleic acid molecule native to a host cell may be considered heterologous if it has been altered with a heterologous expression control sequence or has been altered with an endogenous expression control sequence not normally associated with the nucleic acid molecule native to a host cell.
  • heterologous can refer to a biological activity that is different, altered, or not endogenous to a host cell.
  • heterologous nucleic acid molecule can be introduced into a host cell as separate nucleic acid molecules, as a plurality of individually controlled genes, as a polycistronic nucleic acid molecule, as a single nucleic acid molecule encoding a fusion protein, or any combination thereof.
  • endogenous or “native” refers to a polynucleotide, gene, protein, compound, molecule, or activity that is normally present in a host cell or a subject.
  • expression refers to the process by which a polypeptide is produced based on the encoding sequence of a nucleic acid molecule, such as a gene.
  • the process may include transcription, post-transcriptional control, post-transcriptional modification, translation, post-translational control, post- translational modification, or any combination thereof.
  • An expressed nucleic acid molecule is typically operably linked to an expression control sequence (e.g., a promoter).
  • operably linked refers to the association of two or more nucleic acid molecules on a single nucleic acid fragment so that the function of one is affected by the other.
  • a promoter is operably linked with a coding sequence when it is capable of affecting the expression of that coding sequence (i.e., the coding sequence is under the transcriptional control of the promoter).
  • "Unlinked" means that the associated genetic elements are not closely associated with one another and the function of one does not affect the other.
  • more than one heterologous nucleic acid molecule can be introduced into a host cell as separate nucleic acid molecules, as a plurality of individually controlled genes, as a polycistronic nucleic acid molecule, as a single nucleic acid molecule encoding a protein (e.g ., a heavy chain of an antibody), or any combination thereof.
  • a protein e.g ., a heavy chain of an antibody
  • two or more heterologous nucleic acid molecules can be introduced as a single nucleic acid molecule (e.g., on a single vector), on separate vectors, integrated into the host chromosome at a single site or multiple sites, or any combination thereof.
  • the number of referenced heterologous nucleic acid molecules or protein activities refers to the number of encoding nucleic acid molecules or the number of protein activities, not the number of separate nucleic acid molecules introduced into a host cell.
  • construct refers to any polynucleotide that contains a recombinant nucleic acid molecule (or, when the context clearly indicates, a fusion protein of the present disclosure).
  • a (polynucleotide) construct may be present in a vector (e.g., a bacterial vector, a viral vector) or may be integrated into a genome.
  • a "vector” is a nucleic acid molecule that is capable of transporting another nucleic acid molecule.
  • Vectors may be, for example, plasmids, cosmids, viruses, a RNA vector or a linear or circular DNA or RNA molecule that may include chromosomal, non-chromosomal, semi -synthetic or synthetic nucleic acid molecules.
  • Vectors of the present disclosure also include transposon systems (e.g., Sleeping Beauty, see, e.g, Geurts etal, Mol.
  • Exemplary vectors are those capable of autonomous replication (episomal vector), capable of delivering a polynucleotide to a cell genome (e.g., viral vector), or capable of expressing nucleic acid molecules to which they are linked (expression vectors).
  • expression vector refers to a DNA construct containing a nucleic acid molecule that is operably linked to a suitable control sequence capable of effecting the expression of the nucleic acid molecule in a suitable host.
  • control sequences include a promoter to effect transcription, an optional operator sequence to control such transcription, a sequence encoding suitable mRNA ribosome binding sites, and sequences which control termination of transcription and translation.
  • the vector may be a plasmid, a phage particle, a virus, or simply a potential genomic insert.
  • the vector may replicate and function independently of the host genome, or may, in some instances, integrate into the genome itself or deliver the polynucleotide contained in the vector into the genome without the vector sequence.
  • plasmid "expression plasmid,” “virus,” and “vector” are often used interchangeably.
  • the term "introduced” in the context of inserting a nucleic acid molecule into a cell means “transfection", “transformation,” or “transduction” and includes reference to the incorporation of a nucleic acid molecule into a eukaryotic or prokaryotic cell wherein the nucleic acid molecule may be incorporated into the genome of a cell (e.g., chromosome, plasmid, plastid, or mitochondrial DNA), converted into an autonomous replicon, or transiently expressed (e.g., transfected mRNA).
  • a cell e.g., chromosome, plasmid, plastid, or mitochondrial DNA
  • transiently expressed e.g., transfected mRNA
  • polynucleotides of the present disclosure may be operatively linked to certain elements of a vector.
  • polynucleotide sequences that are needed to effect the expression and processing of coding sequences to which they are ligated may be operatively linked.
  • Expression control sequences may include appropriate transcription initiation, termination, promoter, and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (i.e., Kozak consensus sequences); sequences that enhance protein stability; and possibly sequences that enhance protein secretion.
  • Expression control sequences may be operatively linked if they are contiguous with the gene of interest and expression control sequences that act in trans or at a distance to control the gene of interest.
  • the vector comprises a plasmid vector or a viral vector (e.g ., a lentiviral vector or a g-retroviral vector).
  • Viral vectors include retrovirus, adenovirus, parvovirus (e.g., adeno-associated viruses), coronavirus, negative strand RNA viruses such as ortho-myxovirus (e.g, influenza virus), rhabdovirus (e.g, rabies and vesicular stomatitis virus), paramyxovirus (e.g, measles and Sendai), positive strand RNA viruses such as picornavirus and alphavirus, and double-stranded DNA viruses including adenovirus, herpesvirus (e.g, Herpes Simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus), and poxvirus (e.g, vaccinia, fowlpox, and canarypox).
  • herpesvirus e.g, Herpe
  • viruses include, for example, Norwalk virus, togavirus, flavivirus, reoviruses, papovavirus, hepadnavirus, and hepatitis virus.
  • retroviruses include avian leukosis-sarcoma, mammalian C-type, B-type viruses, D type viruses, HTLV-BLV group, lentivirus, spumavirus (Coffin, J. M., Retroviridae: The viruses and their replication, In Fundamental Virology, Third Edition, B. N. Fields et ak, Eds., Lippincott-Raven Publishers, Philadelphia, 1996).
  • “Retroviruses” are viruses having an RNA genome, which is reverse-transcribed into DNA using a reverse transcriptase enzyme, the reverse-transcribed DNA is then incorporated into the host cell genome.
  • “Gammaretrovirus” refers to a genus of the retroviridae family. Examples of gammaretroviruses include mouse stem cell virus, murine leukemia virus, feline leukemia virus, feline sarcoma virus, and avian reticuloendotheliosis viruses.
  • Lentiviral vectors include HIV-based lentiviral vectors for gene delivery, which can be integrative or non-integrative, have relatively large packaging capacity, and can transduce a range of different cell types. Lentiviral vectors are usually generated following transient transfection of three (packaging, envelope, and transfer) or more plasmids into producer cells. Like HIV, lentiviral vectors enter the target cell through the interaction of viral surface glycoproteins with receptors on the cell surface. On entry, the viral RNA undergoes reverse transcription, which is mediated by the viral reverse transcriptase complex. The product of reverse transcription is a double-stranded linear viral DNA, which is the substrate for viral integration into the DNA of infected cells.
  • the viral vector can be a gammaretrovirus, e.g, Moloney murine leukemia virus (MLV)-derived vectors.
  • the viral vector can be a more complex retrovirus-derived vector, e.g. , a lentivirus-derived vector. HIV-l-derived vectors belong to this category.
  • Other examples include lentivirus vectors derived from HIV-2, FIV, equine infectious anemia virus, SIV, and Maedi-Visna virus (ovine lentivirus).
  • Retroviral and lentiviral vector constructs and expression systems are also commercially available.
  • Other viral vectors also can be used for polynucleotide delivery including DNA viral vectors, including, for example adenovirus-based vectors and adeno-associated virus (AAV)-based vectors; vectors derived from herpes simplex viruses (HSVs), including amplicon vectors, replication-defective HSV and attenuated HSV (Krisky et al., Gene Ther. 5:1517, 1998).
  • HSVs herpes simplex viruses
  • a viral vector genome comprises a plurality of polynucleotides to be expressed in a host cell as separate transcripts
  • the viral vector may also comprise additional sequences between the two (or more) transcripts allowing for bicistronic or multi cistronic expression. Examples of such sequences used in viral vectors include internal ribosome entry sites (IRES), furin cleavage sites, viral 2A peptide, or any combination thereof.
  • IRS internal ribosome entry sites
  • Plasmid vectors including DNA-based antibody or antigen-binding fragment- encoding plasmid vectors for direct administration to a subject, are described further herein.
  • the term "host” refers to a cell or microorganism targeted for genetic modification with a heterologous nucleic acid molecule to produce a polypeptide of interest (e.g ., an antibody of the present disclosure).
  • a host cell may include any individual cell or cell culture which may receive a vector or the incorporation of nucleic acids or express proteins. The term also encompasses progeny of the host cell, whether genetically or phenotypically the same or different. Suitable host cells may depend on the vector and may include mammalian cells, animal cells, human cells, simian cells, insect cells, yeast cells, and bacterial cells. These cells may be induced to incorporate the vector or other material by use of a viral vector, transformation via calcium phosphate precipitation, DEAE-dextran, electroporation, microinjection, or other methods. See , for example, Sambrook etal., Molecular Cloning: A Laboratory Manual 2d ed. (Cold Spring Harbor Laboratory, 1989).
  • a "host” refers to a cell or a subject infected with the SARS-CoV-2 coronavirus.
  • Antigen refers to an immunogenic molecule that provokes an immune response. This immune response may involve antibody production, activation of specific immunologically-competent cells, activation of complement, antibody dependent cytotoxicicity, or any combination thereof.
  • An antigen immunogenic molecule
  • An antigen may be, for example, a peptide, glycopeptide, polypeptide, glycopolypeptide, polynucleotide, polysaccharide, lipid, or the like. It is readily apparent that an antigen can be synthesized, produced recombinantly, or derived from a biological sample. Exemplary biological samples that can contain one or more antigens include tissue samples, stool samples, cells, biological fluids, or combinations thereof.
  • Antigens can be produced by cells that have been modified or genetically engineered to express an antigen. Antigens can also be present in a SARS-CoV-2 coronavirus (e.g, a surface glycoprotein or portion thereof), such as present in a virion, or expressed or presented on the surface of a cell infected by SARS-CoV-2.
  • SARS-CoV-2 coronavirus e.g, a surface glycoprotein or portion thereof
  • epitope includes any molecule, structure, amino acid sequence, or protein determinant that is recognized and specifically bound by a cognate binding molecule, such as an immunoglobulin, or other binding molecule, domain, or protein.
  • Epitopic determinants generally contain chemically active surface groupings of molecules, such as amino acids or sugar side chains, and can have specific three-dimensional structural characteristics, as well as specific charge characteristics.
  • the epitope can comprise consecutive amino acids (e.g, a linear epitope), or can comprise amino acids from different parts or regions of the protein that are brought into proximity by protein folding (e.g, a discontinuous or conformational epitope), or non-contiguous amino acids that are in close proximity irrespective of protein folding.
  • the present disclosure provides an isolated antibody, or an antigen-binding fragment thereof, that is capable of binding to a surface glycoprotein of SARS-CoV-2.
  • the antibody or antigen-binding fragment is capable of binding to a surface glycoprotein of SARS-CoV-2 expressed on a cell surface of a host cell and/or on a SARS-CoV-2 virion.
  • an antibody or antigen-binding fragment of the present disclosure associates with or unites with a SARS-CoV-2 surface glycoprotein epitope or antigen comprising the epitope, while not significantly associating or uniting with any other molecules or components in a sample.
  • an antibody or antigen-binding fragment of the present disclosure associates with or unites (e.g, binds) to a SARS-CoV-2 surface glycoprotein epitope, and can also associate with or unite with an epitope from another coronavirus (e.g, SARS-CoV-1) present in the sample, but not significantly associating or uniting with any other molecules or components in the sample.
  • an antibody or antigen binding fragment of the present disclosure is cross-reactive for SARS-CoV-2 and one or more additional coronavirus. Binding comprises "contacting" a S glycoprotein feature, such as an amino acid, a glycan, or the like.
  • contacting encompasses, for example, electrostatic interactions, hydrophobic interactions, hydrophobic contacts, formation of a chemical bond (e.g ., a hydrogen bond), formation of a water molecule, van der Waals interactions, and/or interactions due to shape complementarity (e.g., inserting or burying an antibody (or antigen-binding fragment) amino acid residue in a recess formed by the S glycoprotein; antibody amino acids encompassing a S glycoprotein amino acid residue or residues), and combinations of these.
  • a chemical bond e.g ., a hydrogen bond
  • formation of a water molecule e.g., van der Waals interactions
  • shape complementarity e.g., inserting or burying an antibody (or antigen-binding fragment) amino acid residue in a recess formed by the S glycoprotein; antibody amino acids encompassing a S glycoprotein amino acid residue or residues
  • binding to a S glycoprotein or trimer thereof is described with reference to herein-disclosed cryo-electron microscopy techniques and/or x-ray crystallography techniques and/or crystal structures.
  • binding interactions are resolved to a resolution of 10 angstroms or less, 5 angstroms or less, 4 angstroms or less, 3.9 angstroms or less, 3.8 angstroms or less, 3.7 angstroms or less,
  • 3.6 angstroms or less 3.5 angstroms or less, 3.4 angstroms or less, 3.3 angstroms or less, 3.2 angstroms or less, 3.1 angstroms or less, 3.0 angstroms or less, 2.9 angstroms or less, 2.8 angstroms or less, 2.7 angstroms or less, 2.65 angstroms or less, 2.6 angstroms or less, or 2.5 angstroms or less.
  • contacting comprises a distance between an antibody (or antigen-binding fragment) amino acid residue and a S glycoprotein amino acid residue of 3.6 angstroms or less, 3.5 angstroms or less, 3.4 angstroms or less, 3.3 angstroms or less, 3.2 angstroms or less, 3.1 angstroms or less, 3.0 angstroms or less, 2.9 angstroms or less, 2.8 angstroms or less,
  • binding of an antibody or antigen-binding fragment comprises recognizing (i.e., specifically recognizing, as opposed to non-specific sticking) an epitope formed by certain amino acids and/or glycan structures.
  • An epitope that is formed by the recited amino acids and/or structures is comprised in, and can be comprised of some or all of, the recited amino acids and/or structures.
  • an epitope that is formed by residues 1-10 can comprise from 1 to 10 amino acids that contact an amino acid of an antibody or antigen-binding fragment.
  • amino acids forming the epitope may not contact an amino acid of an antibody or antigen-binding fragment, but may contribute to the overall structure of the epitope; e.g ., supporting the position of an epitope amino acid that does contact an amino acid of an antibody or antigen-binding fragment.
  • an antibody or antigen-binding fragment is capable of the recited binding when the S glycoprotein is present as a monomer and/or in a trimer. Unless expressly stated otherwise, the ability to bind to a S glycoprotein monomer is not exclusive of the ability to bind to the S glycoprotein when present in a trimer. In certain embodiments, an antibody or antigen-binding fragment is capable of binding to an epitope that comprises amino acids in two adjacent RBDs in a trimer.
  • an antibody or antigen-binding fragment of the present disclosure specifically binds to a SARS-CoV-2 surface glycoprotein.
  • “specifically binds” refers to an association or union of an antibody or antigen-binding fragment to an antigen with an affinity or K a (i.e., an equilibrium association constant of a particular binding interaction with units of 1/M) equal to or greater than 10 5 M 1 (which equals the ratio of the on-rate [K 0n ] to the off rate [K 0ff ] for this association reaction), while not significantly associating or uniting with any other molecules or components in a sample.
  • K a i.e., an equilibrium association constant of a particular binding interaction with units of 1/M
  • affinity may be defined as an equilibrium dissociation constant (K d ) of a particular binding interaction with units of M (e.g, 10 5 M to 10 13 M).
  • Antibodies may be classified as “high-affinity” antibodies or as “low- affinity” antibodies.
  • “High-affinity” antibodies refer to those antibodies having a K a of at least 10 7 M _1 , at least 10 8 M 1 , at least 10 9 M 1 , at least 10 10 M 1 , at least 10 11 M 1 , at least 10 12 M _1 , or at least 10 13 M 1 .
  • “Low-affinity” antibodies refer to those antibodies having a K a of up to 10 7 M 1 , up to 10 6 M 1 , up to 10 5 M 1 .
  • affinity may be defined as an equilibrium dissociation constant (K d ) of a particular binding interaction with units of M (e.g, 10 5 M to 10 13 M).
  • assays for identifying antibodies of the present disclosure that bind a particular target, as well as determining binding domain or binding protein affinities, such as Western blot, ELISA (e.g ., direct, indirect, or sandwich), analytical ultracentrifugation, spectroscopy, and surface plasmon resonance (Biacore®) analysis (see, e.g., Scatchard etal., Ann. N.Y. Acad. Sci. 57:660, 1949; Wilson, Science 295: 2103, 2002; Wolff etal., Cancer Res. 53: 2560, 1993; and U.S. Patent Nos. 5,283,173, 5,468,614, or the equivalent). Assays for assessing affinity or apparent affinity or relative affinity are also known.
  • binding can be identified by recombinantly expressing a SARS-CoV-2 antigen in a host cell (e.g, by transfection) and immunostaining the (e.g, fixed, or fixed and permeabilized) host cell with antibody and assessing presence or absence of binding by flow cytometery (e.g, using a ZE5 Cell Analyzer (BioRad®) and FlowJo software (TreeStar).
  • flow cytometery e.g, using a ZE5 Cell Analyzer (BioRad®) and FlowJo software (TreeStar).
  • positive binding can be defined by differential staining by antibody of SARS-CoV-2 -expressing cells versus control (e.g, mock) cells.
  • an antibody or antigen-binding fragment of the present disclosure binds to SARS-CoV-2 S protein, as measured using biolayer interferometry.
  • an antibody or antigen-binding fragment of the present disclosure is capable of neutralizing infection by SARS-CoV-2.
  • a “neutralizing antibody” is one that can neutralize, i.e., prevent, inhibit, reduce, impede, or interfere with, the ability of a pathogen to initiate and/or perpetuate an infection in a host.
  • neutralizing antibody and “an antibody that neutralizes” or “antibodies that neutralize” are used interchangeably herein.
  • the antibody or antigen-binding fragment is capable of preventing and/or neutralizing a SARS-CoV-2 infection in an in vitro model of infection and/or in an in vivo animal model of infection and/or in a human.
  • antibody refers to an intact antibody comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, as well as any antigen-binding portion or fragment of an intact antibody that has or retains the ability to bind to the antigen target molecule recognized by the intact antibody, such as an scFv, Fab, or Fab'2 fragment.
  • antibody herein is used in the broadest sense and includes polyclonal and monoclonal antibodies, including intact antibodies and functional (antigen-binding) antibody fragments thereof, including fragment antigen binding (Fab) fragments, F(ab')2 fragments, Fab' fragments, Fv fragments, recombinant IgG (rlgG) fragments, single chain antibody fragments, including single chain variable fragments (scFv), and single domain antibodies (e.g ., sdAb, sdFv, nanobody) fragments.
  • the term encompasses genetically engineered and/or otherwise modified forms of immunoglobulins, such as intrabodies, peptibodies, chimeric antibodies, fully human antibodies, humanized antibodies, and heteroconjugate antibodies, multi specific, e.g., bispecific antibodies, diabodies, triabodies, tetrabodies, tandem di-scFv, and tandem tri-scFv.
  • antibody should be understood to encompass functional antibody fragments thereof.
  • the term also encompasses intact or full-length antibodies, including antibodies of any class or sub-class, including IgG and sub-classes thereof (IgGl, IgG2, IgG3, IgG4), IgM, IgE, IgA, and IgD.
  • variable binding regions refer to the variable binding region from an antibody light chain and an antibody heavy chain, respectively.
  • a VL is a kappa (K) class (also “VK” herein).
  • a VL is a lambda (l) class.
  • the variable binding regions comprise discrete, well-defined sub-regions known as “complementarity determining regions” (CDRs) and “framework regions” (FRs).
  • CDR complementarity determining region
  • HVR hypervariable region
  • an antibody VH comprises four FRs and three CDRs as follows: FR1 -HCDR1 -FR2-HCDR2-FR3 -HCDR3 -FR4; and an antibody VL comprises four FRs and three CDRs as follows: FR1-LCDR1-FR2- LCDR2-FR3-LCDR3-FR4.
  • the VH and the VL together form the antigen binding site through their respective CDRs.
  • a "variant" of a CDR refers to a functional variant of a CDR sequence having up to 1-3 amino acid substitutions (e.g ., conservative or non- conservative substitutions), deletions, or combinations thereof.
  • Numbering of CDR and framework regions may be according to any known method or scheme, such as the Rabat, Chothia, EU, IMGT, and AHo numbering schemes (see, e.g., Rabat etal., "Sequences of Proteins of Immunological Interest, US Dept. Health and Human Services, Public Health Service National Institutes of Health, 1991, 5 th ed.; Chothia and Lesk, J. Mol. Biol. 196:901-911 (1987)); Lefranc etal., Dev.
  • Exemplary antibodies of the present disclosure include those summarized in Table 1.
  • S2H14 refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO.:47 and the VL amino acid sequence of SEQ ID NO.:51.
  • S2H13 refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO.:31 and the VL amino acid sequence of SEQ IDNO.:35.
  • S2X259 refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO. : 16 and the VL amino acid sequence of SEQ IDNO.:26.
  • S2X35 refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO.:72 and the VL amino acid sequence of SEQ IDNO.:76.
  • S2A4 refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO. :64 and the VL amino acid sequence of SEQ IDNO.:68.
  • S304 refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO.: 150 and the VL amino acid sequence of SEQ IDNO.: 154.
  • S309 refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO.:101 and the VL amino acid sequence of SEQ IDNO.:105.
  • S2E12 refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO.:123 and the VL amino acid sequence of SEQ ID NO.:138.
  • S2M11 refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO. : 142 and the VL amino acid sequence of SEQ IDNO. : 146.
  • Presently disclosed antibodies and antigen-binding fragments bind in an antigenic Site as described herein.
  • Site la containing the S2H14 epitope
  • Site lb containing the S2H13 epitope; Figure 34C
  • Site II is divided into Site Ila (containing the S2X35 epitope, e.g.
  • FIG 34D which partially overlaps with the ACE2 -binding site, Site lib (containing the S2A4 epitope, proximal to the N343 glycan, e.g. Figure 34E), which does not overlap with the ACE2 -binding site, and Site lie (containing the S304 epitope, proximal to the N343 glycan, e.g. Figure 34F).
  • Site IV does not overlap with the ACE-2 binding site and contains the S309 proteoglycan epitope (e.g. Figure 34G).
  • the S2X259 epitope is formed by amino acid residues 369-386, 404-411, and 499-508 of SEQ ID NO: 3.
  • the S2H13 epitope is formed by amino acid residues 444- 449 and 472-498 of SEQ ID NO: 3.
  • the S2H14 epitope is formed by amino acid residues 403, 444-456, 475, and 485-505 of SEQ ID NO: 3.
  • the S2A4 epitope is formed by amino acid residues 368-388 and 407-414 of SEQ ID NO: 3.
  • the S304 epitope is formed by amino acid residues 369-392, 411-414, 427-430, and 515-517 of SEQ ID NO: 3.
  • the S2E12 epitope is formed by amino acid residues 417, 453, 455, 456, 473, 475-480, 484-489, and 493 of SEQ ID NO: 3.
  • the S2M11 epitope is formed by: (i) on a first RBD, amino acid residues 339, 342, 343, 367, 368, 371, 372, 373, 374, 436, 440, and 441, and, (ii) on a second RBD, amino acid residues 446, 447, 449, 452, 455, 456, 484, 485, 486, 487, 489, 490, 492, 493, 494, 496, and 498, wherein the amino acid numbering is according to SEQ ID NO.:3.
  • presently disclosed immunogenic compositions comprise a Site la polypeptide, a Site lb polypeptide, a Site Ila polypeptide, a Site lib polypeptide, a Site lie polypeptide, and/or a Site IV polypeptide; these polypeptides comprise at least a portion of a RBD or S glycoprotein, wherein the at least a portion includes the Site la, lb, Ila, lib, lie, or IV; i.e., comprises amino acid sequence and a structure such that a herein disclosed antibody is capable of binding thereto.
  • Variants of S2H14 include those that comprise the VH amino acid sequence of any one of SEQ ID NOs:55, 57, 59, 61, and 62.
  • Variants of S2H13 include those that comprise the VH amino acid sequence of any one of SEQ ID Nos.:39, 41, 43, 44, and 45.
  • Variants of S2X259 include those that comprise the VH amino acid sequence of any one of SEQ ID NOs. : 17-22 and/or the VL amino acid sequence of any one of SEQ ID NOs.:27-29.
  • Variants of S2X35 include those that comprise: the VH amino acid sequence of SEQ ID NO.:83, SEQ ID NO.:85, or SEQ ID NO.:88.
  • the S304 epitope (in Antigenic site lie) partially overlaps with the epitopes of S315 (VH of SEQ ID NO. : 162, VL of SEQ ID NO : 163), S2A4, S2X35, S2D22 (VH of SEQ ID NO : 166, VL of SEQ ID NO.: 167), and CR3022 (heavy chain of SEQ ID NO.: 158, light chain of SEQ ID NO.: 159).
  • S309 is described in, for example, Pinto etal. , Nature 583, pages 290-295 (2020). Amino acid residues 333-337, 339-341, 343-346, 354, 356-361, 440, 441, and 509 of SEQ ID NO.:3 contribute to the S309 proteoglycan epitope, with amino acid residues 340, 343, 345, 346, and 356 contributing significantly to antigen-antibody binding energy.
  • a non-limiting variant of S309 comprises the VH amino acid sequence of SEQ ID NO.:93 (comprising a N55Q mutation in CDRH2 relative to S309) and the VL amino acid sequence of SEQ ID NO.:97.
  • the antibodies S303 (VH of SEQ ID NO. : 164, VL of SEQ ID NO. : 165) and S2A10 (VH of SEQ ID NO.: 168, VL of SEQ ID NO.: 169) bind in the same antigenic region as S309.
  • Variants of S2E12 include those that comprise the VH amino acid sequence of any one of SEQ ID NOs. : 124-132 and/or the VL amino acid sequence of any one of SEQ ID NOs.:140-141.
  • an antibody, or an antigen-binding fragment thereof that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 16 and a VL amino acid sequence according to SEQ ID NO: 26 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
  • an antibody, or an antigen-binding fragment thereof is provided that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein: (a) binding comprises contacting one or more of amino acid residues 369-386, 404-411, and 499-508 of SEQ ID NO: 3; and/or (b) binding comprises binding an epitope formed by amino acid residues 369-386, 404-411, and 499-508 of SEQ ID NO: 3.
  • the antibody or antigen-binding fragment does not contact one or more of amino acids 406, 409, 410, 411, 499, 500, 505, and 507 of SEQ ID NO.:3 when binding to the S glycoprotein.
  • the antibody or antigen-binding fragment is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and one or zero RBDs of the trimer is in a closed conformation, and optionally is not capable of binding to the S glycoprotein when only one RBD of the trimer is in an open conformation and two RBDs of the trimer are in a closed conformation.
  • RBDs receptor binding domains
  • an antibody, or an antigen-binding fragment thereof which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and one or zero RBDs of the trimer is in a closed conformation, and optionally is not capable of binding to the S protein when only one RBD of the trimer is in an open conformation and two RBDs of the trimer are in a closed conformation.
  • RBDs receptor binding domains
  • an antibody, or an antigen-binding fragment thereof that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 31 and a VL amino acid sequence according to SEQ ID NO: 35 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
  • an antibody, or an antigen-binding fragment thereof is provided that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein: (a) binding comprises contacting one or more of amino acid residues 444-449 and 472-498 of SEQ ID NO: 3; and/or (b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 444-449 and 472-498 of SEQ ID NO: 3; and/or (c) binding comprises binding within a crevice formed by a receptor binding motif (RBM) b-hairpin in a receptor binding domain (RBD) of the S glycoprotein.
  • RBM receptor binding motif
  • RBD receptor binding domain
  • the antibody or antigen-binding fragment is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein one or zero receptor binding domains (RBDs) of the trimer are in an open conformation and two or three RBDs of the trimer are in a closed conformation.
  • RBDs receptor binding domains
  • an antibody, or an antigen-binding fragment thereof which is capable of binding to a SARS-CoV-2 S glycoprotein protein of a S glycoprotein trimer wherein one or zero receptor binding domains (RBDs) of the trimer are in an open conformation and two or three RBDs of the trimer are in a closed conformation.
  • RBDs receptor binding domains
  • an antibody, or an antigen-binding fragment thereof that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 47 and a VL amino acid sequence according to SEQ ID NO: 51 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
  • an antibody, or an antigen-binding fragment thereof is provided that is capable of binding to a SARS CoV-2 S glycoprotein, wherein: (a) binding comprises contacting one or more of amino acid residues 403, 444-456, 475, and 485-505 of SEQ ID NO: 3; and/or (b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 403, 444-456, 475, and 485-505 of SEQ ID NO: 3.
  • the antibody or antigen-binding fragment does not contact one or more of amino acids 448, 450, 451, 452, 454, 486, 488, 490, 491, 492, 497, 503, and 504 of SEQ ID NO.:3 when binding to the S glycoprotein.
  • the antibody or antigen-binding fragment is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein one, two, or three receptor binding domains (RBDs) of the trimer are in an open conformation.
  • RBDs receptor binding domains
  • an antibody, or an antigen-binding fragment thereof that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 64 and a VL amino acid sequence according to SEQ ID NO: 58 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
  • an antibody, or an antigen-binding fragment thereof is provided that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein: (a) binding comprises contacting one or more of amino acid residues 368-388 and 407-414 of SEQ ID NO: 3; and/or (b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 368-388 and 407-414 of SEQ ID NO: 3.
  • the antibody or antigen-binding fragment is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and zero or one RBDs of the trimer is in a closed conformation.
  • RBDs receptor binding domains
  • an antibody, or an antigen-binding fragment thereof that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 150 and a VL amino acid sequence according to SEQ ID NO: 154 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
  • an antibody, or an antigen-binding fragment thereof is provided that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein: (a) binding comprises contacting one or more of amino acid residues 369-392, 411-414, 427-430, and 515-517 of SEQ ID NO: 3; and/or (b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 369-392, 411-414, 427-430, and 515-517 of SEQ ID NO: 3.
  • the antibody or antigen-binding fragment is capable of binding to a SARS-CoV-2 S protein of a S protein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and zero or one RBDs of the trimer is in a closed conformation.
  • RBDs receptor binding domains
  • binding of the antibody or antigen-binding fragment to the S glycoprotein promotes or leads to release of the SI subunit from the S glycoprotein.
  • an antibody, or an antigen-binding fragment thereof that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 123 and a VL amino acid sequence according to SEQ ID NO: 138 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
  • an antibody, or an antigen-binding fragment thereof is provided that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein: (a) binding comprises contacting one or more of amino acid residues 417, 453, 455, 456, 473, 475-480, 484-489, and 493 of SEQ ID NO: 3; and/or (b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 417, 453, 455, 456, 473, 475-480, 484-489, and 493of SEQ ID NO.: 3.
  • the antibody or antigen-binding fragment capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein one, two, or three receptor binding domains (RBDs) of the trimer are in an open conformation and zero, one, or two RBDs of the trimer are in a closed conformation.
  • RBDs receptor binding domains
  • an antibody, or an antigen-binding fragment thereof that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 142 and a VL amino acid sequence according to SEQ ID NO: 146 for binding to a SARS-CoV-2 S glycoprotein trimer.
  • an antibody, or an antigen-binding fragment thereof is provided that is capable of binding to a SARS CoV-2 S glycoprotein trimer, wherein:
  • binding comprises contacting one or more of amino acid residues on each of two receptor binding domains (RBDs), wherein binding comprises contacting, on a first RBD, one or more of amino acid residues 339, 342, 343, 367, 368, 371, 372, 373, 374, 436, 440, and 441, and, on a second RBD, one or more of amino acid residues 446, 447, 449, 452, 455, 456, 484, 485, 486, 487, 489, 490, 492, 493, 494, 496, and 498, wherein the amino acid numbering is according to SEQ ID NO.:3; and/or (b) the antibody or antigen-binding fragment recognizes an epitope formed by the following: (b)(i) on a first RBD, amino acid residues 339, 342, 343, 367, 368, 371, 372, 373, 374, 436, 440, and 441, and, (b)(ii) on a second RBD, amino acid
  • the antibody or antigen-binding fragment of is capable of binding to the S glycoprotein trimer wherein three receptor binding domains (RBDs) of the trimer are in a closed conformation.
  • binding of the antibody or antigen-binding fragment to the S glycoprotein trimer inhibits or prevents an RBD of the trimer from assuming an open conformation.
  • binding of the antibody or antigen-binding fragment to the S glycoprotein or S glycoprotein trimer, respectively blocks an interaction between the S glycoprotein and a human ACE2. In certain embodiments, binding of the antibody or antigen-binding fragment to the S glycoprotein or S glycoprotein trimer, respectively, does not block an interaction between the S glycoprotein and a human ACE2.
  • the antibody or antigen-binding fragment is capable of neutralizing an infection by a SARS-CoV-2.
  • CL refers to an "immunoglobulin light chain constant region” or a "light chain constant region,” i.e., a constant region from an antibody light chain.
  • CH refers to an "immunoglobulin heavy chain constant region” or a "heavy chain constant region,” which is further divisible, depending on the antibody isotype into CHI, CH2, and CH3 (IgA, IgD, IgG), or CHI, CH2, CH3, and CH4 domains (IgE, IgM).
  • CHI unimmunoglobulin heavy chain constant region
  • an antibody or antigen-binding fragment of the present disclosure comprises any one or more of CL, a CHI, a CH2, and a CH3.
  • a CL comprises an amino acid sequence having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 975, 98%, 99%, or 100% identity to the amino acid sequence of SEQ ID NO : 8 or SEQ ID NO.: 9.
  • a CH1-CH2-CH3 comprises an amino acid sequence having 90%, 91%, 92%, 93%, 94%, 95%, 96%,
  • a “Fab” fragment antigen binding is the part of an antibody that binds to antigens and includes the variable region and CHI of the heavy chain linked to the light chain via an inter-chain disulfide bond. Each Fab fragment is monovalent with respect to antigen binding, i.e., it has a single antigen-binding site. Pepsin treatment of an antibody yields a single large F(ab')2 fragment that roughly corresponds to two disulfide linked Fab fragments having divalent antigen-binding activity and is still capable of cross-linking antigen.
  • Both the Fab and F(ab’)2 are examples of "antigen binding fragments.”
  • Fab' fragments differ from Fab fragments by having additional few residues at the carboxy terminus of the CHI domain including one or more cysteines from the antibody hinge region.
  • Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
  • F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments that have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
  • Fab fragments may be joined, e.g ., by a peptide linker, to form a single chain Fab, also referred to herein as "scFab.”
  • a linker serves in full or in part to link or connect the Fab fragments in a single polypeptide chain.
  • a heavy chain- derived Fab fragment e.g., comprising, consisting of, or consisting essentially of VH + CHI, or "Fd”
  • a light chain-derived Fab fragment e.g., comprising, consisting of, or consisting essentially of VL + CL
  • a scFab may be arranged, in N-terminal to C-terminal direction, according to (heavy chain Fab fragment - linker - light chain Fab fragment) or (light chain Fab fragment - linker - heavy chain Fab fragment).
  • Peptide linkers and exemplary linker sequences for use in scFabs are discussed in further detail herein.
  • Fv is a small antibody fragment that contains a complete antigen-recognition and antigen-binding site. This fragment generally consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although typically at a lower affinity than the entire binding site.
  • Single-chain Fv also abbreviated as “sFv” or “scFv”
  • sFv single-chain Fv
  • the scFv polypeptide comprises a polypeptide linker disposed between and linking the VH and VL domains that enables the scFv to retain or form the desired structure for antigen binding.
  • a peptide linker can be incorporated into a fusion polypeptide using standard techniques well known in the art.
  • the antibody or antigen-binding fragment comprises a scFv comprising a VH domain, a VL domain, and a peptide linker linking the VH domain to the VL domain.
  • a scFv comprises a VH domain linked to a VL domain by a peptide linker, which can be in a VH-linker- VL orientation or in a VL-linker-VH orientation.
  • Any scFv of the present disclosure may be engineered so that the C-terminal end of the VL domain is linked by a short peptide sequence to the N-terminal end of the VH domain, or vice versa (i.e., (N)VL(C)-linker-(N)VH(C) or (N)VH(C)-linker-(N)VL(C).
  • a linker may be linked to an N-terminal portion or end of the VH domain, the VL domain, or both.
  • Peptide linker sequences may be chosen, for example, based on: (1) their ability to adopt a flexible extended conformation; (2) their inability or lack of ability to adopt a secondary structure that could interact with functional epitopes on the first and second polypeptides and/or on a target molecule; and/or (3) the lack or relative lack of hydrophobic or charged residues that might react with the polypeptides and/or target molecule.
  • linker design e.g ., length
  • linker design e.g ., length
  • peptide linker sequences contain, for example, Gly, Asn and Ser residues.
  • linker sequence may also be included in a linker sequence.
  • Other amino acid sequences which may be usefully employed as linker include those disclosed in Maratea et ah, Gene 40:3946 (1985); Murphy et ah, Proc. Natl. Acad. Sci. USA 83:8258 8262 (1986); U.S. Pat. No. 4,935,233, and U.S. Pat. No. 4,751,180.
  • linkers may include, for example, Glu-Gly-Lys-Ser-Ser-Gly-Ser-Gly-Ser-Glu-Ser-Lys- Val-Asp (Chaudhary et ah, Proc. Natl. Acad. Sci.
  • Any suitable linker may be used, and in general can be about 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 15 23, 24, 25, 26, 27, 28, 29, 30, 40, 50, 60, 70, 80, 90, 100 amino acids in length, or less than about 200 amino acids in length, and will preferably comprise a flexible structure (can provide flexibility and room for conformational movement between two regions, domains, motifs, fragments, or modules connected by the linker), and will preferably be biologically inert and/or have a low risk of immunogenicity in a human.
  • scFv can be constructed using any combination of the VH and VL sequences or any combination of the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 sequences disclosed herein.
  • linker sequences are not required; for example, when the first and second polypeptides have non-essential N-terminal amino acid regions that can be used to separate the functional domains and prevent steric interference.
  • DNA in the germline variable (V), joining (J), and diversity (D) gene loci may be rearranged and insertions and/or deletions of nucleotides in the coding sequence may occur. Somatic mutations may be encoded by the resultant sequence, and can be identified by reference to a corresponding known germline sequence.
  • somatic mutations that are not critical to a desired property of the antibody e.g ., binding to a SARS-CoV-2 antigen
  • that confer an undesirable property upon the antibody e.g., an increased risk of immunogenicity in a subject administered the antibody
  • the antibody or antigen-binding fragment of the present disclosure comprises at least one more germline-encoded amino acid in a variable region as compared to a parent antibody or antigen-binding fragment, provided that the parent antibody or antigen binding fragment comprises one or more somatic mutations.
  • Variable region and CDR amino acid sequences of exemplary anti-SARS-CoV-2 antibodies of the present disclosure are provided in Table 1 herein.
  • an antibody or antigen-binding fragment comprises an amino acid modification (e.g, a substitution mutation) to remove an undesired risk of oxidation, deamidation, and/or isomerization.
  • an amino acid modification e.g, a substitution mutation
  • variant antibodies that comprise one or more amino acid alterations in a variable region (e.g, VH, VL, framework or CDR) as compared to a presently disclosed (“parent”) antibody, wherein the variant antibody is capable of binding to a SARS-CoV-2 antigen.
  • a variable region e.g, VH, VL, framework or CDR
  • an antibody or antigen-binding fragment of the present disclosure is monospecific (e.g ., binds to a single epitope) or is multispecific (e.g, binds to multiple epitopes and/or target molecules).
  • Antibodies and antigen binding fragments may be constructed in various formats. Exemplary antibody formats disclosed in Spiess et al., Mol. Immunol.
  • FIT-Ig e.g, PCT Publication No.
  • the antibody or antigen-binding fragment comprises two or more of VH domains, two or more VL domains, or both (i.e., two or more VH domains and two or more VL domains).
  • an antigen-binding fragment comprises the format (N-terminal to C-terminal direction) VH-linker-VL- linker-VH-linker-VL, wherein the two VH sequences can be the same or different and the two VL sequences can be the same or different.
  • Such linked scFvs can include any combination of VH and VL domains arranged to bind to a given target, and in formats comprising two or more VH and/or two or more VL, one, two, or more different eptiopes or antigens may be bound. It will be appreciated that formats incorporating multiple antigen-binding domains may include VH and/or VL sequences in any combination or orientation.
  • the antigen-binding fragment can comprise the format VL-linker-VH-linker-VL-linker-VH, VH-linker-VL-linker-VL-linker-VH, or VL-linker- VH-linker- VH-linker- VL .
  • Monospecific or multispecific antibodies or antigen-binding fragments of the present disclosure constructed comprise any combination of the VH and VL sequences and/or any combination of the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 sequences disclosed herein.
  • a bispecific or multispecific antibody or antigen binding fragment may, in some embodiments, comprise one, two, or more antigen binding domains (e.g ., a VH and a VL) of the instant disclosure.
  • Two or more binding domains may be present that bind to the same or a different SARS-CoV-2 epitope, and a bispecific or multispecific antibody or antigen-binding fragment as provided herein can, in some embodiments, comprise a further SARS-CoV-2 binding domain, and/or can comprise a binding domain that binds to a different antigen or pathogen altogether.
  • the antibody or antigen-binding fragment can be multispecific; e.g., bispecific, trispecific, or the like.
  • the antibody or antigen-binding fragment comprises a Fc polypeptide, or a fragment thereof.
  • the "Fc" fragment or Fc polypeptide comprises the carboxy -terminal portions (i.e., the CH2 and CH3 domains of IgG) of both antibody H chains held together by disulfides.
  • Antibody “effector functions” refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype.
  • antibody effector functions include: Clq binding and complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g., B cell receptor); and B cell activation.
  • modifications e.g, amino acid substitutions
  • Fc domain in order to modify (e.g, improve, reduce, or ablate) one or more functionality of an Fc-containing polypeptide (e.g ., an antibody of the present disclosure).
  • Such functions include, for example, Fc receptor (FcR) binding, antibody half-life modulation (e.g., by binding to FcRn), ADCC function, protein A binding, protein G binding, and complement binding.
  • Amino acid modifications that modify (e.g., improve, reduce, or ablate) Fc functionalities include, for example, the T250Q/M428L, M252Y/S254T/T256E (also referred-to as "YTE"), H433K/N434F, M428L/N434S (also referred-to as "LS” or "MLNS”), E233P/L234V/L235A/G236 + A327G/A330S/P331S, E333A, S239D/A330L/I332E, P257EQ311, K326W/E333S, S239D/I332E/G236A, N297Q, K322A, S228P, L235E + E318A/K320A/K322A, L234A/L235A (also referred to herein as "LALA”), and L234A/L235A/P329G mutations, which mutations are
  • the Clq protein complex can bind to at least two molecules of IgGl or one molecule of IgM when the immunoglobulin molecule(s) is attached to the antigenic target (Ward, E. S., and Ghetie, V., Ther. Immunol. 2 (1995) 77-94).
  • Burton, D. R. described (Mol. Immunol. 22 (1985) 161-206) that the heavy chain region comprising amino acid residues 318 to 337 is involved in complement fixation.
  • Duncan, A. R., and Winter, G. ( Nature 332 (1988) 738-740), using site directed mutagenesis, reported that Glu318, Lys320 and Lys322 form the binding site to Clq.
  • the role of Glu318, Lys320 and Lys 322 residues in the binding of Clq was confirmed by the ability of a short synthetic peptide containing these residues to inhibit complement mediated lysis.
  • FcR binding can be mediated by the interaction of the Fc moiety (of an antibody) with Fc receptors (FcRs), which are specialized cell surface receptors on cells including hematopoietic cells.
  • Fc receptors belong to the immunoglobulin superfamily, and shown to mediate both the removal of antibody-coated pathogens by phagocytosis of immune complexes, and the lysis of erythrocytes and various other cellular targets (e.g. tumor cells) coated with the corresponding antibody, via antibody dependent cell mediated cytotoxicity (ADCC; Van de Winkel, J. G., and Anderson, C. L., J. Leukoc. Biol. 49 (1991) 511-524).
  • ADCC antibody dependent cell mediated cytotoxicity
  • FcRs are defined by their specificity for immunoglobulin classes; Fc receptors for IgG antibodies are referred to as FcyR, for IgE as FceR, for IgA as FcaR and so on and neonatal Fc receptors are referred to as FcRn.
  • Fc receptor binding is described for example in Ravetch, J. V., and Kinet, J. P., Annu. Rev. Immunol. 9 (1991) 457-492; Capel, P. J., et al., Immunomethods 4 (1994) 25-34; de Haas, M., et al., J Lab. Clin. Med. 126 (1995) 330-341; and Gessner, J. E., et al., Ann. Hematol. 76 (1998) 231-248.
  • FcyR Fc domain of native IgG antibodies
  • FcyR In humans, three classes of FcyR have been characterized to-date, which are: (i) FcyRI (CD64), which binds monomeric IgG with high affinity and is expressed on macrophages, monocytes, neutrophils and eosinophils; (ii) FcyRII (CD32), which binds complexed IgG with medium to low affinity, is widely expressed, in particular on leukocytes, is believed to be a central player in antibody-mediated immunity, and which can be divided into FcyRIIA, FcyRIIB and FcyRIIC, which perform different functions in the immune system, but bind with similar low affinity to the IgG-Fc, and the ectodomains of these receptors are highly homologuous; and (iii) FcyRIII (CD 16), which binds IgG with medium to low affinity and has been found in two forms: FcyRIIIA, which has been found on NK cells, macrophages,
  • FcyRIIA is found on many cells involved in killing (e.g. macrophages, monocytes, neutrophils) and seems able to activate the killing process.
  • FcyRIIB seems to play a role in inhibitory processes and is found on B-cells, macrophages and on mast cells and eosinophils. Importantly, it has been shown that 75% of all FcyRIIB is found in the liver (Ganesan, L. P. et al., 2012: “FcyRIIb on liver sinusoidal endothelium clears small immune complexes,” Journal of Immunology 189: 4981-4988).
  • FcyRIIB is abundantly expressed on Liver Sinusoidal Endothelium, called LSEC, and in Kupffer cells in the liver and LSEC are the major site of small immune complexes clearance (Ganesan, L. P. et al., 2012: FcyRIIb on liver sinusoidal endothelium clears small immune complexes. Journal of Immunology 189: 4981-4988).
  • the antibodies disclosed herein and the antigen-binding fragments thereof comprise an Fc polypeptide or fragment thereof for binding to FcyRIIb, in particular an Fc region, such as, for example IgG-type antibodies.
  • the antibodies of the present disclosure comprise an engineered Fc moiety with the mutations S267E and L328F, in particular as described by Chu, S. Y. et al., 2008: Inhibition of B cell receptor-mediated activation of primary human B cells by coengagement of CD19 and FcgammaRIIb with Fc-engineered antibodies. Molecular Immunology 45, 3926-3933.
  • FcyRIIB may function to suppress further immunoglobulin production and isotype switching to, for example, the IgE class.
  • FcyRIIB On macrophages, FcyRIIB is thought to inhibit phagocytosis as mediated through FcyRIIA.
  • the B form On eosinophils and mast cells, the B form may help to suppress activation of these cells through IgE binding to its separate receptor.
  • modification in native IgG of at least one of E233- G236, P238, D265, N297, A327 and P329 reduces binding to FcyRI.
  • FcyRIIA reduced binding for FcyRIIA is found, e.g., for IgG mutation of at least one of E233-G236, P238, D265, N297, A327, P329, D270, Q295, A327, R292 and K414.
  • FcyRIII binding reduced binding to FcyRIIIA is found, e.g., for mutation of at least one of E233-G236, P238, D265, N297, A327, P329, D270, Q295, A327, S239, E269, E293, Y296, V303, A327, K338 and D376. Mapping of the binding sites on human IgGl for Fc receptors, the above-mentioned mutation sites, and methods for measuring binding to FcyRI and FcyRIIA, are described in Shields, R. L., et al., J. Biol. Chem. 276 (2001) 6591-6604.
  • FcyRIIIA Two allelic forms of human FcyRIIIA are the "FI 58" variant, which binds to IgGl Fc with low affinity, and the "VI 58" variant, which binds to IgGl Fc with high affinity. See, e.g., Bruhns et al, Blood 773:3716-3725 (2009).
  • two regions of native IgG Fc appear to be involved in interactions between FcyRIIs and IgGs, namely (i) the lower hinge site of IgG Fc, in particular amino acid residues L, L, G, G (234 - 237, EU numbering), and (ii) the adjacent region of the CH2 domain of IgG Fc, in particular a loop and strands in the upper CH2 domain adjacent to the lower hinge region, e.g. in a region of P331 (Wines, B.D., et al., J. Immunol. 2000; 164: 5313 - 5318).
  • FcyRI appears to bind to the same site on IgG Fc
  • FcRn and Protein A bind to a different site on IgG Fc, which appears to be at the CH2-CH3 interface
  • mutations that increase binding affinity of an Fc polypeptide or fragment thereof of the present disclosure to a (i.e., one or more) Fey receptor (e.g ., as compared to a reference Fc polypeptide or fragment thereof or containing the same that does not comprise the mutation(s)).
  • an antibody or antigen-binding fragment can comprise a Fc polypeptide or fragment thereof comprising a mutation selected from G236A; S239D; A330L; and I332E; or a combination comprising any two or more of the same; e.g., S239D/I332E; S239D/A330L/I332E;
  • the Fc polypeptide or fragment thereof does not comprise S239D.
  • the Fc polypeptide or fragment thereof comprises a native amino acid (e.g, serine) at position 239.
  • the Fc polypeptide or fragment thereof may comprise or consist of at least a portion of an Fc polypeptide or fragment thereof that is involved in binding to FcRn binding.
  • the Fc polypeptide or fragment thereof comprises one or more amino acid modifications that improve binding affinity for (e.g, enhance binding to) FcRn (e.g, at a pH of about 6.0) and, in some embodiments, thereby extend in vivo half-life of a molecule comprising the Fc polypeptide or fragment thereof (e.g., as compared to a reference Fc polypeptide or fragment thereof or antibody that is otherwise the same but does not comprise the modification(s)).
  • the Fc polypeptide or fragment thereof comprises or is derived from a IgG Fc and a half-life-extending mutation comprises any one or more of: M428L; N434S; N434H; N434A; N434S; M252Y; S254T; T256E; T250Q; P257I Q31 II; D376V; T307A; E380A (EU numbering).
  • a half-life-extending mutation comprises M428L/N434S (also referred to herein as "MLNS").
  • a half-life-extending mutation comprises M252Y/S254T/T256E.
  • a half-life-extending mutation comprises T250Q/M428L. In certain embodiments, a half-life-extending mutation comprises P257I/Q311I. In certain embodiments, a half-life-extending mutation comprises P257I/N434H. In certain embodiments, a half-life-extending mutation comprises D376V/N434H. In certain embodiments, a half-life-extending mutation comprises T307A/E380A/N434A.
  • an antibody or antigen-binding fragment includes a Fc moiety that comprises the substitution mtuations M428L/N434S. In some embodiments, an antibody or antigen-binding fragment includes a Fc polypeptide or fragment thereof that comprises the substitution mtuations G236A/A330L/I332E. In certain embodiments, an antibody or antigen-binding fragment includes a (e.g., IgG) Fc moiety that comprises a G236A mutation, an A330L mutation, and a I332E mutation (GAALIE), and does not comprise a S239D mutation (e.g., comprises a native S at position 239).
  • a S239D mutation e.g., comprises a native S at position 239
  • an antibody or antigen-binding fragment includes an Fc polypeptide or fragment thereof that comprises the substitution mutations: M428L/N434S and G236A/A330L/I332E, and optionally does not comprise S239D.
  • an antibody or antigen-binding fragment includes a Fc polypeptide or fragment thereof that comprises the substitution mutations: M428L/N434S and G236A/S239D/A330L/I332E.
  • the antibody or antigen-binding fragment comprises a mutation that alters glycosylation, wherein the mutation that alters glycosylation comprises N297A, N297Q, or N297G, and/or the antibody or antigen-binding fragment is partially or fully aglycosylated and/or is partially or fully afucosylated.
  • Host cell lines and methods of making partially or fully aglycosylated or partially or fully afucosylated antibodies and antigen-binding fragments are known (see, e.g., PCT Publication No. WO 2016/181357; Suzuki et al. Clin. Cancer Res. 73(6):1875-82 (2007); Huang et al. MAbs 6:1-12 (2018)).
  • the antibody or antigen-binding fragment is capable of eliciting continued protection in vivo in a subject even once no detectable levels of the antibody or antigen-binding fragment can be found in the subject (i.e., when the antibody or antigen-binding fragment has been cleared from the subject following administration). Such protection is referred to herein as a vaccinal effect. Without wishing to be bound by theory, it is believed that dendritic cells can internalize complexes of antibody and antigen and thereafter induce or contribute to an endogenous immune response against antigen.
  • an antibody or antigen binding fragment comprises one or more modifications, such as, for example, mutations in the Fc comprising G236A, A330L, and I332E, that are capable of activating dendritic cells that may induce, e.g ., T cell immunity to the antigen.
  • the antibody or antigen-binding fragment comprises a Fc polypeptide or a fragment thereof, including a CH2 (or a fragment thereof, a CH3 (or a fragment thereof), or a CH2 and a CH3, wherein the CH2, the CH3, or both can be of any isotype and may contain amino acid substitutions or other modifications as compared to a corresponding wild-type CH2 or CH3, respectively.
  • a Fc polypeptide of the present disclosure comprises two CH2-CH3 polypeptides that associate to form a dimer.
  • the antibody or antigen-binding fragment can be monoclonal.
  • the term "monoclonal antibody” (mAh) as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present, in some cases in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations that include different antibodies directed against different epitopes, each monoclonal antibody is directed against a single epitope of the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies.
  • monoclonal antibodies useful in the present invention may be prepared by the hybridoma methodology first described by Kohler et al., Nature 256:495 (1975), or may be made using recombinant DNA methods in bacterial, eukaryotic animal, or plant cells (see, e.g, U.S. Pat. No. 4,816,567).
  • Monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in Clackson et al., Nature, 352: 624-628 (1991) and Marks et al, J Mol. Biol., 222:581-597 (1991), for example.
  • Monoclonal antibodies may also be obtained using methods disclosed in PCT Publication No. WO 2004/076677A2.
  • Antibodies and antigen-binding fragments of the present disclosure include "chimeric antibodies" in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (see, U.S. Pat. Nos. 4,816,567; 5,530,101 and 7,498,415; and Morrison etal., Proc.
  • chimeric antibodies may comprise human and non-human residues.
  • chimeric antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. For further details, see Jones et al, Nature 321:522-525 (1986); Riechmann et al, Nature 332:323- 329 (1988); and Presta, Curr. Op. Struct. Biol. 2: 593-596 (1992). Chimeric antibodies also include primatized and humanized antibodies.
  • a “humanized antibody” is generally considered to be a human antibody that has one or more amino acid residues introduced into it from a source that is non-human. These non-human amino acid residues are typically taken from a variable domain. Humanization may be performed following the method of Winter and co-workers (Jones et al, Nature, 321:522-525 (1986); Reichmann et al, Nature, 332:323-327 (1988); Verhoeyen etal, Science, 239:1534-1536 (1988)), by substituting non-human variable sequences for the corresponding sequences of a human antibody. Accordingly, such "humanized” antibodies are chimeric antibodies (U.S. Pat. Nos.
  • a “humanized” antibody is one which is produced by a non-human cell or animal and comprises human sequences, e.g., He domains.
  • a "human antibody” is an antibody containing only sequences that are present in an antibody that is produced by a human.
  • human antibodies may comprise residues or modifications not found in a naturally occurring human antibody (e.g ., an antibody that is isolated from a human), including those modifications and variant sequences described herein. These are typically made to further refine or enhance antibody performance.
  • human antibodies are produced by transgenic animals. For example, see U.S. Pat. Nos. 5,770,429; 6,596,541 and 7,049,426.
  • an antibody or antigen-binding fragment of the present disclosure is chimeric, humanized, or human.
  • Presently disclosed antibodies and antigen-binding fragments can be obtained by, for example, introducing into a host (e.g., a mouse, a rabbit, a camelid, or a human) a SARS-CoV-2 spike protein or an immunogenic polypeptide as provided herein, and, in accordance with known methods, identifying from the host antibodies that bind to a presently disclosed epitope or epitope portion.
  • Antigen-binding fragments can be produced from an antibody using known means.
  • Presently disclosed antibodies can also be obtained by screening B cells, plasma cells, or sera from a subject that is or has been infected with a SARS-CoV-2 and identifying antibodies that bind to a presently disclosed epitope or epitope portion. Techniques for determining epitope-binding can include, for example, X-ray crystallography, alanine scanning mutagenesis, and cryo- electron microscopy.
  • antibody compositions and combinations that comprise any two or more (i.e., any two, any three, any four, any five, any six, or the like) antibodies or antigen-binding fragments of the present disclosure.
  • immunogenic compositions that comprise or encode a SARS-CoV-2 polypeptide (e.g, RBD, S glycoprotein, nucleoprotein, or fragment thereof) or polypeptide multimer (e.g, a S polypeptide trimer) that is capable of being bound by (e.g, comprises, retains, or substantially retains an epitope or antigenic region) a presently disclosed antibody or antigen-binding fragment and are capable of inducing a host immune response against the polypeptide or multimer that may involve, for example, production of antibodies, activation of specific immunologically competent cells, production of inflammatory cytokines, activation of complement, antibody dependent cytotoxicity, or any combination thereof.
  • SARS-CoV-2 polypeptide e.g, RBD, S glycoprotein, nucleoprotein, or fragment thereof
  • polypeptide multimer e.g, a S polypeptide trimer
  • An immunogenic composition can include a polypeptide comprising an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a corresponding S polypeptide, RBD, or portion thereof that comprises the epitope or antigenic region, provided that the subject epitope or antigen region is completely retained or is at least substantially retained as compared to the reference S polypeptide or RBD sequence and structure.
  • an immunogenic composition comprises an S polypeptide amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO.:3, or to a portion of SEQ ID NO.:3 that comprises the subject epitope or antigenic site.
  • an immunogenic composition comprises a RBD amino acid sequence that is at least least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO.:4, or to a portion of SEQ ID NO.:4 that comprises the subject epitope or antigenic site.
  • an immunogenic composition comprises a RBM amino acid sequence that is at least least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO.: 5, or to a portion of SEQ ID NO.: 5 that comprises the subject epitope or antigenic site.
  • any one two or more immunogenic amino acid sequences each comprising all or a portion of a presently disclosed epitope or antigenic site can be present in, for example, an isolated fragment of a SARS-CoV-2 S protein or RBD, in a fusion protein (e.g., fused or linked to a different portion, sequence or fragment of SARS-CoV-2 RBD, or as a Fc fusion or antibody fusion protein), as a recombinant protein, in a mixture of immunogenic polypeptides, or the like.
  • Two or more immunogenic polypeptides each comprising all or a portion of a presently disclosed epitope or target region can also be present as separate molecules in a composition.
  • S glycoprotein and RBD polypeptides can be engineered to comprise one or more mutations that can, for example, bias the S glycoprotein and/or RBD in a conformation of interest.
  • mutations include, for example, D614G, replacement of the residues 682-685 with the sequence G-S-A-S, V987P, and K986P, as well as the other mutations and alterations disclosed in Xiong et al, Nature Strutural & Molecular Biology 27 (934-941 (2020)), which mutations and other alterations are incorporated herein by reference.
  • S glycoprotein polypeptides can be provided in monomeric form, or as a multimer (e.g. , a trimer).
  • S glycoprotein polypeptides (in monomeric or multimeric form) can be present as monomers or can be comprised in disposed on or at a surface of a host cell or on a carrier molecule, such as a substrate polypeptide, lipid, or surface (e.g, a nanobead).
  • an immunogenic composition comprises: (a) a SARS-CoV-2 nucleocapsid (N) protein (SEQ ID NO.: 170), or an immunogenic fragment thereof; (b) a SARS-CoV-2 S glycoprotein polypeptide or multimer thereof comprising (i) one, two, or three Receptor Binding Domains (RBDs) in an open conformation and (ii) a Site la polypeptide, the Site la polypeptide capable of being bound by antibody S2H14; (c) a SARS-CoV-2 Spike (S) polypeptide comprising (i) a RBD in an open conformation or in a closed conformation and (ii) a Site lb polypeptide, the Site lb polypeptide capable of being bound by antibody S2H13; (d) a SARS-CoV-2 S polypeptide or multimer thereof comprising (i) two or three Receptor Binding Domains (RBDs) in an open conformation and (i
  • the immunogenic composition further comprises a pharmaceutically acceptable carrier, excipient, or diluent, and/or comprising an adjuvant.
  • the SARS-COV-2 S glycoprotein polypeptide comprises a prefusion-stabilized S ectodomain and/or does not comprise a C-terminal domain, such as a R1 domain, a CH domain, a CD domain, a HR1 domain, a HR2 domain, a TM domain, and/or a CT domain.
  • a SARS-CoV-2 S glycoprotein comprises one or more mutations and/or is missing one or more domains as compared to a native, full-length SARS-CoV-2 S glycoprotein.
  • an immunogenic composition comprises: (a) a SARS-CoV-2 S polypeptide or multimer thereof that comprises two or three receptor binding domains (RBDs) in a closed-conformation, wherein two adjacent RBDs are in a closed conformation; (b) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 143, a CDRH2 comprising the sequence set forth in SEQ ID NO: 144, a CDRH3 comprising the sequence set forth in SEQ ID NO: 145, a CDRLl comprising the sequence set forth in SEQ ID NO: 147, a CDRL2 comprising the sequence set forth in SEQ ID NO: 148, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 149; (c) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding
  • the immunogenic composition comprises: (d) a SARS- CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRL1 comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 108; (e) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO:94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising
  • an immunogenic composition comprises: (a) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a VH comprising the sequence set forth in SEQ ID NO: 142 and a VL comprising the sequence set forth in SEQ ID NO: 146; (b) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a VH comprising the sequence set forth in SEQ ID NO: 123 and a VL comprising the sequence set forth in SEQ ID NO: 138; or a combination thereof.
  • the immunogenic composition comprises: (c) a SARS- CoV-2 S protein polypeptide capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRL1 comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 108; (d) a SARS-CoV-2 S protein polypeptide capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in
  • an immunogenic composition comprises: (a) a SARS-CoV-2 S polypeptide capable of being bound by antibody S2M11, or an antigen-binding fragment thereof; (b) a SARS-CoV-2 S polypeptide capable of being bound by antibody S2E12, or an antigen-binding fragment thereof; (c) a SARS-CoV-2 S polypeptide capable of being bound by antibody S309, or an antigen-binding fragment thereof; or (d) any combination of (a)-(c) above.
  • the immunogenic composition further comprises a pharmaceutically acceptable carrier, excipient, or diluent, and/or comprising an adjuvant.
  • an immunogenic composition comprises a polynucleotide that encodes a presently disclosed RBD or S glycoprotein polypeptide (or multimer), and/or a vector that comprises the polynucleotide.
  • the immunogenic composition further comprises an adjuvant.
  • adjuvants include, for example, poly-ICLC, poly I:C, GLA, CpG, GM-CSF, alum, Delta Inulin, aluminum hydroxide, alhydrogel, aluminum phosphate, MF59, AS03, TLR agonists, resiquimod, and saponins.
  • an immunogenic polypeptide is provided with a carrier, such as, for example, a further polypeptide (e.g., an antibody or an antibody Fc that is conjugated to or fused to the immunogenic polyeptide), a liposome, a polysaccharide, a polylactic acid, a polyglycolic acid, polymeric amino acids, an amino acid copolymer, an inactive virus particle, a microbead, a nanobead, or the like.
  • a carrier such as, for example, a further polypeptide (e.g., an antibody or an antibody Fc that is conjugated to or fused to the immunogenic polyeptide), a liposome, a polysaccharide, a polylactic acid, a polyglycolic acid, polymeric amino acids, an amino acid copolymer, an inactive virus particle, a microbead, a nanobead, or the like.
  • the present disclosure provides isolated polynucleotides that encode any of the presently disclosed antibodies or an antigen-binding fragment thereof, or a portion thereof (e.g ., a CDR, a VH, a VL, a heavy chain, or a light chain), and/or that encode a presently disclosed immunogenic composition.
  • the polynucleotide is codon-optimized for expression in a host cell.
  • Codon-optimized sequences include sequences that are partially codon-optimized (i.e., one or more codon is optimized for expression in the host cell) and those that are fully codon-optimized.
  • polynucleotides encoding antibodies, antigen binding fragments and/or immunogenic compositions of the present disclosure may possess different nucleotide sequences while still encoding a same antibody or antigen binding fragment or immunogenic composition due to, for example, the degeneracy of the genetic code, splicing, and the like.
  • the polynucleotide can comprise deoxyribonucleic acid (DNA) or ribonucleic acid (RNA).
  • the RNA comprises messenger RNA (mRNA).
  • Vectors are also provided, wherein the vectors comprise or contain a polynucleotide as disclosed herein (e.g, a polynucleotide that encodes an antibody or antigen-binding fragment that binds to SARS-CoV-2).
  • a vector can comprise any one or more of the vectors disclosed herein.
  • a vector is provided that comprises a DNA plasmid construct encoding the antibody or antigen-binding fragment, or a portion thereof (e.g, so-called "DMAb”; see, e.g, Muthumani etal, J Infect Dis.
  • a DNA plasmid construct comprises a single open reading frame encoding a heavy chain and a light chain (or a VH and a VL) of the antibody or antigen binding fragment, wherein the sequence encoding the heavy chain and the sequence encoding the light chain are optionally separated by polynucleotide encoding a protease cleavage site and/or by a polynucleotide encoding a self-cleaving peptide.
  • the substituent components of the antibody or antigen-binding fragment are encoded by a polynucleotide comprised in a single plasmid.
  • the substituent components of the antibody or antigen-binding fragment are encoded by a polynucleotide comprised in two or more plasmids (e.g ., a first plasmid comprises a polynucleotide encoding a heavy chain, VH, or VH+CH, and a second plasmid comprises a polynucleotide encoding the cognate light chain, VL, or VL+CL).
  • a single plasmid comprises a polynucleotide encoding a heavy chain and/or a light chain from two or more antibodies or antigen-binding fragments of the present disclosure.
  • An exemplary expression vector is pVaxl, available from Invitrogen®.
  • a DNA plasmid of the present disclosure can be delivered to a subject by, for example, electroporation (e.g., intramuscular electroporation), or with an appropriate formulation (e.g, hyaluronidase).
  • the present disclosure also provides a host cell expressing an antibody or antigen-binding fragment or immunogenic composition according to the present disclosure; or comprising or containing a vector or polynucleotide according the present disclosure.
  • the cells include but are not limited to, eukaryotic cells, e.g., yeast cells, animal cells, insect cells, plant cells; and prokaryotic cells, including E. coli.
  • the cells are mammalian cells.
  • the cells are a mammalian cell line such as CHO cells (e.g, DHFR- CHO cells (Urlaub et al, PNAS 77:4216 (1980)), human embryonic kidney cells (e.g, HEK293T cells), PER.C6 cells, Y0 cells, Sp2/0 cells.
  • NS0 cells human liver cells, e.g. Hepa RG cells, myeloma cells or hybridoma cells.
  • mammalian host cell lines include mouse sertoli cells (e.g, TM4 cells); monkey kidney CV1 line transformed by SV40 (COS-7); baby hamster kidney cells (BHK); African green monkey kidney cells (VERO-76); monkey kidney cells (CV1); human cervical carcinoma cells (HELA); human lung cells (W138); human liver cells (Hep G2); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3 A); mouse mammary tumor (MMT 060562); TRI cells; MRC 5 cells; and FS4 cells.
  • Mammalian host cell lines suitable for antibody production also include those described in, for example, Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B. K. C. Lo, ed., Humana Press, Totowa, N.J.), pp. 255- 268 (2003).
  • a host cell is a prokaryotic cell, such as an E. coli.
  • a prokaryotic cell such as an E. coli.
  • the expression of peptides in prokaryotic cells such as E. coli is well established (see, e.g, Pluckthun, A. Bio/Technology 9:545-551 (1991).
  • antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
  • For expression of antibody fragments and polypeptides in bacteria see, e.g., U.S. Pat. Nos. 5,648,237; 5,789,199; and 5,840,523.
  • the cell may be transfected with a vector according to the present description with an expression vector.
  • transfection refers to the introduction of nucleic acid molecules, such as DNA or RNA (e.g. mRNA) molecules, into cells, such as into eukaryotic cells.
  • RNA e.g. mRNA
  • transfection encompasses any method known to the skilled person for introducing nucleic acid molecules into cells, such as into eukaryotic cells, including into mammalian cells.
  • Such methods encompass, for example, electroporation, lipofection, e.g, based on cationic lipids and/or liposomes, calcium phosphate precipitation, nanoparticle based transfection, virus based transfection, or transfection based on cationic polymers, such as DEAE-dextran or polyethylenimine, etc.
  • the introduction is non-viral.
  • host cells of the present disclosure may be transfected stably or transiently with a vector according to the present disclosure, e.g. for expressing an antibody, antigen-binding fragment, or immunogenic composition according to the present disclosure.
  • the cells may be stably transfected with the vector as described herein.
  • cells may be transiently transfected with a vector according to the present disclosure encoding an antibody, antigen-binding fragment, or immunogenic composition as disclosed herein.
  • a polynucleotide may be heterologous to the host cell.
  • the present disclosure also provides recombinant host cells that heterologously express an antibody, antigen-binding fragment, or immunogenic composition of the present disclosure.
  • the cell may be of a species that is different to the species from which the antibody was fully or partially obtained (e.g ., CHO cells expressing a human antibody or an engineered human antibody).
  • the cell type of the host cell does not express the antibody or antigen binding fragment in nature.
  • the host cell may impart a post-translational modification (PTM; e.g., glysocylation or fucosylation) on the antibody or antigen binding fragment that is not present in a native state of the antibody or antigen-binding fragment (or in a native state of a parent antibody from which the antibody or antigen binding fragment was engineered or derived).
  • PTM post-translational modification
  • Such a PTM may result in a functional difference (e.g, reduced immunogenicity).
  • an antibody or antigen binding fragment of the present disclosure that is produced by a host cell as disclosed herein may include one or more post-translational modification that is distinct from the antibody (or parent antibody) in its native state (e.g, a human antibody produced by a CHO cell can comprise a more post-translational modification that is distinct from the antibody when isolated from the human and/or produced by the native human B cell or plasma cell).
  • a post-translational modification that is distinct from the antibody (or parent antibody) in its native state
  • a human antibody produced by a CHO cell can comprise a more post-translational modification that is distinct from the antibody when isolated from the human and/or produced by the native human B cell or plasma cell.
  • Insect cells useful expressing an antibody or antigen-binding fragment of the present disclosure are known in the art and include, for example, Spodoptera frugipera Sf9 cells, Trichoplusia ni BTI-TN5B1-4 cells, and Spodoptera frugipera SfSWTOl “MimicTM” cells. See, e.g., Palmberger et al., J. Biotechnol. 753(3-4): 160-166 (2011). Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
  • Eukaryotic microbes such as filamentous fungi or yeast are also suitable hosts for cloning or expressing protein-encoding vectors, and include fungi and yeast strains with "humanized” glycosylation pathways, resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gerngross, Nat.
  • Plant cells can also be utilized as hosts for expressing a binding protein of the present disclosure.
  • PLANTIBODIESTM technology (described in, for example, U.S. Pat. Nos. 5,959,177; 6,040,498; 6,420,548; 7,125,978; and 6,417,429) employs transgenic plants to produce antibodies.
  • the host cell comprises a mammalian cell.
  • the host cell is a CHO cell, a HEK293 cell, a PER.C6 cell, a Y0 cell, a Sp2/0 cell, a NS0 cell, a human liver cell, a myeloma cell, or a hybridoma cell.
  • the present disclosure provides methods for producing an antibody, antigen-binding fragment, or immunogenic composition, wherein the methods comprise culturing a host cell of the present disclosure under conditions and for a time sufficient to produce the antibody, antigen-binding fragment, or immunogenic composition.
  • Methods useful for isolating and purifying recombinantly produced antibodies may include obtaining supernatants from suitable host cell/vector systems that secrete the recombinant antibody into culture media and then concentrating the media using a commercially available filter. Following concentration, the concentrate may be applied to a single suitable purification matrix or to a series of suitable matrices, such as an affinity matrix or an ion exchange resin.
  • One or more reverse phase HPLC steps may be employed to further purify a recombinant polypeptide. These purification methods may also be employed when isolating an immunogen from its natural environment. Methods for large scale production of one or more of the isolated/recombinant antibody, antigen-binding fragment, or immunogenic composition described herein include batch cell culture, which is monitored and controlled to maintain appropriate culture conditions. Purification of soluble antibodies may be performed according to methods described herein and known in the art and that comport with laws and guidelines of domestic and foreign regulatory agencies. Additional Compositions
  • compositions that comprise any one or more of the presently disclosed antibodies, antigen-binding fragments, polynucleotides, vectors, host cells, or immunogenic compositions, singly or in any combination, and can further comprise a pharmaceutically acceptable carrier, excipient, or diluent. Carriers, excipients, and diluents are discussed in further detail herein.
  • a composition comprises two or more different antibodies, antigen-binding fragments, or immunogenic compositions according to the present disclosure.
  • antibodies or antigen-binding fragments to be used in a combination each independently have one or more of the following characteristics: neutralize naturally occurring SARS-CoV-2 variants; do not compete with one another for Spike protein binding; bind distinct Spike protein epitopes; have a reduced formation of resistance to SARS-CoV-2; when in a combination, have a reduced formation of resistance to SARS-CoV-2; potently neutralize live SARS-CoV-2 virus; exhibit additive or synergistic effects on neutralization of live SARS-CoV-2 virus when used in combination; exhibit effector functions; are protective in relevant animal model(s) of infection; are capable of being produced in sufficient quantities for large- scale production.
  • a composition comprises a first vector comprising a first plasmid, and a second vector comprising a second plasmid, wherein the first plasmid comprises a polynucleotide encoding a heavy chain, VH, or VH+CH, and a second plasmid comprises a polynucleotide encoding the cognate light chain, VL, or VL+CL of the antibody or antigen-binding fragment thereof.
  • a composition comprises a polynucleotide (e.g ., mRNA) coupled to a suitable delivery vehicle or carrier.
  • Exemplary vehicles or carriers for administration to a human subject include a lipid or lipid-derived delivery vehicle, such as a liposome, solid lipid nanoparticle, oily suspension, submicron lipid emulsion, lipid microbubble, inverse lipid micelle, cochlear liposome, lipid microtubule, lipid microcylinder, or lipid nanoparticle (LNP) or a nanoscale platform (see, e.g., Li et al. Wilery Interdiscip Rev. Nanomed Nanobiotechnol. 77(2):el530 (2019)).
  • LNP lipid nanoparticle
  • Principles, reagents, and techniques for designing appropriate mRNA and and formulating mRNA-LNP and delivering the same are described in, for example, Pardi et al.
  • lipid nanoparticles e.g ., ionizable cationic lipid/phosphatidylcholine/cholesterol/PEG-lipid; ionizable lipid:distearoyl PC:cholesterol:polyethylene glycol lipid
  • subcutaneous, intramuscular, intradermal, intravenous, intraperitoneal, and intratracheal administration of the same, are incorporated herein by reference.
  • Methods of diagnosis may include contacting an antibody, antibody fragment (e.g., antigen binding fragment) with a sample.
  • samples may be isolated from a subject, for example an isolated tissue sample taken from, for example, nasal passages, sinus cavities, salivary glands, lung, liver, pancreas, kidney, ear, eye, placenta, alimentary tract, heart, ovaries, pituitary, adrenals, thyroid, brain, skin or blood.
  • the methods of diagnosis may also include the detection of an antigen/antibody complex, in particular following the contacting of an antibody or antibody fragment with a sample. Such a detection step can be performed at the bench, i.e. without any contact to the human or animal body. Examples of detection methods are well-known to the person skilled in the art and include, e.g, ELISA (enzyme-linked immunosorbent assay), including direct, indirect, and sandwich ELISA.
  • Treatment refers to medical management of a disease, disorder, or condition of a subject (e.g ., a human or non human mammal, such as a primate, horse, cat, dog, goat, mouse, or rat).
  • an appropriate dose or treatment regimen comprising an antibody or composition of the present disclosure is administered in an amount sufficient to elicit a therapeutic or prophylactic benefit.
  • Therapeutic or prophylactic/preventive benefit includes improved clinical outcome; lessening or alleviation of symptoms associated with a disease; decreased occurrence of symptoms; improved quality of life; longer disease-free status; diminishment of extent of disease, stabilization of disease state; delay or prevention of disease progression; remission; survival; prolonged survival; or any combination thereof.
  • therapeutic or prophylactic/preventive benefit includes reduction or prevention of hospitalization for treatment of a SARS-CoV-2 infection (i.e., in a statistically significant manner).
  • therapeutic or prophylactic/preventive benefit includes a reduced duration of hospitalization for treatment of a SARS-CoV-2 infection (i.e., in a statistically significant manner).
  • therapeutic or prophylactic/preventive benefit includes a reduced or abrogated need for respiratory intervention, such as intubation and/or the use of a respirator device.
  • therapeutic or prophylactic/preventive benefit includes reversing a late-stage disease pathology and/or reducing mortality.
  • a “therapeutically effective amount” or “effective amount” of an antibody, antigen-binding fragment, polynucleotide, vector, host cell, composition, or immunogenic composition of this disclosure refers to an amount of the composition or molecule sufficient to result in a therapeutic effect, including improved clinical outcome; lessening or alleviation of symptoms associated with a disease; decreased occurrence of symptoms; improved quality of life; longer disease-free status; diminishment of extent of disease, stabilization of disease state; delay of disease progression; remission; survival; or prolonged survival in a statistically significant manner.
  • a therapeutically effective amount refers to the effects of that ingredient or cell expressing that ingredient alone.
  • a therapeutically effective amount refers to the combined amounts of active ingredients or combined adjunctive active ingredient with a cell expressing an active ingredient that results in a therapeutic effect, whether administered serially, sequentially, or simultaneously.
  • a combination may comprise, for example, two or more different antibodies that specifically bind a SARS-CoV-2 antigen, which in certain embodiments, may be the same or different SARS-CoV-2 antigen, and/or can comprise the same or different epitopes.
  • methods for treating a SARS-CoV-2 infection in a subject, wherein the methods comprise administering to the subject an effective amount of an antibody, antigen-binding fragment, polynucleotide, vector, host cell, immunogenic composition, or composition as disclosed herein.
  • Subjects that can be treated by the present disclosure are, in general, human and other primate subjects, such as monkeys and apes for veterinary medicine purposes. Other model organisms, such as mice and rats, may also be treated according to the present disclosure.
  • the subject may be a human subject.
  • the subjects can be male or female and can be any suitable age, including infant, juvenile, adolescent, adult, and geriatric subjects.
  • a subject treated according to the present disclosure comprises one or more risk factors.
  • a human subject treated according to the present disclosure is an infant, a child, a young adult, an adult of middle age, or an elderly person. In certain embodiments, a human subject treated according to the present disclosure is less than 1 year old, or is 1 to 5 years old, or is between 5 and 125 years old (e.g., 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100,
  • a human subject treated according to the present disclosure is 0- 19 years old, 20-44 years old, 45-54 years old, 55-64 years old, 65-74 years old, 75-84 years old, or 85 years old, or older. Persons of middle, and especially of elderly age are believed to be at particular risk.
  • the human subject is 45-54 years old, 55-64 years old, 65-74 years old, 75-84 years old, or 85 years old, or older.
  • the human subject is male. In some embodiments, the human subject is female.
  • a human subject treated according to the present disclosure is a resident of a nursing home or a long-term care facility, is a hospice care worker, is a healthcare provider or healthcare worker, is a first responder, is a family member or other close contact of a subject diagnosed with or suspected of having a SARS-CoV-2 infection, is overweight or clinically obese, is or has been a smoker, has or had chronic obstructive pulmonary disease (COPD), is asthmatic ( e.g ., having moderate to severe asthma), has an autoimmune disease or condition (e.g., diabetes), and/or has a compromised or depleted immune system (e.g, due to AIDS/HIV infection, a cancer such as a blood cancer, a lymphodepleting therapy such as a chemotherapy, a bone marrow or organ transplantation, or a genetic immune condition), has chronic liver disease, has cardiovascular disease, has a pulmonary or heart defect, works or otherwise spends time in close proximity with others, such as in a factory, shipping
  • COPD
  • a subject treated according to the present disclosure has received a vaccine for SARS-CoV-2 and the vaccine is determined to be ineffective, e.g, by post-vaccine infection or symptoms in the subject, by clinical diagnosis or scientific or regulatory criteria.
  • treatment is administered as peri-exposure prophylaxis.
  • treatment is administered to a subject with mild- to-moderate disease, which may be in an outpatient setting.
  • treatment is administered to a subject with moderate-to- severe disease, such as requiring hospitalization.
  • Typical routes of administering the presently disclosed compositions thus include, without limitation, oral, topical, transdermal, inhalation, parenteral, sublingual, buccal, rectal, vaginal, and intranasal.
  • parenteral includes subcutaneous injections, intravenous, intramuscular, intrastemal injection or infusion techniques.
  • administering comprises administering by a route that is selected from oral, intravenous, parenteral, intragastric, intrapleural, intrapulmonary, intrarectal, intradermal, intraperitoneal, intratumoral, subcutaneous, topical, transdermal, intracisternal, intrathecal, intranasal, and intramuscular.
  • a method comprises orally administering the antibody, antigen binding fragment, polynucleotide, vector, host cell, or composition to the subject.
  • compositions according to certain embodiments of the present invention are formulated so as to allow the active ingredients contained therein to be bioavailable upon administration of the composition to a patient.
  • Compositions that will be administered to a subject or patient may take the form of one or more dosage units, where for example, a tablet may be a single dosage unit, and a container of a herein described an antibody or antigen-binding in aerosol form may hold a plurality of dosage units.
  • Actual methods of preparing such dosage forms are known, or will be apparent, to those skilled in this art; for example, see Remington: The Science and Practice of Pharmacy, 20th Edition (Philadelphia College of Pharmacy and Science, 2000).
  • composition to be administered will, in any event, contain an effective amount of an antibody or antigen-binding fragment, polynucleotide, vector, host cell, , or composition of the present disclosure, for treatment of a disease or condition of interest in accordance with teachings herein.
  • a composition may be in the form of a solid or liquid.
  • the carrier(s) are particulate, so that the compositions are, for example, in tablet or powder form.
  • the carrier(s) may be liquid, with the compositions being, for example, an oral oil, injectable liquid or an aerosol, which is useful in, for example, inhalatory administration.
  • the pharmaceutical composition is preferably in either solid or liquid form, where semi solid, semi liquid, suspension and gel forms are included within the forms considered herein as either solid or liquid.
  • the pharmaceutical composition may be formulated into a powder, granule, compressed tablet, pill, capsule, chewing gum, wafer or the like.
  • a solid composition will typically contain one or more inert diluents or edible carriers.
  • binders such as carboxymethylcellulose, ethyl cellulose, microcrystalline cellulose, gum tragacanth or gelatin; excipients such as starch, lactose or dextrins, disintegrating agents such as alginic acid, sodium alginate, Primogel, corn starch and the like; lubricants such as magnesium stearate or Sterotex; glidants such as colloidal silicon dioxide; sweetening agents such as sucrose or saccharin; a flavoring agent such as peppermint, methyl salicylate or orange flavoring; and a coloring agent.
  • a liquid carrier such as polyethylene glycol or oil.
  • the composition may be in the form of a liquid, for example, an elixir, syrup, solution, emulsion or suspension.
  • the liquid may be for oral administration or for delivery by injection, as two examples.
  • preferred compositions contain, in addition to the present compounds, one or more of a sweetening agent, preservatives, dye/colorant and flavor enhancer.
  • a surfactant, preservative, wetting agent, dispersing agent, suspending agent, buffer, stabilizer and isotonic agent may be included.
  • Liquid pharmaceutical compositions may include one or more of the following adjuvants: sterile diluents such as water for injection, saline solution, preferably physiological saline, Ringer’s solution, isotonic sodium chloride, fixed oils such as synthetic mono or diglycerides which may serve as the solvent or suspending medium, polyethylene glycols, glycerin, propylene glycol or other solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose.
  • sterile diluents such as water for injection, saline solution, preferably physiological saline, Ringer’s solution, isotonic sodium chloride
  • fixed oils such as synthetic mono or diglycerides which may serve as
  • parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
  • Physiological saline is a preferred adjuvant.
  • An injectable pharmaceutical composition is preferably sterile.
  • a liquid composition intended for either parenteral or oral administration should contain an amount of an antibody or antigen-binding fragment as herein disclosed such that a suitable dosage will be obtained. Typically, this amount is at least 0.01% of the antibody or antigen-binding fragment in the composition. When intended for oral administration, this amount may be varied to be between 0.1 and about 70% of the weight of the composition. Certain oral pharmaceutical compositions contain between about 4% and about 75% of the antibody or antigen-binding fragment.
  • pharmaceutical compositions and preparations according to the present invention are prepared so that a parenteral dosage unit contains between 0.01 to 10% by weight of antibody or antigen-binding fragment prior to dilution.
  • the composition may be intended for topical administration, in which case the carrier may suitably comprise a solution, emulsion, ointment or gel base.
  • the base may comprise one or more of the following: petrolatum, lanolin, polyethylene glycols, bee wax, mineral oil, diluents such as water and alcohol, and emulsifiers and stabilizers.
  • Thickening agents may be present in a composition for topical administration.
  • the composition may include a transdermal patch or iontophoresis device.
  • the pharmaceutical composition may be intended for rectal administration, in the form, for example, of a suppository, which will melt in the rectum and release the drug.
  • the composition for rectal administration may contain an oleaginous base as a suitable nonirritating excipient.
  • Such bases include, without limitation, lanolin, cocoa butter and polyethylene glycol.
  • a composition may include various materials which modify the physical form of a solid or liquid dosage unit.
  • the composition may include materials that form a coating shell around the active ingredients.
  • the materials that form the coating shell are typically inert, and may be selected from, for example, sugar, shellac, and other enteric coating agents.
  • the active ingredients may be encased in a gelatin capsule.
  • the composition in solid or liquid form may include an agent that binds to the antibody or antigen-binding fragment of the disclosure and thereby assists in the delivery of the compound. Suitable agents that may act in this capacity include monoclonal or polyclonal antibodies, one or more proteins or a liposome.
  • the composition may consist essentially of dosage units that can be administered as an aerosol.
  • aerosol is used to denote a variety of systems ranging from those of colloidal nature to systems consisting of pressurized packages. Delivery may be by a liquefied or compressed gas or by a suitable pump system that dispenses the active ingredients. Aerosols may be delivered in single phase, bi phasic, or tri phasic systems in order to deliver the active ingredient(s). Delivery of the aerosol includes the necessary container, activators, valves, subcontainers, and the like, which together may form a kit. One of ordinary skill in the art, without undue experimentation, may determine preferred aerosols.
  • compositions of the present disclosure also encompass carrier molecules for polynucleotides, as described herein (e.g ., lipid nanoparticles, nanoscale delivery platforms, and the like).
  • compositions may be prepared by methodology well known in the pharmaceutical art.
  • a composition intended to be administered by injection can be prepared by combining a composition that comprises an antibody, antigen-binding fragment thereof, or antibody conjugate as described herein and optionally, one or more of salts, buffers and/or stabilizers, with sterile, distilled water so as to form a solution.
  • a surfactant may be added to facilitate the formation of a homogeneous solution or suspension.
  • Surfactants are compounds that non-covalently interact with the peptide composition so as to facilitate dissolution or homogeneous suspension of the antibody or antigen-binding fragment thereof in the aqueous delivery system.
  • an appropriate dose and treatment regimen provide the composition(s) in an amount sufficient to provide therapeutic and/or prophylactic benefit (such as described herein, including an improved clinical outcome (e.g., a decrease in frequency, duration, or severity of diarrhea or associated dehydration, or inflammation, or longer disease-free and/or overall survival, or a lessening of symptom severity).
  • a dose should be sufficient to prevent, delay the onset of, or diminish the severity of a disease associated with disease or disorder.
  • Prophylactic benefit of the compositions administered according to the methods described herein can be determined by performing pre-clinical (including in vitro and in vivo animal studies) and clinical studies and analyzing data obtained therefrom by appropriate statistical, biological, and clinical methods and techniques, all of which can readily be practiced by a person skilled in the art.
  • Compositions are administered in an effective amount (e.g ., to treat a Wuhan coronavirus infection), which will vary depending upon a variety of factors including the activity of the specific compound employed; the metabolic stability and length of action of the compound; the age, body weight, general health, sex, and diet of the subject; the mode and time of administration; the rate of excretion; the drug combination; the severity of the particular disorder or condition; and the subject undergoing therapy.
  • tollowing administration of therapies according to the formulations and methods of this disclosure test subjects will exhibit about a 10% up to about a 99% reduction in one or more symptoms associated with the disease or disorder being treated as compared to placebo-treated or other suitable control subjects.
  • a therapeutically effective daily dose of an antibody or antigen binding fragment is (for a 70 kg mammal) from about 0.001 mg/kg (i.e., 0.07 mg) to about 100 mg/kg (i.e., 7.0 g); preferably a therapeutically effective dose is (for a 70 kg mammal) from about 0.01 mg/kg (i.e., 0.7 mg) to about 50 mg/kg (i.e., 3.5 g); more preferably a therapeutically effective dose is (for a 70 kg mammal) from about 1 mg/kg (i.e., 70 mg) to about 25 mg/kg (i.e., 1.75 g).
  • a therapeutically effective dose may be different than for an antibody or antigen-binding fragment.
  • a method comprises administering the antibody, antigen-binding fragment, polynucleotide, vector, host cell, or composition to the subject at 2, 3, 4, 5, 6, 7, 8, 9, 10 times, or more.
  • a method comprises administering the antibody, antigen-binding fragment, or composition to the subject a plurality of times, wherein a second or successive administration is performed at about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 24, about 48, about 74, about 96 hours, or more, following a first or prior administration, respectively.
  • a method comprises administering the antibody, antigen-binding fragment, polynucleotide, vector, host cell, immavouruc composition, or composition at least one time prior to the subject being infected by SARS-CoV-2.
  • compositions comprising an antibody, antigen-binding fragment, polynucleotide, vector, host cell, immunogenic composition, or composition of the present disclosure may also be administered simultaneously with, prior to, or after administration of one or more other therapeutic agents.
  • combination therapy may include administration of a single pharmaceutical dosage formulation which contains a compound of the invention and one or more additional active agents, as well as administration of compositions comprising an antibody or antigen-binding fragment of the disclosure and each active agent in its own separate dosage formulation.
  • an antibody or antigen-binding fragment thereof as described herein and the other active agent can be administered to the patient together in a single oral dosage composition such as a tablet or capsule, or each agent administered in separate oral dosage formulations.
  • an antibody or antigen-binding fragment as described herein and the other active agent can be administered to the subject together in a single parenteral dosage composition such as in a saline solution or other physiologically acceptable solution, or each agent administered in separate parenteral dosage formulations.
  • a single parenteral dosage composition such as in a saline solution or other physiologically acceptable solution, or each agent administered in separate parenteral dosage formulations.
  • the compositions comprising an antibody or antigen-binding fragment and one or more additional active agents can be administered at essentially the same time, i.e., concurrently, or at separately staggered times, i.e., sequentially and in any order; combination therapy is understood to include all these regimens.
  • a combination therapy comprises one or more anti-SARS-CoV-2 antibody (or one or more nucleic acid, host cell, vector, or composition) of the present disclosure and one or more anti-inflammatory agent and/or one or more anti-viral agent.
  • the one or more anti inflammatory agent comprises a corticosteroid such as, for example, dexamethasone, prednisone, or the like.
  • the one or more anti-inflammatory agents comprise a cytokine antagonist such as, for example, an antibody that binds to IL6 (such as siltuximab), or to IL-6R (such as tocilizumab), or to IL-Ib, IL-7, IL-8, IL- 9, IL-10, FGF, G-CSF, GM-CSF, IFN-g, IP-10, MCP-1, MPMA, MIP1-B, PDGR, TNF-a, or VEGF.
  • a cytokine antagonist such as, for example, an antibody that binds to IL6 (such as siltuximab), or to IL-6R (such as tocilizumab), or to IL-Ib, IL-7, IL-8, IL- 9, IL-10, FGF, G-CSF, GM-CSF, IFN-g, IP-10, MCP-1, MPMA, MIP1-B, PDGR, TNF-a, or VEGF
  • the one or more anti-viral agents comprise nucleotide analogs or nucelotide analog prodrugs such as, for example, remdesivir, sofosbuvir, acyclovir, and zidovudine.
  • an anti viral agent comprises lopinavir, ritonavir, favipiravir, or any combination thereof.
  • NSAIDS non-steroidal anti-inflammatory drugs
  • the one or more antibody (or one or more nucleic acid, host cell, vector, or composition) and the one or more anti inflammatory agent and/or one or the more antiviral agent can be administered in any order and any sequence, or together.
  • an antibody (or one or more nucleic acid, host cell, vector, or immunogenic composition, composition) is administered to a subject who has previously received one or more anti-inflammatory agent and/or one or more antiviral agent.
  • one or more anti-inflammatory agent and/or one or more antiviral agent is administered to a subject who has previously received an antibody (or one or more nucleic acid, host cell, vector, immunogenic composition, or composition).
  • a combination therapy comprises two or more anti-SARS-CoV-2 antibodies of the present disclosure.
  • a method can comprise administering a first antibody to a subject who has received a second antibody, or can comprise administering two or more antibodies together.
  • a method is provided that comprises administering to the subject (a) a first antibody or antigen-binding fragment, when the subject has received a second antibody or antigen-binding fragment; (b) the second antibody or antigen binding fragment, when the subject has received the first antibody or antigen-binding fragment; or (c) the first antibody or antigen-binding fragment, and the second antibody or antigen-binding fragment.
  • an antibody, antigen-binding fragment, polynucleotide, vector, host cell, immunogenic composition, or composition is provided for use in a method of preventing or treating a SARS-CoV-2 infection in a subject.
  • an antibody, antigen-binding fragment, immunogenic composition, or composition is provided for use in a method of manufacturing or preparing a medicament for preventing or treating a SARS-CoV-2 coronavirus infection in a subject.
  • the present disclosure also provides the following Embodiments.
  • Embodiment 1 An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 16 and a VL amino acid sequence according to SEQ ID NO: 26 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
  • Embodiment 2 An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein:
  • binding comprises contacting one or more of amino acid residues 369- 386, 404-411, and 499-508 of SEQ ID NO: 3; and/or
  • binding comprises binding an epitope formed by amino acid residues 369-386, 404-411, and 499-508 of SEQ ID NO: 3.
  • Embodiment 3 The antibody or antigen-binding fragment of Embodiment
  • Embodiment 4 The antibody or antigen-binding fragment of any one of
  • Embodiments 1-3 which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and one or zero RBDs of the trimer is in a closed conformation, and optionally is not capable of binding to the S glycoprotein when only one RBD of the trimer is in an open conformation and two RBDs of the trimer are in a closed conformation.
  • RBDs receptor binding domains
  • Embodiment 5 An antibody, or an antigen-binding fragment thereof, which is capable of binding to a SAR.S-CoV-2 S glycoprotein of a S glycoprotein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and one or zero RBDs of the trimer is in a closed conformation, and optionally is not capable of binding to the S protein when only one RBD of the trimer is in an open conformation and two RBDs of the trimer are in a closed conformation.
  • RBDs receptor binding domains
  • Embodiment 6 An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 31 and a VL amino acid sequence according to SEQ ID NO: 35 for binding to a SAR.S-CoV-2 S glycoprotein of a S glycoprotein trimer.
  • Embodiment 7 An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SAR.S CoV-2 S glycoprotein of a S glycoprotein trimer, wherein:
  • binding comprises contacting one or more of amino acid residues 444- 449 and 472-498 of SEQ ID NO: 3; and/or
  • the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 444-449 and 472-498 of SEQ ID NO: 3; and/or
  • binding comprises binding within a crevice formed by a receptor binding motif (RBM) b-hairpin in a receptor binding domain (RBD) of the S glycoprotein.
  • RBM receptor binding motif
  • RBD receptor binding domain
  • Embodiment 9 The antibody or antigen-binding fragment of any one of Embodiments 6-8, which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein one or zero receptor binding domains (RBDs) of the trimer are in an open conformation and two or three RBDs of the trimer are in a closed conformation.
  • RBDs receptor binding domains
  • Embodiment 10 An antibody, or an antigen-binding fragment thereof, which is capable of binding to a SARS-CoV-2 S glycoprotein protein of a S glycoprotein trimer wherein one or zero receptor binding domains (RBDs) of the trimer are in an open conformation and two or three RBDs of the trimer are in a closed conformation.
  • RBDs receptor binding domains
  • Embodiment 11 An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 47 and a VL amino acid sequence according to SEQ ID NO: 51 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
  • Embodiment 12 An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein, wherein:
  • binding comprises contacting one or more of amino acid residues 403, 444-456, 475, and 485-505 of SEQ ID NO: 3; and/or
  • the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 403, 444-456, 475, and 485-505 of SEQ ID NO: 3.
  • Embodiment 13 The antibody or antigen-binding fragment of Embodiment 12, which does not contact one or more of amino acids 448, 450, 451, 452, 454, 486, 488, 490, 491, 492, 497, 503, and 504 of SEQ ID NO.:3 when binding to the S glycoprotein.
  • Embodiment 14 The antibody or antigen-binding fragment of any one of
  • Embodiments 11-13 which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein one, two, or three receptor binding domains (RBDs) of the trimer are in an open conformation.
  • RBDs receptor binding domains
  • Embodiment 15 An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 64 and a VL amino acid sequence according to SEQ ID NO: 68 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
  • Embodiment 16 An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein:
  • binding comprises contacting one or more of amino acid residues 368- 388 and 407-414 of SEQ ID NO: 3; and/or
  • the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 368-388 and 407-414 of SEQ ID NO: 3.
  • Embodiment 17 The antibody or antigen-binding fragment of Embodiment 15 or 16, which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and zero or one RBDs of the trimer is in a closed conformation.
  • Embodiment 18 An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 150 and a VL amino acid sequence according to SEQ ID NO: 154 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
  • Embodiment 19 An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein:
  • binding comprises contacting one or more of amino acid residues 369- 392, 411-414, 427-430, and 515-517 of SEQ ID NO: 3; and/or
  • the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 369-392, 411-414, 427-430, and 515-517 of SEQ ID NO: 3.
  • Embodiment 20 The antibody or antigen-binding fragment of Embodiment 18 or 19, which is capable of binding to a SARS-CoV-2 S protein of a S protein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and zero or one RBDs of the trimer is in a closed conformation.
  • RBDs receptor binding domains
  • Embodiment 21 The antibody or antigen-binding fragment of any one of Embodiments 15-20, wherein binding of the antibody or antigen-binding fragment to the S glycoprotein promotes or leads to release of the SI subunit from the S glycoprotein.
  • Embodiment 22 An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 123 and a VL amino acid sequence according to SEQ ID NO: 138 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
  • Embodiment 23 An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein:
  • binding comprises contacting one or more of amino acid residues 417, 453, 455, 456, 473, 475-480, 484-489, and 493 of SEQ ID NO: 3; and/or
  • the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 417, 453, 455, 456, 473, 475-480, 484-489, and 493of SEQ ID NO.: 3.
  • Embodiment 24 The antibody or antigen-binding fragment of Embodiment 22 or 23, which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein one, two, or three receptor binding domains (RBDs) of the trimer are in an open conformation and zero, one, or two RBDs of the trimer are in a closed conformation.
  • RBDs receptor binding domains
  • Embodiment 25 An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 142 and a VL amino acid sequence according to SEQ ID NO: 146 for binding to a SARS-CoV-2 S glycoprotein trimer.
  • Embodiment 26 An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein trimer, wherein: (a) binding comprises contacting one or more of amino acid residues on each of two receptor binding domains (RBDs), wherein binding comprises contacting, on a first RBD, one or more of amino acid residues 339, 342, 343, 367, 368, 371, 372, 373, 374, 436, 440, and 441, and, on a second RBD, one or more of amino acid residues 446, 447, 449, 452, 455, 456, 484, 485, 486, 487, 489, 490, 492, 493, 494, 496, and 498, wherein the amino acid numbering is according to SEQ ID NO. :3; and/or
  • the antibody or antigen-binding fragment recognizes an epitope formed by the following: (b)(i) on a first RBD, amino acid residues 339, 342, 343, 367, 368, 371,
  • amino acid numbering is according to SEQ ID NO.:3.
  • Embodiment 27 The antibody or antigen-binding fragment of Embodiment 25 or 26, which is capable of binding to the S glycoprotein trimer wherein three receptor binding domains (RBDs) of the trimer are in a closed conformation.
  • RBDs receptor binding domains
  • Embodiment 28 The antibody or antigen-binding fragment of any one of Embodiments 25-27, wherein binding of the antibody or antigen-binding fragment to the S glycoprotein trimer inhibits or prevents an RBD of the trimer from assuming an open conformation.
  • Embodiment 29 The antibody or antigen-binding fragment of any one of Embodiments 1-28, wherein binding of the antibody or antigen-binding fragment to the S glycoprotein or S glycoprotein trimer, respectively, blocks an interaction between the S glycoprotein and a human ACE2.
  • Embodiment 30 The antibody or antigen-binding fragment of any one of Embodiments 1-28, wherein binding of the antibody or antigen-binding fragment to the S glycoprotein or S glycoprotein trimer, respectively, does not block an interaction between the S glycoprotein and a human ACE2.
  • Embodiment 31 The antibody or antigen-binding fragment of any one of Embodiments 1-30, which is capable of neutralizing an infection by a SARS-CoV-2.
  • Embodiment 32 An isolated polynucleotide encoding the antibody or antigen-binding fragment of any one of Embodiments 1-31.
  • Embodiment 33 A vector comprising the polynucleotide of Embodiment
  • Embodiment 34 A recombinant host cell that: (i) expresses the antibody or antigen-binding fragment of any one of Embodiments 1-31; (ii) comprises the polynucleotide of Embodiment 32; and/or (iii) comprises the vector of Embodiment 33.
  • Embodiment 35 A composition comprising:
  • Embodiment 36 A combination comprising (i) any two or more of the antibodies or antigen-binding fragments of any of Embodiments 1-31 or (ii) a first antibody or antigen-binding fragment of any of Embodiments 1-31 and a second antibody that is antibody S309 or that competes with antibody S309 for binding to a SARS-CoV-2 S glycoprotein.
  • Embodiment 37 A composition comprising (i) any two or more of the antibodies or antigen-binding fragments of any of Embodiments 1-31 or (ii) a first antibody or antigen-binding fragment of any of Embodiments 1-31 and a second antibody or antigen-binding fragment that is antibody S309 or that competes with antibody S309 for binding to a SARS-CoV-2 S glycoprotein, and a pharmaceutically acceptable carrier, excipient, or diluent.
  • Embodiment 38 A method for treating a SARS-CoV-2 infection in a subject, the method administering to the subject an effective amount of: (i) the antibody or antigen-binding fragment of any one of Embodiments 1-
  • Embodiment 39 The antibody or antigen-binding fragment of any one of Embodiments 1-31, the polynucleotide of Embodiment 32, the vector of Embodiment 33, the host cell of Embodiment 34, the composition of Embodiment 35, the combination of Embodiment 36, the composition of Embodiment 37, and/or the any two or more of the antibodies or antigen-binding fragments of Embodiments 1-31, for use in a method of treating a SARS-CoV-2 infection in a subject.
  • Embodiment 40 An immunogenic composition comprising:
  • SARS-CoV-2 nucleocapsid (N) protein SEQ ID NO.: 170
  • immunogenic fragment thereof SEQ ID NO.: 170
  • a SARS-CoV-2 S polypeptide or multimer thereof comprising (i) one, two, or three Receptor Binding Domains (RBDs) in an open conformation and (ii) a Site la polypeptide, the Site la polypeptide capable of being bound by antibody S2H14;
  • RBDs Receptor Binding Domains
  • SARS-CoV-2 Spike (S) polypeptide comprising (i) a RBD in an open conformation or in a closed conformation and (ii) a Site lb polypeptide, the Site lb polypeptide capable of being bound by antibody S2H13;
  • SARS-CoV-2 S polypeptide or multimer thereof comprising (i) two or three Receptor Binding Domains (RBDs) in an open conformation and (ii) a Site Ila polypeptide, the Site Ila polypeptide capable of being bound by antibody S2X35;
  • a SARS-CoV-2 S polypeptide or multimer thereof comprising (i) two adjacent RBDs in an open conformation and (ii) a Site lib polypeptide, the Site lib polypeptide capable of being bound by antibody S2A4;
  • a SARS-CoV-2 S polypeptide or multimer thereof comprising (i) two adjacent RBDs in an open conformation and (ii) a Site lie polypeptide, the Site lie polypeptide capable of being bound by antibody S304;
  • S SARS-CoV-2 Spike
  • Embodiment 41 The immunogenic composition of Embodiment 40, further comprising a pharmaceutically acceptable carrier, excipient, or diluent, and/or comprising an adjuvant.
  • Embodiment 42 The immunogenic composition of Embodiment 40 or Embodiment 41, wherein the SARS-COV-2 S polypeptide comprises a prefusion- stabilized S ectodomain and/or does not comprise a R1 domain, a CH domain, a CD domain, a HR1 domain, a HR2 domain, a TM domain, and/or a CT domain.
  • Embodiment 43 A method comprising administering the immunogenic composition or composition of any one of Embodiments 40-42 to a subject having, suspected of having, or at risk for having a SARS-CoV-2 infection.
  • Embodiment 44 Use of:
  • Embodiment 45 Use of: (a) (a)(i) antibody S2H14, or an antigen-binding fragment thereof, or (a)(ii) an antibody or antigen-binding fragment thereof that competes with (a)(i) for binding to a SARS-CoV-2 S glycoprotein;
  • Embodiment 46 A method comprising detecting, in sera from one or more subject having (hospitalized, symptomatic, or asymptomatic) or recovered from a SARS-CoV-2 infection:
  • the titer of antibody e.g., IgG, IgA, and/or IgM
  • the titer of antibody that binds to SARS-CoV-2 S glycoprotein
  • the titer of antibody that binds to SARS-CoV-2 RBD and optionally neutralizes the SARS-CoV-2 infection
  • Embodiment 47 The method of Embodiment 45, further comprising preparing an immunogenic composition comprising whichever of SARS-CoV-2 S glycoprotein, RBD, Domain A, or N protein that resulted in the highest titer of antibody.
  • Embodiment 48 The method of Embodiment 46 or 47, wherein the sera is from a subject who experienced a symptom of a SARS-CoV-2 infection and the method further comprises preparing an immunogenic composition comprising whichever of the SARS-CoV-2 S protein, RBD, Domain A, or N protein against which the highest titer of antibody is detected at 25, preferably 50, more preferably 75, still more preferably 100, even more preferably 125, still more preferably 150 days after the onset of the symptom.
  • Embodiment 49 A composition or combination comprising any two, any three, or all four of (a)-(d):
  • Fab fragment scFab, or the like
  • a SARS CoV-2 S glycoprotein that is capable of binding to a SARS CoV-2 S glycoprotein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 143, a CDRH2 comprising the sequence set forth in SEQ ID NO: 144, a CDRH3 comprising the sequence set forth in SEQ ID NO: 145, a CDRL1 comprising the sequence set forth in SEQ ID NO: 147, a CDRL2 comprising the sequence set forth in SEQ ID NO: 148, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 149, or (a)(ii) an antibody or antigen-binding fragment thereof that competes with the antibody or antigen-binding fragment of (a)(i) for binding to the SARS CoV-2 S glycoprotein;
  • Embodiment 50 an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S glycoprotein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRL1 comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO:99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100, or (d)(ii) an antibody or antigen-binding fragment thereof that competes with the antibody or antigen-binding fragment of (d)(i) for binding to the SARS CoV-2 S glycoprotein.
  • Embodiment 50 The composition of Embodiment 49, further comprising a pharmaceutically acceptable carrier, excipient, or diluent.
  • Embodiment 51 The composition of Embodiment 49 or 50, wherein:
  • the antibody or antigen-binding fragment of (a)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity (e.g ., as determined using BLAST) (e.g., 100% identity) to the amino acid sequence set forth in SEQ ID NO: 142 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 146;
  • the antibody or antigen-binding fragment thereof of (b)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
  • the antibody or antigen-binding fragment thereof of (c)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
  • the antibody or antigen-binding fragment thereof of (d)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO:93 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO:97.
  • a composition comprising:
  • Embodiment 53 The composition of Embodiment 52, further comprising a pharmaceutically acceptable carrier, excipient, or diluent.
  • Embodiment 54 The antibody or antigen-binding fragment of any one of Embodiments 1-31, the combination of Embodiment 36, or the composition of any one of Embodiments 37, 38, and 49-53, wherein any one or more of the antibodies or antigen binding fragments comprises a Fc polypeptide comprising:
  • a mutation that enhances binding to a human FcRn and/or extends an in vivo half-life of antibody or antigen-binding fragment optionally a M428L mutation, a N434S mutation, YTE mutation, or any combination thereof; and/or
  • a mutation that that enhances binding to a human FcyR optionally a G236A mutation, a A330L mutation, a I332E, a S239D mutation, or any combination thereof.
  • Embodiment 55 The composition of any one of Embodiments 49-54 for use in treating or preventing SARS-CoV-2 infection.
  • Embodiment 56 A method of treating or preventing SARS-CoV-2 infection in a subject, comprising administering to the subject an effective amount of the composition of any one of Embodiments 49-54.
  • Embodiment 57 A method of treating or preventing a SARS-CoV-2 infection in a subject, comprising administering to the subject an effective amount of any one or more of:
  • an antibody or antigen-binding fragment thereof e.g ., Fv, scFv, Fab, scFab, or the like
  • an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 143, a CDRH2 comprising the sequence set forth in SEQ ID NO: 144, a CDRH3 comprising the sequence set forth in SEQ ID NO: 145, a CDRL1 comprising the sequence set forth in SEQ ID NO: 147, a CDRL2 comprising the sequence set forth in SEQ ID NO: 148, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 149, or (ii) an antibody or antigen binding fragment thereof that competes with the antibody or antigen-binding fragment of (i) for binding to the SARS CoV-2 S protein;
  • an antibody or antigen-binding fragment thereof e.g ., Fv,
  • an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 109, a CDRH2 comprising the sequence set forth in SEQ ID NO: 110, a CDRH3 comprising the sequence set forth in SEQ ID NO: 111, a CDRLl comprising the sequence set forth in SEQ ID NO: 133, a CDRL2 comprising the sequence set forth in SEQ ID NO: 134, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 135, or (ii) an antibody or antigen-binding fragment thereof that competes the antibody or antigen-binding fragment of (i) for binding to the SARS CoV- 2 S protein;
  • Embodiment 58 The method of Embodiment 57, wherein: (1) the antibody or antigen-binding fragment of (a)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity (e.g ., as determined using BLAST) (e.g., 100% identity) to the amino acid sequence set forth in SEQ ID NO: 142 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 146;
  • an antibody or antigen-binding fragment thereof of (b)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
  • the an antibody or antigen-binding fragment thereof of (c)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 101 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 105; and/or
  • the antibody or antigen-binding fragment thereof of (d)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
  • Embodiment 59 A method of treating or preventing a SARS-CoV-2 infection in a subject, comprising administering to the subject an effective amount of one of (a)-(d):
  • an antibody or antigen-binding fragment thereof e.g ., Fv, scFv, Fab, scFab, or the like
  • an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 143, a CDRH2 comprising the sequence set forth in SEQ ID NO: 144, a CDRH3 comprising the sequence set forth in SEQ ID NO: 145, a CDRL1 comprising the sequence set forth in SEQ ID NO: 147, a CDRL2 comprising the sequence set forth in SEQ ID NO: 148, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 149, or (ii) an antibody or antigen binding fragment thereof that competes with the antibody or antigen-binding fragment of (i) for binding to the SARS CoV-2 S protein;
  • an antibody or antigen-binding fragment thereof e.g ., Fv,
  • an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 109, a CDRH2 comprising the sequence set forth in SEQ ID NO: 110, a CDRH3 comprising the sequence set forth in SEQ ID NO: 111, a CDRL1 comprising the sequence set forth in SEQ ID NO: 133, a CDRL2 comprising the sequence set forth in SEQ ID NO: 134, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 135, or (ii) an antibody or antigen-binding fragment thereof that competes the antibody or antigen-binding fragment of (i) for binding to the SARS CoV- 2 S protein;
  • an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRLl comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID
  • (d) (i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO:94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRLl comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO:99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100, or (ii) an antibody or antigen-binding fragment thereof that competes the antibody or antigen-binding fragment of (i) for binding to the SARS CoV- 2 S protein; wherein the subject has received, or is receiving, any one or more of the other of (a)-(d) (e.g ., administering an effective amount of (a) to a subject who has received or is receiving (b), (c), and
  • Embodiment 60 The method of Embodiment 59, wherein:
  • the antibody or antigen-binding fragment of (a)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity (e.g., as determined using BLAST) (e.g, 100% identity) to the amino acid sequence set forth in SEQ ID NO: 142 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 146;
  • the antibody or antigen-binding fragment thereof of (b)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 123 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO: 138;
  • the antibody or antigen-binding fragment thereof of (c)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
  • VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
  • Embodiment 61 The method of any one of Embodiments 57-60, wherein an antibody or antigen-binding fragment administered to the subject comprises a Fc polypeptide comprising:
  • N434S mutation N434S mutation, YTE mutation, or any combination thereof;
  • Embodiment 62 A method of diagnosing a SARS-CoV-2 infection, comprising contacting the composition of any one of Embodiments 49-54 with a sample from a subject and detecting the presence or absence of a complex comprising the antibody or antigen-binding fragment and an antigen.
  • Embodiment 63 The composition of any one of Embodiments 49-54 for use in determining whether a SARS-CoV-2 vaccine composition comprises an epitope in a correct conformation for binding by the antibody(ies) or antigen-binding fragment(s) thereof.
  • Embodiment 64 An immunogenic composition comprising:
  • a SARS-CoV-2 S polypeptide or multimer thereof that comprises two or three receptor binding domains (RBDs) in a closed-conformation, wherein two adjacent RBDs are in a closed conformation;
  • a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 143, a CDRH2 comprising the sequence set forth in SEQ ID NO: 144, a CDRH3 comprising the sequence set forth in SEQ ID NO: 145, a CDRL1 comprising the sequence set forth in SEQ ID NO: 147, a CDRL2 comprising the sequence set forth in SEQ ID NO: 148, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 149;
  • Embodiment 65 a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 109, a CDRH2 comprising the sequence set forth in SEQ ID NO: 110, a CDRH3 comprising the sequence set forth in SEQ ID NO: 111, a CDRLl comprising the sequence set forth in SEQ ID NO: 133, a CDRL2 comprising the sequence set forth in SEQ ID NO: 134, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 135; or any combination of (a)-(c).
  • Embodiment 65 The immunogenic composition of Embodiment 64, further comprising:
  • a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRL1 comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 108;
  • a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO:94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRL1 comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO: 99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100; or a combination thereof.
  • Embodiment 66 An immunogenic composition comprising:
  • Embodiment 67 a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a VH comprising the sequence set forth in SEQ ID NO: 123 and a VL comprising the sequence set forth in SEQ ID NO: 138; or a combination thereof.
  • Embodiment 67 The immunogenic composition of Embodiment 66, further comprising:
  • a SARS-CoV-2 S protein polypeptide capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRL1 comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 108;
  • a SARS-CoV-2 S protein polypeptide capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRL1 comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO:99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100; or a combination thereof.
  • Embodiment 68 An immunogenic composition comprising:
  • Embodiment 69 The immunogenic composition of any one of Embodiments 64-68, further comprising a pharmaceutically acceptable carrier, excipient, or diluent, and/or comprising an adjuvant.
  • Table 2 Sequences
  • SARS-CoV-2 strain 2019 n-CoV/USA_WAl/2020 was obtained from the United States Centers for Disease Control and Prevention. Vims was passaged once in Vero CCL81 cells (ATCC) and titrated by focus-forming assay on Vero E6 cells. Serial dilutions of indicated mAbs were incubated with 10 2 FFU of SARS-CoV-2 for 1 hour at 37 °C.
  • Antibody-vims complexes were added to Vero E6 cell monolayers in 96-well plates and incubated at 37 °C for 1 hour. Subsequently, cells were overlaid with 1% (w/v) methylcellulose in MEM supplemented with 2% FBS. Plates were harvested 30 hours later by removing overlays and fixed with 4% PFA in PBS for 20 minutes at room temperature. Plates were washed and sequentially incubated with 1 pg/mL of CR3022 anti-S antibody and HRP-conjugated goat anti human IgG in PBS supplemented with 0.1% saponin and 0.1% BSA.
  • SARS-CoV-2- infected cell foci were visualized using TmeBlue peroxidase substrate (KPL) and quantitated on an ImmunoSpot microanalyzer (Cellular Technologies). Data were processed using Prism software (GraphPad Prism 8.0). Results are shown in Figures 1A and IB. Calculated IC50 values (ng/ml) for
  • Figure 1 A are shown in Table 3. Calculated EC50 values (ng/ml) for Figure IB are listed to the right of the graph in Figure IB.
  • Figure 1 A includes comparator antibody S309, isolated from a patient who recovered from SARS-CoV-1 infection. Table 3. Calculated IC50 values for Antibodies shown in Figure 1A
  • Neutralization of SARS-CoV-2 infection by combinations of monoclonal antibodies was assessed using a SARS-CoV-2 live virus assay.
  • SARS-CoV-2 strain 2019n-CoV/USA_WAl/2020 was obtained from the Centers for Disease Control and Prevention.
  • the virus was passaged once in Vero CCL81 cells (ATCC) and titrated by focus-forming assay on Vero E6 cells.
  • Neutralization assays were carried out as follows. Serial dilutions of monoclonal antibodies were incubated with 10 2 FFU of SARS-CoV-2 for one hour at 37°C.
  • Antibody-virus complexes were added to Vero E6 cell monolayers in 96-well plates and incubated at 37°C for one hour. Subsequently, cells were overlaid with 1% (w/v) methylcellulose in MEM supplemented with 2% FBS.
  • Plates were harvested 30 hours later by removing overlays and fixed with 4% PFA in PBS for 20 minutes at room temperature. Plates were washed and sequentially incubated with one pg/mL of CR3022 (Yuan et al, 2020) anti-S antibody and HRP-conjugated goat anti-human IgG in PBS supplemented with 0.1% saponin and 0.1% BSA. SARS-CoV-2-infected cell foci were visualized using TrueBlue peroxidase substrate (KPL) and quantitated on an ImmunoSpot microanalyzer (Cellular Technologies). Data were processed using Prism software (GraphPad Prism 8.0).
  • S309, S2H14, and S2X2 alone or in combination was assessed.
  • S309, S2H14, and S2X2 were tested individually, S2H14 and S2X2 were each tested in combination with S309, and the combination of all three of S309, S2H14, and S2X2 was tested. Results are shown in Figure 2. Calculated EC50 values are shown below each graph. Additionally, S309, S2H14, and S2A4 were tested individually, S2H14 and S2A4 were each tested in combination with S309, and the combination of all three of S309, S2H14, and S2A4 was tested. Results are shown in Figure 3.
  • SARS-CoV-2 Spike protein binding by various antibodies was analyzed by antibody competition assays, cryo-EM data, and crystallography data. From this analysis, Spike RBD antigenic Sites la, lb, Ic, Id, II, and IV were identified. A map showing these sites and exemplary antibodies that bind within each site is shown in Figure 4.
  • S2X259 binding was evaluated at 3.1- angstrom and 2.65-angstrom resolution. From these studies, the S2X259 epitope is formed by amino acid residues 369-386, 404-411, and 499-508 of the S glycoprotein (SEQ ID NO: 3). S2X259 does not appear to contact amino acids 406, 409, 410, 411, 499, 500, 505, and 507.
  • ExpiCHO cells were transfected with S protein of SARS-CoV-2, SARS-CoV and MERS-CoV, or with an empty plasmid as a negative control. The monoclonal antibodies were then tested by flow-cytometry at 10 pg/ml for their ability to stain ExpiCHO cells expressing the S protein of 2019-nCoV, SARS-CoV, MERS-CoV or Mock cell transfectants.
  • BetaCo V/W uhan-Hu- 1 /2019 (accession number MN908947) was codon optimized for human cell expression and cloned into the phCMVl expression vector (Genlantis).
  • Expi-CHO cells were transiently transfected with phCMVl-SARS-CoV-2-S, phCMVl - MERS-CoV-S (Londonl/2012), SARS-spike_pcDNA.3 (strain SARS) or the empty phCMVl (Mock) using Expifectamine CHO Enhancer.
  • anti-His sensors (BIOSENSOR ANTI PENT A-HIS (HIS IK)) were used to immobilize the SI subunit protein of SARS-CoV (Sino Biological Europe GmbH). Sensors were hydrated for 10 min with Kinetics Buffer (KB; 0.01% endotoxin-free BSA, 0.002 L Tween-20, 0.005% NaN3 in PBS). SARS-CoV SI subunit protein was then loaded for 8 min at a concentration of 10 pg/ml in KB.
  • Kinetics Buffer KB; 0.01% endotoxin-free BSA, 0.002 L Tween-20, 0.005% NaN3 in PBS.
  • Antibodies were associated for 6 min at 15 pg/ml for full length mAbs nCoV-10 and nCov-6 mAbs or 5 pg/ml for Fab nCoV-4, and in a subsequent experiment comprising nCoV-1 all at 10 pg/ml. Competing antibodies were then associated at the same concentration for additional 6 mins.
  • ACE2-His Bio-Techne AG
  • HIS2 anti -HIS
  • SARS-CoV- 1 RBD-rabbitFc or SARS-CoV-2 RBD-mouseFc SARS-CoV-2 RBD-mouseFc at 1 pg/ml was associated for 15 minutes, after a preincubation with or without antibody (30 pg/ml, 30 minutes). Dissociation was monitored for 5 minutes.
  • Protein A biosensors (Pall ForteBio) were used to immobilize recombinant antibodies at 2.7 pg/ml for 1 minute, after a hydration step for 10 minutes with Kinetics Buffer. Association curves were recorded for 5min by incubating the antibody-coated sensors with different concentration of SARS-CoV- 1 RBD (Sino Biological) or SARS-CoV-2 RBD (produced in house; residues 331-550 of spike from BetaCoV/Wuhan-Hu-1/2019, accession number MN908947). Highest RBD concentration tested was lOug/ml, then 1 :2.5 serially diluted. Dissociation was recorded for 9min by moving the sensors to wells containing KB. KD values were calculated using a global fit model (Octet). Octet Red96 (ForteBio) equipment was used.
  • SARS-CoV Spike SI Subunit Protein strain WH20 protein
  • ELISA enzyme-linked immunosorbent assays
  • Bound mAbs were detected by incubating alkaline phosphatase- conjugated goat anti-human IgG (Southern Biotechnology: 2040-04) for 1 h at room temperature and were developed by 1 mg/ml p-nitrophenylphosphate substrate in 0.1 M glycine buffer (pH 10.4) for 30 min at room temperature.
  • the optical density (OD) values were measured at a wavelength of 405 nm in an ELISA reader (Powerwave 340/96 spectrophotometer, BioTek).
  • Murine leukemia virus (MLV) pseudotyped with SARS-CoV-2 Spike protein (SARS-CoV-2pp) or SARS-CoV-1 Spike protein (SARS- CoV-lpp) were used.
  • DBT cells stably transfected with ACE2 (DBT-ACE2) were used as target cells.
  • SARS-CoV-2pp or SARS-CoV-lpp was activated with trypsin TPCK at lOug/ml.
  • Activated SARS-CoV-2pp or SARS-CoV-lpp was added to a dilution series of antibodies (starting 50ug/ml final concentration per antibody, 3-fold dilution).
  • DBT- ACE2 cells were added to the antibody-virus mixtures and incubated for 48h. Luminescence was measured after aspirating cell culture supernatant and adding steady - GLO substrate (Promega). Unless otherwise indicated, pseudoparticle neutralization assays use a VSV- based luciferase reporter pseudotyping system (Kerafast). VSV pseudoparticles and antibody are mixed in DMEM and allowed to incubate for 30 minutes at 37C. The infection mixture is then allowed to incubate with Vero E6 cells for lh at 37C, followed by the addition of DMEM with Pen-Strep and 10% FBS (infection mixture is not removed). The cells are incubated at 37C for 18-24 hours. Luciferase is measured using an Ensight Plate Reader (Perkin Elmer) after the addition of Bio-Glo reagent (Promega).
  • S304, S306, S309, S310, and S315 were expressed as rlgG-LS antibodies.
  • the LS mutation confers a longer half-life in vivo. (Zalevsky et al. (2010) Enhanced antibody half-life improves in vivo activity. Nature Biotechnology, 28(2), 157-159)
  • SARS-CoV-2 genomics sequences were downloaded from GISAID on March 29th 2020, using the "complete (>29,000 bp)" and "low coverage exclusion” filters. Bat and pangolin sequences were removed to yield human-only sequences.
  • the spike ORF was localized by performing reference protein (YP_009724390.1)-genome alignments with GeneWise2. Incomplete matches and indel-containing ORFs were rescued and included in downstream analysis. Nucleotide sequences were translated in silico using seqkit. Sequences with more than 10% undetermined aminoacids (due to N basecalls) were removed. Multiple sequence alignment was performed using MAFFT.
  • Sourced SARS-CoV genome sequences comprised all the major published strains, such as Urbani, Tor2, TW1, P2, Frankfurtl, among others.
  • Pangolin sequences as shown by Tsan-Yuk Lam et al were sourced from GISAID.
  • Bat sequences from the three clades of Sarbecoviruses as shown by Lu et al (Lancet 2020) were sourced from Genbank.
  • Civet and racoon dog sequences were similarly sourced from Genbank.
  • IgG, IgA, and IgM binding titers to the SARS-CoV-2 prefusion- stabilized S ectodomain (Walls et al., 2020), the RBD, domain A (residues 14-302), the S2 subunit (residues 685-1211) and the N protein, were evaluated by ELISA.
  • the IgG responses were on average 1-2 orders of magnitude higher in hospitalized relative to non-hospitalized individuals and varied across SARS-CoV-2 antigens and among subjects ( Figures 28 A and 24 A). Males had higher Ab titers than females, although no correlation with age was observed. Levels of SARS-CoV-2 S- and N-specific IgG correlated within each individual (p value ⁇ 0.0001) ( Figure 24D). SARS-CoV-2 RBD-specific Abs dominated IgG responses whereas much lower titers were observed to the S2 subunit or domain A ( Figure 28A).
  • RBD-specific Abs were measured before and after Ab depletion using RBD-coated beads. An almost complete depletion of RBD-specific Abs from 21 plasma samples reduced SARS-CoV-2 neutralizing titers by -90% on average ( Figure 28E and other data not shown). It was then evaluated whether RBD-specific Abs in patient serum or plasma samples inhibit binding of the SARS-CoV-2 RBD to ACE2.
  • S2H13 recognizes an epitope located within the crevice formed by the receptor binding motif (RBM) b-hairpin of the RBD, which is accessible in both the closed and open S states, thereby explaining the stoichiometric binding of Fab to each protom er of the S trimer ( Figures 30B-30D and 27A).
  • S2H13 recognition of the SARS-CoV-2 RBM is mediated by electrostatic interactions and shape complementarity, and is dominated by unusual contacts involving CDRL2/FRL3, accounting for 55% of the -700 A 2 of surface area buried by the Fab, in addition to the 13-residue long CDRH3, CDRH1, FRL1 and the heavy chain N-terminal end.
  • S2H13 FRL1 and CDRL2/FRL3 interacts with the SARS-CoV-2 residues 444-449 whereas the heavy chain N-terminus, CDRH1, CDRH3 and CDRL2/FRL3 recognize the tip of the RBM spanning residues 472-498 ( Figure 30E). Further analysis (3.0 angstrom resolution) indicated that S2H13 does not contact amino acids 448, 473-478, 487, 491, 492, 495, 496, and 497.
  • the S2H14 neutralizing mAh was isolated from the plasma cells from the same SARS-CoV-2 convalescent individual from which S2H13 was obtained and does not carry somatic hypermutations in the heavy or light chain variable regions ( Figures 31 A and 25A).
  • SARS-CoV-2 S trimers with two and three RBDs open suggest that S2H14 binding conformationally selects open RBDs in a way reminiscent of the SARS-CoV S230 (Walls et al., 2019) and of the SARS-CoV-2 Cl 05 (Barnes et al., 2020) neutralizing mAbs. Indeed, these findings differ from what those observed for SARS-CoV-2 S without (Walls et al., 2020) or with bound Fabs, such as S309 (Pinto et al., 2020) or S2H13, which recognize epitopes accessible in all prefusion S states, hence no conformational selection occurred.
  • S2H14 recognizes an epitope overlapping with the RBM which is inaccessible in the closed S state but becomes exposed upon RBD opening ( Figures 26B-26E), similar to the ACE2 -binding site (Walls et al., 2020; Wrapp et al., 2020).
  • the crystal structure of the RBD bound to the S2H14, S309 and S304 Fabs show that CDRH1-H3 and CDRL1-L3 participate in the CDRH3 -dominated S2H14 paratope which buries 900A 2 at the interface with the RBM.
  • the epitope spans the entire RBM crevice and involves SARS-CoV-2 S residues 403, 444-456, 475 and 485-505 that interact with S2H14 via hydrogen-bonding and shape complementarity (Figure 26A). Further analysis indicated that S2H14 does not contact amino acids 448, 450, 451, 452, 454, 486, 488, 490, 491, 492, 497, 503, and 504.
  • the S2A4 mAh recognizes a cryptic epitope leading to release of the Si subunit
  • the S2A4 mAh was isolated from memory B cells of a hospitalized patient 24 days after disease onset and was found to weakly neutralize SARS-CoV-2 infection ( Figures 32A and 25A).
  • S2A4 binding to the RBD buries an average surface of ⁇ 850A 2 using all six CDR loops along with contributions from FRH3 and FRL3.
  • CDRH3 and CDRL1 dominate the interface which involve electrostatic and hydrophobic interactions ( Figures 32D and 32E).
  • the S2A4 epitope comprises residues 368-388, which form two a -helices and an intervening b-strand participating in the formation of the structurally conserved RBD b-sheet, and residues 407-414 forming an a-helix followed by a loop segment ( Figures 32D, 32E and Figure 26 A).
  • S304 recognizes a cryptic epitope, which is buried in the closed S conformation but is distinct from the RBM, with one S304 Fab bound to each of the three open RBDs ( Figures 33A-33B).
  • CDRH1-H3, CDRLl and CDRL3 interact with SARS-CoV-2 S through burial of an average surface area of 900A 2 at the epitope/paratope interface involving electrostatic interactions and shape complementarity (Figure 33D).
  • the S304 epitope comprises residues 366-392, which form two a-helices and an intervening b-strand, as well as residues 515-517 (both regions participating in the formation of the structurally conserved RBD b-sheet), and loop residues 411-414 and 427-430 (Figure 33D and Figure 26A).
  • the S304 epitope partially overlaps with the epitopes of the weakly neutralizing mAh CR3022 (Huo et ak, 2020; Joyce et ah, 2020; ter Meulen et ah, 2006; Tian et al., 2020; Yuan et ak, 2020) and of the neutralizing mAh S2A4 (Figure 33G). It also overlaps with the mAh S2X35 which was isolated from the memory B cells of a COVID-19 convalescent symptomatic individual 48 days after disease onset and which neutralizes entry of SARS-CoV-2 pseudovirus into cells with ICso values of 500 ng/ml ( Figures 33H, 25A-25C and other data not shown).
  • S2H14 and S2H13 define two classes of RBM-targeting mAbs recognizing sites that are referred to here as la and lb, respectively.
  • Site la largely overlaps with the ACE2 -binding site and is only accessible in the open S state ( Figure 34B), whereas site lb partially overlaps with the ACE2 footprint and is accessible in both the open and closed S states (Figure 34C).
  • epitopes are SARS-CoV-2-specific and harbor several naturally occurring mutations among circulating viral isolates ( Figure 25F andother data not shown).
  • the S2X35, S2A4 and S304 mAbs recognize overlapping cryptic epitopes, that are only accessible when at least two RBDs are open, respectively termed sites Ila, lib and lie, which are positioned increasingly further away from the ACE2 -binding site ( Figures 34D-34F).
  • S309 binds to a conserved epitope termed site IV, which is accessible independently of the RBD conformation, and neutralizes SARS-CoV-2 without interfering with ACE2 binding (Figure 34G) (Pinto et al., 2020).
  • S309 and S2H13 are set apart from the other mAbs studied here as they recognize epitopes accessible in both the closed and open S states. Consistent with a recent report that the closed S state is favored at endosomal pH (Zhou et al., 2020b), binding of all mAbs to the S ectodomain was dampened at pH 5.4, except for S309 and S2H13, whereas binding of all these mAbs to the free RBD was not affected at pH 5.4 ( Figures 27A and 27B). S309 and S2H13 do not select for a specific S conformation nor promote Si shedding, which are specific features of site la- and site II-targeted mAbs ( Figure 25E). Based on these data, high-density binding of S309 or S2H13 to multiple S conformations may explain their unique ability to trigger Fc-mediated effector functions efficiently among the panel of mAbs tested.
  • SARS-CoV-2 RBD is immunodominant in terms of total Abs elicited and is the target of 90% of the neutralizing activity present in the sera or plasma of most individuals evaluated. The remaining neutralizing activity observed in certain individuals may be accounted for by Abs targeting domain A (Chi et al., 2020), quaternary epitopes on the S trimer or the S2 subunit (Liu et al., 2020a).
  • site la coincides with the ACE2 binding site and is accessible only in the open S conformation
  • site lb is also exposed in the closed S conformation and is targeted by Abs with both neutralizing activity and effector function.
  • the remaining RBD sites, Ila, lib, lie and IV are subdominant and generate lower and variable Ab responses in different individuals.
  • the immunodominance of sites la and lb may be related to their greater accessibility compared to sites Ila, lib and lie, as the latter epitopes become exposed only after opening of two RBDs, which is a rare event (Ke et al., 2020; Walls et al., 2020; Wrapp et al., 2020).
  • Fc-mediated effector functions are key antiviral pathways in vivo that can be profoundly affected by the epitope specificities of the mAbs (DiLillo et al., 2014; Hessell et al., 2007).
  • the finding that only S309 and S2H13 (out of the six mAbs evaluated in this study) efficiently activated effector functions underscores the importance of the orientation and distance of the Fc fragment from the plasma membrane (DiLillo et al., 2016; Pinto et al., 2020; Tang et al., 2019) and the requirement for a high density binding of mAbs for efficient FcD receptors cross- linking and engagement of the hexameric Clq.
  • Samples were obtained from 5 cohorts of SARS-CoV-2 infected individuals under study protocols approved by the local Institutional Review Boards (Canton Ticino Ethics Committee, Switzerland, the Ethical committee of Luigi Sacco Hospital, Milan, Italy, and WCG North America, Princeton, NJ, US). All donors provided written informed consent for the use of blood and blood components (such as PBMCs, sera or plasma) and were recruited at hospitals or as outpatients. Based on their availability, participants were enrolled and allocated to either single blood draws or longitudinal follow-up.
  • Donors were categorized as symptomatic if they reported any COVID-19- related symptoms (a, fever; b, respiratory distress; c, cough; d, throat pain; e, common cold; f, taste loss/smell loss; g, diarrhea; h, fatigue; i, muscle bone pain; j, headache).
  • Donors from the Ticino healthcare workers cohort were further categorized based on symptom severity as follows: asymptomatic (declaration of no symptom experience), low symptomatic (1 or 2 symptoms of a-f and any of g-j), mild symptomatic (any 3 symptoms of a-f); high symptomatic (any 4 symptoms of a-f), severe symptomatic (any 4 symptoms of a-f, including b), atypical (all the remaining cases).
  • PBMCs peripheral blood mononuclear cells
  • PBMCs and plasma were isolated from blood draw performed using tubes or syringes pre-filled with heparin, followed by Ficoll density gradient centrifugation. Sera were obtained from blood collected using tubes containing clot activator, followed by centrifugation. PBMCs, plasma and sera were stored in liquid nitrogen and -80°C freezers until use, respectively.
  • S2H13, S2H14 and S2A4 mAbs were isolated from memory B cells or plasma cells as previously described (Corti et al., 2011; Pinto et al., 2020).
  • S2X35 was isolated from SARS-CoV-2 S-specific CD19 + IgG + B cells sorted using a C-terminal biotinylated SARS-CoV-2 S ectodomain trimer conjugated to Streptavidin, Alexa FluorTM 647 (Life Technologies).
  • Recombinant antibodies were expressed as IgGl or Fab in ExpiCHO-S cells transiently co-transfected with plasmids expressing the heavy and light chain, as previously described (Stettler et al., 2016).
  • Recombinant Abs were affinity purified using HiTrap Protein A columns (Cytiva) followed by desalting against phosphate- buffered saline (PBS) using HiTrap Fast desalting columns (Cytiva). All liquid chromatography purification steps were performed on a AKTA express FPLC (Cytiva). The final products were sterilized by filtration through 0.22 pm filters and stored at 4°C.
  • Fabs were expressed using transient transfection of ExpiCHO-S cells with ExpiCHO expression medium and ExpiFectamineTM CHO Transfection Kit (Life Technologies), purified by affinity chromatography on AKTA Xpress Mab System (Cytiva) with UNICORN 5.11 software version (Build 407) using CaptureSelect CHI- XL MiniChrom column (ThermoFisher Scientific), buffer exchanged to PBS using a HiPrepTM 26/10 desalting columns (Cytiva) and sterilized through a 0.2 pm filter.
  • SARS-CoV-2 and SARS-CoV prefusion S ectodomain trimers were previously described (Walls et al., 2020; Walls et al., 2019). Briefly, the SARS-CoV-2 and SARS-CoV S ectodomains were synthesized by Genscript or GeneArt, respectively, with a mu-phosphatase signal peptide, 2P stabilizing mutation (Kirchdoerfer et al., 2018; Pallesen et al., 2017), a TEV cleavage site, foldon, and 8X His-tag.
  • the SARS-CoV-2 domain A construct (residue 14-302) was synthesized by Genscript into pcDNA3.1- with an N-terminal mu-phosphatase signal peptide and a C- terminal octa-histidine tag (GSS(H)8). All constructs were produced in HEK293F cells grown in suspension using FreeStyle 293 expression medium (Life technologies) at 37°C in a humidified 8% CO2 incubator rotating at 130 rpm. The cultures were transfected using PEI (9 pg/ml) with cells grown to a density of 2.5 million cells per mL and cultivated for 3-4 days. The supernatants were harvested and cells resuspended for another 3-4 days in fresh media, yielding two harvests.
  • Proteins were purified from clarified supernatants using a 5mL Cobalt affinity column (Takara Bio), concentrated and flash frozen in a buffer containing 20 mM Tris pH 8.0 and 150 mM NaCl prior to analysis. SDS-PAGE or negative stain EM was run to check purity.
  • a SARS-CoV-2 prefusion stabilized S ectodomain with an Avi-tag between the foldon domain and the 8x His-tag was codon optimized, synthesized and cloned into the phCMVl vector by ATUM.
  • Expi293F cells were transfected using ExpiFectamine according to Thermo Fisher’s Expi293 expression system user guide. Supernatants were harvested after 4 days of expression and purified over a 5 mL Cobalt affinity column (Takara Bio).
  • IMAC elution peak was pooled concentrated and injected onto a Superose 6 Increase 10/300 GL size exclusion chromatography column (Cytiva) using lx PBS pH 7.4 as a running buffer. SEC fractions corresponding to the main protein peak were pooled, flash frozen in liquid nitrogen and stored at -80°C.
  • RBD protein for ELISA was produced in Expi293 cells using the phCMVl SARS-CoV-2 RBD plasmid, which encodes for an N-terminal mu-phosphatase signal peptide, an ‘ETGT linker, SARS-CoV-2 residues 328-531, a linker sequence and Strep-8xHis-tag.
  • Supernatants were harvested five days after transfection, equilibrated with 0.1 M Tris-HCl, 0.15 MNaCl, 10 mM EDTA, pH 8.0 and supplemented with a biotin blocking solution (IBA Lifesciences).
  • RBD was purified by affinity chromatography on a Strep-Trap HP 5 ml column followed by elution with 50 mM biotin and buffer exchange into PBS.
  • the phCMVl SARS-CoV-2 RBD expression plasmid was used, which encodes for an N-terminal mu-phosphatase signal peptide, an ‘ETGT’ linker, SARS-CoV-2 residues 328-531 and a C-terminal 8xHis-tag.
  • Protein was expressed in Expi293F cells in the presence of 10 mM kifunensine at 37°C and 8% CO2 in a humidified incubator. Transfection was performed using ExpiFectamine 293 reagent (Thermo Fisher Scientific) and 1 pg plasmid per ml of cell culture.
  • SARS-CoV-2 RBD was purified using a 5 ml HisTALON Superflow cartridge (Takara Bio) and subsequently dialyzed against 50 mM Tris-HCl pH 7.5, 150 mM NaCl. SARS-CoV-2 RBD was deglycosylated by overnight incubation with EndoH glycosidase at 4°C.
  • SARS-CoV-2 RBD (residues 328-531) with a C-terminal Thrombin- Twin-Strep-8xHis-tag was expressed in Expi293F cells at 37°C and 8% C02 in a humidified incubator.
  • Transfection was performed using ExpiFectamine 293 reagent (Thermo Fisher Scientific) and 1 pg plasmid per ml of cell culture.
  • the protein was purified by affinity chromatography using a 1 ml HisTALON Superflow cartridge as described above (Takara Bio) and subsequently buffer exchanged using a Zeba spin desalting column into Cytiva lx HBS-N buffer.
  • Antibody Fab fragments for mAbs S304, S309 and S2H14 were obtained from ATUM.
  • the deglycosylated SARS-CoV-2 RBD was mixed with a 1.3-fold molar excess of S304 Fab, S309 Fab and S2H14 Fab.
  • the complex was purified on a Superdex 200 Increase 10/300 GL column pre-equilibrated with 20 mM Tris-HCl pH 7.5, 150 mM NaCl, and concentrated to 4 mg/ml. 100 m ⁇ of the protein solution were mixed with 0.3 mg Polyvalan Crystallophore N°1 and this solution was used for setting up crystallization trays.
  • Recombinant ACE2 was expressed in ExpiCHO-S cells transiently transfected with a plasmid encoding ACE2 residues 19-615, a C-terminal thrombin cleavage site, Twin-Strep-tag and lOxHis-tag. Cell culture supernatant was collected after nine days, filtered through a 0.22 pm filter, supplemented with buffer to a final concentration of 80 mM Tris-HCl pH 8.0, 100 mM NaCl, and then incubated with BioLock solution for one hour.
  • ACE2 was purified using a 1 ml StrepTrap High Performance column (Cytiva) followed by size exclusion chromatography using a Superdex 200 Increase 10/300 GL column pre-equilibrated in 20 mM Tris-HCl pH 7.5, 150 mM NaCl.
  • Spectraplate-384 with high protein binding treatment were coated overnight at 4°C with 1 pg/ml of SARS-CoV-2 S, domain A (in- house produced), N (The Native Antigen company), S2 (The Native Antigen company), SARS-CoV S (in-house produced) or 5 pg/ml of SARS-CoV-2/SARS-CoV RBD (in- house produced) in PBS, pH 7.2, and plates were subsequently blocked with Blocker Casein (1%) in PBS (Thermo Fisher Scientific) supplemeted with 0.05% Tween 20 (Sigma Aldrich).
  • the coated plates were incubated with serial dilutions of human monoclonal antibodies or human plasma or sera for 1 h at room temperature. The plates were then washed with PBS containing 0.1 % Tween-20 (PBS-T), and Alkaline Phosphatase-conjugated Goat Anti-Human IgG, IgM or IgA (Southern Biotech) were added and incubated for 1 h. Plates were washed three times with PBS-T, and 4- NitroPhenyl Phosphate (pNPP, Sigma-Aldrich) substrate was added and incubated for 1 h (IgG) or 2 h (IgA and IgM). The absorbance of 405 nm was measured by a microplate reader (Biotek), and the data was plotted with Graph Prism software.
  • PBS-T PBS containing 0.1 % Tween-20
  • pNPP 4- NitroPhenyl Phosphate
  • the efficiency was calculated based on the ratio of the binding titers before and after depletion and is expressed as a percentage: (1- (ED50(after)/ED50(before))* 100.
  • Magnetic beads were washed with ice-cold 1 mM HC1 solution. 1 mg/ml RBD solution was coupled to magnetic beads in 50 mM borate buffer, pH 8.5, with a 2h incubation at room temperature. Beads were washed 3 times with 0.1 M glycine, pH 2.0, followed by a wash with purified water. Beads were then incubated with quenching buffer (3 M ethanolammine, pH 9.0) for 2 h. Beads were washed with purified water and resuspended in storage buffer (50 mM borate buffer, pH 8.5, with 0.05% sodium azide).
  • Serum or plasma were diluted to 1/50 in 500 m ⁇ PBS containing 1/20 (25 m ⁇ ) of RBD-magnetic beads and incubated for 1 h at room temperature, rotating. Tubes were placed on a magnetic holder and supernatants were collected.
  • VSV-based SARS-CoV-2 S-glycoprotein-pseudotyped viruses were used to test the neutralizing activity of serum or plasma from COVID-19 recovered patients. Briefly, HEK293T cells were transfected with a SARS-CoV-2 S glycoprotein-encoding plasmid harboring the D19 C-terminal truncation (Ou et al., 2020) using the X- tremeGENE HP DNA transfection reagent (Merck) according to the manufacturer’s instructions and then incubated at 37 °C with 8% CO2 for 24 h.
  • the transfected cells were infected with Delta-G-VSV-Luc in DMEM and incubated lh at 37 °C with 5% CO2. After removing the infection medium, the cells were washed twice with PBS and DMEM containing 10% FBS and 1% penicillin-streptomycin was added. Infected cells were further incubated for 24 hours at 37°C before the supernatant containing the VSV-SARS-CoV-2 pseudoviruses was collected, cleaned from cellular debris by centrifugation, and stored at -80°C. VSV-SARS-CoV-2 pseudovirus was incubated with serial dilution of serum or plasma for 1 h in white culture 96 well plate at 37°C.
  • VeroE6 at 20 000 cells/well were added to the mix and incubated 2 h at 37°C. After 2 h, MEM supplemented with 40% FBS and 4% penicillin-streptomycin was added to the cells for additional 24h. Culture medium was then removed from the cells and 50 pL/well of Bio-Glo (Promega) diluted 1:2 with PBS Ca 2+ Mg 2+ was added. After 5 minutes incubation in the dark the luminescence signal was measured using a Synergy HI Hybrid Multi-Mode plate reader (Biotek). Measurements were performed in duplicate and relative luciferase units (RLU) were converted into neutralization percentages and plotted with a nonlinear regression curve fit in Graph Prism.
  • RLU relative luciferase units
  • the efficiency was calculated based on the ratio of the neutralizing titers before and after depletion and is expressed as a percentage: (1- (ID80(after)/ID80(before))* 100.
  • MLV-based SARS-CoV-2 S-glycoprotein-pseudotyped viruses were used to test the neutralizing activity of recombinant mAbs.
  • MLV-based SARS-CoV-2 S pseudotyped viruses were prepared as previously described (Walls et ak, 2020).
  • HEK293T cells were co-transfected with a SARS-CoV-2 S glycoprotein-encoding- plasmid harboring the D19 C-terminal truncation, an MLV Gag-Pol packaging construct and the MLV transfer vector encoding a luciferase reporter using the X-tremeGENE HP DNA transfection reagent (Merck) according to the manufacturer’s instructions.
  • VeroE6 cells were cultured in MEM containing 10% FBS, 1% penicillin-streptomycin and plated into 96-well plates for 16-24h at 20 000 cells/well.
  • Pseudovirus pre activated with TPCK (Bioconcept) at 10 pg/mL for lh at 37°, with or without serial dilution of antibodies was incubated for lh and then added to the wells after washing 3X with MEM. A monoclonal antibody of unrelated specificity was used as a negative control. After 2-3h MEM containing 20% FBS and 2% penicillin-streptomycin was added to the cells for 48h.
  • Unlabeled mAbs or plasma/sera were serially diluted, mixed with RBD mouse Fc-tagged antigen (Sino Biological, final concentration 20 ng/ml) and incubated for 30 min at 37°C. The mix was added for 30 min to ELISA 96-well plates (Coming) pre- coated overnight at 4 °C with 2 pg/ml human ACE2 in PBS. Plates were washed and RBD binding was revealed using secondary goat anti-mouse IgG (Southern Biotech). After washing, pNPP substrate was added and plates were read at 405 nm. The percentage of inhibition was calculated as follow: (l-(OD sample-OD neg ctr)/(OD pos ctr-OD neg ctr)]) x 100. Blockade of binding to RBD
  • Human anti-RBD full IgGl mAbs were biotinylated using the EZ-Link NHS- PEO solid phase biotinylation kit (Pierce). Labelled mAbs were tested for binding to RBD by ELISA and the optimal concentration of each mAh to achieve 80% maximal binding was determined. Unlabeled mAbs or sera/plasma were serially diluted and added to ELISA 96-well plates (Corning) pre-coated overnight at 4 °C with 1 pg/ml of RBD mouse Fc-tagged antigen (Sino Biological) in PBS.
  • biotinylated anti-RBD mAbs were added at the concentration achieving 80% maximal binding and the mixture was incubated at room temperature for 230 min. Plates were washed and antibody binding was revealed using alkaline phosphatase-comjugated streptavidin (Jackson ImmunoResearch). After washing, pNPP substrate (Sigma-Aldrich) was added and plates were read at 405 nm. The percentage of inhibition was calculated as follow: (l-(OD sample-OD neg ctr)/ (OD pos ctr-OD neg ctr)]) x 100.
  • Cell-surface niA b-mediated Si shedding CHO cells stably expressing wild-type SARS-CoV-2 S were resuspended in wash buffer (PBS 1% BSA, 2 mM EDTA) and treated with 10 pg/ml TPCK-t (Bioconcept) for 30 min at 37°C. Cells were washed and aliquoted (90,000 cells/well). MAbs were added to cells at 15 pg/ml final concentration for 180 min at 37°C.
  • Cells were collected at different time points (5, 15, 30, 60, 120, 180 and 240 min), washed at +4°C and incubated with 1.5 pg/ml secondary goat anti-human IgG, Fey fragment specific (Jackson ImmunoResearch) on ice for 20 min. Cells were washed and resuspended in wash buffer and analysed with ZE5 FACS (Bio-rad).
  • SARS-CoV-2 S was incubated alone or with S2A4, S304 or S2X35 Fabs (molar ratio 1:1.2) during 0.5, 1 or 2 hr at room temperature.
  • Laemmli loading buffer was added prior to boiling the samples for 5 min at 95 °C.
  • Samples were run on a 4%-20% gradient Tris-Glycine Gel (BioRad) and transferred to a PVDF membrane. Membrane was blocked in 5 % milk during 45 min at room temperature.
  • An anti-S2 SARS-CoV S monoclonal primary antibody (1:250 dilution) and an Alexa Fluor 680-conjugated goat anti-human secondary antibody (1:50,000; Jackson Laboratory) were used for Western- blotting.
  • a LI-COR processor was used to develop images.
  • Determination of antibody-dependent activation of human FcyRIIIa was performed using SARS CoV-2 S stable transfected CHO cells as target, incubated with titrated concentrations of antibodies and after 10 min incubated with Jurkat expressing FcyRIIIa receptor on their surface and stable transfected with NFAT-driven luciferase gene (Promega, Cat. Nr. G9798 and G7018) at an effector to target ratio of 6:1.
  • Activation of human FcyRIIIa (FI 58 or VI 58 variants) in this bioassay results in the NFAT-mediated expression of the luciferase reporter gene.
  • Luminescence was measured after 21 hours of incubation at 37°C with 5% CO2 with a luminometer using the Bio-Glo-TM Luciferase Assay Reagent according to the manufacturer’s instructions. Determination of antibody-dependent activation of human FcyRIIa was performed using SARS CoV-2 S stable transfected CHO cells as target, incubated with titrated concentrations of antibodies and after 10 min incubated with Jurkat expressing FcyRIIa receptor on their surface and stable transfected with NFAT-driven luciferase gene (Promega, Cat. Nr. G9995) at an effector to target ratio of 5:1.
  • Activation of human FcyRIIa (H131 variant) in this bioassay results in the NFAT-mediated expression of the luciferase reporter gene.
  • Luminescence was measured after 21 hours of incubation at 37°C with 5% CO2 with a luminometer using the Bio-Glo-TM Luciferase Assay Reagent according to the manufacturer’s instructions.
  • CDC Complement-dependent cytotoxicity assays were performed using SARS CoV-2 S stable transfected CHO cells as target, incubated with titrated concentrations of antibodies and after 10 min incubated at a concentration of 1:24 with Low-Tox M Rabbit Complement (Cedarlane Laboratories Limited, Cat. Nr.: CL3051) previously pre-absorbed with target cells alone in excess. Antibody dependent cell killing was measured using LDH release assay (Cytotoxicity Detection Kit (LDH) (Roche; Cat. Nr.: 11644793001) after 2 hours of incubation at 37°C.
  • LDH release assay Cytotoxicity Detection Kit (LDH) (Roche; Cat. Nr.: 11644793001) after 2 hours of incubation at 37°C.
  • SPR binding measurements were performed using a Biacore T200 instrument using either anti-AviTag pAb (for capturing S proteins) or StrepTactin XT (for capturing RBDs) covalently immobilized on CM5 chips.
  • Running buffer for neutral pH experiments was Cytiva HBS-EP+ (pH 7.4) and for acidic pH experiments was 20 mM phosphate pH 5.4, 150 mM NaCl, 0.05% P-20. All measurements were performed at 25 °C. Acidic pH experiments were run as single-cycle kinetics. Antibody concentrations for all experiments are a 3-fold dilution series starting from 300 nM.
  • Double reference-subtracted data were fit to a 1:1 binding model using Biacore Evaluation software, which yields an “apparent KD” for the S-binding data because the kinetics also reflect Spike conformational dynamics and especially for the IgG binding data where the kinetics reflect avidity.
  • RBD-binding data were fit with a Global Rmax.
  • Spike-binding data for the tightly-associating S309 and S2X35 Fabs as well as all IgG were fit with local Rmax, since the Spike is undergoing conformational changes which can affect the accessibility of epitopes across different mAh concentrations (these Kx>,app are indicated to be approximate). For dissociation rates that were too slow to fit, Kx>,app are reported as an upper limit.
  • the SARS-CoV-2 RBD was loaded for 3 min at 8 pg/ml in kinetics buffer onto anti-Penta-HIS (HIS IK) biosensors (Molecular Devices, ForteBio). Association of mAbs (full-length IgG) was performed in kinetics buffer (0.01% endotoxin-free BSA, 0.002% Tween-20, 0.005% NaN3 in PBS) at 15 pg/ml for 7 min.
  • Crystals of the SARS-CoV-2 RBD-S304-S309-S2H14 Fab complex were obtained at 22°C by sitting drop vapor diffusion.
  • a total of 200 nl complex were mixed with 200 nl mother liquor solution containing 16.2% (w/v) PEG 4000, 0.9 M sodium citrate pH 6.0, 0.18 M ammonium acetate, 0.02 M potassium acetate, 0.01 M MES pH 6 and 1.5% Pentaerythritol ethoxylate (15/4 EO/OH).
  • Optimal crystals of S2H14, S2A4 and S2X35 Fabs were obtained by the hanging-drop vapor diffusion method with a mosquito robot at 20°C.
  • a total of 150 nl of Fabs at 20 mg per mL (for S2H14, S2A4) or at 12 mg per mL (for S2X35) in 20 mM Tris-HCl pH 8.0, 150 mM NaCl were mixed with 150nL mother liquor solution containing 0.2 M magnesium acetate and 20% (w/v) PEG 3350 (for S2H14 Fab), 1.2 M Ammonium sulfate, 0.1M Sodium cacodylate/Hydrochloric acid pH 6,5 (for S2A4 Fab) or 0.16 M MgCh, 0.08 M Tris-HCl, pH 8.5, 24% (w/v) PEG 4000 and 20% (v/v) glycerol (for S2X35 Fab).
  • S2H13 Fab was generated by digestion of the corresponding monoclonal IgG with LysC (Thermo Fisher Scientific) at 1:2000 (w/w) ratio during 5 h at 37°C while Fabs S2A4, S2H14, S304 and S2X35 were recombinantly expressed as described above.
  • SARS-CoV-2 S at 1.2 mg per mL was incubated with 1.2 molar excess of Fabs at 4°C at least for 1 h.
  • S2A4 data set 1,995 micrographs were collected with a defocus range comprised between -0.4 and -2.4 pm. Movie frame alignment, estimation of the microscope contrast-transfer function parameters, particle picking and extraction were carried out using Warp (Tegunov and Cramer, 2019). Particle images were extracted with a box size of 800 binned to 400 yielding a pixel size of 1.05 A.
  • S/S2H14 and S/S2X35 complexes data were acquired on a FEI Glacios transmission electron microscope operated at 200 kV.
  • the particles were symmetry-expanded and subjected to focus 3D classification without refining angles and shifts using a soft mask encompassing the RBM and S2H13 variable domains or RBD and S2A4 variable domains using a tau value of 60 (S2H13 and S2A4) or 40 for (S2X235).
  • Particles belonging to classes with the best resolved local density were selected (all particles were retained for S2X35) and subjected to local refinement using cryoSPARC (Punjani et al., 2017; Punjani et al., 2019).
  • UCSF Chimera (Pettersen et al., 2004) and Coot (Emsley et al., 2010) were used to fit atomic models (PDB 6VXX or PDB 6VYB) into the cryoEM maps and the Fab variable domains were manually built or the co-crystal structures of SARS-CoV-2 RBD with S304/S309 was used. Models were refined and relaxed using Rosetta using both sharpened and unsharpened maps (Frenz et al., 2019; Wang et al., 2016). Figures were generated using UCSF ChimeraX (Goddard et al., 2018).
  • a non-linear mixed effects model was used to estimate parameters describing the kinetics of RBD, S- and N-specific IgG in individuals with longitudinal data following the onset of disease symptoms. Briefly, a one compartment direct response model with 1 st order input and 1 st order output was developed to describe the antibody response formation and decay. Individual parameters are assumed to be log-normally distributed and proportional residual error was employed in the modeling. Influence of gender, age and disease severity (hospitalized vs. symptomatic) in antibody response formation and decay were evaluated. The analyses were conducted using NONMEM, version 7.4 (ICON Development Solutions, Hanover, MD, USA). Graphical data presentations were conducted using R 4.0.2 (R Foundation for Statistical Computing). QUANTIFICATION AND STATISTICAL ANALYSIS
  • iMOSFLM a new graphical interface for diffraction-image processing with MOSFLM. Acta Crystallogr D Biol Crystallogr 67, 271-281.
  • a neutralizing human antibody binds to the N- terminal domain of the Spike protein of SARS-CoV-2. Science.
  • a neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins. Science 333, 850-856.
  • Coronavirus protective immunity is short-lasting. medRxiv, 2020.2005.2011.20086439.
  • Alveolar macrophages are critical for broadly-reactive antibody-mediated protection against influenza A virus in mice. Nat Commun 8, 846.
  • 3B11-N a monoclonal antibody against MERS-CoV, reduces lung pathology in rhesus monkeys following intratracheal inoculation of MERS-CoV Jordan-n3/2012.
  • a pH-dependent switch mediates conformational masking of SARS-CoV-2 spike. bioRxiv.
  • Memory B cells from two individuals recovering from severe COVID-19 disease were sorted using biotinylated prefusion SARS-CoV-2 S ectodomain trimer as bait.
  • Two mAbs, S2E12 and S2M11 stood out for their high neutralization potency against authentic SARS-CoV-2 virus and two different SARS-CoV-2 S pseudotyped viruses (using either murine-leukemia virus (MLV) or vesicular stomatitis virus (VSV) backbones).
  • MMV murine-leukemia virus
  • VSV vesicular stomatitis virus
  • ICso half-maximal inhibitory concentrations (ICso) of 3-6 ng/ml (20-40 pM) were determined ( Figures 35A-35B). ICso values of 1.9-2.5 ng/ml for SARS-CoV-2 S-VSV ( Figure 40A) and 10.3-30.4 ng/ml for SARS-CoV-2 S-MLV were determined ( Figure 40B). In an authentic SARS-CoV-2 focus reduction neutralization test that measures inhibition of virus entry and spread (35), the ICso values were 1.2-6.6 ng/ml ( Figure 40C).
  • the potency of these mAbs was demonstrated further by the concentrations necessary to inhibit 90% of authentic SARS-CoV-2 -Nluc viral entry (IC90), which was determined as 26.4+7.8 ng/mL and 12.7+3.1 ng/mL for S2E12 and S2M11, respectively.
  • IC90 authentic SARS-CoV-2 -Nluc viral entry
  • the higher neutralization potency of IgG compared to Fab observed for each mAb suggested that the distinct binding affinities and/or bivalent binding contribute to potency (Figure 35A).
  • the S2E12 heavy chain uses VH1-58*01, D2-15*01 and JH3*02 genes whereas S2M11 derives from VH 1-2*02, D3-3*01 and JH4*02 genes.
  • the heavy chain variable gene nucleotide sequence germline identity is 96.53% for S2M11 and 97.6% for S2E12.
  • S2E12 and S2M11 bound to the SARS-CoV-2 RBD and prefusion- stabilized S ectodomain trimer ( 6 ) but not to the SARS-CoV RBD or S (36) by ELISA ( Figures 35C-35F).
  • SPR surface plasmon resonance
  • flow cytometry it was observed that S2E12 and S2M11 compete for binding to the SARS-CoV-2 RBD or to SARS-CoV-2 S, presented either as a recombinantly expressed prefusion-stabilized S ectodomain trimer or as full-length S expressed at the surface of ExpiCHO cells ( Figures 41A-41B).
  • S2M11 When added first, S2M11 competed in a concentration-dependent manner with the sarbecovirus neutralizing S309 mAh for binding to SARS-CoV-2 S, whereas it could bind with minimal competition when added after S309 ( Figure 41B). Whereas the S2E12 Fab (or IgG) bound to SARS-CoV-2 S and RBD similarly, the binding affinity of the S2M11 Fab (or IgG) for the S trimer was enhanced relative to the isolated SARS-CoV-2 RBD ( Figure 35G and Figure 41C).
  • S2M11 binding kinetics to SARS-CoV-2 S were biphasic, including a first phase with identical binding kinetics and affinity as measured for binding to the isolated RBD, and a second phase with a much slower off-rate and therefore higher affinity.
  • Binding of S2M11 Fab and IgG to S was increased at pH 5.4, a condition that favors the closed trimer conformation, compared to pH 7.4 (37) ( Figure 35G, Figure 41C and Figure 49).
  • binding of the S2E12 Fab to S was diminished at pH 5.4 (and moderately reduced for S2E12 IgG), possibly due to the increased number of S trimers with closed RBDs ( Figure 35G, Figures 41 A and 41Cand Figure 49).
  • S2E12 potently neutralizes SARS-CoV-2 by targeting the RBM
  • S2E12 recognizes an RBD epitope overlapping with the RBM (i.e. ACE2 receptor-binding site) that is partially buried at the interface between protomers in the closed S trimer ( Figures 36A-36D and Figures 43A-43B).
  • RBM i.e. ACE2 receptor-binding site
  • S2E12 only interacts with open RBDs, as is the case for ACE2 as well as for several previously described neutralizing mAbs including S2H14 (22, 25) (Piccoli, Cell in Press).
  • S2H14 22, 25
  • the concave S2E12 paratope recognizes the convex RBM tip through electrostatic and van der Waals interactions ( Figures 36C-36D).
  • S2E12 utilizes the heavy chain complementary determining regions (CDR) 1-3 and the light chain CDR1 and CDR3, respectively accounting for 2/3 and 1/3 of the paratope buried surface area, to recognize residues 455-458 and 473-493 of the SARS-CoV-2 RBD ( Figures 36C-36D). Most of the S2E12 contacts with the RBD are mediated by germline encoded residues, with only 1 out of 5 heavy chain (Glyl09) and 1 out of 4 light chain (Gly94) mutated residues contributing to the paratope.
  • CDR heavy chain complementary determining regions
  • S2E12 in complex with RBD achieved a resolution of 2.93 angstroms. Based on these studies, the S2E12 epitope is formed by amino acid residues 417, 453, 455, 456, 473, 475-480, 484-489, and 493. S2M11 locks the SARS-CoV-2 S trimer in the closed state through binding to a quaternary epitope
  • 3D classification of the cryoEM data revealed the exclusive presence of S turners adopting a closed conformation, which allowed determination of a 2.6 ⁇ structure of SARS-CoV-2 S bound to three S2M11 Fab fragments ( Figures 37A-37B, Figures 44A- 44F and Figure 50).
  • S2M11 recognizes a quaternary epitope through electrostatic interactions and shape complementarity, comprising distinct regions of two neighboring RBDs within an S trimer ( Figures 37C-37D).
  • S2M11 CDRH1, CDRH2 and the heavy chain framework region 3 (FR3) are docked into the RBM crevice (burying a surface of ⁇ 400A 2 ), whereas CDRH3 spans the interface between the RBM and helices 339-343, and 367-374, as well as residue 436 of an adjacent RBD belonging to the neighboring protomer (i.e., burying a total surface of ⁇ 500A 2 ) ( Figures 37C-37F).
  • S2M11 CDRL2 interacts with residues 440-441 and CDRLl forms key contacts with the glycan at position N343, which is rotated -45° compared to the orientation it adopts in the S309-bound S structure (27), both sets of interactions occurring with the neighboring RBD (quaternary epitope) ( Figures 37C-37F and Figure 44G).
  • Three out of eight S2M11 heavy chain residues that are mutated relative to germline contribute to epitope recognition (Ile54, Thr77 and Phel02) whereas none of the two light chain mutated residues participate in RBD binding.
  • S2M11 epitope is formed by: on a first RBD, amino acid residues 339, 342, 343, 367, 368, 371, 372, 373, 374, 436, 440, and 441, and, on a second RBD, amino acid residues 446, 447, 449, 452, 455, 456, 484, 485, 486, 487, 489, 490, 492, 493, 494, 496, and 498.
  • the biphasic binding may be interpreted as S2M11 interacting with a tertiary epitope present in open RBDs (fast off-rate), based on the identical kinetics and affinity measured relative to isolated RBD, and S2M11 recognizing its full quaternary epitope (slow off-rate).
  • S2M11 and S2E12 inhibit SARS-CoV-2 atachment to ACE 2 and trigger Fc-mediated effector functions
  • both S2E12 and S2M11 inhibited binding of ACE2 to SAR.S- CoV-2 S expressed at the surface of CHO cells ( Figure 38E), validating this mechanism of neutralization using full-length native S trimers.
  • the comparable efficiency of S2E12 and S2M11 to block S attachment to ACE2 correlates with their similar neutralization potencies.
  • ADCC Ab-dependent cell cytotoxicity
  • ADCP Ab-dependent cell phagocytosis
  • S2M11 promoted efficient, dose-dependent FcyRIIIa- mediated (but not FcyRIIa-mediated) signaling, in particular for the high affinity (VI 58) variant of the Fc receptor, to levels comparable to the cross-reactive mAb S309 ( Figure 38G and Figures 45C-45D) (21).
  • S2E12 triggered FcyRIIa-mediated (but not FcyRIIIa-mediated) signaling, possibly as a result of the distinct orientation of the mAb relative to the membrane of the effector cells in comparison to S2M11 and S309.
  • S2M11 but not S2E12 showed FcyRIIIa-dependent ADCC activity (Figure 38H and 45E) and ADCP activity ( Figure 381).
  • cocktails of these mAbs may leverage additional protective mechanisms in vivo besides inhibition of viral entry.
  • SARS-CoV-2 S-VSV pseudotyped virus entry assays with selected S variants confirmed these results and showed that the Y449N, E484K/Q, F490L/S and S494P individual substitutions abrogated S2M11 -mediated neutralization whereas the L455F variant reduced neutralization potency by an order of magnitude ( Figures 46A, 46C, 46E). S2E12 neutralized efficiently all variants tested except G476S that showed an order of magnitude decreased potency ( Figures 46B, 46D, 46F).
  • S494P and F490L mutations have been detected in 20, 10/17, 15 and 5 viral isolates across three continents and in theory could be selected under the selective pressure of S2E12 or S2M11.
  • S2E12 or S2M11 were reported, with a prevalence of less than 0.1% as of September 2020. (Figure 46G).
  • S2M11 and S2E12 protect hamsters against SARS-CoV-2 challenge
  • S2E12 and S2M11 protect hamsters against SARS-CoV-2 challenge
  • either mAh or a cocktail of both mAbs were tested in a Syrian hamster model (43).
  • the mAbs were engineered with heavy and light chain constant regions from Syrian hamster IgG2 to allow optimal triggering of Fc-dependent effector functions.
  • mAbs were administered via intraperitoneal injection 48h before intranasal challenge with 2 x 10 6 TCTDso of SARS-CoV-2. Four days later, lungs were collected for the quantification of viral RNA and infectious virus.
  • Expi-293 Invitrogen
  • Expi-CHO cells Invitrogen
  • Expi-293 and Expi- CHO cells were maintained in Expi-293 Expression Medium (Invitrogen) and ExpiCHO- Expression Medium (Gibco), respectively. All cell lines used in this study (except HEK293F) were routinely tested for mycoplasma and found to be mycoplasma-free.
  • a SARS-CoV-2 prefusion S ectodomain trimer was designed based on a previously described construct (6). Specifically, a gene encoding for the ectodomain of SARS-CoV-2 prefusion S ectodomain trimer (residues 14-1211, GenBank: YP 009724390.1) covering the region from the end of the signal peptide sequence (starting with QCVN) to the beginning of the transmembrane domain (ending with QYIK) was synthesized, codon optimized for human cell expression and placed into a pCVM vector by Genscript.
  • the cultures were transfected using PEI (9 pg/mL) with cells grown to a density of 2.5 million cells per mL and cultivated for 4 days. Supernatants were harvested and cells resuspended for another 4 days in fresh media, yielding two harvests.
  • SARS-CoV-2 S hexapro was purified from clarified supernatants using lmL cobalt resin (Takara Bio TALON) and SARS-CoV-2 S avi was purified from supernatants using a lmL HisTrap HP column. Both proteins were concentrated and flash frozen in a buffer containing 20 mM Tris pH 8.0 and 150 mM NaCl prior to analysis. SDS-PAGE and negative stain EM was run to check purity and quality of the proteins.
  • SARS-CoV-2 S (residues 13-1211) with a mu-phosphatase signal sequence and a C-terminal Avi-His8-EPEA-tag in a pD2610-V5 vector (ATUM Bio) was expressed in Expi293F cells at 37°C and 8% C02 according to manufacturer’s instructions (Thermo Fisher Scientific). Cell culture supernatant was collected after four days and purified over a 5 mL C-tag affinity matrix (Thermo Fisher Scientific). Elution fractions were concentrated and injected on a Superose 6 Increase 10/300 GL column with lx PBS pH 7.4 as running buffer.
  • SARS-CoV-2 RBD (residues 328-531 with a C-terminal thrombin cleavage site- TwinStrep-8xHis-tag, and N-terminal signal sequence) was expressed in Expi293F cells at 37°C and 8% CO2 in a humidified incubator. Transfection was performed using ExpiFectamine 293 reagent (Thermo Fisher Scientific). Cell culture supernatant was collected three days after transfection and supplemented with 1 Ox PBS to a final concentration of 2.5x PBS (342.5 mM NaCl, 6.75 mM KC1 and 29.75 mM phosphate) and sodium phosphate dibasic to adjust the pH.
  • SARS-CoV-2 RBD was purified using a 1 ml HisTALON Superflow cartridge (Takara Bio) and subsequently buffer exchanged using a Zeba spin desalting column into Cytiva lx HBS-N buffer.
  • Recombinant ACE2 (residues 19-615 from Uniprot Q9BYF1 with a C-terminal thrombin cleavage site-TwinStrep-lOxHis-GGG-tag, and N-terminal signal sequence) was expressed in Expi293F cells at 37 °C and 8% C02 in a humified incubator. Transfection was performed using ExpiFectamine 293 reagent (Thermo Fisher Scientific). Cell culture supernatant was collected seven days after transfection, supplemented with buffer to a final concentration of 80 mM Tris-HCl pH 8.0, 100 mM NaCl, and then incubated with BioLock solution for one hour.
  • ACE2 was purified using a 1 ml StrepTrap High Performance column (Cytiva) followed by size exclusion chromatography using a Superdex 200 Increase 10/300 GL column and PBS as running buffer (Gibco 10010-023).
  • ACE2 protein for BLI experiments was expressed in ExpiCHO-S cells. Cell culture supernatant was collected nine days after transfection and protein was purified as described above using 20 mM Tris-HCl pH 7.5, 150 mM NaCl as size exclusion buffer.
  • Peripheral blood samples were obtained from two donors who have recovered from SARS-CoV-2 infection. Samples were collected 46 and 61 days after symptoms onset, respectively. Donors provided written informed consent. The study was approved by the Scientific and Ethical Committee of the Luigi Sacco Hospital, Milan, Italy. Peripheral blood mononuclear cells were isolated by Ficoll density gradient centrifugation and cryopreserved until use. Upon thawing of cells, B cells were enriched by staining with CD 19 PE-Cy7 (BD Bioscience 341113) and incubation with anti -PE bead (Miltenyi Biotec, cat. 130-048-801), followed by positive selection using LS columns.
  • CD 19 PE-Cy7 BD Bioscience 341113
  • anti -PE bead Miltenyi Biotec, cat. 130-048-801
  • Enriched B cells were stained with anti-IgM, anti-IgD, anti-CD14 and anti-IgA, all PE labelled, and prefusion SARS-CoV-2 S with a biotinylated avi tag conjugated to Streptavidin Alexa-Fluor 647 (Life Technologies).
  • SARS-CoV-2 S- specific IgG+ memory B cells were sorted by flow cytometry via gating for PE- negative and Alexa-Fluor 647 positive cells. Cells were cultured for the screening of positive supernatants.
  • S2M11 and S2E12 VH and VL sequences were obtained by RT-PCR and mAbs (including S309) were expressed as recombinant human Fab fragment or as IgGl (Glm3 allotype) carrying the half-life extending M428L/N434S (LS) mutation in the Fc .
  • ExpiCHO cells were transiently transfected with heavy and light chain expression vectors as described previously (57).
  • S2M11, S2E12 and a control mAb specific to Plasmodium falciparum sporozoite
  • Affinity purification of recombinant antibodies was performed on AKTA Xpress FPLC (Cytiva) operated by UNICORN software version 5.11 (Build 407) using HiTrap Protein A columns (Cytiva) for full length human and hamster antibodies and CaptureSelect CH1-XL MiniChrom columns (ThermoFisher Scientific) for Fab fragments, using PBS as mobile phase. Buffer exchange to the appropriate formulation buffer was performed with a HiTrap Fast desalting column (Cytiva).
  • 96-well ELISA plates were coated overnight at 4°C with 5 pg/ml of SARS-CoV2 RBD (produced in house; residues 331-550 of S glycoprotein from BetaCoV/Wuhan- Hu-1/2019, accession number MN908947) or 1 pg/ml of SARS-RBD (Sino Biological Europe GmbH), SARS-CoV-2 (6) or SARS-CoV S (36) trimers in PBS. Plates were blocked with a 1% w/v solution of Bovine Serum Albumin (BSA; Sigma) in PBS and incubated with serial dilutions of mAbs for 1 hour at room temperature.
  • BSA Bovine Serum Albumin
  • Binding measurements were performed using a Biacore T200 instrument using either anti-AviTag pAb (for capturing S protein) or StrepTactin XT (for capturing RBD) covalently immobilized on CM5 chips.
  • the running buffer was either Cytiva HBS-EP+ pH 7.4 (for neutral pH experiments) or 20 mM phosphate pH 5.4, 150 mM NaCl, 0.05% P-20 (for acidic pH experiments). All measurements were performed at 25 °C. Affmity/avidity determinations were run as single-cycle kinetics, with a 3-fold dilution series of mAb starting from 300 nM, and each concentration injected for 180 sec.
  • Double reference-subtracted data were fit to either a 1 : 1 binding model or a heterogeneous ligand model (for S2M11), using Biacore Evaluation software. Fit results yielded apparent equilibrium dissociation constants (I ⁇ D.app) due to conformational dynamics of the RBDs in the context of the prefusion S trimer and due to avidity for IgG binding. For dissociation rates that were too slow to fit, K r>.app are reported as an upper limit.
  • the first injection contained 300 nM IgG; the second injection maintained the same 300 nM IgG as the first injection, plus an additional IgG at 300 nM. Each injection was carried out for 420 sec. For all measurements, pH 5.4 data were normalized by capture level to the corresponding pH 7.4 data set to enable plotting the data on the same scale.
  • Biolaver Interferometry to test ACE2 binding inhibition mAb-mediated inhibition of SARS-CoV-2 RBD or S binding to human recombinant ACE2 was assessed using biolayer interferometry with an Octet Red96 (ForteBio).
  • SARS-CoV2 RBD (1 pg/ml) or prefusion S ectodomain trimer (15 pg/ml) were incubated in kinetic buffer KB (PBS + 0.01% BSA) with S2M11, S2E12, S309 (30 pg/ml) or no mAb for 30 minutes at 37°C.
  • S2M11, S2E12 and S309 were biotinylated using the EZ-Link NHS-PEO solid phase biotinylation kit (Pierce) and mAbs were subsequently buffer exchanged using a 7kDa MWCO Zeba Spin Desalting Columns into PBS.
  • concentration to achieve the 80 % maximal binding to ExpiCHO cells stably expressing wildtype, full-length spike SARS-CoV-2 S was determined by flow cytometry.
  • Unlabeled S2M11, S2E12 and S309 were serially diluted from 10 to 0.056 pg/ml and added to ExpiCHO cells. After 20 minutes, biotinylated mAbs were added at the concentration achieving 80% maximal binding and incubated for additional 20 minutes. Cells were washed and incubated with Streptavidin Alexa Fluor 647 (Life 690Technologies). After 20 minutes and additional washing steps, cells were analyzed with a 855 ZE5 flow-cytometer (Bio-rad).
  • SARS-CoV-2 spike protein coding sequence (YP 009724390.1) was cloned into the pcDNA3.1(+) vector under control of the human CMV promoter to generate pcDNA3.1(+) SARS-CoV-2 D19 spike.
  • SARS-CoV-2 S and variants were generated using site-directed mutagenesis.
  • ExpiCHO-S cells were seeded at 6 x 10 6 cells cells/mL in a volume of 5 mL in a 50 mL bioreactor.
  • S variant plasmids were diluted in iced OptiPRO SFM, mixed with ExpiFectamine CHO Reagent (Life Technologies) and added to the cells. Transfected cells were then incubated at 37°C, 8% CO2 with an orbital shaking speed of 209 RPM (orbital diameter of 25 mm) for 42 hours.
  • ACE2 was biotinylated by incubation with a 1.5 molar excess of Thermo EZ-Link NHS-PEG4-Biotin and was subsequently buffer exchanged using two successive 0.5 ml 7k MWCO Zeba Spin Desalting Columns into PBS; final concentration 1.1 mg/ml. Biotinylated- ACE2 was incubated with SA-BV421 (Biolegend) at a ratio of 1 : 1 by volume for 20 minutes at room temperature.
  • ExpiCHO cells expressing SARS-CoV-2 S variants were harvested, washed twice with FACS buffer (2% FBS), and dispensed into a 96-well V-bottom plate. Separately, the test antibody or ACE2-BV421 were serially diluted.
  • FACS buffer 2% FBS
  • the test antibody or ACE2-BV421 were serially diluted.
  • a SARS-CoV-2 convalescent plasma sample was tested at a dilution of 1 :500.
  • Cells were stained with mAb for 30 mins on ice and then washed twice in FACS buffer. Alexa Fluor 647-labelled Goat Anti-Human IgG secondary Ab (Jackson Immunoresearch) was diluted 1 :750 in FACS buffer to the cells for 15 min on ice. Cells were washed twice with FACS buffer and resuspended in 1% PFA (Alfa Aesar). Data was acquired by flow-cytometry (CytoFlex LX).
  • ExpiCHO cells transfected with wildtype or variant SARS-CoV-2 S were seeded in 96 well V bottom plates and incubated with the indicated anti-S mAbs diluted in FACS buffer for 15 minutes on ice. A final concentration of 20 pg/ml ACE2-SA-BV421 was then added to the cells and incubated for 30 minutes on ice. Cells were washed twice with FACS buffer, resuspended in FACS buffer containing Alexa Fluor 647-AffmiPure F(ab’)2 Fragment Goat Anti-Human IgG (1:750 dilution), and incubated for 15 minutes on ice.
  • Cells were washed twice with FACS buffer and analyzed on a CytoFLEX LX Flow Cytometer (Beckman Coulter). Cells were also stained with anti-S mAbs in the absence of ACE2-SA-BV421 to determine the percent spike positive cells. Data were normalized to the percent spike positive cells.
  • Vero E6 cells were infected with authentic SARS-CoV-2 at an MOI 0.1. 24 hours later, cells were harvested, spun down, plated in a 96-well plate and incubated with mAbs in FACS buffer (PBS, 2%FCS). After a 20-minute incubation, cells were washed with FACS buffer and incubated with secondary antibody Alexa Fluor 647-labelled Goat Anti-Human IgG secondary Ab (Jackson Immunoresearch) at a dilution of 1:750 for 10 minutes. Cells were washed and fixed with BD fix/perm solution (BD Biosciences). Finally, cells were washed in FACS buffer and resuspended in FACS buffer for acquisition on a flow cytometer.
  • FACS buffer PBS, 2%FCS
  • Pseudotyped viruses bearing the SARS-CoV-2 S-glycoprotein were generated as previously described (6). Briefly, HEK293T-17 cells were co-transfected with a plasmid encoding for SARS-CoV-2 S-glycoprotein harboring a C-terminal 19-residue truncation (55), the packaging and reverse transcriptase/integrase encoding-construct Gag-Pol, and the reporter vector pTG-Luc following X-tremeGENE HP (Merck) manufacturer’s recommendations.
  • HEK293T-17 cells were co-transfected with a plasmid encoding for SARS-CoV-2 S-glycoprotein harboring a C-terminal 19-residue truncation (55), the packaging and reverse transcriptase/integrase encoding-construct Gag-Pol, and the reporter vector pTG-Luc following X-tremeGENE HP (Merck) manufacturer
  • VeroE6 cells were seeded at 20000 cells/well in 96 well plates using MEM supplemented with 10% FBS, 1% penicillin-streptomycin. After 24 hours, pseudotyped viruses were pre-activated by incubation with 10 pg/ml TPCK-treated trypsin (Bioconcept) for 1 hour at 37°C. Next, serial dilutions of mAbs were mixed with the pseudotyped viruses and incubated for 1 hour at 37°C. VeroE6 cells were washed twice before addition of the mAb/pseudotyped virus mix and were incubated for 2 hours at 37°C.
  • Lenti-X 293T cells (Takara) were seeded in 10-cm dishes. The next day, cells were transfected with a plasmid encoding for SARS-CoV-2 S (YP 009724390.1) harboring a C-terminal 19- residue truncation using TransIT-Lenti (Mirus Bio) according to the manufacturer’s instructions. One day post-transfection, cells were infected with VSV(G*AG-luciferase) (Kerafast) at an MOI of 3 infectious units/cell.
  • Viral inoculum was washed off after one hour and cells were incubated for another day at 37°C.
  • the cell supernatant containing SARS-CoV-2 pseudotyped VSV was collected at day 2 post-transfection, centrifuged at 1,000 x g for 5 minutes to remove cellular debris, aliquoted, and frozen at -80°C.
  • Vero E6 cells were seeded into clear bottom white walled 96-well plates at 20,000 cells/well and cultured overnight at 37°C. The next day, 9- point 4-fold serial dilutions of mAbs were prepared in media. SARS-CoV-2 pseudotyped VSV was diluted 1:25 in media and added 1:1 to each antibody dilution. Virus:mAb mixtures were incubated for 1 hour at 37°C. Media was removed from the Vero E6 cells and 50 pL of virus:mAb mixtures were added to the cells. One hour post infection, 100 pL medium was added to all wells.
  • Neutralization was determined using SARS-CoV-2-Nluc, an infectious clone of SARS-CoV-2 (based on strain 2019-nCoV/USA_WAl/2020) encoding nanoluciferase in place of the viral ORF7, which demonstrated comparable growth kinetics to wildtype virus (34).
  • VeroE6 cells were seeded into black-walled, clear-bottom 96-well plates at 2 x 10 4 cells/well and cultured overnight at 37°C. The next day, 9-point 4-fold serial dilutions of mAbs were prepared in infection media (DMEM + 10% FBS).
  • SARS-CoV- 2-Nluc was diluted in infection media for a final MOI of 0.1 PFU/cell, added to the mAh dilutions and incubated for 30 minutes at 37°C. Media was removed from the VeroE6 cells, mAb-virus complexes were added, and cells were incubated at 37°C for 6 hours. Media was removed from the cells, Nano-Glo luciferase substrate (Promega) was added according to the manufacturer’s recommendations, incubated for 10 minutes at room temperature and luciferase signal was quantified on a VICTOR Nivo plate reader (Perkin Elmer). mAh combination studies
  • SARS-CoV-2 strain 2019-nCoV/USA_WAl/2020 was obtained from the Centers for Disease Control and Prevention (gift of Natalie Thornburg). Virus was passaged once in Vero CCL81 cells (ATCC) and titrated by focus-forming assay on Vero E6 cells (35). Serial dilutions of indicated mAbs were incubated with 10 2 focus forming units (FFU) of SARS-CoV-2 for 1 hour at 37°C. MAb-virus complexes were added to Vero E6 cell monolayers in 96-well plates and incubated for 1 hour at 37°C. Subsequently, cells were overlaid with 1% (w/v) methylcellulose in MEM supplemented with 2% FBS.
  • FFU focus forming units
  • Plates were harvested 30 hours later by removing overlays and fixed with 4% PFA in PBS for 20 minutes at room temperature. Plates were washed and sequentially incubated with 1 pg/mL of CR3022 anti-S antibody and HRP- conjugated goat anti-human IgG in PBS supplemented with 0.1% saponin and 0.1% BSA. SARS-CoV-2-infected cell foci were visualized using TrueBlue peroxidase substrate (KPL) and quantitated on an ImmunoSpot microanalyzer (Cellular Technologies). Data were processed using Prism software (Graphpad Prism 8).
  • Vero E6 cells were seeded in 96 well plates at 15,000 cells per well in 70pl DMEM High glucose + 2.4% Hyclone without antibiotics. After overnight culture the cells were transfected with CoV-2-Spike-D 19_pcDNA3.1 as follows: for 10 wells, 0.57 pg plasmid CoV2-Spike-D19_pcDNA were mixed with 1.68ul X-tremeGENE HP in 30ul OPTIMEM. After 15min incubation time this solution was diluted 1 : 10 in DMEM medium and 30pl was added per well. A 4-fold serial dilution mAbs was prepared and was added to the cells, with a final starting concentration of 20 pg/ml. The following day, 30m1 5x concentrated Draq5 in DMEM was added per well and incubated for 2 hours at 37°C. Nine images of each well were acquired with a Cytation 5 equipment for analysis.
  • Fc-effector functions mAb-dependent activation of human FcyRIIIa was performed with a bioluminescent reporter assay.
  • ExpiCHO cells stably expressing full-length wild-type SARS-CoV-2 S (target cells) were incubated with different amounts of mAbs.
  • Jurkat cells stably expressing FcyRIIIa receptor (VI 58 or FI 58 variants) or FcyRIIa receptor (H131 variant) and NFAT-driven luciferase gene (effector cells) were added at an effector to target ratio of 6: 1 for FcyRIIIa and 5:1 for FcyRIIa.
  • Luminescence was measured after 20 hours of incubation at 37°C with 5% C02 with a luminometer using the Bio-Glo-TM Luciferase Assay Reagent according to the manufacturer’s instructions (Promega, Cat. Nr.: G9798, G7018 and G9995)
  • NK cells were isolated from the blood of healthy donors with the MACSxpress NK Isolation Kit (Miltenyi Biotec, Cat. Nr.: 130-098-185). Target cells were incubated with mAbs for 10 minutes before addition of NK cells at an effectontarget ratio of 9: 1. After a 4 hour-incubation at 37°C, LDH release as a readout of cellular cytotoxicity was detected with the Cytotoxicity Detection Kit (LDH) (Roche; Cat. Nr.: 11644793001).
  • LDH Cytotoxicity Detection Kit
  • PBMCs were stained with Cell Trace Violet (Invitrogen).
  • ExpiCHO cells stably expressing SARS-CoV-2 S were used as target cells and were fluorescently labelled with PKH67 (Sigma Aldrich).
  • Labelled target cells (7500 cells/well) were incubated with serially diluted antibodies. After 10 minutess, stained PBMCs (150,000 cells/well) were added. The next day, cells were washed with FACS buffer (PBS, 1%FBS). Cells were stained with APC-labelled anti-CD14 mAh (BD Pharmingen) for the identification of monocytes.
  • S2M11 and S2E12 Fabs were generated by digestion of the corresponding mAbs with LysC (Thermo Fisher Scientific) at 1:4000 (w/w) ratio at 37°C during an overnight digestion. SDS-PAGE in reducing and non-reducing condition was used to check quality of digestion. SARS-CoV-2 S avi at 1.2 mg per mL was incubated with a 1.2 molar excess of Fab S2M11 at 4°C for 1 hour.
  • SARS-CoV-2 hexaPro was incubated at 1 mg per ml with a 1.5 molar excess of Fab S2E12 during 1 hour at 4°C after which the complex was further purified by size exclusion chromatography using a Superose 6 increase 10/300 column (GE Healthcare).
  • 3 pL of 1-1.2 mg per mL of complexes were loaded onto a freshly glow discharged R 2/2 UltrAuFoil grids (200 mesh) prior to plunge freezing using a vitrobot MarkIV (ThermoFisher Scientific) with a blot force of 0 and 7-7.5 second blot time at 100% humidity and 21°C.
  • cryoSPARC For S/S2M11 and S/S2E12 datasets, one round of reference-free 2D classification were performed using cryoSPARC (61). Subsequently, for both datasets one round of 3D classification with 50 iterations (angular sampling 7.5° for 25 iterations and 1.8° with local search for 25 iterations), using ab initio generated models in cryoSPARC (61), were carried out using Relion (62, 63) without imposing symmetry. 3D refinements were carried out using non-uniform refinement (64). Particle images were subjected to Bayesian polishing (65) using Relion before performing another round of non-uniform refinement in cryoSPARC followed by per-particle defocus refinement and again non-uniform refinement.
  • the particles were symmetry-expanded and subjected to focus 3D classification without refining angles and shifts using a soft mask encompassing the RBD and S2E12 variable domains in Relion.
  • Particles belonging to classes with the best resolved local density were selected and subjected to local refinement using cryoSPARC .
  • Local resolution estimation, filtering, and sharpening were carried out using CryoSPARC.
  • Reported resolutions are based on the gold-standard Fourier shell correlation (FSC) of 0.143 criterion and Fourier shell correlation curves were corrected for the effects of soft masking by high-resolution noise substitution (66). CryoEM model building and analysis.
  • FSC gold-standard Fourier shell correlation
  • UCSF Chimera (67) and Coot (68) were used to fit atomic models (PDB 6VXX or PDB 6VYB) into the cryoEM maps and the Fab variable domains were manually built.
  • S2E12 was built in the locally refined map and subsequently validated using the Fab crystal structure. Models were refined and relaxed using Rosetta using both sharpened and unsharpened maps (69-71). Validation used Phenix (72), Molprobity (73) and Privateer (74). Figures were generated using UCSF ChimeraX (75).
  • Crystals of S2E12 Fab were obtained by the sitting-drop vapor diffusion method. A total of 200 nl Fab at approximately 7 mg/ml in 20 mM Tris-HCl pH 7.5,
  • 150 mM NaCl were mixed with 200 nl mother liquor solution containing 0.2 M magnesium chloride hexahydrate, 0.1 M Tris pH 8.5 and 30% (w/v) PEG 4000.
  • Crystals were flash cooled in liquid nitrogen using the mother liquor solution supplemented with 20% glycerol as a cryoprotectant.
  • Diffraction data were collected on synchrotron beamline XI OS A at the Swiss Light Source, and processed with the XDS software package (76). Initial phases were obtained by molecular replacement using Phaser (77) on the CCP4 suite, using a homology model. Several subsequent rounds of model building and refinement were performed using Coot (68) and Refmac5 (78).
  • SARS-CoV-2 the SARS-CoV-2 strain used in this study, BetaCov/Belgium/GHB- 03021/2020 (EPI ISL 109407976
  • a close relatedness with the prototypic Wuhan-Hu-1 2019-nCoV (GenBank accession 112 number MN908947.3) strain was confirmed by sequencing and phylogenetic analysis. Infectious virus was isolated by serial passaging on Huh7 and Vero E6 cells ( ⁇ 3); passage 6 virus was used for the study described here.
  • the titer of the virus stock was determined by end-point dilution on Vero E6 cells by the Reed and Muench method. This work was conducted in the high-containment A3 and BSL3+ facilities of the KU Leuven Rega Institute (3 CAPS) under licenses AMV 30112018 SBB 2192018 0892 and AMV 23102017 SBB 21920170589 according to institutional guidelines.
  • Vero E6 cells African green monkey kidney, ATCC CRL-1586 were cultured in minimal essential medium (Gibco) supplemented with 10% fetal bovine serum (Integra), 1% L- glutamine (Gibco) and 1% bicarbonate (Gibco). End-point titrations were performed with medium containing 2% fetal bovine serum instead of 10%.
  • SARS-CoV-2 infection model in hamsters Wildtype Syrian hamsters (Mesocricetus auratus) were purchased from Janvier Laboratories and were housed per two in ventilated isolator cages (IsoCage N Biocontainment System, Tecniplast) with ad libitum access to food and water and cage enrichment (wood block). Housing conditions and experimental procedures were approved by the ethical committee of animal experimentation of KU Leuven (license P065-2020). Female hamsters of 6-10 weeks old were anesthetized with ketamine/xylazine/atropine and inoculated intranasally with 50 pL containing 2x106 TCID50.
  • mAb treatment S2M11 (1 mg/kg), S2E12 (1 mg/kg) or their combinations (1 or 0.5 mg/kg) was initiated 48 hours before infection by intraperitoneal injection.
  • Hamsters were monitored for appearance, behavior and weight.
  • hamsters were euthanized by intraperitoneal injection of 500 pL Dolethal (200mg/mL sodium pentobarbital, Vetoquinol SA).
  • Lungs were collected, and viral RNA and infectious virus were quantified by RT-qPCR and end-point virus titration, respectively. Blood samples were collected before infection for PK analysis.
  • SARS-CoV-2 RT-qPCR Hamster tissues were collected after sacrifice and were homogenized using bead disruption (Precellys) in 350 pL RLT buffer (RNeasy Mini kit, Qiagen) and centrifuged (10,000 rpm, 5 minutes) to pellet the cell debris. RNA was extracted according to the manufacturer’s instructions. To extract RNA from serum, the NucleoSpin kit (Macherey-Nagel) was used. Of 50 pL eluate, 4 pL was used as a template in RT-qPCR reactions.
  • RT-qPCR was performed on a LightCycler96 platform (Roche) using the iTaq Universal Probes One-Step RT-qPCR kit (BioRad) with N2 primers and probes targeting the nucleocapsid (43).
  • Standards of SARS-CoV2 cDNA (IDT) were used to express viral genome copies per mg tissue or per mL serum.
  • End-point virus titrations Lung tissues were homogenized using bead disruption (Precellys) in 350 pL minimal essential medium and centrifuged (10,000 rpm, 5min, 4°C) to pellet the cell debris.
  • Viral titers were calculated by the Reed and Muench method (79) and were expressed as 50% tissue culture infectious dose (TCIDso) per mg tissue.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Virology (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Genetics & Genomics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The instant disclosure provides antibodies and antigen-binding fragments thereof that can bind in certain regions of a SARS-CoV-2 S glycoprotein and can neutralize a SARS-CoV-2 infection. Also provided are immunogenic compositions that comprise a SARS-CoV-2 S glycoprotein or a portion thereof that is capable of being bound by an antibody or antigen-binding fragment.

Description

STRUCTURE-GUIDED IMMUNOTHERAPY AGAINST SARS-COV-2
STATEMENT REGARDING SEQUENCE LISTING
The Sequence Listing associated with this application is provided in text format in lieu of a paper copy, and is hereby incorporated by reference into the specification. The name of the text file containing the Sequence Listing is 930585_412WO_SEQUENCE_LISTING.txt. The text file is 206 KB, was created on June 2, 2021, and is being submitted electronically via EFS-Web.
BACKGROUND
A novel betacoronavirus emerged in Wuhan, China, in late 2019. As of May 29, 2021, approximately 169,600,000 cases of infection by this virus (termed, among other names, SARS-CoV-2 and Wuhan coronavirus), were confirmed worldwide, and had resulted in approximately 3,500,000 deaths. Therapies for preventing or treating SARS-CoV-2 infection are needed.
BRIEF DESCRIPTION OF THE DRAWINGS
Figures 1A and IB show data from a neutralization of infection assay using SARS-CoV-2 virus. Serial dilutions of human monoclonal antibodies were incubated with 102 focus-forming units of SARS-CoV-2 strain 2019n-CoV/USA_WAl/2020 (obtained from the CDC) for 1 hour at 37 °C. SARS-CoV-2 -infected cell foci were visualized using TruBlue peroxidase substrate (KPL) and quantitated on an ImmunoSpot microanalyzer (Cellular Technologies). Data were processed using Prism software (GraphPad Prism 8.0). Figure 1 A shows results for four exemplary antibodies and comparator antibody S309. Figure IB shows results for six exemplary antibodies, with calculated EC50 values to the right of the graph.
Figure 2 shows neutralization of SARS-CoV-2 infection by monoclonal antibodies S309, S2H14, and S2X2. The antibodies were tested individually (left panel), in two-antibody combinations (center panel), and in a three-antibody combination (right panel). For combinations, antibodies were used at 1 : 1 and 1:1:1 ratios. Calculated EC50 values for each antibody or antibody combination are shown below each graph.
Figure 3 shows neutralization of SARS-CoV-2 infection by monoclonal antibodies S309, S2H14, and S2A4. The antibodies were tested individually, in two antibody combinations, and in a three-antibody combination, as shown in the legend. For combinations, S2H14 and/or S2A4 were used at a concentration of 5 pg/ml and S309 was used at the concentrations indicated on the x-axis.
Figure 4 summarizes results of quantitative epitope-specific serology studies using monoclonal antibody S309 and other anti-Spike antibodies, as determined by binding competition, cryo-EM, and crystallography data. Underlined and bolded antibodies are cross-reactive with SARS-CoV-1.
Figures 5A-5C show data from a neutralization of infection assay using SARS- CoV-2 virus. Serial dilutions of human monoclonal antibodies were incubated with 102 focus-forming units of SARS-CoV-2 strain 2019n-CoV/USA_WAl/2020 (obtained from the CDC) for 1 hour at 37 °C. SARS-CoV-2-infected cell foci were visualized using TruBlue peroxidase substrate (KPL) and quantitated on an ImmunoSpot microanalyzer (Cellular Technologies). Data were processed using Prism software (GraphPad Prism 8.0). Figure 5A shows results for antibody S2X190 and four comparator antibodies. Figure 5B shows results for antibody S2X129 and four comparator antibodies. Figure 5C shows results for antibodies S2X132 and S2X127, along with 4 comparator antibodies. Calculated EC50 values are shown to the right of each graph.
Figure 6 shows a cryoEM structure of the prefusion SARS-CoV-2 S ectodomain trimer with three S2X259 Fab fragments bound to three open RBDs viewed along two orthogonal orientations. N-linked glycans are rendered as dark grey spheres. As discussed further herein, S2X259 recognizes a glycan-free, cryptic epitope within antigenic site Ila, which was defined based on the S2X35 mAb isolated from the same donor (See Piccoli et al. Mapping Neutralizing and Immunodominant Sites on the SARS-CoV-2 Spike Receptor-Binding Domain by Structure-Guided High-Resolution Serology. Cell 183, 1024-1042. e21 (2020)). S2X259 binding appears to require opening of two RBDs to grant access to the Fab in the context of the S trimer. S2X259 contacts the RBD using both heavy and light chains, which contribute approximately two thirds and one third of the -950 Al paratope surface buried upon binding, respectively. S2X259 uses complementary determining regions (CDRs) H1-H3, LI and L3 to contact RBD residues 369-386, which form two a-helices and an intervening b- strand belonging to the structurally conserved RBD b-sheet, as well as the residues 404- 411 and 499-508 which form a continuous surface made up of an a-helix and a loop followed by an a-helix, respectively.
Figure 7 shows a model of S2X259 binding with SARS-CoV-2 RBD. The binding pose involves contacts with multiple RBD regions. Residues corresponding to prevalent RBD mutations are shown as light grey spheres. N-linked glycans are rendered as dark grey spheres.
Figure 8 shows selected interactions formed between S2X259 and the SARS- CoV-2 RBD.
Figure 9 shows a map of mutations reducing S2X259 binding using DMS.
Mean mutation effect on ACE2 affinity, RBD folding, and predicted contribution to S2X259 binding for substitutions at each position in the S2X259 epitope is shown. Mutations introducing a N-linked glycosylation sites that may not be tolerated in full spike are indicated with *.
Figure 10 shows selection of the G504D mutation as single neutralization escape mutant using a replicating SARS-CoV-2 S VSV system.
Figure 11 shows a detailed view of the S2X259/RBD interface showing G504D in RBD.
Figures 12A and 12B show data from neutralization tests with S2E12 and S230 control mAbs against VSV pseudotypes harbouring the S glycoprotein of SARS-CoV-
1 and SARS-CoV-2 related strains and VOCs. Figure 12A shows data for SARS-CoV-
2 and SARS-CoV-2 variants. Figure 12B shows data for SARS-CoV-1 and related strains. Figure 13 shows representative electron micrographs (upper panels) and class averages (lower panels) of SARS-CoV-2 S in complex with the S2X259 Fab.
Figure 14 shows gold-standard Fourier shell correlation curves for the S trimer bound to three S2X259 Fabs (solid black line) and the locally refined reconstruction of the RBD/S2X259 variable domains. The 0.143 cutoff is indicated by horizontal dashed lines.
Figure 15 shows a local resolution map for the open S trimer bound to three S2X259 (left panel) and the locally refined reconstruction of the RBD/S2X259 variable domains (right panel).
Figure 16 shows the cryoEM data processing flow-chart.
Figure 17 shows a ribbon diagram showing a superimposition of the S2X259- bound and S2A4-bound (PDB 7JVA) SARS-CoV-2 RBD (Piccoli et al 2020). The SARS-CoV glycan at position N357 was modelled based on the S230-bound SARS- CoV S structure (PDB 6NB630) and is predicted to sterically hinder S2A4 binding (red star) but not S2X259. A portion of the mAh heavy chains are indicated with arrows; S2X259 light chain is adjacent the S2X259 heavy chain and shown at the upper left portion of the figure; a portion of the S2A4 light chain is shown generally beneath the S2X259 light chain portion. N-linked glycans are rendered as dark spheres.
Figure 18 shows S2X259 Fc-mediated activation of FcyRIIa and FcyRIIIa in vitro. NFAT-driven luciferase signal induced in Jurkat cells stably expressing FcyRIIa H131 (left panel) variant or FcyRIIIa V158 (right panel) variant by S2X259 binding to full-length wild-type SARS-CoV-2 S on ExpiCHO target cells. SE12, S2M11, S309, S309-GRLR mAbs are included as controls.
Figure 19 shows S2X259 Fc-mediated activation of FcyRIIa and FcyRIIIa in vitro. NFAT-driven luciferase signal induced in Jurkat cells stably expressing FcyRIIa H131 (left panel) variant or FcyRIIIa V158 (right panel) variant by S2X259 binding to uncleavable full-length pre-fusion stabilized SARS-CoV-2 S (unable to release the SI subunit) transiently expressed in ExpiCHO cells. SE12, S2M11, S309, and S309- GRLR mAbs are included as controls. Figure 20 shows site I-targeting SE12, site II-targeting S2X259, and site IV- targeting S309 mAb binding to immobilized SARS-CoV-2 RBD.
Figure 21 shows RBD binding to S2X259 and ACE2. S2X259 and ACE2 bind partially overlapping binding sites on the SARS-CoV-2 RBD.
Figures 22A and 22B show biolayer interferometry binding analysis of the S2X259 Fab to wildtype or VOC SARS-CoV-2 biotinylated RBDs immobilized at the surface of SA biosensors. Figure 22A shows analysis of S2X259 Fab binding to SAR.S- CoV-2 wildtype RBD (left graph) and SARS-CoV-2 variant B.1.1.7 RBD (right graph). Figure 22B shows analysis of S2X259 Fab binding to SARS-CoV-2 variant B.1.351 (left graph) and SARS-CoV-2 variant P.l (right graph).
Figures 23A-23C show description of cohorts of SARS-CoV-2-infected individuals. (A) Summary of patient demographics. (B) Age distribution of hospitalized, symptomatic and asymptomatic individuals. (C) Time interval between the date of sample collection and the date of symptom onset.
Figures 24A-24G show analysis of serum/plasma IgG binding titers to SAR.S- CoV-2 and SARS-CoV antigens. (A-C) IgG (A), IgA (B) and IgM (C) binding titers to SARS-CoV-2 S, RBD and N from 67 and 154 samples collected from hospitalized and symptomatic individuals, respectively, whose date of symptom onset was known. (D) Correlation between SARS-CoV-2 S- and N-specific IgG binding titers (ED50). (E and F) IgG binding titers to SARS-CoV-2 and SARS-CoV S (E) and RBD (F) from 19 hospitalized, 130 symptomatic and 8 asymptomatic individuals. (G) Ratios of SARS- CoV-2/SARS-CoV S and RBD IgG binding titers.
Figures 25A-25J show characteristics of six probe monoclonal antibodies used for structural and epitope-mapping studies. (A) V(D)J usage, percentage identity to germline, number of somatic mutations, source and time interval between sample collection and mAb isolation, RBD site recognized and neutralization potency of the 6 mAbs. B mem, memory B cell; PC, plasma cells. (B) Binding of the 6 mAbs to the SARS-CoV-2 (up) or SARS-CoV (down) RBD analyzed by ELISA. (C) Competition matrix for binding of each of the six mAbs in presence of another mAb evaluated by biolayer interferometry. (D) mAb-mediated inhibition of RBD binding to ACE2 analyzed by ELISA. (E) mAb-mediated SI subunit shedding from cell-surface expressed SARS-CoV-2 S as determined by flow-cytometry. (F) Conservation of RBM and epitope residues in -74,000 SARS-CoV-2 sequences (GISAID, August 11th, 2020). RBM and epitope residues are shown as gray bars. Black bars indicate variant prevalence for epitope residues with at least 2 variants. RBM residues were determined from PDB 6M0J using a 5.0A° distance cutoff between RBD and ACE2 residues using MOE. (G) Western-blot analysis (top) of the prefusion-stabilized SARS-CoV-2 S ectodomain trimer in presence of S2A4, S304 or S2X35 Fab after incubation for the indicated amount of times. Red ponceau staining (bottom) of the SDS-PAGE gel used for carrying out the western blot confirming the presence of added Fabs when indicated. (H) Analysis of activation of FcyRIIIa (V158 allele) expressed on Jurkat cells by SARS-CoV-2 S stably transfected CHO cells incubated with mAbs. GRLR indicates an antibody Fc variant carrying mutations that abolish binding to FcyRs. (I) Analysis of activation of FcyRIIa (H131 allele), expressed on Jurkat cells by SARS-CoV-2 S stably transfected CHO cells incubated with mAbs. (J) Killing of SARS-CoV-2 S stably transfected CHO cells by mAbs in the presence of complement (CDC assay).
Figures 26A-26B show conservation analysis across Clades of Sarbecoviruses. (A-l-A-4) S glycoprotein residues making contact with S304, S2H13, S2H14 or S2A4 across sarbecovirus clades. Residue numbers for both SARS-CoV-2 S and SARS-CoV S are shown. Multiple sequence alignment was performed using MAFFT. A dash represents the same residue, a strikethrough represents a gap. Asterisk (*) indicates manually aligned residues. Civet SARS-CoV is SARS-CoV HC/SZ/61/03 and raccoon dog SARS-CoV is SARS-CoV A031G. (B) Identity and similarity of SARS-CoV-2 S, RBD, RBM and mAb epitopes across select sequences of the 3 sarbecovirus clades. Values were calculated using EMBOSS Needle. The insertion in the S2A4 epitope for the Clade 1 sarbecoviruses was not included in the calculation.
Figures 27A and 27B show analysis of Fab and IgG binding to the prefusion SARS-CoV-2 S ectodomain trimer and recombinant RBD at neutral and acidic pH analyzed by surface plasmon resonance. (A and B) SARS-CoV-2 S or RBD was captured on the sensor chip surface and binding at multiple mAb concentrations was measured. Neutral pH measurements were performed in multi-cycle format (A) and acidic pH measurements in single-cycle format (B). All data have been fit to a 1:1 binding model, which is an approximation for the S-binding data, since the kinetics incorporate conformational dynamics between open and closed RBD states, and because IgG binding involves avidity. The solid gray horizontal line gives the predicted maximum signal (saturation) based on each fit; the dashed line shows the S309 maximum binding for comparison. Asterisk indicates where a high concentration of S304 IgG was binding to the reference surface (fit was to the first two concentrations only). All mAbs bind similarly to the RBD at both pHs, but the mAbs that bind to only open RBD show a maximum below S309 in the context of the S trimer. This difference is dramatic at acidic pH where RBDs are primarily in the closed state (Zhou et ah, 2020b). S2X35 was an exception, likely because its very slow off rate allows it to bias the S equilibrium toward open RBD.
Figures 28A-28I shows analysis of the specificity of IgG, IgA, and IgM serum/plasma Abs from a panel of 647 hospitalized, symptomatic, and asymptomatic SAR.S-CoV-2-infected individuals. (A-C) Binding titers (ED50) of antigen-specific IgG (A), IgA (B), or IgM (C) were measured in plasma or sera from convalescent SAR.S-CoV-2 patients (47 hospitalized, 556 symptomatic, and 44 asymptomatic) and from pre-pandemic healthy donors (n = 32). A cut-off of 30 was determined based on signal of prepandemic samples and binding to uncoated ELISA plates. (D) Binding titers (ED50) of S- and N-specific IgGs measured in sera from symptomatic and asymptomatic SAR.S-CoV-2-infected individuals from the Ticino healthcare workers cohort (n = 459) categorized according to symptoms severity, as described in the methods. (E) IgG binding titers to SAR.S-CoV-2 RBD (left) and SAR.S-CoV-2 S pseudovirus neutralizing titers (ID80, center) before and after depletion of RBD- specific Abs from 21 SAR.S-CoV-2 immune plasma samples. The percentage of depletion of binding and neutralizing Abs (right) for each sample tested is shown on the right. (F) Ab-mediated inhibition of SAR.S-CoV-2 RBD binding to solid phase ACE2, as determined by ELISA. Shown is the reciprocal plasma or serum dilution that blocks 80% binding (BD80) of RBD to human ACE2. (G) Ab-mediated inhibition of SAR.S- CoV-2 RBD binding to solid phase ACE2 in the Ticino healthcare workers cohort determined as in (F). A cut-off of 10 was used to separate neutralizing from non neutralizing titers. (H) Correlation analysis between levels of plasma/serum RBD- specific IgG (ED50) and the titers of Abs blocking RBD attachment to ACE2 (BD80). (I) Correlation analysis between plasma/serum neutralizing Ab titers (ID80) and the titers of Abs blocking RBD attachment to ACE2 (BD80).
Figures 29A-29H show kinetics of IgG Responses Specific for the SARS-CoV- 2 RBD and Blocking RBD Attachment to ACE2. (A) Binding titers (ED50) of serum or plasma IgG to the SARS-CoV-2 RBD measured at two time points separated by an average time of 44 days in 368 subjects. Tl, time of first blood draw; T2, time of second blood draw. (B) Variation of RBD-specific IgG binding titers from Tl to T2. (C) Kinetics of RBD- and N-specific IgG responses in serum or plasma from 24 convalescent individuals (red, hospitalized; blue, symptomatic non-hospitalized). The starting time point corresponds to the date of collection of the first sample. (D) Model predicted longitudinal decline of RBD- and N-specific IgG binding titers from 18 convalescent individuals with respect to the onset of symptoms from infection.
Symbols, observations; shaded region, 90% prediction interval; line, median prediction. (E) Serum or plasma titers of Abs blocking RBD attachment to ACE2 (BD80) measured at Tl and T2. (F) Variation of RBD-specific IgG binding titers and titers of Abs blocking RBD attachment to ACE2 (BD80) from Tl to T2. (G) Avidity index of serum IgG binding to RBD (%) measured at Tl and T2. (H) Variation of avidity index of IgG binding to RBD (%) from Tl to T2.
Figures 30A-30H show that S2H13 mAb inhibits SARS-CoV-2 by blocking attachment to ACE2 via recognition of an epitope accessible in the open and closed S conformations. (A) SARS-CoV-2 S pseudovirus neutralization assay indicating an IC50 of 500 ng/mL. (B and C) Molecular surface representation of the SARS-CoV-2 S/S2H13 Fab complex structure with three RBDs closed shown in two orthogonal orientations. (D) Molecular surface representation of the SARS-CoV-2 S/S2H13 Fab complex structure with one RBD open. Each SARS-CoV-2 protomer of the trimer is shaded differently, and N-linked glycans are rendered as dark spheres. The S2H13 light and heavy chain variable domains are identified - light chain variable domain with lighter shading, heavy chain variable domain with darker shading. (E) S2H13 recognizes a crevice formed by the SARS-CoV-2 RBM. Selected side chains at the interface are shown. (F) S2H13 and ACE2 (dark green) bind overlapping RBM epitope. The star indicates steric clashes. (G) BLI binding competition between S2H13 and ACE2 for binding to the SARS-CoV-2 RBD. (H) Molecular surface representation of the SARS-CoV-2 RBD (gray) with the S2H13 epitope colored by residue conservation across SARS-CoV-2 isolates and SARS-CoV.
Figures 31A-31I show that S2H14 mAh inhibits SARS-CoV-2 by blocking attachment to the ACE2 receptor. (A) SARS-CoV-2 S pseudovirus neutralization assay indicating an IC50 of 900 ng/mL. (B and C) Molecular surface representation of the SARS-CoV-2 S/S2H14 Fab complex structure with two RBDs open and one RBD closed viewed along two orthogonal orientations. (D and E) Molecular surface representation of the SARS-CoV-2 S/S2H14 Fab complex structure with three RBDs open shown in two orthogonal orientations. Each SARS-CoV-2 protomer is shaded distinctly, and N-linked glycans are rendered as dark spheres. The S2H14 light and heavy chain variable domains are shaded distinctly. (F) S2H14 binds to an epitope within the SARS-CoV-2 RBM. (G) S2H14 and ACE2 bind overlapping RBM epitope. The red star indicates steric clashes. (H) BLI binding competition between S2H14 and ACE2 for binding to the SAR.S-CoV-2 RBD. (I) Molecular surface representation of the SAR.S-CoV-2 RBD (gray) with the S2H14 epitope colored by residue conservation across SAR.S-CoV-2 isolates and SARS-CoV.
Figures 32A-32H show that S2A4 mAh promotes SAR.S-CoV-2 S opening through binding to a cryptic epitope. (A) SAR.S-CoV-2 S pseudovirus neutralization assay indicating an IC50 of 3.5 mg/mL. (B and C) Molecular surface representation of the SARS-CoV-2 S/S2A4 Fab complex cryo-EM structure with three RBDs open viewed along two orthogonal orientations. Each SARS-CoV-2 protomer is shaded distinctly, and N-linked glycans are rendered as dark spheres. The S2A4 light and heavy chain variable domains are shaded differently, as shown in the figure key. (D and E) Detailed views of the contacts formed between S2A4 and the RBD with selected side chains shown. (F) S2A4 and ACE2 bind distinct RBD epitopes but would clash via steric hindrance. The star indicates steric clashes. (G) BLI binding competition between S2A4 and ACE2 for binding to the SARS-CoV-2 RBD. (H) Molecular surface representation of the SARS-CoV-2 RBD (gray) with the S2A4 epitope colored by amino acid residue conservation with SARS-CoV. The position of the SARS-CoV N357 glycan is indicated with red dotted lines.
Figures 33A-33H show that S304 mAh promotes SARS CoV-2 S Opening through binding to a cryptic epitope conserved within the Sarbecovirus subgenus. (A and B) Molecular surface representation of the SARS-CoV-2 S/S304 Fab complex cryo-EM structure with three RBDs opened viewed along two orthogonal orientations. Each SARS-CoV-2 S protomer is shaded distinctly (see figure key), and N-linked glycans are rendered as dark spheres. The S304 light and heavy chains are shaded differently, as shown in the figure key. (C) Cryo-EM reconstruction of the SI subunit trimer (with disordered S2) bound to three S304 Fabs viewed along two orthogonal orientations and the corresponding atomic model fit in density. Each SAR.S- CoV-2 SI protomer is shaded distinctly. The S304 light and heavy chain variable domains are shaded distinctly. (D) Ribbon diagram of the crystal structure of S304, S2H14, and S309 in complex with the SARS-CoV-2 RBD. Only the S304 variable domains are shown, whereas S2H14 and S309 were omitted for clarity. (E) Positioning of ACE2 relative to the S304 Fab bound to the SARS-CoV-2 RBD. ACE2 N-linked glycans at position N322 and N546 are indicated, as they could putatively clash with S304. (F) Molecular surface representation of the SARS CoV-2 RBD (gray) with the S304 epitope colored by residue conservation with SARS-CoV. (G and H) Positioning of ACE2 (relative to the S2A4 (G) and S2X35 (H) Fabs bound to the SARS-CoV-2 RBD. The stars indicate steric clashes.
Figures 34A-34L show structure-guided high-resolution serology. (A) Composite model of the SARS-CoV-2 S trimer with three open RBDs viewed along two orientations with all six mAbs used for competition ELISA shown bound to one RBD. (B-G) Epitopes recognized by each mAh are shown on the surface of the RBD for S2H14 (teal, B), S2H13 (orange, C), S2X35 (red, D), S2A4 (yellow, E), S304 (magenta, F), and S309 (purple, G). The glycan at position N343 is rendered as blue spheres and the RBM is shown as a black outline. (H-J) Competition ELISA (blockade-of-binding) between individual mAbs and sera or plasma from hospitalized (H), symptomatic (I), and asymptomatic (J) COVID-19 convalescent subjects. Each plot shows the magnitude of inhibition of binding to immobilized RBD in the presence of each mAh, expressed as reciprocal sera or plasma dilution blocking 80% of the maximum binding response. (K) Correlation analysis of titers of serum Abs blocking RBD binding to ACE2 and Abs blocking each of the six probe mAbs. (L) Comparison of RBD-specific IgG titers between sera containing Ab blocking at least one probe mAb and sera that do not contain Ab blocking any of the six probe mAbs.
Figures 35A-35G show that S2E12 and S2M11 neutralize SARS-CoV-2 via targeting the RBD. A-B. Neutralization of authentic SARS-CoV-2 (SARS-CoV-2-Nluc) by S2E12 (A) and S2M11 (B) IgG or Fab. Symbols are means+SD of triplicates. Dotted lines indicate ICso and IC90 values. Average IC50 values are indicated in parentheses below the graphs (determined from two independent experiments). C-F. ELISA binding of S2M11, S2E12 or S309 mAbs to immobilized SARS-CoV-2 RBD (C), SARS-CoV-2 S (D), SARS-CoV RBD (E) or SARS-CoV S (F). Symbols show means of duplicates.
G. SPR analysis of S2E12 and S2M11 Fab binding to the SARS-CoV-2 RBD or S ectodomain trimer. Experiments were carried out at pH 7.4 (orange) and pH 5.4 (green) and were repeated twice with similar results (one experiment is shown). The apparent equilibrium dissociation constants at pH7.4 are indicated. White and gray stripes indicate association and dissociation phases, respectively. S2M11 binding to S was fit to two parallel kinetic phases and the resulting KD, app #1 and KD, app #2 were interpreted as apparent affinity for open RBDs (tertiary epitope) and closed RBDs (quaternary epitope), respectively, as supported by the similar binding kinetics and affinity observed for S2M11 binding to the isolated RBD .
Figures 36A-36D show that S2E12 neutralizing mAb recognizes the SARS- CoV-2 RBM. (A-B) CryoEM structure of the prefusion SARS-CoV-2 S ectodomain trimer with three S2E12 Fab fragments bound to three open RBDs viewed along two orthogonal orientations. (C) The S2E12 concave paratope recognizes the convex RBM tip. (D) Close-up views showing selected interactions formed between S2E12 and the SARS-CoV-2 RBD. In (A)-(D), each SARS-CoV-2 S protomer is shaded distinctly whereas the S2E12 light and heavy chain variable domains are also shaded differently from one another. N-linked glycans are rendered as dark spheres in (A)-(C).
Figures 37A-37F show that S2M11 neutralizing mAh recognizes a quaternary epitope spanning two RBDs and stabilizes S in the closed state. (A-B) CryoEM structure of the prefusion SARS-CoV-2 S ectodomain trimer bound to three S2M11 Fab fragments viewed along two orthogonal orientations. (C-D) The S2M11 binding pose, which involves a quaternary epitope spanning two neighboring RBDs. (E-F) Close-up views showing selected interactions formed between S2M11 and the SARS-CoV-2 RBDs. In (A)-(F), each SARS-CoV-2 S protomer is shaded distinctly whereas the S2M11 light and heavy chain variable domains are also shaded distinctly. N-linked glycans are rendered as dark spheres in (A)-(D) and as sticks in (E)-(F). FR: framework.
Figures 38A-38I show that S2E12 and S2M11 prevent SARS-CoV-2 S attachment to ACE2, inhibit membrane fusion and S2M11 triggers effector functions. (A) S2E12 and ACE2 bind overlapping binding sites on the SARS-CoV-2 RBD. (B) S2M11 and ACE2 bind overlapping binding sites on the SARS-CoV-2 RBD. The stars indicate steric clashes. (C-D) Binding of the SARS-CoV-2 RBD (C) or S ectodomain trimer (D) alone (grey) or precomplexed with the S2M11 (red), S2E12 (blue) or S309* (yellow) mAbs to the ACE2 ectodomain immobilized at the surface of biosensors analyzed by biolayer interferometry. "S309*" in the figure is an engineered version of the parent S309 mAh , and comprises the VH amino acid sequence of SEQ ID NO.:93 and the VL amino acid sequence of SEQ ID NO.:97. KB: kinetic buffer (negative control). (E) Binding of varying concentrations of S2E12 (blue), S2M11 (red) or S309 (yellow) mAbs to full-length S expressed at the surface of CHO cells in the presence of 20 pg/mL of the ACE2 ectodomain analyzed by flow cytometry (one measurement per condition). (F) Cell-cell fusion inhibition assay with VeroE6 cells transfected with SARS-CoV-2 S and incubated with varying concentrations of S2E12 (blue), S2M11 (red) or S309 (yellow) mAbs and a control mAh. The values are normalized to the percentage of fusion without mAh and to the percentage of fusion of non-transfected cells. (G) FcyRIIIa (high affinity variant VI 58) signaling induced by individual mAbs or mAh cocktails. For mAh cocktails, the concentration of the constant mAh was 5 mg/ml. The concentration of the diluted mAh is indicated on the x axis. (H) ADCC using primary NK cells as effectors and SARS-CoV-2 S-expressing CHO cells as targets. The magnitude of NK cells-mediated killing is expressed as the area under the curve (AUC) for each mAh used at concentrations ranging between 0.1 ng/ml and 20 pg/ml. For mAh cocktails, the mAh listed first was kept constant at 5 pg/ml. Each symbol represents one donor, data are combined from two individual experiments. (I) ADCP using PBMCs as a source of phagocytic cells (monocytes) and PKH67- fluorescently labelled S-expressing CHO cells as target cells. The y axis indicates % of monocytes double-positive for anti-CD14 (monocyte) marker and PKH67. The dashed line indicates the signal detected in the presence of target and effector cells but without mAh (baseline). Each line indicates the data for one PBMC donor. Symbols are means of duplicates. Data are from one experiment.
Figures 39A-39C show in vivo protection of S2E12, S2M11 or cocktails of these two mAbs against SARS-CoV-2 challenge. Syrian hamsters were injected with the indicated amount of mAh 48 h before intra-nasal challenge with SARS-CoV-2. (A) Quantification of viral RNA in the lungs 4 days post infection. (B) The concentration of mAbs measured in the serum before infection (day 0) inversely correlates with the viral RNA load in the lung 4 days post infection. (C) Quantification of replicating virus in lung homogenates harvested 4 days post infection using a TCID50 assay. For mAh cocktails, the total dose of an equimolar mixture of both mAbs is indicated.
Figures 40A-40C show neutralization of SARS-CoV-2 S pseudotyped and authentic viruses by S2E12 and S2M11. (A) Neutralization assay with SARS-CoV-2 S- VSV. Symbols represent means+SD of triplicates. (B) Neutralization assay with SAR.S- CoV-2 S-MLV. Symbols represent means of duplicates. (C) Neutralization of authentic virus using a focus-forming-assay. The determined mean and range of ICso and IC90 values for each mAh tested are indicated. Symbols represent means of duplicates. Results are combined from one to seven individual experiments for each mAh and (pseudotyped) virus. Figures 41A-41C show binding analysis of monoclonal antibodies (mAbs) S2M11, S2E12 and S309. (A) mAb binding to the immobilized SARS-CoV-2 RBD or the S ectodomain trimer was evaluated by SPR at pH7.4 and pH5.4. The order of addition of the first and second mAb is indicated above and below the graph, respectively. The experiment was performed once. (B). mAb binding to SARS-CoV-2 S expressed at the surface of ExpiCHO cells analyzed by flow cytometry. The mAbs indicated in the legend below the graphs (first mAb) was serially diluted and incubated with cells before addition of biotinylated mAbs at a concentration that achieved 80% maximal binding (when analyzed in the absence of competitors). Symbols show means+SEM. Data are combined from three independent experiments. (C) Surface plasmon resonance analysis of S2E12 and S2M11 IgG binding to the SARS-CoV-2 RBD or the S ectodomain trimer. Experiments were carried out at pH 7.4 (orange) and at pH 5.4 (green) and were performed twice with similar results (one representative experiment is shown). White and gray stripes indicate association and dissociation phases, respectively.
Figures 42A-42G show cryo-electron microscopy data processing and validation of the S/S2E12 complex dataset. (A-B) Representative electron micrograph (A) and class averages (B) of SARS-CoV-2 S in complex with the S2E12 Fab embedded in vitreous ice. Scale bar: 500 A. (C) Gold-standard Fourier shell correlation curves for the open S trimer bound to three S2E12 Fabs (solid black line) and the locally refined reconstruction of the RBD/S2E12 variable domains. The 0.143 cutoff is indicated by horizontal dashed lines. (D-E) Local resolution map calculated using cryoSPARC for the open S trimer bound to three S2E12 Fabs (D) and the locally refined reconstruction of the RBD/S2E12 variable domains (E). (F) Close-up view showing selected interactions formed between S2E12 (light and heavy chain are shaded lighter and darker, respectively) and the SARS-CoV-2 RBD with the corresponding region of cryoEM density (transparent grey surface). (G) CryoEM data processing flow chart.
Figures 43A-43D show epitopes targeted by S2E12 and S2M11 on the SARS- CoV-2 S trimer. (A-B) The S2E12 footprint is shown in purple on one protomer of the closed (A) or open (B) SARS-CoV-2 S trimer. (C-D) The quaternary S2M11 footprint is shown in purple on two neighboring protomers of the closed (A) or open (B) SARS- CoV-2 S trimer. In (A)-(D), the SARS-CoV-2 S is rendered as a molecular surface colored distinctly for each protomer (cyan, pink and gold).
Figures 44A-44G show cryo-electron microscopy data processing and validation of the S/S2M11 complex dataset. (A-B) Representative electron micrograph (A) and class averages (B) of SARS-CoV-2 S in complex with the S2M11 Fab embedded in vitreous ice. Scale bar: 500 A. (C) Gold-standard Fourier shell correlation curves for the closed S2M11-bound trimer. The 0.143 cutoff is indicated by horizontal dashed lines. (D) Local resolution map calculated using cryoSPARC. (E) Close-up view showing selected interactions formed between S2M11 (light and heavy chain portions are colored magenta and purple, respectively) and the SARS-CoV-2 RBDs (cyan and gold) with the corresponding region of cryoEM density (transparent grey surface). (F) CryoEM data processing flow-chart. (G) Comparison of the orientation of the SARS- CoV-2 glycan at position N343 in the S2M11-bound (blue) and the S309-bound (grey) structures (PDB ID 6WPS) reveal a rotation of -45°.
Figures 45A-45E show effector functions of individual monoclonal antibodies and monoclonal antibody cocktails. (A-B) Binding of S2E12, S2M11 and S309 to the surface of VeroE6 cells infected with authentic SARS-CoV-2. Flow cytometry graphs showing the binding of mAbs at a concentration of 10 pg/ml or the secondary Ab only as a negative control (2ry Ab only) (A). Data for the binding of mAbs at 0.1, 1 and 10pg/ml (B). Results are from one out of two independent experiments with similar results. (C) FcyRIIIa low affinity variant F158 and FcyRIIa (high affinity variant H) signaling induced by individual S2E12 or S2M11 mAbs and the S2E12/S2M11 mAh cocktail. Results are shown as fold increase over background (RLU at mAh cone. x/RLU without mAh). (D) FcyRIIIa high affinity variant VI 58, low affinity variant F158 and FcyRIIa (high affinity variant H) signaling induced by S2M11, S309 or the S2M11/S309 cocktail. (E) Representative mAh dose-dependent NK-mediated killing for a donor heterozygous for F158 and V158 FcyRIIIa. For C-E: Symbols show means of duplicates. For mAh cocktails, the concentration of the constant mAh was 5 pg/ml. The concentration of the diluted mAh, starting at 5 pg/ml, is indicated on the x axis. Experiments in C-D were conducted two to three times with similar results.
Figures 46A-46J shows neutralization of known SARS-CoV-2 S variants by monoclonal antibody cocktails. (A-F) S2M11 (A and B) and S2E12 (C and D)- mediated neutralization of SARS-CoV-2 S-VSV variants. SARS-CoV-2 S mutations in the variants tested are indicated in the legend. Symbols show means+SD of triplicates for A-D and means of duplicates for E and F. (G) Variant prevalence of amino acids targeted by S2M11 based on 90,287 complete genome sequences reported by GISAID as of September 12th 2020. At least 4 supporting sequences were required to define a variant. (H-J) Neutralization of SARS-CoV-2 S-VSV variants by mAh cocktails, mixed at 1:1 equimolar ratio for S2E12+S2M11 (G), S2M11+S309 (H), S2E12+S309 (I). The x axis indicates the total mAh concentration. Symbols show means+SD of triplicates. Dashed lines indicated the ICso and IC90. A constraint of <100 was used for all curve fit analysis. All experiments were repeated at least once with similar results.
Figure 47 shows ACE2 binding to variant SARS-CoV-2 S corresponding to circulating isolates. Binding of fluorescently labeled recombinant ACE2 ectodomain to ExpiCHO cells transiently transfected with SARS-CoV-2 S variants. The experiment was performed twice with similar results.
Figures 48A-48F shows data evaluating neutralization potency of monoclonal antibody cocktails. (A) Neutralization matrix to assess the synergistic activity of S2M11 and S2E12 mAh cocktails in vitro with authentic SARS-CoV-2 -Nluc. (B-C) Neutralization matrix for S2M11 in combination with S2E12 tested with SARS-CoV-2 VSV (B) and SARS-CoV-2 MLV (C). (D-E) Neutralization matrix for S309 in combination with S2M11 tested with SARS-CoV-2-MLV (D) and SARS-CoV-2 VSV (E). (F) Neutralization matrix for S309 in combination with S2E12, tested with SARS- CoV-2 VSV. Data for authentic SARS-CoV-2 -Nluc are from one representative experiment out of two, done in triplicate each. All SARS-CoV-2 S-VSV assays were performed twice with similar results, each from triplicate plates. Data for SARS-CoV-2 S-MLV are from quadruplicate plates from one experiment. Figure 49 shows kinetics and affinity parameters of S2E12 (Fab and IgG) and S2M11 (Fab and IgG) to RBD and S glycoprotein, as determined by surface plasmon resonance.
Figure 50 shows cryoEM data collection and refinement statistics for investigating binding of S2M11 and S2E12 to S glycoprotein.
Figure 51 shows x-ray crystallography data collection and refinement statistics for investigating binding of S2E12 Fab to S glycoprotein.
Figure 52 shows binding of S2M11, S2E12 and S309 mAbs to SARS-CoV-2 S variants expressed at the surface of CHO cells and assessed by flow cytometry +: no loss of binding. loss of binding.
Figures 53A-53K show cryo-EM data processing and validation of the S/S2H13 and S/S2H14 complex datasets. (A and B) Representative electron micrograph (A) and class averages (B) of SARS-CoV-2 S in complex with the S2H13 Fab embedded in vitreous ice. Scale bar: 400 A. (C) Gold-standard Fourier shell correlation curves for the closed S2H13-bound trimer (black solid line), partially open S2H13-bound trimer (gray solid line) and locally refined RBM/S2H13 variable domains (black dashed line). The 0.143 cutoff is indicated by horizontal dashed lines. (D and F) Local resolution maps calculated using cryoSPARC for the closed (D) and partially open (E) reconstructions as well as for the locally refined RBM/S2H13 variable domains (F). (G and H) Representative electron micrograph (G) and class averages (H) of SARS-CoV-2 S in complex with the S2H14 Fab embedded in vitreous ice. Scale bar: 400A. (I) Gold- standard Fourier shell correlation curves for the S2H14-bound trimer with one RBD closed (black solid line) or three RBDs open (gray solid line). The 0.143 cutoff is indicated by horizontal dashed lines. (J and K) Local resolution maps calculated using cryoSPARC for the reconstructions with one RBD closed (J) and three RBDs open (K).
Figures 54A-540 show cryo-EM data processing and validation of the S/S2A4 and S/S304 complex datasets. (A and B) Representative electron micrograph (A) and class averages (B) of SARS-CoV-2 S in complex with the S2A4 Fab embedded in vitreous ice. Scale bar: 400A. A 2D class average corresponding to an SI subunit trimer (with disordered S2) bound to three S2A4 Fabs is highlighted in red. (C) Gold-standard Fourier shell correlation curves for the S2A4-bound trimer (black solid line) and locally refined RBD/S2A4 variable domains (black dashed line). The 0.143 cutoff is indicated by a horizontal dashed line. (D and E) Local resolution maps calculated using cryoSPARC for the whole reconstruction (D) as well as for the locally refined RBD/S2A4 variable domains (E). (F) Superimposition of the three distinct open conformations of the S trimer, with three bound S2A4 Fabs and RBDs swung out to various extent. The arrows indicate the distinct positions of the Fabs in the maps. (G and H) CryoEM reconstruction of the SI subunit trimer (with disordered S2) bound to three S2A4 Fabs viewed along two orthogonal orientations and the corresponding atomic model fit in density. Each SARS-CoV-2 SI protomer is colored distinctly (cyan, pink and gold). The S2A4 light and heavy chains are colored magenta and purple, respectively. (I and J) Representative electron micrograph (I) and class averages (J) of SARS-CoV-2 S in complex with the S304 Fab embedded in vitreous ice. Scale bar:
400 A. (K) Gold-standard Fourier shell correlation curve for the S304-bound S trimer reconstruction. The 0.143 cutoff is indicated by a horizontal dashed line. (L) Local resolution map calculated using cryoSPARC. (M) Superimposition of the three distinct open conformations of the S trimer, with three bound S304 Fabs and RBDs swung out to various extent. The arrows indicate the distinct positions of the Fabs in the maps. (N and O) CryoEM reconstruction of the SI subunit trimer (with disordered S2) bound to three S304 Fabs viewed along two orthogonal orientations and the corresponding atomic model fit in density. Each SARS-CoV-2 SI protomer is colored distinctly (cyan, pink and gold). The S304 light and heavy chains are colored magenta and purple, respectively.
DETAILED DESCRIPTION
Provided herein are antibodies and antigen-binding fragments that are capable of binding to a SARS-CoV-2 S glycoprotein, for example, a S glycoprotein of a S glycoprotein trimer. Presently disclosed antibodies and antigen-binding fragments can, for example, bind by contacting one or more amino acid residues of the S glycoprotein or trimer, recognize an epitope formed by specified amino acid residues of the S glycoprotein or trimer, and/or bind to a S glycoprotein of a trimer wherein the three RBDs of a trimer comprise various conformations (e.g, one RBD up ("open") and two RBDs down ("closed"), two RBDs up and one RBD down, three RBDs up, and/or three RBDs down). Accordingly, presently disclosed antibodies and antigen-binding fragments are useful to target SAR.S-CoV-2 S glycoprotein in a variety of conformations. Presently disclosed antibodies and antigen-binding fragments include those that compete with a specified antibody or antigen-binding fragment for binding to a SARS-CoV-2 S glycoprotein.
Antibodies were isolated from survivors of SAR.S-C0V or SAR.S-CoV-2 and used to elucidate different antigenic sites and epitopes in SAR.S-CoV-2 S glycoprotein. Mechanisms for binding to and/or neutralizing SAR.S-CoV-2 infection (e.g, by binding to SAR.S-CoV-2 S glycoprotein receptor binding domain (RBD) in open, closed, or open and closed conformations; by interfering with S glycoprotein interaction with human ACE2; by locking S glycoprotein RBDs (of a trimer) in a closed conformation) were determined. High-resolution serology studies of the human antibody response to SAR.S-CoV-2 infection were performed.
Also provided are compositions and combinations that comprise any two or more of the presently disclosed antibodies or antigen-binding fragments. Theantibodies or antigen-binding fragments, compositions, and combinations can, in certain embodiments, provide multiple mechanisms for binding to and, optionally, neutralizing, a SAR.S-CoV-2. Antibody or antigen-binding fragment-encoding polynucleotides and vectors are also provided, as well as host cells that comprise the same and/or that express an antibody or antigen-binding fragment. Also provided are uses of the presently disclosed antibodies or antigen-binding fragments, combinations, and compositions for treating or diagnosing a SAR.S-CoV-2 infection, or for testing a vaccine composition (e.g, based on the S glycoprotein) to determine whether the vaccine comprises an epitope in a correct conformation.
Also provided are immunogenic compositions comprising a SAR.S-CoV-2 S polypeptide (i.e., a complete S glycoprotein or a portion thereof, optionally which is comprised in a multimer such as a trimer or a dimer) that is capable of being bound by a presently disclosed antibody or antigen-binding fragment, as well as immunogenic compositions that comprise two or more different such S polypeptides ( e.g ., such that two or more different presently disclosed antibodies or antigen-binding fragments can bind to the immunogenic composition). Methods of using the immunogenic compositions are also provided.
Prior to setting forth this disclosure in more detail, it may be helpful to an understanding thereof to provide definitions of certain terms to be used herein. Additional definitions are set forth throughout this disclosure.
As used herein, "SARS-CoV-2", also referred to herein as "Wuhan seafood market phenomia virus", or "Wuhan coronavirus" or "Wuhan CoV", or "novel CoV", or "nCoV", or "2019 nCoV", or "Wuhan nCoV" is a betacoronavirus believed to be of lineage B (sarbecovirus). SARS-CoV-2 was first identified in Wuhan, Hubei province, China, in late 2019 and spread within China and to other parts of the world by early 2020. Symptoms of SARS-CoV-2 infection include fever, dry cough, and dyspnea.
The genomic sequence of SARS-CoV-2 isolate Wuhan-Hu-1 is provided in SEQ ID NO.:l (see also GenBank MN908947.3, January 23, 2020), and the amino acid translation of the genome is provided in SEQ ID NO.:2 (see also GenBank QHD43416.1, January 23, 2020). Like other coronaviruses (e.g., SARS- CoV-1), SARS-CoV-2 comprises a "spike" or surface ("S") type I transmembrane glycoprotein containing a receptor binding domain (RBD). RBD is believed to mediate entry of the lineage B SARS coronavirus to respiratory epithelial cells by binding to the cell surface receptor angiotensin-converting enzyme 2 (ACE2). In particular, a receptor binding motif (RBM) in the virus RBD is believed to interact with ACE2.
It will be understood that SARS CoV-2 S glycoproteins naturally form trimers. The RBDs can undergo hinge-like conformational movements between an "open" (receptor-accessible) conformation that generally points "up", away from the C- terminal end of the S glycoprotein, and a "closed" (receptor-inaccessible) conformation. RBDs of a trimer in an open conformation are depicted in, for example, Figures 33A-33C and 36A-36B. RBDs of a trimer in a closed conformation are depicted in, for example, Figures 37A and 37B. Figures 43A and 43B shown top-down views of a closed S trimer and an open S trimer, respectively. Figures 43C and 43D show top-down views of a closed S trimer and an open S trimer, respectively.
As taught herein, certain epitopes may be available for binding only when an RBD is in an open conformation. Certain other epitopes may be available for binding only when an RBD is in a closed conformation. Some epitopes may be available for binding only when one or more RBDs of a trimer is present in an open conformation. Some other epitopes may be available for binding only when one or more RBDs of a trimer is present in a closed conformation. Some epitopes are available when an RBD is in an open conformation or a closed conformation.
The amino acid sequence of the Wuhan-Hu-1 surface glycoprotein is provided in SEQ ID NO.:3. The amino acid sequence of SARS-CoV-2 RBD is provided in SEQ ID NO.:4. SARS-CoV-2 S protein has approximately 73% amino acid sequence identity with SARS-CoV-1. The amino acid sequence of SARS-CoV-2 RBM is provided in SEQ ID NO.:5. SARS-CoV-2 RBD has approximately 75% to 77% amino acid sequence similarity to SARS-CoV-1 RBD, and SARS-CoV-2 RBM has approximately 50% amino acid sequence similarity to SARS-CoV-1 RBM.
SARS-CoV-2 includes a virus comprising the amino acid sequence set forth in any one or more of SEQ ID NOs.:2, 3, and 4, optionally with the genomic sequence set forth in SEQ ID NO. : 1. There have been a number of emerging SARS-CoV-2 variants. Some SARS-CoV-2 variants contain an N439K mutation, which has enhanced binding affinity to the human ACE2 receptor (Thomson, E.C., et al., The circulating SAR.S- CoV-2 spike variant N439K maintains fitness while evading antibody-mediated immunity. bioRxiv, 2020). Some SARS-CoV-2 variants contain an N501 Y mutation, which is associated with increased transmissibility, including the lineages B.l.1.7 (also known as 20E501Y.V1 and VOC 202012/01; (del69-70, dell44, N501Y, A570D, D614G, P681H, T716I, S982A, and D1118H mutations)) and B.1.351 (also known as 20H/501Y.V2; L18F, D80A, D215G, R246I, K417N, E484K, N501Y, D614G, and A701 V mutations), which were discovered in the United Kingdom and South Africa, respectively (Tegally, FL, et al., Emergence and rapid spread of a new severe acute respiratory syndrome-related coronavirus 2 (SARS-CoV-2) lineage with multiple spike mutations in South Africa. medRxiv, 2020: p. 2020.12.21.20248640; Leung, K., et al., Early empirical assessment of the N501 Y mutant strains of SARS-CoV-2 in the United Kingdom, October to November 2020. medRxiv, 2020: p. 2020.12.20.20248581).
B.1.351 also include two other mutations in the RBD domain of SARS-CoV2 spike protein, K417N and E484K (Tegally, H., et al., Emergence and rapid spread of a new severe acute respiratory syndrome-related coronavirus 2 (SARS-CoV-2) lineage with multiple spike mutations in South Africa. medRxiv, 2020: p. 2020.12.21.20248640). Other SARS-CoV-2 variants include the Lineage B.1.1.28, which was first reported in Brazil; the Variant P.1, lineage B.1.1.28 (also known as 20J/501Y.V3), which was first reported in Japan; Variant L452R, which was first reported in California in the United States (Pan American Health Organization, Epidemiological update: Occurrence of variants of SARS-CoV-2 in the Americas, January 20, 2021, available at reliefweb.int/sites/reliefweb.int/files/resources/2021-jan-20-phe-epi-update-SARS- CoV-2.pdf). Other SARS-CoV-2 variants include a SARS CoV-2 of clade 19A; SARS CoV-2 of clade 19B; a SARS CoV-2 of clade 20A; a SARS CoV-2 of clade 20B; a SARS CoV-2 of clade 20C; a SARS CoV-2 of clade 20D; a SARS CoV-2 of clade 20E (EU1); a SARS CoV-2 of clade 20F; a SARS CoV-2 of clade 20G; and SARS CoV-2 Bl.1.207; and other SARS CoV-2 lineages described in Rambaut, A., et al., A dynamic nomenclature proposal for SARS-CoV-2 lineages to assist genomic epidemiology. Nat Microbiol 5, 1403-1407 (2020). The foregoing SARS-CoV-2 variants, and the amino acid and nucleotide sequences thereof, are incorporated herein by reference.
SARS-CoV is another betacoronavirus of lineage B (sarbecovirus) that causes respiratory symptoms in infected individuals. The genomic sequence of SARS-CoV Urbani strain has GenBank accession number AAP 13441.1.
In the present description, any concentration range, percentage range, ratio range, or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated. Also, any number range recited herein relating to any physical feature, such as polymer subunits, size or thickness, are to be understood to include any integer within the recited range, unless otherwise indicated. As used herein, the term "about" means ± 20% of the indicated range, value, or structure, unless otherwise indicated. It should be understood that the terms "a" and "an" as used herein refer to "one or more" of the enumerated components. The use of the alternative ( e.g ., "or") should be understood to mean either one, both, or any combination thereof of the alternatives. As used herein, the terms "include," "have," and "comprise" are used synonymously, which terms and variants thereof are intended to be construed as non-limiting.
"Optional" or "optionally" means that the subsequently described element, component, event, or circumstance may or may not occur, and that the description includes instances in which the element, component, event, or circumstance occurs and instances in which they do not.
In addition, it should be understood that the individual constructs, or groups of constructs, derived from the various combinations of the structures and subunits described herein, are disclosed by the present application to the same extent as if each construct or group of constructs was set forth individually. Thus, selection of particular structures or particular subunits is within the scope of the present disclosure.
The term "consisting essentially of is not equivalent to "comprising" and refers to the specified materials or steps of a claim, or to those that do not materially affect the basic characteristics of a claimed subject matter. For example, a protein domain, region, or module (e.g., a binding domain) or a protein "consists essentially of a particular amino acid sequence when the amino acid sequence of a domain, region, module, or protein includes extensions, deletions, mutations, or a combination thereof (e.g., amino acids at the amino- or carboxy -terminus or between domains) that, in combination, contribute to at most 20% (e.g., at most 15%, 10%, 8%, 6%, 5%, 4%, 3%, 2% or 1%) of the length of a domain, region, module, or protein and do not substantially affect (i.e., do not reduce the activity by more than 50%, such as no more than 40%, 30%, 25%, 20%, 15%, 10%, 5%, or 1%) the activity of the domain(s), region(s), module(s), or protein (e.g., the target binding affinity of a binding protein).
As used herein, "amino acid" refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g ., hydroxyproline, g-carboxyglutamate, and O-phosphoserine. Amino acid analogs refer to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a-carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g. , homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g, norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refer to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
As used herein, "mutation" refers to a change in the sequence of a nucleic acid molecule or polypeptide molecule as compared to a reference or wild-type nucleic acid molecule or polypeptide molecule, respectively. A mutation can result in several different types of change in sequence, including substitution, insertion or deletion of nucleotide(s) or amino acid(s).
A "conservative substitution" refers to amino acid substitutions that do not significantly affect or alter binding characteristics of a particular protein. Generally, conservative substitutions are ones in which a substituted amino acid residue is replaced with an amino acid residue having a similar side chain. Conservative substitutions include a substitution found in one of the following groups: Group 1 : Alanine (Ala or A), Glycine (Gly or G), Serine (Ser or S), Threonine (Thr or T); Group 2: Aspartic acid (Asp or D), Glutamic acid (Glu or Z); Group 3 : Asparagine (Asn or N), Glutamine (Gin or Q); Group 4: Arginine (Arg or R), Lysine (Lys or K), Histidine (His or H); Group 5: Isoleucine (lie or I), Leucine (Leu or L), Methionine (Met or M), Valine (Val or V); and Group 6: Phenylalanine (Phe or F), Tyrosine (Tyr or Y), Tryptophan (Trp or W). Additionally or alternatively, amino acids can be grouped into conservative substitution groups by similar function, chemical structure, or composition (e.g., acidic, basic, aliphatic, aromatic, or sulfur-containing). For example, an aliphatic grouping may include, for purposes of substitution, Gly, Ala, Val, Leu, and He. Other conservative substitutions groups include: sulfur-containing: Met and Cysteine (Cys or C); acidic: Asp, Glu, Asn, and Gin; small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, Pro, and Gly; polar, negatively charged residues and their amides: Asp, Asn, Glu, and Gin; polar, positively charged residues: His, Arg, and Lys; large aliphatic, nonpolar residues: Met, Leu, lie, Val, and Cys; and large aromatic residues: Phe, Tyr, and Trp. Additional information can be found in Creighton (1984) Proteins, W.H. Freeman and Company.
As used herein, "protein" or "polypeptide" refers to a polymer of amino acid residues. Proteins apply to naturally occurring amino acid polymers, as well as to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, and non-naturally occurring amino acid polymers. Variants of proteins, peptides, and polypeptides of this disclosure are also contemplated. In certain embodiments, variant proteins, peptides, and polypeptides comprise or consist of an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9% identical to an amino acid sequence of a defined or reference amino acid sequence as described herein.
"Nucleic acid molecule" or "polynucleotide" or "polynucleic acid" refers to a polymeric compound including covalently linked nucleotides, which can be made up of natural subunits ( e.g ., purine or pyrimidine bases) or non-natural subunits (e.g, morpholine ring). Purine bases include adenine, guanine, hypoxanthine, and xanthine, and pyrimidine bases include uracil, thymine, and cytosine. Nucleic acid molecules include polyribonucleic acid (RNA), which includes mRNA, microRNA, siRNA, viral genomic RNA, and synthetic RNA, and polydeoxyribonucleic acid (DNA), which includes cDNA, genomic DNA, and synthetic DNA, either of which may be single or double stranded. If single-stranded, the nucleic acid molecule may be the coding strand or non-coding (anti-sense) strand. A nucleic acid molecule encoding an amino acid sequence includes all nucleotide sequences that encode the same amino acid sequence. Some versions of the nucleotide sequences may also include intron(s) to the extent that the intron(s) would be removed through co- or post-transcriptional mechanisms. In other words, different nucleotide sequences may encode the same amino acid sequence as the result of the redundancy or degeneracy of the genetic code, or by splicing.
Variants of nucleic acid molecules of this disclosure are also contemplated. Variant nucleic acid molecules are at least 70%, 75%, 80%, 85%, 90%, and are preferably 95%, 96%, 97%, 98%, 99%, or 99.9% identical a nucleic acid molecule of a defined or reference polynucleotide as described herein, or that hybridize to a polynucleotide under stringent hybridization conditions of 0.015M sodium chloride, 0.0015M sodium citrate at about 65-68°C or 0.015M sodium chloride, 0.0015M sodium citrate, and 50% formamide at about 42°C. Nucleic acid molecule variants retain the capacity to encode a binding domain thereof having a functionality described herein, such as binding a target molecule.
"Percent sequence identity" refers to a relationship between two or more sequences, as determined by comparing the sequences. Preferred methods to determine sequence identity are designed to give the best match between the sequences being compared. For example, the sequences are aligned for optimal comparison purposes ( e.g ., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment). Further, non-homologous sequences may be disregarded for comparison purposes. The percent sequence identity referenced herein is calculated over the length of the reference sequence, unless indicated otherwise. Methods to determine sequence identity and similarity can be found in publicly available computer programs. Sequence alignments and percent identity calculations may be performed using a BLAST program (e.g., BLAST 2.0, BLASTP, BLASTN, or BLASTX). The mathematical algorithm used in the BLAST programs can be found in Altschul et al., Nucleic Acids Res. 25: 3389-3402, 1997. Within the context of this disclosure, it will be understood that where sequence analysis software is used for analysis, the results of the analysis are based on the "default values" of the program referenced. "Default values" mean any set of values or parameters which originally load with the software when first initialized.
The term "isolated" means that the material is removed from its original environment (e.g, the natural environment if it is naturally occurring). For example, a naturally occurring nucleic acid or polypeptide present in a living animal is not isolated, but the same nucleic acid or polypeptide, separated from some or all of the co-existing materials in the natural system, is isolated. Such nucleic acid could be part of a vector and/or such nucleic acid or polypeptide could be part of a composition ( e.g ., a cell lysate), and still be isolated in that such vector or composition is not part of the natural environment for the nucleic acid or polypeptide.
The term "gene" means the segment of DNA or RNA involved in producing a polypeptide chain; in certain contexts, it includes regions preceding and following the coding region (e.g., 5’ untranslated region (UTR) and 3’ UTR) as well as intervening sequences (introns) between individual coding segments (exons).
A "functional variant" refers to a polypeptide or polynucleotide that is structurally similar or substantially structurally similar to a parent or reference compound of this disclosure, but differs slightly in composition (e.g., one base, atom or functional group is different, added, or removed), such that the polypeptide or encoded polypeptide is capable of performing at least one function of the parent polypeptide with at least 50% efficiency, preferably at least 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.9%, or 100% level of activity of the parent polypeptide. In other words, a functional variant of a polypeptide or encoded polypeptide of this disclosure has "similar binding," "similar affinity" or "similar activity" when the functional variant displays no more than a 50% reduction in performance in a selected assay as compared to the parent or reference polypeptide, such as an assay for measuring binding affinity (e.g., Biacore® or tetramer staining measuring an association (Ka) or a dissociation (KD) constant).
As used herein, a "functional portion" or "functional fragment" refers to a polypeptide or polynucleotide that comprises only a domain, portion or fragment of a parent or reference compound, and the polypeptide or encoded polypeptide retains at least 50% activity associated with the domain, portion or fragment of the parent or reference compound, preferably at least 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.9%, or 100% level of activity of the parent polypeptide, or provides a biological benefit (e.g., effector function). A "functional portion" or "functional fragment" of a polypeptide or encoded polypeptide of this disclosure has "similar binding" or "similar activity" when the functional portion or fragment displays no more than a 50% reduction in performance in a selected assay as compared to the parent or reference polypeptide (preferably no more than 20% or 10%, or no more than a log difference as compared to the parent or reference with regard to affinity).
As used herein, the term "engineered," "recombinant," or "non-natural" refers to an organism, microorganism, cell, nucleic acid molecule, or vector that includes at least one genetic alteration or has been modified by introduction of an exogenous or heterologous nucleic acid molecule, wherein such alterations or modifications are introduced by genetic engineering (i.e., human intervention). Genetic alterations include, for example, modifications introducing expressible nucleic acid molecules encoding functional RNA, proteins, fusion proteins or enzymes, or other nucleic acid molecule additions, deletions, substitutions, or other functional disruption of a cell’s genetic material. Additional modifications include, for example, non-coding regulatory regions in which the modifications alter expression of a polynucleotide, gene, or operon.
As used herein, "heterologous" or "non-endogenous" or "exogenous" refers to any gene, protein, compound, nucleic acid molecule, or activity that is not native to a host cell or a subject, or any gene, protein, compound, nucleic acid molecule, or activity native to a host cell or a subject that has been altered. Heterologous, non-endogenous, or exogenous includes genes, proteins, compounds, or nucleic acid molecules that have been mutated or otherwise altered such that the structure, activity, or both is different as between the native and altered genes, proteins, compounds, or nucleic acid molecules.
In certain embodiments, heterologous, non-endogenous, or exogenous genes, proteins, or nucleic acid molecules ( e.g ., receptors, ligands, etc.) may not be endogenous to a host cell or a subject, but instead nucleic acids encoding such genes, proteins, or nucleic acid molecules may have been added to a host cell by conjugation, transformation, transfection, electroporation, or the like, wherein the added nucleic acid molecule may integrate into a host cell genome or can exist as extra-chromosomal genetic material (e.g., as a plasmid or other self-replicating vector). The term "homologous" or "homolog" refers to a gene, protein, compound, nucleic acid molecule, or activity found in or derived from a host cell, species, or strain. For example, a heterologous or exogenous polynucleotide or gene encoding a polypeptide may be homologous to a native polynucleotide or gene and encode a homologous polypeptide or activity, but the polynucleotide or polypeptide may have an altered structure, sequence, expression level, or any combination thereof. A non-endogenous polynucleotide or gene, as well as the encoded polypeptide or activity, may be from the same species, a different species, or a combination thereof.
In certain embodiments, a nucleic acid molecule or portion thereof native to a host cell will be considered heterologous to the host cell if it has been altered or mutated, or a nucleic acid molecule native to a host cell may be considered heterologous if it has been altered with a heterologous expression control sequence or has been altered with an endogenous expression control sequence not normally associated with the nucleic acid molecule native to a host cell. In addition, the term "heterologous" can refer to a biological activity that is different, altered, or not endogenous to a host cell. As described herein, more than one heterologous nucleic acid molecule can be introduced into a host cell as separate nucleic acid molecules, as a plurality of individually controlled genes, as a polycistronic nucleic acid molecule, as a single nucleic acid molecule encoding a fusion protein, or any combination thereof. When
As used herein, the term "endogenous" or "native" refers to a polynucleotide, gene, protein, compound, molecule, or activity that is normally present in a host cell or a subject.
The term "expression", as used herein, refers to the process by which a polypeptide is produced based on the encoding sequence of a nucleic acid molecule, such as a gene. The process may include transcription, post-transcriptional control, post-transcriptional modification, translation, post-translational control, post- translational modification, or any combination thereof. An expressed nucleic acid molecule is typically operably linked to an expression control sequence (e.g., a promoter). The term "operably linked" refers to the association of two or more nucleic acid molecules on a single nucleic acid fragment so that the function of one is affected by the other. For example, a promoter is operably linked with a coding sequence when it is capable of affecting the expression of that coding sequence (i.e., the coding sequence is under the transcriptional control of the promoter). "Unlinked" means that the associated genetic elements are not closely associated with one another and the function of one does not affect the other.
As described herein, more than one heterologous nucleic acid molecule can be introduced into a host cell as separate nucleic acid molecules, as a plurality of individually controlled genes, as a polycistronic nucleic acid molecule, as a single nucleic acid molecule encoding a protein ( e.g ., a heavy chain of an antibody), or any combination thereof. When two or more heterologous nucleic acid molecules are introduced into a host cell, it is understood that the two or more heterologous nucleic acid molecules can be introduced as a single nucleic acid molecule (e.g., on a single vector), on separate vectors, integrated into the host chromosome at a single site or multiple sites, or any combination thereof. The number of referenced heterologous nucleic acid molecules or protein activities refers to the number of encoding nucleic acid molecules or the number of protein activities, not the number of separate nucleic acid molecules introduced into a host cell.
The term "construct" refers to any polynucleotide that contains a recombinant nucleic acid molecule (or, when the context clearly indicates, a fusion protein of the present disclosure). A (polynucleotide) construct may be present in a vector (e.g., a bacterial vector, a viral vector) or may be integrated into a genome. A "vector" is a nucleic acid molecule that is capable of transporting another nucleic acid molecule. Vectors may be, for example, plasmids, cosmids, viruses, a RNA vector or a linear or circular DNA or RNA molecule that may include chromosomal, non-chromosomal, semi -synthetic or synthetic nucleic acid molecules. Vectors of the present disclosure also include transposon systems (e.g., Sleeping Beauty, see, e.g, Geurts etal, Mol.
Ther. 5:108, 2003: Mates et al., Nat. Genet. 41:153, 2009). Exemplary vectors are those capable of autonomous replication (episomal vector), capable of delivering a polynucleotide to a cell genome (e.g., viral vector), or capable of expressing nucleic acid molecules to which they are linked (expression vectors).
As used herein, "expression vector" or "vector" refers to a DNA construct containing a nucleic acid molecule that is operably linked to a suitable control sequence capable of effecting the expression of the nucleic acid molecule in a suitable host. Such control sequences include a promoter to effect transcription, an optional operator sequence to control such transcription, a sequence encoding suitable mRNA ribosome binding sites, and sequences which control termination of transcription and translation. The vector may be a plasmid, a phage particle, a virus, or simply a potential genomic insert. Once transformed into a suitable host, the vector may replicate and function independently of the host genome, or may, in some instances, integrate into the genome itself or deliver the polynucleotide contained in the vector into the genome without the vector sequence. In the present specification, "plasmid," "expression plasmid," "virus," and "vector" are often used interchangeably.
The term "introduced" in the context of inserting a nucleic acid molecule into a cell, means "transfection", "transformation," or "transduction" and includes reference to the incorporation of a nucleic acid molecule into a eukaryotic or prokaryotic cell wherein the nucleic acid molecule may be incorporated into the genome of a cell (e.g., chromosome, plasmid, plastid, or mitochondrial DNA), converted into an autonomous replicon, or transiently expressed (e.g., transfected mRNA).
In certain embodiments, polynucleotides of the present disclosure may be operatively linked to certain elements of a vector. For example, polynucleotide sequences that are needed to effect the expression and processing of coding sequences to which they are ligated may be operatively linked. Expression control sequences may include appropriate transcription initiation, termination, promoter, and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (i.e., Kozak consensus sequences); sequences that enhance protein stability; and possibly sequences that enhance protein secretion. Expression control sequences may be operatively linked if they are contiguous with the gene of interest and expression control sequences that act in trans or at a distance to control the gene of interest.
In certain embodiments, the vector comprises a plasmid vector or a viral vector ( e.g ., a lentiviral vector or a g-retroviral vector). Viral vectors include retrovirus, adenovirus, parvovirus (e.g., adeno-associated viruses), coronavirus, negative strand RNA viruses such as ortho-myxovirus (e.g, influenza virus), rhabdovirus (e.g, rabies and vesicular stomatitis virus), paramyxovirus (e.g, measles and Sendai), positive strand RNA viruses such as picornavirus and alphavirus, and double-stranded DNA viruses including adenovirus, herpesvirus (e.g, Herpes Simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus), and poxvirus (e.g, vaccinia, fowlpox, and canarypox). Other viruses include, for example, Norwalk virus, togavirus, flavivirus, reoviruses, papovavirus, hepadnavirus, and hepatitis virus. Examples of retroviruses include avian leukosis-sarcoma, mammalian C-type, B-type viruses, D type viruses, HTLV-BLV group, lentivirus, spumavirus (Coffin, J. M., Retroviridae: The viruses and their replication, In Fundamental Virology, Third Edition, B. N. Fields et ak, Eds., Lippincott-Raven Publishers, Philadelphia, 1996).
"Retroviruses" are viruses having an RNA genome, which is reverse-transcribed into DNA using a reverse transcriptase enzyme, the reverse-transcribed DNA is then incorporated into the host cell genome. "Gammaretrovirus" refers to a genus of the retroviridae family. Examples of gammaretroviruses include mouse stem cell virus, murine leukemia virus, feline leukemia virus, feline sarcoma virus, and avian reticuloendotheliosis viruses.
"Lentiviral vectors" include HIV-based lentiviral vectors for gene delivery, which can be integrative or non-integrative, have relatively large packaging capacity, and can transduce a range of different cell types. Lentiviral vectors are usually generated following transient transfection of three (packaging, envelope, and transfer) or more plasmids into producer cells. Like HIV, lentiviral vectors enter the target cell through the interaction of viral surface glycoproteins with receptors on the cell surface. On entry, the viral RNA undergoes reverse transcription, which is mediated by the viral reverse transcriptase complex. The product of reverse transcription is a double-stranded linear viral DNA, which is the substrate for viral integration into the DNA of infected cells.
In certain embodiments, the viral vector can be a gammaretrovirus, e.g, Moloney murine leukemia virus (MLV)-derived vectors. In other embodiments, the viral vector can be a more complex retrovirus-derived vector, e.g. , a lentivirus-derived vector. HIV-l-derived vectors belong to this category. Other examples include lentivirus vectors derived from HIV-2, FIV, equine infectious anemia virus, SIV, and Maedi-Visna virus (ovine lentivirus). Methods of using retroviral and lentiviral viral vectors and packaging cells for transducing mammalian host cells with viral particles containing transgenes are known in the art and have been previous described, for example, in: U.S. Patent 8,119,772; Walchli et al, PLoS One (5:327930, 2011; Zhao et al., J. Immunol. 777:4415, 2005; Engels etal. , Hum. Gene Ther. 14: 1 155, 2003; Frecha et al.,Mol. Ther. 75:1748, 2010; and Verhoeyen et al ., Methods Mol. Biol. 506:91 ,
2009. Retroviral and lentiviral vector constructs and expression systems are also commercially available. Other viral vectors also can be used for polynucleotide delivery including DNA viral vectors, including, for example adenovirus-based vectors and adeno-associated virus (AAV)-based vectors; vectors derived from herpes simplex viruses (HSVs), including amplicon vectors, replication-defective HSV and attenuated HSV (Krisky et al., Gene Ther. 5:1517, 1998).
Other vectors that can be used with the compositions and methods of this disclosure include those derived from baculoviruses and a-viruses. (Jolly, D J. 1999. Emerging Viral Vectors pp 209-40 in Friedmann T. ed. The Development of Human Gene Therapy. New York: Cold Spring Harbor Lab), or plasmid vectors (such as sleeping beauty or other transposon vectors).
When a viral vector genome comprises a plurality of polynucleotides to be expressed in a host cell as separate transcripts, the viral vector may also comprise additional sequences between the two (or more) transcripts allowing for bicistronic or multi cistronic expression. Examples of such sequences used in viral vectors include internal ribosome entry sites (IRES), furin cleavage sites, viral 2A peptide, or any combination thereof. Plasmid vectors, including DNA-based antibody or antigen-binding fragment- encoding plasmid vectors for direct administration to a subject, are described further herein.
As used herein, the term "host" refers to a cell or microorganism targeted for genetic modification with a heterologous nucleic acid molecule to produce a polypeptide of interest ( e.g ., an antibody of the present disclosure).
A host cell may include any individual cell or cell culture which may receive a vector or the incorporation of nucleic acids or express proteins. The term also encompasses progeny of the host cell, whether genetically or phenotypically the same or different. Suitable host cells may depend on the vector and may include mammalian cells, animal cells, human cells, simian cells, insect cells, yeast cells, and bacterial cells. These cells may be induced to incorporate the vector or other material by use of a viral vector, transformation via calcium phosphate precipitation, DEAE-dextran, electroporation, microinjection, or other methods. See , for example, Sambrook etal., Molecular Cloning: A Laboratory Manual 2d ed. (Cold Spring Harbor Laboratory, 1989).
In the context of a SARS-CoV-2 infection, a "host" refers to a cell or a subject infected with the SARS-CoV-2 coronavirus.
"Antigen" or "Ag", as used herein, refers to an immunogenic molecule that provokes an immune response. This immune response may involve antibody production, activation of specific immunologically-competent cells, activation of complement, antibody dependent cytotoxicicity, or any combination thereof. An antigen (immunogenic molecule) may be, for example, a peptide, glycopeptide, polypeptide, glycopolypeptide, polynucleotide, polysaccharide, lipid, or the like. It is readily apparent that an antigen can be synthesized, produced recombinantly, or derived from a biological sample. Exemplary biological samples that can contain one or more antigens include tissue samples, stool samples, cells, biological fluids, or combinations thereof. Antigens can be produced by cells that have been modified or genetically engineered to express an antigen. Antigens can also be present in a SARS-CoV-2 coronavirus (e.g, a surface glycoprotein or portion thereof), such as present in a virion, or expressed or presented on the surface of a cell infected by SARS-CoV-2.
The term "epitope" or "antigenic epitope" includes any molecule, structure, amino acid sequence, or protein determinant that is recognized and specifically bound by a cognate binding molecule, such as an immunoglobulin, or other binding molecule, domain, or protein. Epitopic determinants generally contain chemically active surface groupings of molecules, such as amino acids or sugar side chains, and can have specific three-dimensional structural characteristics, as well as specific charge characteristics. Where an antigen is or comprises a peptide or protein, the epitope can comprise consecutive amino acids (e.g, a linear epitope), or can comprise amino acids from different parts or regions of the protein that are brought into proximity by protein folding (e.g, a discontinuous or conformational epitope), or non-contiguous amino acids that are in close proximity irrespective of protein folding.
Antibodies, Antigen-Binding Fragments, and Antibody Combinations
In one aspect, the present disclosure provides an isolated antibody, or an antigen-binding fragment thereof, that is capable of binding to a surface glycoprotein of SARS-CoV-2. In certain embodiments, the antibody or antigen-binding fragment is capable of binding to a surface glycoprotein of SARS-CoV-2 expressed on a cell surface of a host cell and/or on a SARS-CoV-2 virion.
In certain embodiments, an antibody or antigen-binding fragment of the present disclosure associates with or unites with a SARS-CoV-2 surface glycoprotein epitope or antigen comprising the epitope, while not significantly associating or uniting with any other molecules or components in a sample.
In certain embodiments, an antibody or antigen-binding fragment of the present disclosure associates with or unites (e.g, binds) to a SARS-CoV-2 surface glycoprotein epitope, and can also associate with or unite with an epitope from another coronavirus (e.g, SARS-CoV-1) present in the sample, but not significantly associating or uniting with any other molecules or components in the sample. In other words, in certain embodiments, an antibody or antigen binding fragment of the present disclosure is cross-reactive for SARS-CoV-2 and one or more additional coronavirus. Binding comprises "contacting" a S glycoprotein feature, such as an amino acid, a glycan, or the like. In this context, contacting encompasses, for example, electrostatic interactions, hydrophobic interactions, hydrophobic contacts, formation of a chemical bond ( e.g ., a hydrogen bond), formation of a water molecule, van der Waals interactions, and/or interactions due to shape complementarity (e.g., inserting or burying an antibody (or antigen-binding fragment) amino acid residue in a recess formed by the S glycoprotein; antibody amino acids encompassing a S glycoprotein amino acid residue or residues), and combinations of these.
In some contexts, binding to a S glycoprotein or trimer thereof is described with reference to herein-disclosed cryo-electron microscopy techniques and/or x-ray crystallography techniques and/or crystal structures. In some embodiments, binding interactions are resolved to a resolution of 10 angstroms or less, 5 angstroms or less, 4 angstroms or less, 3.9 angstroms or less, 3.8 angstroms or less, 3.7 angstroms or less,
3.6 angstroms or less, 3.5 angstroms or less, 3.4 angstroms or less, 3.3 angstroms or less, 3.2 angstroms or less, 3.1 angstroms or less, 3.0 angstroms or less, 2.9 angstroms or less, 2.8 angstroms or less, 2.7 angstroms or less, 2.65 angstroms or less, 2.6 angstroms or less, or 2.5 angstroms or less. In some embodiments, contacting comprises a distance between an antibody (or antigen-binding fragment) amino acid residue and a S glycoprotein amino acid residue of 3.6 angstroms or less, 3.5 angstroms or less, 3.4 angstroms or less, 3.3 angstroms or less, 3.2 angstroms or less, 3.1 angstroms or less, 3.0 angstroms or less, 2.9 angstroms or less, 2.8 angstroms or less,
2.7 angstroms or less, 2.65 angstroms or less, 2.6 angstroms or less, or 2.5 angstroms or less. Settings and techniques for performing x-ray crystallography and cryo-electron microscopy include those disclosed in the present Examples, and principles of these are known in the art.
In some contexts, binding of an antibody or antigen-binding fragment comprises recognizing (i.e., specifically recognizing, as opposed to non-specific sticking) an epitope formed by certain amino acids and/or glycan structures. An epitope that is formed by the recited amino acids and/or structures is comprised in, and can be comprised of some or all of, the recited amino acids and/or structures. For example, in an amino acid sequence comprising residues 1-10, an epitope that is formed by residues 1-10 can comprise from 1 to 10 amino acids that contact an amino acid of an antibody or antigen-binding fragment. Other amino acids forming the epitope may not contact an amino acid of an antibody or antigen-binding fragment, but may contribute to the overall structure of the epitope; e.g ., supporting the position of an epitope amino acid that does contact an amino acid of an antibody or antigen-binding fragment.
In certain embodiments, an antibody or antigen-binding fragment is capable of the recited binding when the S glycoprotein is present as a monomer and/or in a trimer. Unless expressly stated otherwise, the ability to bind to a S glycoprotein monomer is not exclusive of the ability to bind to the S glycoprotein when present in a trimer. In certain embodiments, an antibody or antigen-binding fragment is capable of binding to an epitope that comprises amino acids in two adjacent RBDs in a trimer.
In certain embodiments, an antibody or antigen-binding fragment of the present disclosure specifically binds to a SARS-CoV-2 surface glycoprotein. As used herein, "specifically binds" refers to an association or union of an antibody or antigen-binding fragment to an antigen with an affinity or Ka (i.e., an equilibrium association constant of a particular binding interaction with units of 1/M) equal to or greater than 105 M 1 (which equals the ratio of the on-rate [K0n] to the off rate [K0ff] for this association reaction), while not significantly associating or uniting with any other molecules or components in a sample. Alternatively, affinity may be defined as an equilibrium dissociation constant (Kd) of a particular binding interaction with units of M (e.g, 105 M to 10 13 M). Antibodies may be classified as "high-affinity" antibodies or as "low- affinity" antibodies. "High-affinity" antibodies refer to those antibodies having a Ka of at least 107M_1, at least 108 M 1, at least 109 M 1, at least 1010 M 1, at least 1011 M 1, at least 1012M_1, or at least 1013 M 1. "Low-affinity" antibodies refer to those antibodies having a Ka of up to 107 M 1, up to 106 M 1, up to 105 M 1. Alternatively, affinity may be defined as an equilibrium dissociation constant (Kd) of a particular binding interaction with units of M (e.g, 105 M to 10 13 M).
A variety of assays are known for identifying antibodies of the present disclosure that bind a particular target, as well as determining binding domain or binding protein affinities, such as Western blot, ELISA ( e.g ., direct, indirect, or sandwich), analytical ultracentrifugation, spectroscopy, and surface plasmon resonance (Biacore®) analysis (see, e.g., Scatchard etal., Ann. N.Y. Acad. Sci. 57:660, 1949; Wilson, Science 295: 2103, 2002; Wolff etal., Cancer Res. 53: 2560, 1993; and U.S. Patent Nos. 5,283,173, 5,468,614, or the equivalent). Assays for assessing affinity or apparent affinity or relative affinity are also known.
In certain examples, binding can be identified by recombinantly expressing a SARS-CoV-2 antigen in a host cell (e.g, by transfection) and immunostaining the (e.g, fixed, or fixed and permeabilized) host cell with antibody and assessing presence or absence of binding by flow cytometery (e.g, using a ZE5 Cell Analyzer (BioRad®) and FlowJo software (TreeStar). In some embodiments, positive binding can be defined by differential staining by antibody of SARS-CoV-2 -expressing cells versus control (e.g, mock) cells.
In some embodiments an antibody or antigen-binding fragment of the present disclosure binds to SARS-CoV-2 S protein, as measured using biolayer interferometry.
In certain embodiments, an antibody or antigen-binding fragment of the present disclosure is capable of neutralizing infection by SARS-CoV-2. As used herein, a "neutralizing antibody" is one that can neutralize, i.e., prevent, inhibit, reduce, impede, or interfere with, the ability of a pathogen to initiate and/or perpetuate an infection in a host. The terms "neutralizing antibody" and "an antibody that neutralizes" or "antibodies that neutralize" are used interchangeably herein. In any of the presently disclosed embodiments, the antibody or antigen-binding fragment is capable of preventing and/or neutralizing a SARS-CoV-2 infection in an in vitro model of infection and/or in an in vivo animal model of infection and/or in a human.
Terms understood by those in the art of antibody technology are each given the meaning acquired in the art, unless expressly defined differently herein. For example, the term "antibody" refers to an intact antibody comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, as well as any antigen-binding portion or fragment of an intact antibody that has or retains the ability to bind to the antigen target molecule recognized by the intact antibody, such as an scFv, Fab, or Fab'2 fragment. Thus, the term "antibody" herein is used in the broadest sense and includes polyclonal and monoclonal antibodies, including intact antibodies and functional (antigen-binding) antibody fragments thereof, including fragment antigen binding (Fab) fragments, F(ab')2 fragments, Fab' fragments, Fv fragments, recombinant IgG (rlgG) fragments, single chain antibody fragments, including single chain variable fragments (scFv), and single domain antibodies ( e.g ., sdAb, sdFv, nanobody) fragments. The term encompasses genetically engineered and/or otherwise modified forms of immunoglobulins, such as intrabodies, peptibodies, chimeric antibodies, fully human antibodies, humanized antibodies, and heteroconjugate antibodies, multi specific, e.g., bispecific antibodies, diabodies, triabodies, tetrabodies, tandem di-scFv, and tandem tri-scFv. Unless otherwise stated, the term "antibody" should be understood to encompass functional antibody fragments thereof. The term also encompasses intact or full-length antibodies, including antibodies of any class or sub-class, including IgG and sub-classes thereof (IgGl, IgG2, IgG3, IgG4), IgM, IgE, IgA, and IgD.
The terms "VL" or "VL" and " VH" or "VH" refer to the variable binding region from an antibody light chain and an antibody heavy chain, respectively. In certain embodiments, a VL is a kappa (K) class (also "VK" herein). In certain embodiments, a VL is a lambda (l) class. The variable binding regions comprise discrete, well-defined sub-regions known as "complementarity determining regions" (CDRs) and "framework regions" (FRs). The terms "complementarity determining region," and "CDR," are synonymous with "hypervariable region" or "HVR," and refer to sequences of amino acids within antibody variable regions, which, in general, together confer the antigen specificity and/or binding affinity of the antibody, wherein consecutive CDRs (i.e., CDR1 and CDR2, CDR2 and CDR3) are separated from one another in primary structure by a framework region. There are three CDRs in each variable region (HCDR1, HCDR2, HCDR3; LCDR1, LCDR2, LCDR3; also referred to as CDRHs and CDRLs, respectively). In certain embodiments, an antibody VH comprises four FRs and three CDRs as follows: FR1 -HCDR1 -FR2-HCDR2-FR3 -HCDR3 -FR4; and an antibody VL comprises four FRs and three CDRs as follows: FR1-LCDR1-FR2- LCDR2-FR3-LCDR3-FR4. In general, the VH and the VL together form the antigen binding site through their respective CDRs.
As used herein, a "variant" of a CDR refers to a functional variant of a CDR sequence having up to 1-3 amino acid substitutions ( e.g ., conservative or non- conservative substitutions), deletions, or combinations thereof.
Numbering of CDR and framework regions may be according to any known method or scheme, such as the Rabat, Chothia, EU, IMGT, and AHo numbering schemes (see, e.g., Rabat etal., "Sequences of Proteins of Immunological Interest, US Dept. Health and Human Services, Public Health Service National Institutes of Health, 1991, 5th ed.; Chothia and Lesk, J. Mol. Biol. 196:901-911 (1987)); Lefranc etal., Dev.
Comp. Immunol. 27:55, 2003; Honegger and Pluckthun, J. Mol. Bio. 309:651-610 (2001)). Equivalent residue positions can be annotated and for different molecules to be compared using Antigen receptor Numbering And Receptor Classification (ANARCI) software tool (2016, Bioinformatics 15:298-300). Accordingly, identification of CDRs of an exemplary variable domain (VH or VL) sequence as provided herein according to one numbering scheme is not exclusive of an antibody comprising CDRs of the same variable domain as determined using a different numbering scheme.
Exemplary antibodies of the present disclosure include those summarized in Table 1.
Table 1. Features of certain Antibodies
Figure imgf000042_0001
Figure imgf000043_0001
Herein, "S2H14" refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO.:47 and the VL amino acid sequence of SEQ ID NO.:51. Herein, "S2H13" refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO.:31 and the VL amino acid sequence of SEQ IDNO.:35. Herein, "S2X259" refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO. : 16 and the VL amino acid sequence of SEQ IDNO.:26. Herein, "S2X35" refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO.:72 and the VL amino acid sequence of SEQ IDNO.:76. Herein, "S2A4" refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO. :64 and the VL amino acid sequence of SEQ IDNO.:68. Herein, "S304" refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO.: 150 and the VL amino acid sequence of SEQ IDNO.: 154. Herein, "S309" refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO.:101 and the VL amino acid sequence of SEQ IDNO.:105. Herein, "S2E12" refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO.:123 and the VL amino acid sequence of SEQ ID NO.:138. Herein,
"S2M11" refers to an antibody that comprises the VH amino acid sequence of SEQ ID NO. : 142 and the VL amino acid sequence of SEQ IDNO. : 146. Presently disclosed antibodies and antigen-binding fragments bind in an antigenic Site as described herein. For example, Site la (containing the S2H14 epitope) largely overlaps with the ACE2 -binding site and is only accessible in the open S state (e.g. Figure 34B), whereas Site lb (containing the S2H13 epitope; Figure 34C) partially overlaps with the ACE2 footprint and is accessible in both the open and closed S states (Figure 34C). Site II is divided into Site Ila (containing the S2X35 epitope, e.g. Figure 34D), which partially overlaps with the ACE2 -binding site, Site lib (containing the S2A4 epitope, proximal to the N343 glycan, e.g. Figure 34E), which does not overlap with the ACE2 -binding site, and Site lie (containing the S304 epitope, proximal to the N343 glycan, e.g. Figure 34F). Site IV does not overlap with the ACE-2 binding site and contains the S309 proteoglycan epitope (e.g. Figure 34G).
The S2X259 epitope is formed by amino acid residues 369-386, 404-411, and 499-508 of SEQ ID NO: 3. The S2H13 epitope is formed by amino acid residues 444- 449 and 472-498 of SEQ ID NO: 3. The S2H14 epitope is formed by amino acid residues 403, 444-456, 475, and 485-505 of SEQ ID NO: 3. The S2A4 epitope is formed by amino acid residues 368-388 and 407-414 of SEQ ID NO: 3. The S304 epitope is formed by amino acid residues 369-392, 411-414, 427-430, and 515-517 of SEQ ID NO: 3. The S2E12 epitope is formed by amino acid residues 417, 453, 455, 456, 473, 475-480, 484-489, and 493 of SEQ ID NO: 3. The S2M11 epitope is formed by: (i) on a first RBD, amino acid residues 339, 342, 343, 367, 368, 371, 372, 373, 374, 436, 440, and 441, and, (ii) on a second RBD, amino acid residues 446, 447, 449, 452, 455, 456, 484, 485, 486, 487, 489, 490, 492, 493, 494, 496, and 498, wherein the amino acid numbering is according to SEQ ID NO.:3.
In certain embodiments, presently disclosed immunogenic compositions comprise a Site la polypeptide, a Site lb polypeptide, a Site Ila polypeptide, a Site lib polypeptide, a Site lie polypeptide, and/or a Site IV polypeptide; these polypeptides comprise at least a portion of a RBD or S glycoprotein, wherein the at least a portion includes the Site la, lb, Ila, lib, lie, or IV; i.e., comprises amino acid sequence and a structure such that a herein disclosed antibody is capable of binding thereto. Variants of S2H14 include those that comprise the VH amino acid sequence of any one of SEQ ID NOs:55, 57, 59, 61, and 62.
Variants of S2H13 include those that comprise the VH amino acid sequence of any one of SEQ ID NOs.:39, 41, 43, 44, and 45.
Variants of S2X259 include those that comprise the VH amino acid sequence of any one of SEQ ID NOs. : 17-22 and/or the VL amino acid sequence of any one of SEQ ID NOs.:27-29.
Variants of S2X35 include those that comprise: the VH amino acid sequence of SEQ ID NO.:83, SEQ ID NO.:85, or SEQ ID NO.:88.
The S304 epitope (in Antigenic site lie) partially overlaps with the epitopes of S315 (VH of SEQ ID NO. : 162, VL of SEQ ID NO : 163), S2A4, S2X35, S2D22 (VH of SEQ ID NO : 166, VL of SEQ ID NO.: 167), and CR3022 (heavy chain of SEQ ID NO.: 158, light chain of SEQ ID NO.: 159).
S309 is described in, for example, Pinto etal. , Nature 583, pages 290-295 (2020). Amino acid residues 333-337, 339-341, 343-346, 354, 356-361, 440, 441, and 509 of SEQ ID NO.:3 contribute to the S309 proteoglycan epitope, with amino acid residues 340, 343, 345, 346, and 356 contributing significantly to antigen-antibody binding energy. A non-limiting variant of S309 comprises the VH amino acid sequence of SEQ ID NO.:93 (comprising a N55Q mutation in CDRH2 relative to S309) and the VL amino acid sequence of SEQ ID NO.:97.
The antibodies S303 (VH of SEQ ID NO. : 164, VL of SEQ ID NO. : 165) and S2A10 (VH of SEQ ID NO.: 168, VL of SEQ ID NO.: 169) bind in the same antigenic region as S309.
Variants of S2E12 include those that comprise the VH amino acid sequence of any one of SEQ ID NOs. : 124-132 and/or the VL amino acid sequence of any one of SEQ ID NOs.:140-141.
Other antibodies that have been reported to bind to an epitope comprising two neighboring RBDs and stabilize the S glycoprotein in a closed conformation include the nanobody Nb6 and its engineered derivatives (M. Schoof etal. , An ultra-potent synthetic nanobody neutralizes SARS-CoV-2 by locking Spike into an inactive conformation. bioRxiv 2020.2008.2008.238469 [Preprint] (17 August 2020)) and the human antibody C144 (C. O. Barnes et al., Structural classification of neutralizing antibodies against the SARS-CoV-2 spike receptor-binding domain suggests vaccine and therapeutic strategies. bioRxiv 2020.2008.2030.273920 [Preprint] (30 August 2020). Nb6 and the engineered derivatives thereof, and C144, are incorporated herein by reference.
In some embodiments, an antibody, or an antigen-binding fragment thereof, is provided that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 16 and a VL amino acid sequence according to SEQ ID NO: 26 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
In some embodiments, an antibody, or an antigen-binding fragment thereof, is provided that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein: (a) binding comprises contacting one or more of amino acid residues 369-386, 404-411, and 499-508 of SEQ ID NO: 3; and/or (b) binding comprises binding an epitope formed by amino acid residues 369-386, 404-411, and 499-508 of SEQ ID NO: 3. In certain embodiments, the antibody or antigen-binding fragment does not contact one or more of amino acids 406, 409, 410, 411, 499, 500, 505, and 507 of SEQ ID NO.:3 when binding to the S glycoprotein.
In some embodiments, the antibody or antigen-binding fragment is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and one or zero RBDs of the trimer is in a closed conformation, and optionally is not capable of binding to the S glycoprotein when only one RBD of the trimer is in an open conformation and two RBDs of the trimer are in a closed conformation.
In certain embodiments, an antibody, or an antigen-binding fragment thereof, is provided which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and one or zero RBDs of the trimer is in a closed conformation, and optionally is not capable of binding to the S protein when only one RBD of the trimer is in an open conformation and two RBDs of the trimer are in a closed conformation.
In certain embodiments, an antibody, or an antigen-binding fragment thereof, is provided that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 31 and a VL amino acid sequence according to SEQ ID NO: 35 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
In some embodiments, an antibody, or an antigen-binding fragment thereof, is provided that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein: (a) binding comprises contacting one or more of amino acid residues 444-449 and 472-498 of SEQ ID NO: 3; and/or (b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 444-449 and 472-498 of SEQ ID NO: 3; and/or (c) binding comprises binding within a crevice formed by a receptor binding motif (RBM) b-hairpin in a receptor binding domain (RBD) of the S glycoprotein. In ceratin embodiments, antibody or antigen-binding fragment does not contact one or more of amino acids 448, 473-478, 487, 491, 492,
495, 496, and 497 of SEQ ID NO.:3 when binding to the SARS-CoV-2 S glycoprotein.
In certain embodiments, the antibody or antigen-binding fragment is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein one or zero receptor binding domains (RBDs) of the trimer are in an open conformation and two or three RBDs of the trimer are in a closed conformation.
In some embodiments, an antibody, or an antigen-binding fragment thereof, is provided which is capable of binding to a SARS-CoV-2 S glycoprotein protein of a S glycoprotein trimer wherein one or zero receptor binding domains (RBDs) of the trimer are in an open conformation and two or three RBDs of the trimer are in a closed conformation.
In some embodiments, an antibody, or an antigen-binding fragment thereof, is provided that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 47 and a VL amino acid sequence according to SEQ ID NO: 51 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
In some embodiments, an antibody, or an antigen-binding fragment thereof, is provided that is capable of binding to a SARS CoV-2 S glycoprotein, wherein: (a) binding comprises contacting one or more of amino acid residues 403, 444-456, 475, and 485-505 of SEQ ID NO: 3; and/or (b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 403, 444-456, 475, and 485-505 of SEQ ID NO: 3. In certain embodiments, the antibody or antigen-binding fragment does not contact one or more of amino acids 448, 450, 451, 452, 454, 486, 488, 490, 491, 492, 497, 503, and 504 of SEQ ID NO.:3 when binding to the S glycoprotein.
In some embodiments, the antibody or antigen-binding fragment is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein one, two, or three receptor binding domains (RBDs) of the trimer are in an open conformation.
In some embodiments, an antibody, or an antigen-binding fragment thereof, is provided that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 64 and a VL amino acid sequence according to SEQ ID NO: 58 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
In some embodiments, an antibody, or an antigen-binding fragment thereof, is provided that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein: (a) binding comprises contacting one or more of amino acid residues 368-388 and 407-414 of SEQ ID NO: 3; and/or (b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 368-388 and 407-414 of SEQ ID NO: 3.
In certain embodiments, the antibody or antigen-binding fragment is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and zero or one RBDs of the trimer is in a closed conformation.
In some embodiments, an antibody, or an antigen-binding fragment thereof, is provided that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 150 and a VL amino acid sequence according to SEQ ID NO: 154 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
In some embodiments, an antibody, or an antigen-binding fragment thereof, is provided that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein: (a) binding comprises contacting one or more of amino acid residues 369-392, 411-414, 427-430, and 515-517 of SEQ ID NO: 3; and/or (b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 369-392, 411-414, 427-430, and 515-517 of SEQ ID NO: 3. In certain embodiments, the antibody or antigen-binding fragment is capable of binding to a SARS-CoV-2 S protein of a S protein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and zero or one RBDs of the trimer is in a closed conformation.
In ceratin embodiments, binding of the antibody or antigen-binding fragment to the S glycoprotein promotes or leads to release of the SI subunit from the S glycoprotein.
In some embodiments, an antibody, or an antigen-binding fragment thereof, is provided that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 123 and a VL amino acid sequence according to SEQ ID NO: 138 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
In some embodiments, an antibody, or an antigen-binding fragment thereof, is provided that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein: (a) binding comprises contacting one or more of amino acid residues 417, 453, 455, 456, 473, 475-480, 484-489, and 493 of SEQ ID NO: 3; and/or (b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 417, 453, 455, 456, 473, 475-480, 484-489, and 493of SEQ ID NO.: 3.
In certain embodiments, the antibody or antigen-binding fragment capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein one, two, or three receptor binding domains (RBDs) of the trimer are in an open conformation and zero, one, or two RBDs of the trimer are in a closed conformation.
In some embodiments, an antibody, or an antigen-binding fragment thereof, is provided that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 142 and a VL amino acid sequence according to SEQ ID NO: 146 for binding to a SARS-CoV-2 S glycoprotein trimer.
In some embodiments, an antibody, or an antigen-binding fragment thereof, is provided that is capable of binding to a SARS CoV-2 S glycoprotein trimer, wherein:
(a) binding comprises contacting one or more of amino acid residues on each of two receptor binding domains (RBDs), wherein binding comprises contacting, on a first RBD, one or more of amino acid residues 339, 342, 343, 367, 368, 371, 372, 373, 374, 436, 440, and 441, and, on a second RBD, one or more of amino acid residues 446, 447, 449, 452, 455, 456, 484, 485, 486, 487, 489, 490, 492, 493, 494, 496, and 498, wherein the amino acid numbering is according to SEQ ID NO.:3; and/or (b) the antibody or antigen-binding fragment recognizes an epitope formed by the following: (b)(i) on a first RBD, amino acid residues 339, 342, 343, 367, 368, 371, 372, 373, 374, 436, 440, and 441, and, (b)(ii) on a second RBD, amino acid residues 446, 447, 449, 452, 455, 456, 484, 485, 486, 487, 489, 490, 492, 493, 494, 496, and 498, wherein the amino acid numbering is according to SEQ ID NO.:3.
In certain embodiments, the antibody or antigen-binding fragment of is capable of binding to the S glycoprotein trimer wherein three receptor binding domains (RBDs) of the trimer are in a closed conformation.
In certain embodiments, binding of the antibody or antigen-binding fragment to the S glycoprotein trimer inhibits or prevents an RBD of the trimer from assuming an open conformation.
In certain embodiments, binding of the antibody or antigen-binding fragment to the S glycoprotein or S glycoprotein trimer, respectively, blocks an interaction between the S glycoprotein and a human ACE2. In certain embodiments, binding of the antibody or antigen-binding fragment to the S glycoprotein or S glycoprotein trimer, respectively, does not block an interaction between the S glycoprotein and a human ACE2.
In certain embodiments, the antibody or antigen-binding fragment is capable of neutralizing an infection by a SARS-CoV-2.
The term "CL" refers to an "immunoglobulin light chain constant region" or a "light chain constant region," i.e., a constant region from an antibody light chain. The term "CH" refers to an "immunoglobulin heavy chain constant region" or a "heavy chain constant region," which is further divisible, depending on the antibody isotype into CHI, CH2, and CH3 (IgA, IgD, IgG), or CHI, CH2, CH3, and CH4 domains (IgE, IgM). The Fc region of an antibody heavy chain is described further herein. In any of the presently disclosed embodiments, an antibody or antigen-binding fragment of the present disclosure comprises any one or more of CL, a CHI, a CH2, and a CH3. In certain embodiments, a CL comprises an amino acid sequence having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 975, 98%, 99%, or 100% identity to the amino acid sequence of SEQ ID NO : 8 or SEQ ID NO.: 9. In certain embodiments, a CH1-CH2-CH3 comprises an amino acid sequence having 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, 99%, or 100% identity to the amino acid sequence of SEQ ID NO.:6 or SEQ ID NO.:6 or 7.
A "Fab" (fragment antigen binding) is the part of an antibody that binds to antigens and includes the variable region and CHI of the heavy chain linked to the light chain via an inter-chain disulfide bond. Each Fab fragment is monovalent with respect to antigen binding, i.e., it has a single antigen-binding site. Pepsin treatment of an antibody yields a single large F(ab')2 fragment that roughly corresponds to two disulfide linked Fab fragments having divalent antigen-binding activity and is still capable of cross-linking antigen. Both the Fab and F(ab’)2 are examples of "antigen binding fragments." Fab' fragments differ from Fab fragments by having additional few residues at the carboxy terminus of the CHI domain including one or more cysteines from the antibody hinge region. Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group. F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments that have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
Fab fragments may be joined, e.g ., by a peptide linker, to form a single chain Fab, also referred to herein as "scFab." In these embodiments, an inter-chain disulfide bond that is present in a native Fab may not be present, and the linker serves in full or in part to link or connect the Fab fragments in a single polypeptide chain. A heavy chain- derived Fab fragment (e.g., comprising, consisting of, or consisting essentially of VH + CHI, or "Fd") and a light chain-derived Fab fragment (e.g., comprising, consisting of, or consisting essentially of VL + CL) may be linked in any arrangement to form a scFab. For example, a scFab may be arranged, in N-terminal to C-terminal direction, according to (heavy chain Fab fragment - linker - light chain Fab fragment) or (light chain Fab fragment - linker - heavy chain Fab fragment). Peptide linkers and exemplary linker sequences for use in scFabs are discussed in further detail herein.
"Fv" is a small antibody fragment that contains a complete antigen-recognition and antigen-binding site. This fragment generally consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although typically at a lower affinity than the entire binding site.
"Single-chain Fv" also abbreviated as "sFv" or "scFv", are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain. In some embodiments, the scFv polypeptide comprises a polypeptide linker disposed between and linking the VH and VL domains that enables the scFv to retain or form the desired structure for antigen binding. Such a peptide linker can be incorporated into a fusion polypeptide using standard techniques well known in the art. For a review of scFv, see Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994); Borrebaeck 1995, infra. In certain embodiments, the antibody or antigen-binding fragment comprises a scFv comprising a VH domain, a VL domain, and a peptide linker linking the VH domain to the VL domain. In particular embodiments, a scFv comprises a VH domain linked to a VL domain by a peptide linker, which can be in a VH-linker- VL orientation or in a VL-linker-VH orientation. Any scFv of the present disclosure may be engineered so that the C-terminal end of the VL domain is linked by a short peptide sequence to the N-terminal end of the VH domain, or vice versa (i.e., (N)VL(C)-linker-(N)VH(C) or (N)VH(C)-linker-(N)VL(C). Alternatively, in some embodiments, a linker may be linked to an N-terminal portion or end of the VH domain, the VL domain, or both.
Peptide linker sequences may be chosen, for example, based on: (1) their ability to adopt a flexible extended conformation; (2) their inability or lack of ability to adopt a secondary structure that could interact with functional epitopes on the first and second polypeptides and/or on a target molecule; and/or (3) the lack or relative lack of hydrophobic or charged residues that might react with the polypeptides and/or target molecule. Other considerations regarding linker design ( e.g ., length) can include the conformation or range of conformations in which the VH and VL can form a functional antigen-binding site. In certain embodiments, peptide linker sequences contain, for example, Gly, Asn and Ser residues. Other near neutral amino acids, such as Thr and Ala, may also be included in a linker sequence. Other amino acid sequences which may be usefully employed as linker include those disclosed in Maratea et ah, Gene 40:3946 (1985); Murphy et ah, Proc. Natl. Acad. Sci. USA 83:8258 8262 (1986); U.S. Pat. No. 4,935,233, and U.S. Pat. No. 4,751,180. Other illustrative and non-limiting examples of linkers may include, for example, Glu-Gly-Lys-Ser-Ser-Gly-Ser-Gly-Ser-Glu-Ser-Lys- Val-Asp (Chaudhary et ah, Proc. Natl. Acad. Sci. USA 87:1066-1070 (1990)) and Lys-Glu-Ser-Gly-Ser-Val-Ser-Ser-Glu-Gln-Leu-Ala-Gln-Phe-Arg-Ser-Leu-Asp (Bird et ah, Science 242:423-426 (1988)) and the pentamer Gly-Gly-Gly-Gly-Ser when present in a single iteration or repeated 1 to 5 or more times, or more. Any suitable linker may be used, and in general can be about 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 15 23, 24, 25, 26, 27, 28, 29, 30, 40, 50, 60, 70, 80, 90, 100 amino acids in length, or less than about 200 amino acids in length, and will preferably comprise a flexible structure (can provide flexibility and room for conformational movement between two regions, domains, motifs, fragments, or modules connected by the linker), and will preferably be biologically inert and/or have a low risk of immunogenicity in a human. scFv can be constructed using any combination of the VH and VL sequences or any combination of the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 sequences disclosed herein.
In some embodiments, linker sequences are not required; for example, when the first and second polypeptides have non-essential N-terminal amino acid regions that can be used to separate the functional domains and prevent steric interference.
During antibody development, DNA in the germline variable (V), joining (J), and diversity (D) gene loci may be rearranged and insertions and/or deletions of nucleotides in the coding sequence may occur. Somatic mutations may be encoded by the resultant sequence, and can be identified by reference to a corresponding known germline sequence. In some contexts, somatic mutations that are not critical to a desired property of the antibody ( e.g ., binding to a SARS-CoV-2 antigen), or that confer an undesirable property upon the antibody (e.g., an increased risk of immunogenicity in a subject administered the antibody), or both, may be replaced by the corresponding germline-encoded amino acid, or by a different amino acid, so that a desirable property of the antibody is improved or maintained and the undesirable property of the antibody is reduced or abrogated. Thus, in some embodiments, the antibody or antigen-binding fragment of the present disclosure comprises at least one more germline-encoded amino acid in a variable region as compared to a parent antibody or antigen-binding fragment, provided that the parent antibody or antigen binding fragment comprises one or more somatic mutations. Variable region and CDR amino acid sequences of exemplary anti-SARS-CoV-2 antibodies of the present disclosure are provided in Table 1 herein.
In certain embodiments, an antibody or antigen-binding fragment comprises an amino acid modification (e.g, a substitution mutation) to remove an undesired risk of oxidation, deamidation, and/or isomerization.
Also provided herein are variant antibodies that comprise one or more amino acid alterations in a variable region (e.g, VH, VL, framework or CDR) as compared to a presently disclosed ("parent") antibody, wherein the variant antibody is capable of binding to a SARS-CoV-2 antigen.
In certain embodiments, an antibody or antigen-binding fragment of the present disclosure is monospecific ( e.g ., binds to a single epitope) or is multispecific (e.g, binds to multiple epitopes and/or target molecules). Antibodies and antigen binding fragments may be constructed in various formats. Exemplary antibody formats disclosed in Spiess et al., Mol. Immunol. 67(2):95 (2015), and in Brinkmann and Kontermann, mAbs 9(2): 182-212 (2017), which formats and methods of making the same are incorporated herein by reference and include, for example, Bispecific T cell Engagers (BiTEs), DARTs, Knobs-Into-Holes (KIH) assemblies, scFv-CH3-KIH assemblies, KIH Common Light-Chain antibodies, TandAbs, Triple Bodies, TriBi Minibodies, Fab-scFv, scFv-CH-CL-scFv, F(ab')2-scFv2, tetravalent HCabs, Intrabodies, CrossMabs, Dual Action Fabs (DAFs) (two-in-one or four-in-one), DutaMabs, DT-IgG, Charge Pairs, Fab-arm Exchange, SEEDbodies, Triomabs, LUZ-Y assemblies, Fcabs, kl-bodies, orthogonal Fabs, DVD-Igs (e.g, US Patent No.
8,258,268, which formats are incorporated herein by reference in their entirety), IgG(H)-scFv, scFv-(H)IgG, IgG(L)-scFv, scFv-(L)IgG, IgG(L,H)-Fv, IgG(H)-V, V(H)- IgG, IgG(L)-V, V(L)-IgG, KIH IgG-scFab, 2scFv-IgG, IgG-2scFv, scFv4-Ig, Zybody, and DVI-IgG (four-in-one), as well as so-called FIT-Ig (e.g, PCT Publication No. WO 2015/103072, which formats are incorporated herein by reference in their entirety), so- called WuxiBody formats (e.g, PCT Publication No. WO 2019/057122, which formats are incorporated herein by reference in their entirety), and so-called In-Elbow-Insert Ig formats (IEI-Ig; e.g, PCT Publication Nos. WO 2019/024979 and WO 2019/025391, which formats are incorporated herein by reference in their entirety).
In certain embodiments, the antibody or antigen-binding fragment comprises two or more of VH domains, two or more VL domains, or both (i.e., two or more VH domains and two or more VL domains). In particular embodiments, an antigen-binding fragment comprises the format (N-terminal to C-terminal direction) VH-linker-VL- linker-VH-linker-VL, wherein the two VH sequences can be the same or different and the two VL sequences can be the same or different. Such linked scFvs can include any combination of VH and VL domains arranged to bind to a given target, and in formats comprising two or more VH and/or two or more VL, one, two, or more different eptiopes or antigens may be bound. It will be appreciated that formats incorporating multiple antigen-binding domains may include VH and/or VL sequences in any combination or orientation. For example, the antigen-binding fragment can comprise the format VL-linker-VH-linker-VL-linker-VH, VH-linker-VL-linker-VL-linker-VH, or VL-linker- VH-linker- VH-linker- VL .
Monospecific or multispecific antibodies or antigen-binding fragments of the present disclosure constructed comprise any combination of the VH and VL sequences and/or any combination of the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 sequences disclosed herein. A bispecific or multispecific antibody or antigen binding fragment may, in some embodiments, comprise one, two, or more antigen binding domains ( e.g ., a VH and a VL) of the instant disclosure. Two or more binding domains may be present that bind to the same or a different SARS-CoV-2 epitope, and a bispecific or multispecific antibody or antigen-binding fragment as provided herein can, in some embodiments, comprise a further SARS-CoV-2 binding domain, and/or can comprise a binding domain that binds to a different antigen or pathogen altogether.
In any of the presently disclosed embodiments, the antibody or antigen-binding fragment can be multispecific; e.g., bispecific, trispecific, or the like.
In certain embodiments, the antibody or antigen-binding fragment comprises a Fc polypeptide, or a fragment thereof. The "Fc" fragment or Fc polypeptide comprises the carboxy -terminal portions (i.e., the CH2 and CH3 domains of IgG) of both antibody H chains held together by disulfides. Antibody “effector functions” refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype. Examples of antibody effector functions include: Clq binding and complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g., B cell receptor); and B cell activation. As discussed herein, modifications (e.g, amino acid substitutions) may be made to an Fc domain in order to modify (e.g, improve, reduce, or ablate) one or more functionality of an Fc-containing polypeptide ( e.g ., an antibody of the present disclosure). Such functions include, for example, Fc receptor (FcR) binding, antibody half-life modulation (e.g., by binding to FcRn), ADCC function, protein A binding, protein G binding, and complement binding. Amino acid modifications that modify (e.g., improve, reduce, or ablate) Fc functionalities include, for example, the T250Q/M428L, M252Y/S254T/T256E (also referred-to as "YTE"), H433K/N434F, M428L/N434S (also referred-to as "LS" or "MLNS"), E233P/L234V/L235A/G236 + A327G/A330S/P331S, E333A, S239D/A330L/I332E, P257EQ311, K326W/E333S, S239D/I332E/G236A, N297Q, K322A, S228P, L235E + E318A/K320A/K322A, L234A/L235A (also referred to herein as "LALA"), and L234A/L235A/P329G mutations, which mutations are summarized and annotated in "Engineered Fc Regions", published by InvivoGen (2011) and available online at invivogen.com/PDF/review/review-Engineered-Fc-Regions- invivogen.pdf?utm_source=review&utm_medium=pdf&utm_ campaign=review&utm_content=Engineered-Fc-Regions, and are incorporated herein by reference. Unless specifically stated otherwise, numbering of Fc residues is according to the EU numbering system as set forth in Rabat.
For example, to activate the complement cascade, the Clq protein complex can bind to at least two molecules of IgGl or one molecule of IgM when the immunoglobulin molecule(s) is attached to the antigenic target (Ward, E. S., and Ghetie, V., Ther. Immunol. 2 (1995) 77-94). Burton, D. R., described (Mol. Immunol. 22 (1985) 161-206) that the heavy chain region comprising amino acid residues 318 to 337 is involved in complement fixation. Duncan, A. R., and Winter, G. ( Nature 332 (1988) 738-740), using site directed mutagenesis, reported that Glu318, Lys320 and Lys322 form the binding site to Clq. The role of Glu318, Lys320 and Lys 322 residues in the binding of Clq was confirmed by the ability of a short synthetic peptide containing these residues to inhibit complement mediated lysis.
For example, FcR binding can be mediated by the interaction of the Fc moiety (of an antibody) with Fc receptors (FcRs), which are specialized cell surface receptors on cells including hematopoietic cells. Fc receptors belong to the immunoglobulin superfamily, and shown to mediate both the removal of antibody-coated pathogens by phagocytosis of immune complexes, and the lysis of erythrocytes and various other cellular targets (e.g. tumor cells) coated with the corresponding antibody, via antibody dependent cell mediated cytotoxicity (ADCC; Van de Winkel, J. G., and Anderson, C. L., J. Leukoc. Biol. 49 (1991) 511-524). FcRs are defined by their specificity for immunoglobulin classes; Fc receptors for IgG antibodies are referred to as FcyR, for IgE as FceR, for IgA as FcaR and so on and neonatal Fc receptors are referred to as FcRn. Fc receptor binding is described for example in Ravetch, J. V., and Kinet, J. P., Annu. Rev. Immunol. 9 (1991) 457-492; Capel, P. J., et al., Immunomethods 4 (1994) 25-34; de Haas, M., et al., J Lab. Clin. Med. 126 (1995) 330-341; and Gessner, J. E., et al., Ann. Hematol. 76 (1998) 231-248.
Cross-linking of receptors by the Fc domain of native IgG antibodies (FcyR) triggers a wide variety of effector functions including phagocytosis, antibody-dependent cellular cytotoxicity, and release of inflammatory mediators, as well as immune complex clearance and regulation of antibody production. Fc moieties providing cross- linking of receptors (e.g., FcyR) are contemplated herein. In humans, three classes of FcyR have been characterized to-date, which are: (i) FcyRI (CD64), which binds monomeric IgG with high affinity and is expressed on macrophages, monocytes, neutrophils and eosinophils; (ii) FcyRII (CD32), which binds complexed IgG with medium to low affinity, is widely expressed, in particular on leukocytes, is believed to be a central player in antibody-mediated immunity, and which can be divided into FcyRIIA, FcyRIIB and FcyRIIC, which perform different functions in the immune system, but bind with similar low affinity to the IgG-Fc, and the ectodomains of these receptors are highly homologuous; and (iii) FcyRIII (CD 16), which binds IgG with medium to low affinity and has been found in two forms: FcyRIIIA, which has been found on NK cells, macrophages, eosinophils, and some monocytes and T cells, and is believed to mediate ADCC; and FcyRIIIB, which is highly expressed on neutrophils.
FcyRIIA is found on many cells involved in killing (e.g. macrophages, monocytes, neutrophils) and seems able to activate the killing process. FcyRIIB seems to play a role in inhibitory processes and is found on B-cells, macrophages and on mast cells and eosinophils. Importantly, it has been shown that 75% of all FcyRIIB is found in the liver (Ganesan, L. P. et al., 2012: “FcyRIIb on liver sinusoidal endothelium clears small immune complexes,” Journal of Immunology 189: 4981-4988). FcyRIIB is abundantly expressed on Liver Sinusoidal Endothelium, called LSEC, and in Kupffer cells in the liver and LSEC are the major site of small immune complexes clearance (Ganesan, L. P. et al., 2012: FcyRIIb on liver sinusoidal endothelium clears small immune complexes. Journal of Immunology 189: 4981-4988).
In some embodiments, the antibodies disclosed herein and the antigen-binding fragments thereof comprise an Fc polypeptide or fragment thereof for binding to FcyRIIb, in particular an Fc region, such as, for example IgG-type antibodies.
Moreover, it is possible to engineer the Fc moiety to enhance FcyRIIB binding by introducing the mutations S267E and L328F as described by Chu, S. Y. et al., 2008: Inhibition of B cell receptor-mediated activation of primary human B cells by coengagement of CD19 and FcgammaRIIb with Fc-engineered antibodies. Molecular Immunology 45, 3926-3933. Thereby, the clearance of immune complexes can be enhanced (Chu, S., et al., 2014: Accelerated Clearance of IgE In Chimpanzees Is Mediated By Xmab7195, An Fc-Engineered Antibody With Enhanced Affinity For Inhibitory Receptor FcyRIIb. Am J Respir Crit, American Thoracic Society International Conference Abstracts). In some embodiments, the antibodies of the present disclosure, or the antigen binding fragments thereof, comprise an engineered Fc moiety with the mutations S267E and L328F, in particular as described by Chu, S. Y. et al., 2008: Inhibition of B cell receptor-mediated activation of primary human B cells by coengagement of CD19 and FcgammaRIIb with Fc-engineered antibodies. Molecular Immunology 45, 3926-3933.
On B cells, FcyRIIB may function to suppress further immunoglobulin production and isotype switching to, for example, the IgE class. On macrophages, FcyRIIB is thought to inhibit phagocytosis as mediated through FcyRIIA. On eosinophils and mast cells, the B form may help to suppress activation of these cells through IgE binding to its separate receptor. Regarding FcyRI binding, modification in native IgG of at least one of E233- G236, P238, D265, N297, A327 and P329 reduces binding to FcyRI. IgG2 residues at positions 233-236, substituted into corresponding positions IgGl and IgG4, reduces binding of IgGl and IgG4 to FcyRI by 103-fold and eliminated the human monocyte response to antibody-sensitized red blood cells (Armour, K. L., et al. Eur. ./. Immunol. 29 (1999) 2613-2624).
Regarding FcyRII binding, reduced binding for FcyRIIA is found, e.g., for IgG mutation of at least one of E233-G236, P238, D265, N297, A327, P329, D270, Q295, A327, R292 and K414.
Two allelic forms of human FcyRIIA are the "H131" variant, which binds to IgGl Fc with high affinity, and the "R131" variant, which binds to IgGl Fc with low affinity. See, e.g., Bruhns et al, Blood 773:3716-3725 (2009).
Regarding FcyRIII binding, reduced binding to FcyRIIIA is found, e.g., for mutation of at least one of E233-G236, P238, D265, N297, A327, P329, D270, Q295, A327, S239, E269, E293, Y296, V303, A327, K338 and D376. Mapping of the binding sites on human IgGl for Fc receptors, the above-mentioned mutation sites, and methods for measuring binding to FcyRI and FcyRIIA, are described in Shields, R. L., et al., J. Biol. Chem. 276 (2001) 6591-6604.
Two allelic forms of human FcyRIIIA are the "FI 58" variant, which binds to IgGl Fc with low affinity, and the "VI 58" variant, which binds to IgGl Fc with high affinity. See, e.g., Bruhns et al, Blood 773:3716-3725 (2009).
Regarding binding to FcyRII, two regions of native IgG Fc appear to be involved in interactions between FcyRIIs and IgGs, namely (i) the lower hinge site of IgG Fc, in particular amino acid residues L, L, G, G (234 - 237, EU numbering), and (ii) the adjacent region of the CH2 domain of IgG Fc, in particular a loop and strands in the upper CH2 domain adjacent to the lower hinge region, e.g. in a region of P331 (Wines, B.D., et al., J. Immunol. 2000; 164: 5313 - 5318). Moreover, FcyRI appears to bind to the same site on IgG Fc, whereas FcRn and Protein A bind to a different site on IgG Fc, which appears to be at the CH2-CH3 interface (Wines, B.D., et al., J. Immunol. 2000; 164: 5313 - 5318). Also contemplated are mutations that increase binding affinity of an Fc polypeptide or fragment thereof of the present disclosure to a (i.e., one or more) Fey receptor ( e.g ., as compared to a reference Fc polypeptide or fragment thereof or containing the same that does not comprise the mutation(s)). See, e.g., Delillo and Ravetch, Cell 161(5): 1035-1045 (2015) and Ahmed et al., J. Struc. Biol. 194(1):78 (2016), the Fc mutations and techniques of which are incorporated herein by reference.
In any of the herein disclosed embodiments, an antibody or antigen-binding fragment can comprise a Fc polypeptide or fragment thereof comprising a mutation selected from G236A; S239D; A330L; and I332E; or a combination comprising any two or more of the same; e.g., S239D/I332E; S239D/A330L/I332E;
G236 A/S239D/I332E; G236A/A330L/I332E (also referred to herein as "GAALIE"); or G236A/S239D/A330L/I332E. In some embodiments, the Fc polypeptide or fragment thereof does not comprise S239D. In some embodiments, the Fc polypeptide or fragment thereof comprises a native amino acid (e.g, serine) at position 239.
In certain embodiments, the Fc polypeptide or fragment thereof may comprise or consist of at least a portion of an Fc polypeptide or fragment thereof that is involved in binding to FcRn binding. In certain embodiments, the Fc polypeptide or fragment thereof comprises one or more amino acid modifications that improve binding affinity for (e.g, enhance binding to) FcRn (e.g, at a pH of about 6.0) and, in some embodiments, thereby extend in vivo half-life of a molecule comprising the Fc polypeptide or fragment thereof (e.g., as compared to a reference Fc polypeptide or fragment thereof or antibody that is otherwise the same but does not comprise the modification(s)). In certain embodiments, the Fc polypeptide or fragment thereof comprises or is derived from a IgG Fc and a half-life-extending mutation comprises any one or more of: M428L; N434S; N434H; N434A; N434S; M252Y; S254T; T256E; T250Q; P257I Q31 II; D376V; T307A; E380A (EU numbering). In certain embodiments, a half-life-extending mutation comprises M428L/N434S (also referred to herein as "MLNS"). In certain embodiments, a half-life-extending mutation comprises M252Y/S254T/T256E. In certain embodiments, a half-life-extending mutation comprises T250Q/M428L. In certain embodiments, a half-life-extending mutation comprises P257I/Q311I. In certain embodiments, a half-life-extending mutation comprises P257I/N434H. In certain embodiments, a half-life-extending mutation comprises D376V/N434H. In certain embodiments, a half-life-extending mutation comprises T307A/E380A/N434A.
In some embodiments, an antibody or antigen-binding fragment includes a Fc moiety that comprises the substitution mtuations M428L/N434S. In some embodiments, an antibody or antigen-binding fragment includes a Fc polypeptide or fragment thereof that comprises the substitution mtuations G236A/A330L/I332E. In certain embodiments, an antibody or antigen-binding fragment includes a (e.g., IgG) Fc moiety that comprises a G236A mutation, an A330L mutation, and a I332E mutation (GAALIE), and does not comprise a S239D mutation (e.g., comprises a native S at position 239). In particular embodiments, an antibody or antigen-binding fragment includes an Fc polypeptide or fragment thereof that comprises the substitution mutations: M428L/N434S and G236A/A330L/I332E, and optionally does not comprise S239D. In certain embodiments, an antibody or antigen-binding fragment includes a Fc polypeptide or fragment thereof that comprises the substitution mutations: M428L/N434S and G236A/S239D/A330L/I332E.
In certain embodiments, the antibody or antigen-binding fragment comprises a mutation that alters glycosylation, wherein the mutation that alters glycosylation comprises N297A, N297Q, or N297G, and/or the antibody or antigen-binding fragment is partially or fully aglycosylated and/or is partially or fully afucosylated. Host cell lines and methods of making partially or fully aglycosylated or partially or fully afucosylated antibodies and antigen-binding fragments are known (see, e.g., PCT Publication No. WO 2016/181357; Suzuki et al. Clin. Cancer Res. 73(6):1875-82 (2007); Huang et al. MAbs 6:1-12 (2018)).
In certain embodiments, the antibody or antigen-binding fragment is capable of eliciting continued protection in vivo in a subject even once no detectable levels of the antibody or antigen-binding fragment can be found in the subject (i.e., when the antibody or antigen-binding fragment has been cleared from the subject following administration). Such protection is referred to herein as a vaccinal effect. Without wishing to be bound by theory, it is believed that dendritic cells can internalize complexes of antibody and antigen and thereafter induce or contribute to an endogenous immune response against antigen. In certain embodiments, an antibody or antigen binding fragment comprises one or more modifications, such as, for example, mutations in the Fc comprising G236A, A330L, and I332E, that are capable of activating dendritic cells that may induce, e.g ., T cell immunity to the antigen.
In any of the presently disclosed embodiments, the antibody or antigen-binding fragment comprises a Fc polypeptide or a fragment thereof, including a CH2 (or a fragment thereof, a CH3 (or a fragment thereof), or a CH2 and a CH3, wherein the CH2, the CH3, or both can be of any isotype and may contain amino acid substitutions or other modifications as compared to a corresponding wild-type CH2 or CH3, respectively. In certain embodiments, a Fc polypeptide of the present disclosure comprises two CH2-CH3 polypeptides that associate to form a dimer.
In any of the presently disclosed embodiments, the antibody or antigen-binding fragment can be monoclonal. The term "monoclonal antibody" (mAh) as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present, in some cases in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations that include different antibodies directed against different epitopes, each monoclonal antibody is directed against a single epitope of the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies. The term "monoclonal" is not to be construed as requiring production of the antibody by any particular method. For example, monoclonal antibodies useful in the present invention may be prepared by the hybridoma methodology first described by Kohler et al., Nature 256:495 (1975), or may be made using recombinant DNA methods in bacterial, eukaryotic animal, or plant cells (see, e.g, U.S. Pat. No. 4,816,567). Monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in Clackson et al., Nature, 352: 624-628 (1991) and Marks et al, J Mol. Biol., 222:581-597 (1991), for example. Monoclonal antibodies may also be obtained using methods disclosed in PCT Publication No. WO 2004/076677A2.
Antibodies and antigen-binding fragments of the present disclosure include "chimeric antibodies" in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (see, U.S. Pat. Nos. 4,816,567; 5,530,101 and 7,498,415; and Morrison etal., Proc.
Natl. Acad. Sci. USA, 57:6851-6855 (1984)). For example, chimeric antibodies may comprise human and non-human residues. Furthermore, chimeric antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. For further details, see Jones et al, Nature 321:522-525 (1986); Riechmann et al, Nature 332:323- 329 (1988); and Presta, Curr. Op. Struct. Biol. 2: 593-596 (1992). Chimeric antibodies also include primatized and humanized antibodies.
A "humanized antibody" is generally considered to be a human antibody that has one or more amino acid residues introduced into it from a source that is non-human. These non-human amino acid residues are typically taken from a variable domain. Humanization may be performed following the method of Winter and co-workers (Jones et al, Nature, 321:522-525 (1986); Reichmann et al, Nature, 332:323-327 (1988); Verhoeyen etal, Science, 239:1534-1536 (1988)), by substituting non-human variable sequences for the corresponding sequences of a human antibody. Accordingly, such "humanized" antibodies are chimeric antibodies (U.S. Pat. Nos. 4,816,567; 5,530,101 and 7,498,415) wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In some instances, a “humanized” antibody is one which is produced by a non-human cell or animal and comprises human sequences, e.g., He domains. A "human antibody" is an antibody containing only sequences that are present in an antibody that is produced by a human. However, as used herein, human antibodies may comprise residues or modifications not found in a naturally occurring human antibody ( e.g ., an antibody that is isolated from a human), including those modifications and variant sequences described herein. These are typically made to further refine or enhance antibody performance. In some instances, human antibodies are produced by transgenic animals. For example, see U.S. Pat. Nos. 5,770,429; 6,596,541 and 7,049,426.
In certain embodiments, an antibody or antigen-binding fragment of the present disclosure is chimeric, humanized, or human.
Presently disclosed antibodies and antigen-binding fragments can be obtained by, for example, introducing into a host (e.g., a mouse, a rabbit, a camelid, or a human) a SARS-CoV-2 spike protein or an immunogenic polypeptide as provided herein, and, in accordance with known methods, identifying from the host antibodies that bind to a presently disclosed epitope or epitope portion. Antigen-binding fragments can be produced from an antibody using known means. Presently disclosed antibodies can also be obtained by screening B cells, plasma cells, or sera from a subject that is or has been infected with a SARS-CoV-2 and identifying antibodies that bind to a presently disclosed epitope or epitope portion. Techniques for determining epitope-binding can include, for example, X-ray crystallography, alanine scanning mutagenesis, and cryo- electron microscopy.
Also provided are antibody compositions and combinations that comprise any two or more (i.e., any two, any three, any four, any five, any six, or the like) antibodies or antigen-binding fragments of the present disclosure.
Immunogenic Compositions
Also provided herein are immunogenic compositions that comprise or encode a SARS-CoV-2 polypeptide (e.g, RBD, S glycoprotein, nucleoprotein, or fragment thereof) or polypeptide multimer (e.g, a S polypeptide trimer) that is capable of being bound by (e.g, comprises, retains, or substantially retains an epitope or antigenic region) a presently disclosed antibody or antigen-binding fragment and are capable of inducing a host immune response against the polypeptide or multimer that may involve, for example, production of antibodies, activation of specific immunologically competent cells, production of inflammatory cytokines, activation of complement, antibody dependent cytotoxicity, or any combination thereof. An immunogenic composition can include a polypeptide comprising an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a corresponding S polypeptide, RBD, or portion thereof that comprises the epitope or antigenic region, provided that the subject epitope or antigen region is completely retained or is at least substantially retained as compared to the reference S polypeptide or RBD sequence and structure. For example, in some embodiments, an immunogenic composition comprises an S polypeptide amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO.:3, or to a portion of SEQ ID NO.:3 that comprises the subject epitope or antigenic site. In some embodiments, an immunogenic composition comprises a RBD amino acid sequence that is at least least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO.:4, or to a portion of SEQ ID NO.:4 that comprises the subject epitope or antigenic site. In some embodiments, an immunogenic composition comprises a RBM amino acid sequence that is at least least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO.: 5, or to a portion of SEQ ID NO.: 5 that comprises the subject epitope or antigenic site.
It will also be understood that any one two or more immunogenic amino acid sequences each comprising all or a portion of a presently disclosed epitope or antigenic site can be present in, for example, an isolated fragment of a SARS-CoV-2 S protein or RBD, in a fusion protein (e.g., fused or linked to a different portion, sequence or fragment of SARS-CoV-2 RBD, or as a Fc fusion or antibody fusion protein), as a recombinant protein, in a mixture of immunogenic polypeptides, or the like. Two or more immunogenic polypeptides each comprising all or a portion of a presently disclosed epitope or target region can also be present as separate molecules in a composition.
S glycoprotein and RBD polypeptides can be engineered to comprise one or more mutations that can, for example, bias the S glycoprotein and/or RBD in a conformation of interest. Such mutations include, for example, D614G, replacement of the residues 682-685 with the sequence G-S-A-S, V987P, and K986P, as well as the other mutations and alterations disclosed in Xiong et al, Nature Strutural & Molecular Biology 27 (934-941 (2020)), which mutations and other alterations are incorporated herein by reference.
S glycoprotein polypeptides can be provided in monomeric form, or as a multimer ( e.g. , a trimer). In certain embodiments, S glycoprotein polypeptides (in monomeric or multimeric form) can be present as monomers or can be comprised in disposed on or at a surface of a host cell or on a carrier molecule, such as a substrate polypeptide, lipid, or surface (e.g, a nanobead).
In some embodiments, an immunogenic composition is provided that comprises: (a) a SARS-CoV-2 nucleocapsid (N) protein (SEQ ID NO.: 170), or an immunogenic fragment thereof; (b) a SARS-CoV-2 S glycoprotein polypeptide or multimer thereof comprising (i) one, two, or three Receptor Binding Domains (RBDs) in an open conformation and (ii) a Site la polypeptide, the Site la polypeptide capable of being bound by antibody S2H14; (c) a SARS-CoV-2 Spike (S) polypeptide comprising (i) a RBD in an open conformation or in a closed conformation and (ii) a Site lb polypeptide, the Site lb polypeptide capable of being bound by antibody S2H13; (d) a SARS-CoV-2 S polypeptide or multimer thereof comprising (i) two or three Receptor Binding Domains (RBDs) in an open conformation and (ii) a Site Ila polypeptide, the Site Ila polypeptide capable of being bound by antibody S2X35; (e) a SARS-CoV-2 S polypeptide or multimer thereof comprising (i) two adjacent RBDs in an open conformation and (ii) a Site lib polypeptide, the Site lib polypeptide capable of being bound by antibody S2A4; (f) a SARS-CoV-2 S polypeptide or multimer thereof comprising (i) two adjacent RBDs in an open conformation and (ii) a Site lie polypeptide, the Site lie polypeptide capable of being bound by antibody S304; (g) a SARS-CoV-2 S polypeptide capable of being bound by antibody CR3022; (h) a SARS- CoV-2 Spike (S) polypeptide or multimer thereof comprising (i) a RBD in an open conformation or in a closed conformation and (ii) a Site IV polypeptide, the Site IV polypeptide capable of being bound by antibody S309; (i) a polynucleotide encoding the SARS-CoV-2 N or S protein polypeptide of any one or more of (a)-(h); or (j) any combination of (a)-(i) above.
In further embodiments, the immunogenic composition further comprises a pharmaceutically acceptable carrier, excipient, or diluent, and/or comprising an adjuvant.
In some embodiments, the SARS-COV-2 S glycoprotein polypeptide comprises a prefusion-stabilized S ectodomain and/or does not comprise a C-terminal domain, such as a R1 domain, a CH domain, a CD domain, a HR1 domain, a HR2 domain, a TM domain, and/or a CT domain. In some embodiments, a SARS-CoV-2 S glycoprotein comprises one or more mutations and/or is missing one or more domains as compared to a native, full-length SARS-CoV-2 S glycoprotein.
In some embodiments, an immunogenic composition is provided that comprises: (a) a SARS-CoV-2 S polypeptide or multimer thereof that comprises two or three receptor binding domains (RBDs) in a closed-conformation, wherein two adjacent RBDs are in a closed conformation; (b) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 143, a CDRH2 comprising the sequence set forth in SEQ ID NO: 144, a CDRH3 comprising the sequence set forth in SEQ ID NO: 145, a CDRLl comprising the sequence set forth in SEQ ID NO: 147, a CDRL2 comprising the sequence set forth in SEQ ID NO: 148, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 149; (c) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 109, a CDRH2 comprising the sequence set forth in SEQ ID NO: 110, a CDRH3 comprising the sequence set forth in SEQ ID NO: 111, a CDRL1 comprising the sequence set forth in SEQ ID NO: 133, a CDRL2 comprising the sequence set forth in SEQ ID NO: 134, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 135; or any combination of (a)-(c).
In further embodiments, the immunogenic composition comprises: (d) a SARS- CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRL1 comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 108; (e) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO:94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRL1 comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO: 99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100; or a combination thereof.
In certain embodiments, an immunogenic composition is provided that comprises: (a) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a VH comprising the sequence set forth in SEQ ID NO: 142 and a VL comprising the sequence set forth in SEQ ID NO: 146; (b) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a VH comprising the sequence set forth in SEQ ID NO: 123 and a VL comprising the sequence set forth in SEQ ID NO: 138; or a combination thereof.
In further embodiments, the immunogenic composition comprises: (c) a SARS- CoV-2 S protein polypeptide capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRL1 comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 108; (d) a SARS-CoV-2 S protein polypeptide capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRL1 comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO:99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100; or a combination thereof.
In some embodiments, an immunogenic composition is provided that comprises: (a) a SARS-CoV-2 S polypeptide capable of being bound by antibody S2M11, or an antigen-binding fragment thereof; (b) a SARS-CoV-2 S polypeptide capable of being bound by antibody S2E12, or an antigen-binding fragment thereof; (c) a SARS-CoV-2 S polypeptide capable of being bound by antibody S309, or an antigen-binding fragment thereof; or (d) any combination of (a)-(c) above.
In some embodiments, the immunogenic composition further comprises a pharmaceutically acceptable carrier, excipient, or diluent, and/or comprising an adjuvant.
In some embodiments, an immunogenic composition comprises a polynucleotide that encodes a presently disclosed RBD or S glycoprotein polypeptide (or multimer), and/or a vector that comprises the polynucleotide.
In certain embodiments, the immunogenic composition further comprises an adjuvant. Examples of adjuvants include, for example, poly-ICLC, poly I:C, GLA, CpG, GM-CSF, alum, Delta Inulin, aluminum hydroxide, alhydrogel, aluminum phosphate, MF59, AS03, TLR agonists, resiquimod, and saponins.
In some embodiments, an immunogenic polypeptide is provided with a carrier, such as, for example, a further polypeptide (e.g., an antibody or an antibody Fc that is conjugated to or fused to the immunogenic polyeptide), a liposome, a polysaccharide, a polylactic acid, a polyglycolic acid, polymeric amino acids, an amino acid copolymer, an inactive virus particle, a microbead, a nanobead, or the like.
Polynucleotides, Vectors, and Host cells
In another aspect, the present disclosure provides isolated polynucleotides that encode any of the presently disclosed antibodies or an antigen-binding fragment thereof, or a portion thereof ( e.g ., a CDR, a VH, a VL, a heavy chain, or a light chain), and/or that encode a presently disclosed immunogenic composition. In certain embodiments, the polynucleotide is codon-optimized for expression in a host cell.
Once a coding sequence is known or identified, codon optimization can be performed using known techniques and tools, e.g., using the GenScript® OptimiumGene™ tool; see also Scholten et al., Clin. Immunol. 119: 135, 2006). Codon-optimized sequences include sequences that are partially codon-optimized (i.e., one or more codon is optimized for expression in the host cell) and those that are fully codon-optimized.
It will also be appreciated that polynucleotides encoding antibodies, antigen binding fragments and/or immunogenic compositions of the present disclosure may possess different nucleotide sequences while still encoding a same antibody or antigen binding fragment or immunogenic composition due to, for example, the degeneracy of the genetic code, splicing, and the like.
In any of the presently disclosed embodiments, the polynucleotide can comprise deoxyribonucleic acid (DNA) or ribonucleic acid (RNA). In some embodiments, the RNA comprises messenger RNA (mRNA).
Vectors are also provided, wherein the vectors comprise or contain a polynucleotide as disclosed herein (e.g, a polynucleotide that encodes an antibody or antigen-binding fragment that binds to SARS-CoV-2). A vector can comprise any one or more of the vectors disclosed herein. In particular embodiments, a vector is provided that comprises a DNA plasmid construct encoding the antibody or antigen-binding fragment, or a portion thereof (e.g, so-called "DMAb"; see, e.g, Muthumani etal, J Infect Dis. 2/-/(3):369-378 (2016); Muthumani etal., Hum Vaccin Immunother 9: 2253- 2262 (2013)); Flingai et al, Sci Rep. 5: 12616 (2015); and Elliott et al, NPJ Vaccines 18 (2017), which antibody-coding DNA constructs and related methods of use, including administration of the same, are incorporated herein by reference). In certain embodiments, a DNA plasmid construct comprises a single open reading frame encoding a heavy chain and a light chain (or a VH and a VL) of the antibody or antigen binding fragment, wherein the sequence encoding the heavy chain and the sequence encoding the light chain are optionally separated by polynucleotide encoding a protease cleavage site and/or by a polynucleotide encoding a self-cleaving peptide. In some embodiments, the substituent components of the antibody or antigen-binding fragment are encoded by a polynucleotide comprised in a single plasmid. In other embodiments, the substituent components of the antibody or antigen-binding fragment are encoded by a polynucleotide comprised in two or more plasmids ( e.g ., a first plasmid comprises a polynucleotide encoding a heavy chain, VH, or VH+CH, and a second plasmid comprises a polynucleotide encoding the cognate light chain, VL, or VL+CL). In certain embodiments, a single plasmid comprises a polynucleotide encoding a heavy chain and/or a light chain from two or more antibodies or antigen-binding fragments of the present disclosure. An exemplary expression vector is pVaxl, available from Invitrogen®. A DNA plasmid of the present disclosure can be delivered to a subject by, for example, electroporation (e.g., intramuscular electroporation), or with an appropriate formulation (e.g, hyaluronidase).
In a further aspect, the present disclosure also provides a host cell expressing an antibody or antigen-binding fragment or immunogenic composition according to the present disclosure; or comprising or containing a vector or polynucleotide according the present disclosure.
Examples of such cells include but are not limited to, eukaryotic cells, e.g., yeast cells, animal cells, insect cells, plant cells; and prokaryotic cells, including E. coli. In some embodiments, the cells are mammalian cells. In certain such embodiments, the cells are a mammalian cell line such as CHO cells (e.g, DHFR- CHO cells (Urlaub et al, PNAS 77:4216 (1980)), human embryonic kidney cells (e.g, HEK293T cells), PER.C6 cells, Y0 cells, Sp2/0 cells. NS0 cells, human liver cells, e.g. Hepa RG cells, myeloma cells or hybridoma cells. Other examples of mammalian host cell lines include mouse sertoli cells (e.g, TM4 cells); monkey kidney CV1 line transformed by SV40 (COS-7); baby hamster kidney cells (BHK); African green monkey kidney cells (VERO-76); monkey kidney cells (CV1); human cervical carcinoma cells (HELA); human lung cells (W138); human liver cells (Hep G2); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3 A); mouse mammary tumor (MMT 060562); TRI cells; MRC 5 cells; and FS4 cells. Mammalian host cell lines suitable for antibody production also include those described in, for example, Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B. K. C. Lo, ed., Humana Press, Totowa, N.J.), pp. 255- 268 (2003).
In certain embodiments, a host cell is a prokaryotic cell, such as an E. coli. The expression of peptides in prokaryotic cells such as E. coli is well established (see, e.g, Pluckthun, A. Bio/Technology 9:545-551 (1991). For example, antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed. For expression of antibody fragments and polypeptides in bacteria, see, e.g., U.S. Pat. Nos. 5,648,237; 5,789,199; and 5,840,523.
In particular embodiments, the cell may be transfected with a vector according to the present description with an expression vector. The term "transfection" refers to the introduction of nucleic acid molecules, such as DNA or RNA (e.g. mRNA) molecules, into cells, such as into eukaryotic cells. In the context of the present description, the term "transfection" encompasses any method known to the skilled person for introducing nucleic acid molecules into cells, such as into eukaryotic cells, including into mammalian cells. Such methods encompass, for example, electroporation, lipofection, e.g, based on cationic lipids and/or liposomes, calcium phosphate precipitation, nanoparticle based transfection, virus based transfection, or transfection based on cationic polymers, such as DEAE-dextran or polyethylenimine, etc. In certain embodiments, the introduction is non-viral.
Moreover, host cells of the present disclosure may be transfected stably or transiently with a vector according to the present disclosure, e.g. for expressing an antibody, antigen-binding fragment, or immunogenic composition according to the present disclosure. In such embodiments, the cells may be stably transfected with the vector as described herein. Alternatively, cells may be transiently transfected with a vector according to the present disclosure encoding an antibody, antigen-binding fragment, or immunogenic composition as disclosed herein. In any of the presently disclosed embodiments, a polynucleotide may be heterologous to the host cell.
Accordingly, the present disclosure also provides recombinant host cells that heterologously express an antibody, antigen-binding fragment, or immunogenic composition of the present disclosure. For example, the cell may be of a species that is different to the species from which the antibody was fully or partially obtained ( e.g ., CHO cells expressing a human antibody or an engineered human antibody). In some embodiments, the cell type of the host cell does not express the antibody or antigen binding fragment in nature. Moreover, the host cell may impart a post-translational modification (PTM; e.g., glysocylation or fucosylation) on the antibody or antigen binding fragment that is not present in a native state of the antibody or antigen-binding fragment (or in a native state of a parent antibody from which the antibody or antigen binding fragment was engineered or derived). Such a PTM may result in a functional difference (e.g, reduced immunogenicity). For example, an antibody or antigen binding fragment of the present disclosure that is produced by a host cell as disclosed herein may include one or more post-translational modification that is distinct from the antibody (or parent antibody) in its native state (e.g, a human antibody produced by a CHO cell can comprise a more post-translational modification that is distinct from the antibody when isolated from the human and/or produced by the native human B cell or plasma cell).
Insect cells useful expressing an antibody or antigen-binding fragment of the present disclosure are known in the art and include, for example, Spodoptera frugipera Sf9 cells, Trichoplusia ni BTI-TN5B1-4 cells, and Spodoptera frugipera SfSWTOl “Mimic™” cells. See, e.g., Palmberger et al., J. Biotechnol. 753(3-4): 160-166 (2011). Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
Eukaryotic microbes such as filamentous fungi or yeast are also suitable hosts for cloning or expressing protein-encoding vectors, and include fungi and yeast strains with "humanized" glycosylation pathways, resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gerngross, Nat.
Biotech. 22:1409-1414 (2004); Li etal. , Nat. Biotech. 24:210-215 (2006).
Plant cells can also be utilized as hosts for expressing a binding protein of the present disclosure. For example, PLANTIBODIES™ technology (described in, for example, U.S. Pat. Nos. 5,959,177; 6,040,498; 6,420,548; 7,125,978; and 6,417,429) employs transgenic plants to produce antibodies.
In certain embodiments, the host cell comprises a mammalian cell. In particular embodiments, the host cell is a CHO cell, a HEK293 cell, a PER.C6 cell, a Y0 cell, a Sp2/0 cell, a NS0 cell, a human liver cell, a myeloma cell, or a hybridoma cell.
In a related aspect, the present disclosure provides methods for producing an antibody, antigen-binding fragment, or immunogenic composition, wherein the methods comprise culturing a host cell of the present disclosure under conditions and for a time sufficient to produce the antibody, antigen-binding fragment, or immunogenic composition. Methods useful for isolating and purifying recombinantly produced antibodies, by way of example, may include obtaining supernatants from suitable host cell/vector systems that secrete the recombinant antibody into culture media and then concentrating the media using a commercially available filter. Following concentration, the concentrate may be applied to a single suitable purification matrix or to a series of suitable matrices, such as an affinity matrix or an ion exchange resin. One or more reverse phase HPLC steps may be employed to further purify a recombinant polypeptide. These purification methods may also be employed when isolating an immunogen from its natural environment. Methods for large scale production of one or more of the isolated/recombinant antibody, antigen-binding fragment, or immunogenic composition described herein include batch cell culture, which is monitored and controlled to maintain appropriate culture conditions. Purification of soluble antibodies may be performed according to methods described herein and known in the art and that comport with laws and guidelines of domestic and foreign regulatory agencies. Additional Compositions
Also provided herein are compositions that comprise any one or more of the presently disclosed antibodies, antigen-binding fragments, polynucleotides, vectors, host cells, or immunogenic compositions, singly or in any combination, and can further comprise a pharmaceutically acceptable carrier, excipient, or diluent. Carriers, excipients, and diluents are discussed in further detail herein.
In certain embodiments, a composition comprises two or more different antibodies, antigen-binding fragments, or immunogenic compositions according to the present disclosure. In certain embodiments, antibodies or antigen-binding fragments to be used in a combination each independently have one or more of the following characteristics: neutralize naturally occurring SARS-CoV-2 variants; do not compete with one another for Spike protein binding; bind distinct Spike protein epitopes; have a reduced formation of resistance to SARS-CoV-2; when in a combination, have a reduced formation of resistance to SARS-CoV-2; potently neutralize live SARS-CoV-2 virus; exhibit additive or synergistic effects on neutralization of live SARS-CoV-2 virus when used in combination; exhibit effector functions; are protective in relevant animal model(s) of infection; are capable of being produced in sufficient quantities for large- scale production.
In certain embodiments, a composition comprises a first vector comprising a first plasmid, and a second vector comprising a second plasmid, wherein the first plasmid comprises a polynucleotide encoding a heavy chain, VH, or VH+CH, and a second plasmid comprises a polynucleotide encoding the cognate light chain, VL, or VL+CL of the antibody or antigen-binding fragment thereof. In certain embodiments, a composition comprises a polynucleotide ( e.g ., mRNA) coupled to a suitable delivery vehicle or carrier. Exemplary vehicles or carriers for administration to a human subject include a lipid or lipid-derived delivery vehicle, such as a liposome, solid lipid nanoparticle, oily suspension, submicron lipid emulsion, lipid microbubble, inverse lipid micelle, cochlear liposome, lipid microtubule, lipid microcylinder, or lipid nanoparticle (LNP) or a nanoscale platform (see, e.g., Li et al. Wilery Interdiscip Rev. Nanomed Nanobiotechnol. 77(2):el530 (2019)). Principles, reagents, and techniques for designing appropriate mRNA and and formulating mRNA-LNP and delivering the same are described in, for example, Pardi et al. (.1 Control Release 277345-351 (2015)); Thess et al. (Mol Ther 23: 1456-1464 (2015)); Thran et al. (EMBO Mol Med 9(10): 1434-1448 (2017); Kose et al. ( Sci . Immunol. 4 eaaw6647 (2019); and Sabnis et al. (Mol. Ther. 26:1509-1519 (2018)), which techniques, include capping, codon optimization, nucleoside modification, purification of mRNA, incorporation of the mRNA into stable lipid nanoparticles ( e.g ., ionizable cationic lipid/phosphatidylcholine/cholesterol/PEG-lipid; ionizable lipid:distearoyl PC:cholesterol:polyethylene glycol lipid), and subcutaneous, intramuscular, intradermal, intravenous, intraperitoneal, and intratracheal administration of the same, are incorporated herein by reference.
Methods and Uses
Also provided herein are methods for use of an antibody or antigen-binding fragment, nucleic acid, vector, cell, immunogenic composition, or composition of the present disclosure in the diagnosis of SARS-CoV-2 infection (e.g., in a human subject, or in a sample obtained from a human subject).
Methods of diagnosis (e.g, in vitro, ex vivo ) may include contacting an antibody, antibody fragment (e.g., antigen binding fragment) with a sample. Such samples may be isolated from a subject, for example an isolated tissue sample taken from, for example, nasal passages, sinus cavities, salivary glands, lung, liver, pancreas, kidney, ear, eye, placenta, alimentary tract, heart, ovaries, pituitary, adrenals, thyroid, brain, skin or blood. The methods of diagnosis may also include the detection of an antigen/antibody complex, in particular following the contacting of an antibody or antibody fragment with a sample. Such a detection step can be performed at the bench, i.e. without any contact to the human or animal body. Examples of detection methods are well-known to the person skilled in the art and include, e.g, ELISA (enzyme-linked immunosorbent assay), including direct, indirect, and sandwich ELISA.
Also provided herein are methods of treating a subject using an antibody or antigen-binding fragment, nucleic acid, vector, cell, immunogenic composition, or composition, wherein the subject has, is believed to have, or is at risk for having an infection by SARS-CoV-2. "Treat," "treatment," or "ameliorate" refers to medical management of a disease, disorder, or condition of a subject ( e.g ., a human or non human mammal, such as a primate, horse, cat, dog, goat, mouse, or rat). In general, an appropriate dose or treatment regimen comprising an antibody or composition of the present disclosure is administered in an amount sufficient to elicit a therapeutic or prophylactic benefit. Therapeutic or prophylactic/preventive benefit includes improved clinical outcome; lessening or alleviation of symptoms associated with a disease; decreased occurrence of symptoms; improved quality of life; longer disease-free status; diminishment of extent of disease, stabilization of disease state; delay or prevention of disease progression; remission; survival; prolonged survival; or any combination thereof. In certain embodiments, therapeutic or prophylactic/preventive benefit includes reduction or prevention of hospitalization for treatment of a SARS-CoV-2 infection (i.e., in a statistically significant manner). In certain embodiments, therapeutic or prophylactic/preventive benefit includes a reduced duration of hospitalization for treatment of a SARS-CoV-2 infection (i.e., in a statistically significant manner). In certain embodiments, therapeutic or prophylactic/preventive benefit includes a reduced or abrogated need for respiratory intervention, such as intubation and/or the use of a respirator device. In certain embodiments, therapeutic or prophylactic/preventive benefit includes reversing a late-stage disease pathology and/or reducing mortality.
A "therapeutically effective amount" or "effective amount" of an antibody, antigen-binding fragment, polynucleotide, vector, host cell, composition, or immunogenic composition of this disclosure refers to an amount of the composition or molecule sufficient to result in a therapeutic effect, including improved clinical outcome; lessening or alleviation of symptoms associated with a disease; decreased occurrence of symptoms; improved quality of life; longer disease-free status; diminishment of extent of disease, stabilization of disease state; delay of disease progression; remission; survival; or prolonged survival in a statistically significant manner. When referring to an individual active ingredient, administered alone, a therapeutically effective amount refers to the effects of that ingredient or cell expressing that ingredient alone. When referring to a combination, a therapeutically effective amount refers to the combined amounts of active ingredients or combined adjunctive active ingredient with a cell expressing an active ingredient that results in a therapeutic effect, whether administered serially, sequentially, or simultaneously. A combination may comprise, for example, two or more different antibodies that specifically bind a SARS-CoV-2 antigen, which in certain embodiments, may be the same or different SARS-CoV-2 antigen, and/or can comprise the same or different epitopes.
Accordingly, in certain embodiments, methods are provided for treating a SARS-CoV-2 infection in a subject, wherein the methods comprise administering to the subject an effective amount of an antibody, antigen-binding fragment, polynucleotide, vector, host cell, immunogenic composition, or composition as disclosed herein.
Subjects that can be treated by the present disclosure are, in general, human and other primate subjects, such as monkeys and apes for veterinary medicine purposes. Other model organisms, such as mice and rats, may also be treated according to the present disclosure. In any of the aforementioned embodiments, the subject may be a human subject. The subjects can be male or female and can be any suitable age, including infant, juvenile, adolescent, adult, and geriatric subjects.
A number of criteria are believed to contribute to high risk for severe symptoms or death associated with a SARS CoV-2 infection. These include, but are not limited to, age, occupation, general health, pre-existing health conditions, and lifestyle habits. In some embodiments, a subject treated according to the present disclosure comprises one or more risk factors.
In certain embodiments, a human subject treated according to the present disclosure is an infant, a child, a young adult, an adult of middle age, or an elderly person. In certain embodiments, a human subject treated according to the present disclosure is less than 1 year old, or is 1 to 5 years old, or is between 5 and 125 years old (e.g., 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100,
105, 110, 115, or 125 years old, including any and all ages therein or therebetween). In certain embodiments, a human subject treated according to the present disclosure is 0- 19 years old, 20-44 years old, 45-54 years old, 55-64 years old, 65-74 years old, 75-84 years old, or 85 years old, or older. Persons of middle, and especially of elderly age are believed to be at particular risk. In particular embodiments, the human subject is 45-54 years old, 55-64 years old, 65-74 years old, 75-84 years old, or 85 years old, or older. In some embodiments, the human subject is male. In some embodiments, the human subject is female.
In certain embodiments, a human subject treated according to the present disclosure is a resident of a nursing home or a long-term care facility, is a hospice care worker, is a healthcare provider or healthcare worker, is a first responder, is a family member or other close contact of a subject diagnosed with or suspected of having a SARS-CoV-2 infection, is overweight or clinically obese, is or has been a smoker, has or had chronic obstructive pulmonary disease (COPD), is asthmatic ( e.g ., having moderate to severe asthma), has an autoimmune disease or condition (e.g., diabetes), and/or has a compromised or depleted immune system (e.g, due to AIDS/HIV infection, a cancer such as a blood cancer, a lymphodepleting therapy such as a chemotherapy, a bone marrow or organ transplantation, or a genetic immune condition), has chronic liver disease, has cardiovascular disease, has a pulmonary or heart defect, works or otherwise spends time in close proximity with others, such as in a factory, shipping center, hospital setting, or the like.
In certain embodiments, a subject treated according to the present disclosure has received a vaccine for SARS-CoV-2 and the vaccine is determined to be ineffective, e.g, by post-vaccine infection or symptoms in the subject, by clinical diagnosis or scientific or regulatory criteria.
In certain embodiments, treatment is administered as peri-exposure prophylaxis. In certain embodiments, treatment is administered to a subject with mild- to-moderate disease, which may be in an outpatient setting. In certain embodiments, treatment is administered to a subject with moderate-to- severe disease, such as requiring hospitalization.
Typical routes of administering the presently disclosed compositions thus include, without limitation, oral, topical, transdermal, inhalation, parenteral, sublingual, buccal, rectal, vaginal, and intranasal. The term "parenteral", as used herein, includes subcutaneous injections, intravenous, intramuscular, intrastemal injection or infusion techniques. In certain embodiments, administering comprises administering by a route that is selected from oral, intravenous, parenteral, intragastric, intrapleural, intrapulmonary, intrarectal, intradermal, intraperitoneal, intratumoral, subcutaneous, topical, transdermal, intracisternal, intrathecal, intranasal, and intramuscular. In particular embodiments, a method comprises orally administering the antibody, antigen binding fragment, polynucleotide, vector, host cell, or composition to the subject.
Pharmaceutical compositions according to certain embodiments of the present invention are formulated so as to allow the active ingredients contained therein to be bioavailable upon administration of the composition to a patient. Compositions that will be administered to a subject or patient may take the form of one or more dosage units, where for example, a tablet may be a single dosage unit, and a container of a herein described an antibody or antigen-binding in aerosol form may hold a plurality of dosage units. Actual methods of preparing such dosage forms are known, or will be apparent, to those skilled in this art; for example, see Remington: The Science and Practice of Pharmacy, 20th Edition (Philadelphia College of Pharmacy and Science, 2000). The composition to be administered will, in any event, contain an effective amount of an antibody or antigen-binding fragment, polynucleotide, vector, host cell, , or composition of the present disclosure, for treatment of a disease or condition of interest in accordance with teachings herein.
A composition may be in the form of a solid or liquid. In some embodiments, the carrier(s) are particulate, so that the compositions are, for example, in tablet or powder form. The carrier(s) may be liquid, with the compositions being, for example, an oral oil, injectable liquid or an aerosol, which is useful in, for example, inhalatory administration. When intended for oral administration, the pharmaceutical composition is preferably in either solid or liquid form, where semi solid, semi liquid, suspension and gel forms are included within the forms considered herein as either solid or liquid.
As a solid composition for oral administration, the pharmaceutical composition may be formulated into a powder, granule, compressed tablet, pill, capsule, chewing gum, wafer or the like. Such a solid composition will typically contain one or more inert diluents or edible carriers. In addition, one or more of the following may be present: binders such as carboxymethylcellulose, ethyl cellulose, microcrystalline cellulose, gum tragacanth or gelatin; excipients such as starch, lactose or dextrins, disintegrating agents such as alginic acid, sodium alginate, Primogel, corn starch and the like; lubricants such as magnesium stearate or Sterotex; glidants such as colloidal silicon dioxide; sweetening agents such as sucrose or saccharin; a flavoring agent such as peppermint, methyl salicylate or orange flavoring; and a coloring agent. When the composition is in the form of a capsule, for example, a gelatin capsule, it may contain, in addition to materials of the above type, a liquid carrier such as polyethylene glycol or oil.
The composition may be in the form of a liquid, for example, an elixir, syrup, solution, emulsion or suspension. The liquid may be for oral administration or for delivery by injection, as two examples. When intended for oral administration, preferred compositions contain, in addition to the present compounds, one or more of a sweetening agent, preservatives, dye/colorant and flavor enhancer. In a composition intended to be administered by injection, one or more of a surfactant, preservative, wetting agent, dispersing agent, suspending agent, buffer, stabilizer and isotonic agent may be included.
Liquid pharmaceutical compositions, whether they be solutions, suspensions or other like form, may include one or more of the following adjuvants: sterile diluents such as water for injection, saline solution, preferably physiological saline, Ringer’s solution, isotonic sodium chloride, fixed oils such as synthetic mono or diglycerides which may serve as the solvent or suspending medium, polyethylene glycols, glycerin, propylene glycol or other solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic. Physiological saline is a preferred adjuvant. An injectable pharmaceutical composition is preferably sterile. A liquid composition intended for either parenteral or oral administration should contain an amount of an antibody or antigen-binding fragment as herein disclosed such that a suitable dosage will be obtained. Typically, this amount is at least 0.01% of the antibody or antigen-binding fragment in the composition. When intended for oral administration, this amount may be varied to be between 0.1 and about 70% of the weight of the composition. Certain oral pharmaceutical compositions contain between about 4% and about 75% of the antibody or antigen-binding fragment. In certain embodiments, pharmaceutical compositions and preparations according to the present invention are prepared so that a parenteral dosage unit contains between 0.01 to 10% by weight of antibody or antigen-binding fragment prior to dilution.
The composition may be intended for topical administration, in which case the carrier may suitably comprise a solution, emulsion, ointment or gel base. The base, for example, may comprise one or more of the following: petrolatum, lanolin, polyethylene glycols, bee wax, mineral oil, diluents such as water and alcohol, and emulsifiers and stabilizers. Thickening agents may be present in a composition for topical administration. If intended for transdermal administration, the composition may include a transdermal patch or iontophoresis device. The pharmaceutical composition may be intended for rectal administration, in the form, for example, of a suppository, which will melt in the rectum and release the drug. The composition for rectal administration may contain an oleaginous base as a suitable nonirritating excipient.
Such bases include, without limitation, lanolin, cocoa butter and polyethylene glycol.
A composition may include various materials which modify the physical form of a solid or liquid dosage unit. For example, the composition may include materials that form a coating shell around the active ingredients. The materials that form the coating shell are typically inert, and may be selected from, for example, sugar, shellac, and other enteric coating agents. Alternatively, the active ingredients may be encased in a gelatin capsule. The composition in solid or liquid form may include an agent that binds to the antibody or antigen-binding fragment of the disclosure and thereby assists in the delivery of the compound. Suitable agents that may act in this capacity include monoclonal or polyclonal antibodies, one or more proteins or a liposome. The composition may consist essentially of dosage units that can be administered as an aerosol. The term aerosol is used to denote a variety of systems ranging from those of colloidal nature to systems consisting of pressurized packages. Delivery may be by a liquefied or compressed gas or by a suitable pump system that dispenses the active ingredients. Aerosols may be delivered in single phase, bi phasic, or tri phasic systems in order to deliver the active ingredient(s). Delivery of the aerosol includes the necessary container, activators, valves, subcontainers, and the like, which together may form a kit. One of ordinary skill in the art, without undue experimentation, may determine preferred aerosols.
It will be understood that compositions of the present disclosure also encompass carrier molecules for polynucleotides, as described herein ( e.g ., lipid nanoparticles, nanoscale delivery platforms, and the like).
The pharmaceutical compositions may be prepared by methodology well known in the pharmaceutical art. For example, a composition intended to be administered by injection can be prepared by combining a composition that comprises an antibody, antigen-binding fragment thereof, or antibody conjugate as described herein and optionally, one or more of salts, buffers and/or stabilizers, with sterile, distilled water so as to form a solution. A surfactant may be added to facilitate the formation of a homogeneous solution or suspension. Surfactants are compounds that non-covalently interact with the peptide composition so as to facilitate dissolution or homogeneous suspension of the antibody or antigen-binding fragment thereof in the aqueous delivery system.
In general, an appropriate dose and treatment regimen provide the composition(s) in an amount sufficient to provide therapeutic and/or prophylactic benefit (such as described herein, including an improved clinical outcome (e.g., a decrease in frequency, duration, or severity of diarrhea or associated dehydration, or inflammation, or longer disease-free and/or overall survival, or a lessening of symptom severity). For prophylactic use, a dose should be sufficient to prevent, delay the onset of, or diminish the severity of a disease associated with disease or disorder.
Prophylactic benefit of the compositions administered according to the methods described herein can be determined by performing pre-clinical (including in vitro and in vivo animal studies) and clinical studies and analyzing data obtained therefrom by appropriate statistical, biological, and clinical methods and techniques, all of which can readily be practiced by a person skilled in the art.
Compositions are administered in an effective amount ( e.g ., to treat a Wuhan coronavirus infection), which will vary depending upon a variety of factors including the activity of the specific compound employed; the metabolic stability and length of action of the compound; the age, body weight, general health, sex, and diet of the subject; the mode and time of administration; the rate of excretion; the drug combination; the severity of the particular disorder or condition; and the subject undergoing therapy. In certain embodiments, tollowing administration of therapies according to the formulations and methods of this disclosure, test subjects will exhibit about a 10% up to about a 99% reduction in one or more symptoms associated with the disease or disorder being treated as compared to placebo-treated or other suitable control subjects.
Generally, a therapeutically effective daily dose of an antibody or antigen binding fragment is (for a 70 kg mammal) from about 0.001 mg/kg (i.e., 0.07 mg) to about 100 mg/kg (i.e., 7.0 g); preferably a therapeutically effective dose is (for a 70 kg mammal) from about 0.01 mg/kg (i.e., 0.7 mg) to about 50 mg/kg (i.e., 3.5 g); more preferably a therapeutically effective dose is (for a 70 kg mammal) from about 1 mg/kg (i.e., 70 mg) to about 25 mg/kg (i.e., 1.75 g). For polynucleotides, vectors, host cells, and related compositions of the present disclosure, a therapeutically effective dose may be different than for an antibody or antigen-binding fragment.
In certain embodiments, a method comprises administering the antibody, antigen-binding fragment, polynucleotide, vector, host cell, or composition to the subject at 2, 3, 4, 5, 6, 7, 8, 9, 10 times, or more.
In certain embodiments, a method comprises administering the antibody, antigen-binding fragment, or composition to the subject a plurality of times, wherein a second or successive administration is performed at about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 24, about 48, about 74, about 96 hours, or more, following a first or prior administration, respectively.
In certain embodiments, a method comprises administering the antibody, antigen-binding fragment, polynucleotide, vector, host cell, immungenuc composition, or composition at least one time prior to the subject being infected by SARS-CoV-2.
Compositions comprising an antibody, antigen-binding fragment, polynucleotide, vector, host cell, immunogenic composition, or composition of the present disclosure may also be administered simultaneously with, prior to, or after administration of one or more other therapeutic agents. Such combination therapy may include administration of a single pharmaceutical dosage formulation which contains a compound of the invention and one or more additional active agents, as well as administration of compositions comprising an antibody or antigen-binding fragment of the disclosure and each active agent in its own separate dosage formulation. For example, an antibody or antigen-binding fragment thereof as described herein and the other active agent can be administered to the patient together in a single oral dosage composition such as a tablet or capsule, or each agent administered in separate oral dosage formulations. Similarly, an antibody or antigen-binding fragment as described herein and the other active agent can be administered to the subject together in a single parenteral dosage composition such as in a saline solution or other physiologically acceptable solution, or each agent administered in separate parenteral dosage formulations. Where separate dosage formulations are used, the compositions comprising an antibody or antigen-binding fragment and one or more additional active agents can be administered at essentially the same time, i.e., concurrently, or at separately staggered times, i.e., sequentially and in any order; combination therapy is understood to include all these regimens.
In certain embodiments, a combination therapy is provided that comprises one or more anti-SARS-CoV-2 antibody (or one or more nucleic acid, host cell, vector, or composition) of the present disclosure and one or more anti-inflammatory agent and/or one or more anti-viral agent. In particular embodiments, the one or more anti inflammatory agent comprises a corticosteroid such as, for example, dexamethasone, prednisone, or the like. In some embodiments, the one or more anti-inflammatory agents comprise a cytokine antagonist such as, for example, an antibody that binds to IL6 (such as siltuximab), or to IL-6R (such as tocilizumab), or to IL-Ib, IL-7, IL-8, IL- 9, IL-10, FGF, G-CSF, GM-CSF, IFN-g, IP-10, MCP-1, MPMA, MIP1-B, PDGR, TNF-a, or VEGF. In some embodiments, anti-inflammatory agents such as leronlimab, ruxolitinib and/or anakinra are used. In some embodiments, the one or more anti-viral agents comprise nucleotide analogs or nucelotide analog prodrugs such as, for example, remdesivir, sofosbuvir, acyclovir, and zidovudine. In particular embodiments, an anti viral agent comprises lopinavir, ritonavir, favipiravir, or any combination thereof.
Other anti-inflammatory agents for use in a combination therapy of the present disclosure include non-steroidal anti-inflammatory drugs (NSAIDS). It will be appreciated that in such a combination therapy, the one or more antibody (or one or more nucleic acid, host cell, vector, or composition) and the one or more anti inflammatory agent and/or one or the more antiviral agent can be administered in any order and any sequence, or together.
In some embodiments, an antibody (or one or more nucleic acid, host cell, vector, or immunogenic composition, composition) is administered to a subject who has previously received one or more anti-inflammatory agent and/or one or more antiviral agent. In some embodiments, one or more anti-inflammatory agent and/or one or more antiviral agent is administered to a subject who has previously received an antibody (or one or more nucleic acid, host cell, vector, immunogenic composition, or composition).
In certain embodiments, a combination therapy is provided that comprises two or more anti-SARS-CoV-2 antibodies of the present disclosure. A method can comprise administering a first antibody to a subject who has received a second antibody, or can comprise administering two or more antibodies together. For example, in particular embodiments, a method is provided that comprises administering to the subject (a) a first antibody or antigen-binding fragment, when the subject has received a second antibody or antigen-binding fragment; (b) the second antibody or antigen binding fragment, when the subject has received the first antibody or antigen-binding fragment; or (c) the first antibody or antigen-binding fragment, and the second antibody or antigen-binding fragment.
In a related aspect, uses of the presently disclosed antibodies, antigen-binding fragments, vectors, host cells, and compositions are provided.
In certain embodiments, an antibody, antigen-binding fragment, polynucleotide, vector, host cell, immunogenic composition, or composition is provided for use in a method of preventing or treating a SARS-CoV-2 infection in a subject.
In certain embodiments, an antibody, antigen-binding fragment, immunogenic composition, or composition is provided for use in a method of manufacturing or preparing a medicament for preventing or treating a SARS-CoV-2 coronavirus infection in a subject.
The present disclosure also provides the following Embodiments.
Embodiment 1. An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 16 and a VL amino acid sequence according to SEQ ID NO: 26 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
Embodiment 2. An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein:
(a) binding comprises contacting one or more of amino acid residues 369- 386, 404-411, and 499-508 of SEQ ID NO: 3; and/or
(b) binding comprises binding an epitope formed by amino acid residues 369-386, 404-411, and 499-508 of SEQ ID NO: 3.
Embodiment 3. The antibody or antigen-binding fragment of Embodiment
2, which does not contact one or more of amino acids 406, 409, 410, 411, 499, 500,
505, and 507 of SEQ ID NO.:3 when binding to the S glycoprotein. Embodiment 4. The antibody or antigen-binding fragment of any one of
Embodiments 1-3, which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and one or zero RBDs of the trimer is in a closed conformation, and optionally is not capable of binding to the S glycoprotein when only one RBD of the trimer is in an open conformation and two RBDs of the trimer are in a closed conformation.
Embodiment 5. An antibody, or an antigen-binding fragment thereof, which is capable of binding to a SAR.S-CoV-2 S glycoprotein of a S glycoprotein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and one or zero RBDs of the trimer is in a closed conformation, and optionally is not capable of binding to the S protein when only one RBD of the trimer is in an open conformation and two RBDs of the trimer are in a closed conformation.
Embodiment 6. An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 31 and a VL amino acid sequence according to SEQ ID NO: 35 for binding to a SAR.S-CoV-2 S glycoprotein of a S glycoprotein trimer.
Embodiment 7. An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SAR.S CoV-2 S glycoprotein of a S glycoprotein trimer, wherein:
(a) binding comprises contacting one or more of amino acid residues 444- 449 and 472-498 of SEQ ID NO: 3; and/or
(b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 444-449 and 472-498 of SEQ ID NO: 3; and/or
(c) binding comprises binding within a crevice formed by a receptor binding motif (RBM) b-hairpin in a receptor binding domain (RBD) of the S glycoprotein. Embodiment 8. The antibody or antigen-binding fragment of Embodiment
7, which does not contact one or more of amino acids 448, 473-478, 487, 491, 492, 495, 496, and 497 of SEQ ID NO.:3 when binding to the SARS-CoV-2 S glycoprotein.
Embodiment 9. The antibody or antigen-binding fragment of any one of Embodiments 6-8, which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein one or zero receptor binding domains (RBDs) of the trimer are in an open conformation and two or three RBDs of the trimer are in a closed conformation.
Embodiment 10. An antibody, or an antigen-binding fragment thereof, which is capable of binding to a SARS-CoV-2 S glycoprotein protein of a S glycoprotein trimer wherein one or zero receptor binding domains (RBDs) of the trimer are in an open conformation and two or three RBDs of the trimer are in a closed conformation.
Embodiment 11. An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 47 and a VL amino acid sequence according to SEQ ID NO: 51 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
Embodiment 12. An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein, wherein:
(a) binding comprises contacting one or more of amino acid residues 403, 444-456, 475, and 485-505 of SEQ ID NO: 3; and/or
(b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 403, 444-456, 475, and 485-505 of SEQ ID NO: 3. Embodiment 13. The antibody or antigen-binding fragment of Embodiment 12, which does not contact one or more of amino acids 448, 450, 451, 452, 454, 486, 488, 490, 491, 492, 497, 503, and 504 of SEQ ID NO.:3 when binding to the S glycoprotein. Embodiment 14. The antibody or antigen-binding fragment of any one of
Embodiments 11-13, which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein one, two, or three receptor binding domains (RBDs) of the trimer are in an open conformation.
Embodiment 15. An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 64 and a VL amino acid sequence according to SEQ ID NO: 68 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
Embodiment 16. An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein:
(a) binding comprises contacting one or more of amino acid residues 368- 388 and 407-414 of SEQ ID NO: 3; and/or
(b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 368-388 and 407-414 of SEQ ID NO: 3.
Embodiment 17. The antibody or antigen-binding fragment of Embodiment 15 or 16, which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and zero or one RBDs of the trimer is in a closed conformation. Embodiment 18. An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 150 and a VL amino acid sequence according to SEQ ID NO: 154 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
Embodiment 19. An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein:
(a) binding comprises contacting one or more of amino acid residues 369- 392, 411-414, 427-430, and 515-517 of SEQ ID NO: 3; and/or
(b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 369-392, 411-414, 427-430, and 515-517 of SEQ ID NO: 3.
Embodiment 20. The antibody or antigen-binding fragment of Embodiment 18 or 19, which is capable of binding to a SARS-CoV-2 S protein of a S protein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and zero or one RBDs of the trimer is in a closed conformation.
Embodiment 21. The antibody or antigen-binding fragment of any one of Embodiments 15-20, wherein binding of the antibody or antigen-binding fragment to the S glycoprotein promotes or leads to release of the SI subunit from the S glycoprotein.
Embodiment 22. An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 123 and a VL amino acid sequence according to SEQ ID NO: 138 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer. Embodiment 23. An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein:
(a) binding comprises contacting one or more of amino acid residues 417, 453, 455, 456, 473, 475-480, 484-489, and 493 of SEQ ID NO: 3; and/or
(b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 417, 453, 455, 456, 473, 475-480, 484-489, and 493of SEQ ID NO.: 3.
Embodiment 24. The antibody or antigen-binding fragment of Embodiment 22 or 23, which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein one, two, or three receptor binding domains (RBDs) of the trimer are in an open conformation and zero, one, or two RBDs of the trimer are in a closed conformation.
Embodiment 25. An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 142 and a VL amino acid sequence according to SEQ ID NO: 146 for binding to a SARS-CoV-2 S glycoprotein trimer.
Embodiment 26. An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein trimer, wherein: (a) binding comprises contacting one or more of amino acid residues on each of two receptor binding domains (RBDs), wherein binding comprises contacting, on a first RBD, one or more of amino acid residues 339, 342, 343, 367, 368, 371, 372, 373, 374, 436, 440, and 441, and, on a second RBD, one or more of amino acid residues 446, 447, 449, 452, 455, 456, 484, 485, 486, 487, 489, 490, 492, 493, 494, 496, and 498, wherein the amino acid numbering is according to SEQ ID NO. :3; and/or
(b) the antibody or antigen-binding fragment recognizes an epitope formed by the following: (b)(i) on a first RBD, amino acid residues 339, 342, 343, 367, 368, 371,
372, 373, 374, 436, 440, and 441, and,
(b)(ii) on a second RBD, amino acid residues 446, 447, 449, 452, 455,
456, 484, 485, 486, 487, 489, 490, 492, 493, 494, 496, and 498, wherein the amino acid numbering is according to SEQ ID NO.:3.
Embodiment 27. The antibody or antigen-binding fragment of Embodiment 25 or 26, which is capable of binding to the S glycoprotein trimer wherein three receptor binding domains (RBDs) of the trimer are in a closed conformation.
Embodiment 28. The antibody or antigen-binding fragment of any one of Embodiments 25-27, wherein binding of the antibody or antigen-binding fragment to the S glycoprotein trimer inhibits or prevents an RBD of the trimer from assuming an open conformation.
Embodiment 29. The antibody or antigen-binding fragment of any one of Embodiments 1-28, wherein binding of the antibody or antigen-binding fragment to the S glycoprotein or S glycoprotein trimer, respectively, blocks an interaction between the S glycoprotein and a human ACE2.
Embodiment 30 The antibody or antigen-binding fragment of any one of Embodiments 1-28, wherein binding of the antibody or antigen-binding fragment to the S glycoprotein or S glycoprotein trimer, respectively, does not block an interaction between the S glycoprotein and a human ACE2.
Embodiment 31. The antibody or antigen-binding fragment of any one of Embodiments 1-30, which is capable of neutralizing an infection by a SARS-CoV-2.
Embodiment 32. An isolated polynucleotide encoding the antibody or antigen-binding fragment of any one of Embodiments 1-31. Embodiment 33. A vector comprising the polynucleotide of Embodiment
32.
Embodiment 34. A recombinant host cell that: (i) expresses the antibody or antigen-binding fragment of any one of Embodiments 1-31; (ii) comprises the polynucleotide of Embodiment 32; and/or (iii) comprises the vector of Embodiment 33.
Embodiment 35. A composition comprising:
(i) the antibody or antigen-binding fragment of any one of Embodiments 1-
(ii) the polynucleotide of Embodiment 32; (iii) the vector of Embodiment 33; and/or
(iv) the host cell of Embodiment 34, and a pharmaceutically acceptable carrier, excipient, or diluent.
Embodiment 36. A combination comprising (i) any two or more of the antibodies or antigen-binding fragments of any of Embodiments 1-31 or (ii) a first antibody or antigen-binding fragment of any of Embodiments 1-31 and a second antibody that is antibody S309 or that competes with antibody S309 for binding to a SARS-CoV-2 S glycoprotein.
Embodiment 37. A composition comprising (i) any two or more of the antibodies or antigen-binding fragments of any of Embodiments 1-31 or (ii) a first antibody or antigen-binding fragment of any of Embodiments 1-31 and a second antibody or antigen-binding fragment that is antibody S309 or that competes with antibody S309 for binding to a SARS-CoV-2 S glycoprotein, and a pharmaceutically acceptable carrier, excipient, or diluent.
Embodiment 38. A method for treating a SARS-CoV-2 infection in a subject, the method administering to the subject an effective amount of: (i) the antibody or antigen-binding fragment of any one of Embodiments 1-
31:
(ii) the polynucleotide of Embodiment 32;
(iii) the vector of Embodiment 33; (iv) the host cell of Embodiment 34;
(v) the composition of Embodiment 35;
(vi) the combination of Embodiment 36;
(vii) the composition of Embodiment 37;
(viii) any two or more of the antibodies or antigen-binding fragments of any of Embodiments 1-31; or
(ix) any combination of (i)-(viii).
Embodiment 39. The antibody or antigen-binding fragment of any one of Embodiments 1-31, the polynucleotide of Embodiment 32, the vector of Embodiment 33, the host cell of Embodiment 34, the composition of Embodiment 35, the combination of Embodiment 36, the composition of Embodiment 37, and/or the any two or more of the antibodies or antigen-binding fragments of Embodiments 1-31, for use in a method of treating a SARS-CoV-2 infection in a subject.
Embodiment 40. An immunogenic composition comprising:
(a) a SARS-CoV-2 nucleocapsid (N) protein (SEQ ID NO.: 170), or an immunogenic fragment thereof;
(b) a SARS-CoV-2 S polypeptide or multimer thereof comprising (i) one, two, or three Receptor Binding Domains (RBDs) in an open conformation and (ii) a Site la polypeptide, the Site la polypeptide capable of being bound by antibody S2H14;
(c) a SARS-CoV-2 Spike (S) polypeptide comprising (i) a RBD in an open conformation or in a closed conformation and (ii) a Site lb polypeptide, the Site lb polypeptide capable of being bound by antibody S2H13; (d) a SARS-CoV-2 S polypeptide or multimer thereof comprising (i) two or three Receptor Binding Domains (RBDs) in an open conformation and (ii) a Site Ila polypeptide, the Site Ila polypeptide capable of being bound by antibody S2X35;
(e) a SARS-CoV-2 S polypeptide or multimer thereof comprising (i) two adjacent RBDs in an open conformation and (ii) a Site lib polypeptide, the Site lib polypeptide capable of being bound by antibody S2A4;
(f) a SARS-CoV-2 S polypeptide or multimer thereof comprising (i) two adjacent RBDs in an open conformation and (ii) a Site lie polypeptide, the Site lie polypeptide capable of being bound by antibody S304;
(g) a SARS-CoV-2 S polypeptide capable of being bound by antibody CR3022;
(h) a SARS-CoV-2 Spike (S) polypeptide or multimer thereof comprising (i) a RBD in an open conformation or in a closed conformation and (ii) a Site IV polypeptide, the Site IV polypeptide capable of being bound by antibody S309;
(i) a polynucleotide encoding the SARS-CoV-2 N or S protein polypeptide of any one or more of (a)-(h); or
(j) any combination of (a)-(i) above.
Embodiment 41. The immunogenic composition of Embodiment 40, further comprising a pharmaceutically acceptable carrier, excipient, or diluent, and/or comprising an adjuvant.
Embodiment 42. The immunogenic composition of Embodiment 40 or Embodiment 41, wherein the SARS-COV-2 S polypeptide comprises a prefusion- stabilized S ectodomain and/or does not comprise a R1 domain, a CH domain, a CD domain, a HR1 domain, a HR2 domain, a TM domain, and/or a CT domain.
Embodiment 43. A method comprising administering the immunogenic composition or composition of any one of Embodiments 40-42 to a subject having, suspected of having, or at risk for having a SARS-CoV-2 infection. Embodiment 44. Use of:
(a) (a)(i) antibody S2H14, or an antigen-binding fragment thereof, or (a)(ii) an antibody or antigen-binding fragment thereof that competes with (a)(i) for binding to a SARS-CoV-2 S glycoprotein;
(b) (b)(i) antibody S2H13, or an antigen-binding fragment thereof, or (b)(ii) an antibody or antigen-binding fragment thereof that competes with (b)(i) for binding to a SARS-CoV-2 S glycoprotein;
(c) (c)(i) antibody S2X35, or an antigen-binding fragment thereof, or (c)(ii) an antibody or antigen-binding fragment thereof that competes with (i) for binding to a SARS-CoV-2 S glycoprotein;
(d) (d)(i) antibody S2A4 or an antigen-binding fragment thereof, or (d)(ii) an antibody or antigen-binding fragment thereof that competes with (d)(i) for binding to a SARS-CoV-2 S glycoprotein;
(e) (e)(i) antibody S304 or an antigen-binding fragment thereof, or (e)(ii) an antibody or antigen-binding fragment thereof that competes with (e)(i) for binding to a SARS-CoV-2 S glycoprotein;
(f) (f)(i) antibody S309 or an antigen-binding fragment thereof, or (f)(ii) an antibody or antigen-binding fragment thereof that competes with (f)(i) for binding to a SARS-CoV-2 S glycoprotein; and/or
(g) (g)(i) antibody CR3022, or an antigen-binding fragment thereof, or (g)(ii) an antibody or antigen-binding fragment thereof that competes with (g)(i) for binding to a SARS-CoV-2 S glycoprotein, in the diagnosis of a SARS-CoV-2 infection, wherein the diagnosis comprises contacting the antibody or antigen-binding fragment thereof with a sample from a subject, and detecting the presence or absence of a complex comprising the antibody or antigen-binding fragment with an antigen.
Embodiment 45. Use of: (a) (a)(i) antibody S2H14, or an antigen-binding fragment thereof, or (a)(ii) an antibody or antigen-binding fragment thereof that competes with (a)(i) for binding to a SARS-CoV-2 S glycoprotein;
(b) (b)(i) antibody S2H13, or an antigen-binding fragment thereof, or (b)(ii) an antibody or antigen-binding fragment thereof that competes with (b)(i) for binding to a SARS-CoV-2 S glycoprotein;
(c) (c)(i) antibody S2X35, or an antigen-binding fragment thereof, or (c)(ii) an antibody or antigen-binding fragment thereof that competes with (c)(i) for binding to a SARS-CoV-2 S glycoprotein;
(d) (d)(i) antibody S2A4 or an antigen-binding fragment thereof, or (d)(ii) an antibody or antigen-binding fragment thereof that competes with (d)(i) for binding to a SARS-CoV-2 S glycoprotein;
(e) (e)(i) antibody S304 or an antigen-binding fragment thereof, or (e)(ii) an antibody or antigen-binding fragment thereof that competes with (e)(i) for binding to a SARS-CoV-2 S glycoprotein;
(f) (f)(i) antibody S309 or an antigen-binding fragment thereof, or (f)(ii) an antibody or antigen-binding fragment thereof that competes with (f)(i) for binding to a SARS-CoV-2 Spike S glycoprotein; and/or
(g) (g)(i) antibody CR3022, or an antigen-binding fragment thereof, or (g)(ii) an antibody or antigen-binding fragment thereof that competes with (g)(i) for binding to a SARS-CoV-2 S glycoprotein, in determining whether a SARS-CoV-2 vaccine composition comprises an epitope in a correct conformation for binding by the antibody or antigen-binding fragment thereof.
Embodiment 46. A method comprising detecting, in sera from one or more subject having (hospitalized, symptomatic, or asymptomatic) or recovered from a SARS-CoV-2 infection:
(a) the titer of antibody (e.g., IgG, IgA, and/or IgM) that binds to SARS- CoV-2 S glycoprotein; (b) the titer of antibody that binds to SARS-CoV-2 RBD and optionally neutralizes the SARS-CoV-2 infection;
(c) the titer of antibody that binds to SARS-CoV-2 Domain A and optionally neutralizes the SARS CoV-2 infection; (d) the titer of antibody that binds to SARS-CoV-2 S2 and optionally neutralizes the SARS CoV-2 infection; and/or
(e) the titer of antibody that binds to SARS-CoV-2 N protein and optionally neutralizes the SARS-CoV-2 infection.
Embodiment 47. The method of Embodiment 45, further comprising preparing an immunogenic composition comprising whichever of SARS-CoV-2 S glycoprotein, RBD, Domain A, or N protein that resulted in the highest titer of antibody.
Embodiment 48. The method of Embodiment 46 or 47, wherein the sera is from a subject who experienced a symptom of a SARS-CoV-2 infection and the method further comprises preparing an immunogenic composition comprising whichever of the SARS-CoV-2 S protein, RBD, Domain A, or N protein against which the highest titer of antibody is detected at 25, preferably 50, more preferably 75, still more preferably 100, even more preferably 125, still more preferably 150 days after the onset of the symptom. Embodiment 49. A composition or combination comprising any two, any three, or all four of (a)-(d):
(a) (a)(i) an antibody or antigen-binding fragment thereof (e.g, Fv, scFv,
Fab, scFab, or the like) that is capable of binding to a SARS CoV-2 S glycoprotein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 143, a CDRH2 comprising the sequence set forth in SEQ ID NO: 144, a CDRH3 comprising the sequence set forth in SEQ ID NO: 145, a CDRL1 comprising the sequence set forth in SEQ ID NO: 147, a CDRL2 comprising the sequence set forth in SEQ ID NO: 148, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 149, or (a)(ii) an antibody or antigen-binding fragment thereof that competes with the antibody or antigen-binding fragment of (a)(i) for binding to the SARS CoV-2 S glycoprotein;
(b) (b)(i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S glycoprotein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 109, a CDRH2 comprising the sequence set forth in SEQ ID NO: 110, a CDRH3 comprising the sequence set forth in SEQ ID NO: 111, a CDRL1 comprising the sequence set forth in SEQ ID NO: 133, a CDRL2 comprising the sequence set forth in SEQ ID NO: 134, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 135, or (b)(ii) an antibody or antigen-binding fragment thereof that competes with the antibody or antigen-binding fragment of (b)(i) for binding to the SARS CoV-2 S glycoprotein;
(c) (c)(i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S glycoprotein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRL1 comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 108, or (c)(ii) an antibody or antigen-binding fragment thereof that competes with the antibody or antigen-binding fragment of (c)(i) for binding to the SARS CoV-2 S glycoprotein;
(d) (d)(i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S glycoprotein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRL1 comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO:99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100, or (d)(ii) an antibody or antigen-binding fragment thereof that competes with the antibody or antigen-binding fragment of (d)(i) for binding to the SARS CoV-2 S glycoprotein. Embodiment 50. The composition of Embodiment 49, further comprising a pharmaceutically acceptable carrier, excipient, or diluent.
Embodiment 51. The composition of Embodiment 49 or 50, wherein:
(1) the antibody or antigen-binding fragment of (a)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity ( e.g ., as determined using BLAST) (e.g., 100% identity) to the amino acid sequence set forth in SEQ ID NO: 142 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 146;
(2) the antibody or antigen-binding fragment thereof of (b)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 123 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO: 138;
(3) the antibody or antigen-binding fragment thereof of (c)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 101 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 105; and/or
(4) the antibody or antigen-binding fragment thereof of (d)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO:93 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO:97. Embodiment 52. A composition comprising:
(a) (a)(i) antibody S2M11, or an antigen-binding fragment thereof, or (a)(ii) an antibody or antigen-binding fragment thereof that competes with (a)(i) for binding to a SARS-CoV-2 S glycoprotein;
(b) (b)(i) antibody S2E12, or an antigen-binding fragment thereof, or (b)(ii) an antibody or antigen-binding fragment thereof that competes with (b)(i) for binding to a SARS-CoV-2 S glycoprotein;
(c) (c)(i) antibody S309, or an antigen-binding fragment thereof, or (c)(ii) an antibody or antigen-binding fragment thereof that competes with (c)(i) for binding to a SARS-CoV-2 S glycoprotein; or
(d) any combination of (a)-(c) above.
Embodiment 53. The composition of Embodiment 52, further comprising a pharmaceutically acceptable carrier, excipient, or diluent.
Embodiment 54. The antibody or antigen-binding fragment of any one of Embodiments 1-31, the combination of Embodiment 36, or the composition of any one of Embodiments 37, 38, and 49-53, wherein any one or more of the antibodies or antigen binding fragments comprises a Fc polypeptide comprising:
(i) a mutation that enhances binding to a human FcRn and/or extends an in vivo half-life of antibody or antigen-binding fragment, optionally a M428L mutation, a N434S mutation, YTE mutation, or any combination thereof; and/or
(ii) a mutation that that enhances binding to a human FcyR, optionally a G236A mutation, a A330L mutation, a I332E, a S239D mutation, or any combination thereof.
Embodiment 55. The composition of any one of Embodiments 49-54 for use in treating or preventing SARS-CoV-2 infection. Embodiment 56. A method of treating or preventing SARS-CoV-2 infection in a subject, comprising administering to the subject an effective amount of the composition of any one of Embodiments 49-54.
Embodiment 57. A method of treating or preventing a SARS-CoV-2 infection in a subject, comprising administering to the subject an effective amount of any one or more of:
(a) (i) an antibody or antigen-binding fragment thereof ( e.g ., Fv, scFv, Fab, scFab, or the like) that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 143, a CDRH2 comprising the sequence set forth in SEQ ID NO: 144, a CDRH3 comprising the sequence set forth in SEQ ID NO: 145, a CDRL1 comprising the sequence set forth in SEQ ID NO: 147, a CDRL2 comprising the sequence set forth in SEQ ID NO: 148, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 149, or (ii) an antibody or antigen binding fragment thereof that competes with the antibody or antigen-binding fragment of (i) for binding to the SARS CoV-2 S protein;
(b) (i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 109, a CDRH2 comprising the sequence set forth in SEQ ID NO: 110, a CDRH3 comprising the sequence set forth in SEQ ID NO: 111, a CDRLl comprising the sequence set forth in SEQ ID NO: 133, a CDRL2 comprising the sequence set forth in SEQ ID NO: 134, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 135, or (ii) an antibody or antigen-binding fragment thereof that competes the antibody or antigen-binding fragment of (i) for binding to the SARS CoV- 2 S protein;
(c) (i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRLl comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 108, or (ii) an antibody or antigen-binding fragment thereof that competes the antibody or antigen-binding fragment of (i) for binding to the SARS CoV- 2 S protein; (d) (i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRLl comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO:99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100, or (ii) an antibody or antigen-binding fragment thereof that competes the antibody or antigen-binding fragment of (i) for binding to the SARS CoV- 2 S protein.
Embodiment 58. The method of Embodiment 57, wherein: (1) the antibody or antigen-binding fragment of (a)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity ( e.g ., as determined using BLAST) (e.g., 100% identity) to the amino acid sequence set forth in SEQ ID NO: 142 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 146;
(2) the an antibody or antigen-binding fragment thereof of (b)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 123 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO: 138;
(3) the an antibody or antigen-binding fragment thereof of (c)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 101 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 105; and/or
(4) the antibody or antigen-binding fragment thereof of (d)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO:93 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO:97.
Embodiment 59. A method of treating or preventing a SARS-CoV-2 infection in a subject, comprising administering to the subject an effective amount of one of (a)-(d):
(a) (i) an antibody or antigen-binding fragment thereof ( e.g ., Fv, scFv, Fab, scFab, or the like) that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 143, a CDRH2 comprising the sequence set forth in SEQ ID NO: 144, a CDRH3 comprising the sequence set forth in SEQ ID NO: 145, a CDRL1 comprising the sequence set forth in SEQ ID NO: 147, a CDRL2 comprising the sequence set forth in SEQ ID NO: 148, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 149, or (ii) an antibody or antigen binding fragment thereof that competes with the antibody or antigen-binding fragment of (i) for binding to the SARS CoV-2 S protein;
(b) (i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 109, a CDRH2 comprising the sequence set forth in SEQ ID NO: 110, a CDRH3 comprising the sequence set forth in SEQ ID NO: 111, a CDRL1 comprising the sequence set forth in SEQ ID NO: 133, a CDRL2 comprising the sequence set forth in SEQ ID NO: 134, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 135, or (ii) an antibody or antigen-binding fragment thereof that competes the antibody or antigen-binding fragment of (i) for binding to the SARS CoV- 2 S protein;
(c) (i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRLl comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID
NO: 108, or (ii) an antibody or antigen-binding fragment thereof that competes the antibody or antigen-binding fragment of (i) for binding to the SARS CoV-2 S protein;
(d) (i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO:94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRLl comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO:99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100, or (ii) an antibody or antigen-binding fragment thereof that competes the antibody or antigen-binding fragment of (i) for binding to the SARS CoV- 2 S protein; wherein the subject has received, or is receiving, any one or more of the other of (a)-(d) ( e.g ., administering an effective amount of (a) to a subject who has received or is receiving (b), (c), and/or (d).
Embodiment 60. The method of Embodiment 59, wherein:
(1) the antibody or antigen-binding fragment of (a)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity (e.g., as determined using BLAST) (e.g, 100% identity) to the amino acid sequence set forth in SEQ ID NO: 142 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 146;
(2) the antibody or antigen-binding fragment thereof of (b)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 123 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO: 138;
(3) the antibody or antigen-binding fragment thereof of (c)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 101 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 105; and/or (4) the antibody or antigen-binding fragment thereof of (d)(i) comprises a
VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO:93 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO:97.
Embodiment 61. The method of any one of Embodiments 57-60, wherein an antibody or antigen-binding fragment administered to the subject comprises a Fc polypeptide comprising:
(i) a mutation that enhances binding to a human FcRn and/or extends an in vivo half-life of antibody or antigen-binding fragment, optionally a M428L mutation, a
N434S mutation, YTE mutation, or any combination thereof; and/or
(ii) a mutation that that enhances binding to a human FcyR, optionally a G236A mutation, a A330L mutation, a I332E, a S239D mutation, or any combination thereof. Embodiment 62. A method of diagnosing a SARS-CoV-2 infection, comprising contacting the composition of any one of Embodiments 49-54 with a sample from a subject and detecting the presence or absence of a complex comprising the antibody or antigen-binding fragment and an antigen.
Embodiment 63. The composition of any one of Embodiments 49-54 for use in determining whether a SARS-CoV-2 vaccine composition comprises an epitope in a correct conformation for binding by the antibody(ies) or antigen-binding fragment(s) thereof.
Embodiment 64. An immunogenic composition comprising:
(a) a SARS-CoV-2 S polypeptide or multimer thereof that comprises two or three receptor binding domains (RBDs) in a closed-conformation, wherein two adjacent RBDs are in a closed conformation;
(b) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 143, a CDRH2 comprising the sequence set forth in SEQ ID NO: 144, a CDRH3 comprising the sequence set forth in SEQ ID NO: 145, a CDRL1 comprising the sequence set forth in SEQ ID NO: 147, a CDRL2 comprising the sequence set forth in SEQ ID NO: 148, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 149;
(c) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 109, a CDRH2 comprising the sequence set forth in SEQ ID NO: 110, a CDRH3 comprising the sequence set forth in SEQ ID NO: 111, a CDRLl comprising the sequence set forth in SEQ ID NO: 133, a CDRL2 comprising the sequence set forth in SEQ ID NO: 134, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 135; or any combination of (a)-(c). Embodiment 65. The immunogenic composition of Embodiment 64, further comprising:
(d) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRL1 comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 108;
(e) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO:94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRL1 comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO: 99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100; or a combination thereof.
Embodiment 66. An immunogenic composition comprising:
(a) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a VH comprising the sequence set forth in SEQ ID NO: 142 and a VL comprising the sequence set forth in SEQ ID NO: 146;
(b) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a VH comprising the sequence set forth in SEQ ID NO: 123 and a VL comprising the sequence set forth in SEQ ID NO: 138; or a combination thereof. Embodiment 67. The immunogenic composition of Embodiment 66, further comprising:
(c) a SARS-CoV-2 S protein polypeptide capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRL1 comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 108;
(d) a SARS-CoV-2 S protein polypeptide capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRL1 comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO:99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100; or a combination thereof.
Embodiment 68. An immunogenic composition comprising:
(a) a SARS-CoV-2 S polypeptide capable of being bound by antibody S2M11, or an antigen-binding fragment thereof;
(b) a SARS-CoV-2 S polypeptide capable of being bound by antibody S2E12, or an antigen-binding fragment thereof;
(c) a SARS-CoV-2 S polypeptide capable of being bound by antibody S309, or an antigen-binding fragment thereof; or
(d) any combination of (a)-(c) above.
Embodiment 69. The immunogenic composition of any one of Embodiments 64-68, further comprising a pharmaceutically acceptable carrier, excipient, or diluent, and/or comprising an adjuvant. Table 2. Sequences
Figure imgf000112_0001
Figure imgf000113_0001
Figure imgf000114_0001
Figure imgf000115_0001
Figure imgf000116_0001
Figure imgf000117_0001
Figure imgf000118_0001
Figure imgf000119_0001
Figure imgf000120_0001
Figure imgf000121_0001
Figure imgf000122_0001
Figure imgf000123_0001
Figure imgf000124_0001
Figure imgf000125_0001
Figure imgf000126_0001
Figure imgf000127_0001
Figure imgf000128_0001
Figure imgf000129_0001
Figure imgf000130_0001
Figure imgf000131_0001
Figure imgf000132_0001
Figure imgf000133_0001
Figure imgf000134_0001
Figure imgf000135_0001
Figure imgf000136_0001
Figure imgf000137_0001
Figure imgf000138_0001
Figure imgf000139_0001
Figure imgf000140_0001
Figure imgf000141_0001
Figure imgf000142_0001
Figure imgf000143_0001
Figure imgf000144_0001
Figure imgf000145_0001
Figure imgf000146_0001
Figure imgf000147_0001
Figure imgf000148_0001
EXAMPLES
EXAMPLE 1
NEUTRALIZING ANTIBODIES AGAINST SARS-COV-2
Human monoclonal antibodies isolated from patients who recovered from SARS-CoV-2 infection were expressed recombinantly and were tested in neutralization assays against SARS-CoV-2 vims. SARS-CoV-2 strain 2019 n-CoV/USA_WAl/2020 was obtained from the United States Centers for Disease Control and Prevention. Vims was passaged once in Vero CCL81 cells (ATCC) and titrated by focus-forming assay on Vero E6 cells. Serial dilutions of indicated mAbs were incubated with 102 FFU of SARS-CoV-2 for 1 hour at 37 °C. Antibody-vims complexes were added to Vero E6 cell monolayers in 96-well plates and incubated at 37 °C for 1 hour. Subsequently, cells were overlaid with 1% (w/v) methylcellulose in MEM supplemented with 2% FBS. Plates were harvested 30 hours later by removing overlays and fixed with 4% PFA in PBS for 20 minutes at room temperature. Plates were washed and sequentially incubated with 1 pg/mL of CR3022 anti-S antibody and HRP-conjugated goat anti human IgG in PBS supplemented with 0.1% saponin and 0.1% BSA. SARS-CoV-2- infected cell foci were visualized using TmeBlue peroxidase substrate (KPL) and quantitated on an ImmunoSpot microanalyzer (Cellular Technologies). Data were processed using Prism software (GraphPad Prism 8.0). Results are shown in Figures 1A and IB. Calculated IC50 values (ng/ml) for
Figure 1 A are shown in Table 3. Calculated EC50 values (ng/ml) for Figure IB are listed to the right of the graph in Figure IB. Figure 1 A includes comparator antibody S309, isolated from a patient who recovered from SARS-CoV-1 infection. Table 3. Calculated IC50 values for Antibodies shown in Figure 1A
Figure imgf000149_0001
Neutralization assays were carried out using additional monoclonal antibodies using similar methods. Results are shown in Figures 5A-5C. Figure 5A shows results for antibody S2X190 and four comparator antibodies. Figure 5B shows results for antibody S2X129 and four comparator antibodies. Figure 5C shows results for antibodies S2X132 and S2X127, along with 4 comparator antibodies. Calculated EC50 values are shown to the right of each graph. Neutralization of SARS-CoV-2 Infection by Antibody Combinations
Neutralization of SARS-CoV-2 infection by combinations of monoclonal antibodies was assessed using a SARS-CoV-2 live virus assay.
SARS-CoV-2 strain 2019n-CoV/USA_WAl/2020 was obtained from the Centers for Disease Control and Prevention. The virus was passaged once in Vero CCL81 cells (ATCC) and titrated by focus-forming assay on Vero E6 cells. Neutralization assays were carried out as follows. Serial dilutions of monoclonal antibodies were incubated with 102 FFU of SARS-CoV-2 for one hour at 37°C. Antibody-virus complexes were added to Vero E6 cell monolayers in 96-well plates and incubated at 37°C for one hour. Subsequently, cells were overlaid with 1% (w/v) methylcellulose in MEM supplemented with 2% FBS. Plates were harvested 30 hours later by removing overlays and fixed with 4% PFA in PBS for 20 minutes at room temperature. Plates were washed and sequentially incubated with one pg/mL of CR3022 (Yuan et al, 2020) anti-S antibody and HRP-conjugated goat anti-human IgG in PBS supplemented with 0.1% saponin and 0.1% BSA. SARS-CoV-2-infected cell foci were visualized using TrueBlue peroxidase substrate (KPL) and quantitated on an ImmunoSpot microanalyzer (Cellular Technologies). Data were processed using Prism software (GraphPad Prism 8.0).
Neutralization of SARS-CoV-2 infection by monoclonal antibodies S309, S2H14, and S2X2 alone or in combination was assessed. S309, S2H14, and S2X2 were tested individually, S2H14 and S2X2 were each tested in combination with S309, and the combination of all three of S309, S2H14, and S2X2 was tested. Results are shown in Figure 2. Calculated EC50 values are shown below each graph. Additionally, S309, S2H14, and S2A4 were tested individually, S2H14 and S2A4 were each tested in combination with S309, and the combination of all three of S309, S2H14, and S2A4 was tested. Results are shown in Figure 3.
Quantitative Epitope-Specific Serology of SARS-Co V-2 Spike Protein
SARS-CoV-2 Spike protein binding by various antibodies was analyzed by antibody competition assays, cryo-EM data, and crystallography data. From this analysis, Spike RBD antigenic Sites la, lb, Ic, Id, II, and IV were identified. A map showing these sites and exemplary antibodies that bind within each site is shown in Figure 4.
Further Characterization of Antibodies
Antibodies were further studied to assess function and structure. Data from these experiments is shown in Figures 6-22B. S2X259 binding was evaluated at 3.1- angstrom and 2.65-angstrom resolution. From these studies, the S2X259 epitope is formed by amino acid residues 369-386, 404-411, and 499-508 of the S glycoprotein (SEQ ID NO: 3). S2X259 does not appear to contact amino acids 406, 409, 410, 411, 499, 500, 505, and 507.
Materials and Methods
Flow-cytometry based screening for binding to CoV S protein expressed on mammalian cells
ExpiCHO cells were transfected with S protein of SARS-CoV-2, SARS-CoV and MERS-CoV, or with an empty plasmid as a negative control. The monoclonal antibodies were then tested by flow-cytometry at 10 pg/ml for their ability to stain ExpiCHO cells expressing the S protein of 2019-nCoV, SARS-CoV, MERS-CoV or Mock cell transfectants.
Transient expression of recombinant SARS-CoV-2 protein The full-length S gene of SARS-CoV-2 strain (2019-nCoV-S) isolate
BetaCo V/W uhan-Hu- 1 /2019 (accession number MN908947) was codon optimized for human cell expression and cloned into the phCMVl expression vector (Genlantis). Expi-CHO cells were transiently transfected with phCMVl-SARS-CoV-2-S, phCMVl - MERS-CoV-S (Londonl/2012), SARS-spike_pcDNA.3 (strain SARS) or the empty phCMVl (Mock) using Expifectamine CHO Enhancer. Two days after transfection, cells were collected, fixed, or fixed and permeabilized with saponin for immunostaining with a panel of monoclonal antibodies reactive to SARS-CoV Receptor Binding Domain (RBD). An Alexa647-labelled secondary antibody anti-human IgG Fc was used for detection. Binding of antibodies to transfected cells was analyzed by flow cytometry using a ZE5 Cell Analyzer (Biorard) and FlowJo software (TreeStar).
Positive binding was defined by differential staining of CoV-S-transfectants versus mock-transfectants.
Competition experiments using Octet (BLI, biolayer interferometry)
Unless otherwise indicated herein, anti-His sensors (BIOSENSOR ANTI PENT A-HIS (HIS IK)) were used to immobilize the SI subunit protein of SARS-CoV (Sino Biological Europe GmbH). Sensors were hydrated for 10 min with Kinetics Buffer (KB; 0.01% endotoxin-free BSA, 0.002L Tween-20, 0.005% NaN3 in PBS). SARS-CoV SI subunit protein was then loaded for 8 min at a concentration of 10 pg/ml in KB. Antibodies were associated for 6 min at 15 pg/ml for full length mAbs nCoV-10 and nCov-6 mAbs or 5 pg/ml for Fab nCoV-4, and in a subsequent experiment comprising nCoV-1 all at 10 pg/ml. Competing antibodies were then associated at the same concentration for additional 6 mins.
Competition experiments using Octet (BLI, biolayer interferometry)
For ACE2 competition experiments, ACE2-His (Bio-Techne AG) was loaded for 30 minutes at 5 pg/ml in KB onto anti -HIS (HIS2) biosensors (Molecular Devices- ForteBio). SARS-CoV- 1 RBD-rabbitFc or SARS-CoV-2 RBD-mouseFc (Sino Biological Europe GmbH) at 1 pg/ml was associated for 15 minutes, after a preincubation with or without antibody (30 pg/ml, 30 minutes). Dissociation was monitored for 5 minutes.
Affinity determination using Octet (BLI, biolayer interferometry)
For KD determination of full-length antibodies, protein A biosensors (Pall ForteBio) were used to immobilize recombinant antibodies at 2.7 pg/ml for 1 minute, after a hydration step for 10 minutes with Kinetics Buffer. Association curves were recorded for 5min by incubating the antibody-coated sensors with different concentration of SARS-CoV- 1 RBD (Sino Biological) or SARS-CoV-2 RBD (produced in house; residues 331-550 of spike from BetaCoV/Wuhan-Hu-1/2019, accession number MN908947). Highest RBD concentration tested was lOug/ml, then 1 :2.5 serially diluted. Dissociation was recorded for 9min by moving the sensors to wells containing KB. KD values were calculated using a global fit model (Octet). Octet Red96 (ForteBio) equipment was used.
For KD determination of full-length antibodies compared to Fab fragments, His- tagged RBD of SARS-CoV-1 or SARS-CoV-2 were loaded at 3 pg/ml in KB for 15 minutes onto anti -HIS (HIS2) biosensors (Molecular Devices, ForteBio). Association of full-length antibody and Fab was performed in KB at 15 ug/ml and 5 ug/ml respectively for 5 minutes. Dissociation in KB was measured for lOmin.
ELISA binding
The reactivities of mAbs with SARS-CoV Spike SI Subunit Protein (strain WH20) protein were determined by enzyme-linked immunosorbent assays (ELISA). Briefly, 96-well plates were coated with 3 pg/ml of recombinant SARS-CoV Spike SI Subunit Protein (Sino. Biological). Wells were washed and blocked with PBS+1%BSA for 1 h at room temperature and were then incubated with serially diluted mAbs for 1 h at room temperature. Bound mAbs were detected by incubating alkaline phosphatase- conjugated goat anti-human IgG (Southern Biotechnology: 2040-04) for 1 h at room temperature and were developed by 1 mg/ml p-nitrophenylphosphate substrate in 0.1 M glycine buffer (pH 10.4) for 30 min at room temperature. The optical density (OD) values were measured at a wavelength of 405 nm in an ELISA reader (Powerwave 340/96 spectrophotometer, BioTek).
Neutralization assay
Unless otherwise indicated, Murine leukemia virus (MLV) pseudotyped with SARS-CoV-2 Spike protein (SARS-CoV-2pp) or SARS-CoV-1 Spike protein (SARS- CoV-lpp) were used. DBT cells stably transfected with ACE2 (DBT-ACE2) were used as target cells. SARS-CoV-2pp or SARS-CoV-lpp was activated with trypsin TPCK at lOug/ml. Activated SARS-CoV-2pp or SARS-CoV-lpp was added to a dilution series of antibodies (starting 50ug/ml final concentration per antibody, 3-fold dilution). DBT- ACE2 cells were added to the antibody-virus mixtures and incubated for 48h. Luminescence was measured after aspirating cell culture supernatant and adding steady - GLO substrate (Promega). Unless otherwise indicated, pseudoparticle neutralization assays use a VSV- based luciferase reporter pseudotyping system (Kerafast). VSV pseudoparticles and antibody are mixed in DMEM and allowed to incubate for 30 minutes at 37C. The infection mixture is then allowed to incubate with Vero E6 cells for lh at 37C, followed by the addition of DMEM with Pen-Strep and 10% FBS (infection mixture is not removed). The cells are incubated at 37C for 18-24 hours. Luciferase is measured using an Ensight Plate Reader (Perkin Elmer) after the addition of Bio-Glo reagent (Promega).
SPR single-cycle kinetics
SPR experiments were carried out with a Biacore T200 instrument using a single-cycle kinetics approach. S309 IgG was captured on the surface and increasing concentrations of purified SARS-CoV-2 RBD, either glycosylated or deglycosylated, were injected. Association and dissociation kinetics were monitored and fit to a binding model to determine affinity.
Expression of recombinant antibodies
Recombinant antibodies were expressed in ExpiCHO cells transiently co transfected with plasmids expressing the heavy and light chain as previously described. (Stettler etal. (2016) Specificity, cross-reactivity, and function of antibodies elicited by Zika virus infection. Science, 353(6301), 823-826) Monoclonal antibodies S303,
S304, S306, S309, S310, and S315 were expressed as rlgG-LS antibodies. The LS mutation confers a longer half-life in vivo. (Zalevsky et al. (2010) Enhanced antibody half-life improves in vivo activity. Nature Biotechnology, 28(2), 157-159)
Sequence alignment
SARS-CoV-2 genomics sequences were downloaded from GISAID on March 29th 2020, using the "complete (>29,000 bp)" and "low coverage exclusion" filters. Bat and pangolin sequences were removed to yield human-only sequences. The spike ORF was localized by performing reference protein (YP_009724390.1)-genome alignments with GeneWise2. Incomplete matches and indel-containing ORFs were rescued and included in downstream analysis. Nucleotide sequences were translated in silico using seqkit. Sequences with more than 10% undetermined aminoacids (due to N basecalls) were removed. Multiple sequence alignment was performed using MAFFT. Variants were determined by comparison of aligned sequences (n=2,229) to the reference sequence using the R/Bioconductor package Biostrings. A similar strategy was used to extract and translate spike protein sequences from SARS-CoV genomes sourced from ViPR (search criteria: SARS-related coronavirus, full-length genomes, human host, deposited before December 2019 to exclude SARS-CoV-2, n=53). Sourced SARS-CoV genome sequences comprised all the major published strains, such as Urbani, Tor2, TW1, P2, Frankfurtl, among others. Pangolin sequences as shown by Tsan-Yuk Lam et al were sourced from GISAID. Bat sequences from the three clades of Sarbecoviruses as shown by Lu et al (Lancet 2020) were sourced from Genbank. Civet and racoon dog sequences were similarly sourced from Genbank.
EXAMPLE 2
MAPPING NEUTRALIZING AND IMMUNODOMINANT SITES ON THE SARS-CoV-2 SPIKE RECEPTOR-BINDING DOMAIN BY STRUCTURE-GUIDED HIGH-RESOLUTION
SEROLOGY
Analysis of the specificity and kinetics of neutralizing antibodies (Abs) elicited by SARS-CoV-2 infection is important for understanding immune protection. In a cohort of 647 SARS-CoV-2-infected subjects, it was found that both the magnitude of Ab responses to SARS-CoV-2 spike (S) and nucleoprotein and nAb titers correlate with clinical scores. Based on these studies, the receptor-binding domain (RBD) is immunodominant and is the target of 90% of the neutralizing activity present in SARS- CoV-2 immune sera. Whereas overall RBD-specific serum IgG titers waned with a half-life of 49 days, titers and avidity of blocking antibodies increased over time for some individuals, consistent with affinity maturation. An RBD antigenic map was structurally defined and serum Abs specific for distinct RBD epitopes were serologically quantified, leading to the identification of two major receptor-binding motif antigenic sites. IgG, IgA and IgM response to SARS-CoV-2 infection
Plasma or serum samples collected between March and July 2020 from 647 SARS-CoV-2-infected individuals, as determined by PCR (n=271) or by diagnosis based on signs and symptoms (n=392), were analyzed. A total of 1,078 samples, including multiple time points, were collected from 5 different cohorts in Italy, Switzerland and the US, which comprised 47 hospitalized, 556 symptomatic and 44 asymptomatic individuals, as well as 32 pre-pandemic healthy donors (Figures 23A- 23C). For each sample, IgG, IgA, and IgM binding titers to the SARS-CoV-2 prefusion- stabilized S ectodomain (Walls et al., 2020), the RBD, domain A (residues 14-302), the S2 subunit (residues 685-1211) and the N protein, were evaluated by ELISA.
The IgG responses were on average 1-2 orders of magnitude higher in hospitalized relative to non-hospitalized individuals and varied across SARS-CoV-2 antigens and among subjects (Figures 28 A and 24 A). Males had higher Ab titers than females, although no correlation with age was observed. Levels of SARS-CoV-2 S- and N-specific IgG correlated within each individual (p value <0.0001) (Figure 24D). SARS-CoV-2 RBD-specific Abs dominated IgG responses whereas much lower titers were observed to the S2 subunit or domain A (Figure 28A). These findings might be related to the more extensive N-glycan shielding of domain A and the S2 subunit, which respectively harbor 8 and 9 oligosaccharides, relative to the RBD that only possesses 2 N-linked glycans (Walls et al., 2020; Watanabe et al., 2020). The majority of samples contained IgG cross-reactive to the SARS-CoV prefusion-stabilized S ectodomain (Walls et al., 2019) and RBD with 3-fold and 15-fold lower binding titers than those for the corresponding SARS-CoV-2 antigens, respectively (Figures 24E-24G). The observed cross-reactivity between these two viruses are consistent with the 76% sequence identity shared between the two S glycoprotein ectodomains and recent findings (Barnes et al., 2020).
IgA responses to SARS-CoV-2 S and N were detected almost exclusively in hospitalized patients (Figures 28B and 24B) whereas IgM responses were limited to S and undetectable for N (Figures 28C and 24C). In addition, SARS-CoV-2 S- and RBD- specific IgM were detectable up to 60 days after symptom onset, suggesting that detection of IgM antibodies is not associated with an ongoing or recent infection (Figure 24C). Finally, in the 459 individuals of the Ticino healthcare workers cohort, for which a symptom score was available, SARS-CoV-2 RBD-specific IgG, IgA and IgM and SARS-CoV-2 N-specific IgG binding titers were proportional to the severity of symptoms (Figure 28D). This serological analysis indicates that the responses varied amongst different individuals and amongst groups, with binding titers proportional to the severity of symptoms, possibly due to a prolonged exposure to large amounts of viral antigens during the course of viral disease.
Function of Antibodies in blocking S interactions with ACE2
To determine if the RBD is the primary target of neutralizing Abs in COVID-19 convalescent plasma in this study, neutralizing titers were measured before and after Ab depletion using RBD-coated beads. An almost complete depletion of RBD-specific Abs from 21 plasma samples reduced SARS-CoV-2 neutralizing titers by -90% on average (Figure 28E and other data not shown). It was then evaluated whether RBD-specific Abs in patient serum or plasma samples inhibit binding of the SARS-CoV-2 RBD to ACE2. Although 77% of hospitalized individuals had Ab titers that blocked SARS- CoV-2 RBD binding to ACE2 efficiently (BD80 > 10), only 18% and 11% of non- hospitalized symptomatic and asymptomatic individuals had Abs strongly interfering with ACE2 binding, respectively (Figure 28F). The proportion of non-hospitalized individuals with ACE2 -blocking Abs correlated with the anti-RBD Ab binding titers which parallel symptom severity (Figures 28D, 28G and other data not shown). These results suggest that although all SARS-CoV-2-infected individuals can produce RBD- specific Abs, they may not be endowed with enough avidity or are not present at a sufficiently high concentration to block RBD binding to ACE2 effectively. This is illustrated by the large fraction of samples with RBD binding titers ranging between 102 to 103 and which did not block RBD binding to ACE2 efficiently (Figure 28H). A positive correlation between the titers of Abs inhibiting RBD binding to ACE2 and neutralizing serum Ab titers (ID80) (Figure 281) was observed, suggesting that the blockade-of-binding approach could be implemented as a high-throughput, alternative method to measuring serum neutralizing Ab titers, as recently suggested (Tan et al., 2020).
Collectively, these findings indicate that the Ab responses to SARS-CoV-2 S were dominated by anti-RBD Abs and that the majority of the neutralizing activity against SARS-CoV-2 was mediated by RBD-specific Abs interfering with binding to ACE2.
Kinetics of Ab responses upon natural SARS-CoV-2 infection
To characterize persistence of potentially protective Abs, a longitudinal analysis of IgG titers specific for SARS-CoV-2 antigens at two time points (average of 44 days between samples) in 368 individuals tested within 3 months of infection was performed. RBD-specific IgG titers declined by 35% on average between the two time points tested (Figures 29A-29B), with a monthly average decay of approximately 25%, and this trend was independent of the magnitude of the initial binding titers. Kinetics of RBD- and N- specific serum IgG were also followed over a period of up to 126 days from the collection of the first sample (approximately 150 days after onset of symptoms) for a subset of 24 individuals (Figure 29C). This analysis revealed an average decay of RBD- specific IgGs of 67% over four months (21% per month), consistent with the above finding with a larger cohort. To further characterize the decay kinetics of the RBD- and N-specific IgG following onset of disease symptoms, a longitudinal mixed effects model was employed in a subset of 18 convalescent, hospitalized and symptomatic, individuals who had available data on symptom onset from the start of infection (Figure 29D). The model predicted a half-life of 49 days for RBD-specific IgG Abs and 75 days for S- and N-specific IgG Abs (Figure 29D and data not shown), respectively. No significant differences were observed in the decay kinetics in the hospitalized compared to symptomatic individuals.
The kinetics of anti-RBD Ab titers blocking attachment to ACE2 did not mirror the overall decay observed for RBD-specific IgG. In the same samples, an increase in Ab titers blocking attachment to ACE2 for 47% of the individuals who made this type of Abs (which account for 20% of subjects analyzed) as observed (Figures 29E-29F). This increase, which is not influenced by the initial titer of RBD-specific Abs, might result from the development of Abs with increasingly higher affinity, in the context of an overall waning of Abs titers targeting the RBD. Indeed, an overall increased avidity of RBD-specific Abs between the two time points tested was measured (Figures 29G- 29H).
Although a progressive decay of Ab titers was observed, these results demonstrate a change in the quality of the Ab responses that may result in increased neutralizing activity based on the aforementioned correlation with blocking ACE2 attachment.
Structural characterization of the S2H13 RBM-specific neutralizing mAh recognizing multiple RBD conformers
Given the heterogeneity of the humoral responses across individuals and the fact the RBD is the prime target of neutralizing Abs, the fine specificity of RBD-targeting Abs elicited in SARS-CoV-2-exposed individuals (Figures 25A-25B) was investigated. To understand SARS-CoV-2 neutralization, six mAbs with distinct function and epitope recognition (Figures 25A-25C) were selected from a large panel of RBD-specific Abs for structural characterization of their Fab fragments in complex with the SARS-CoV-2 S ectodomain trimer by cryoEM.
S2H13, a neutralizing mAh, was isolated from plasma cells of a SARS-CoV-2 infected individual 17 days after disease onset (Figures 30A and 25A). CryoEM characterization led to the identification of two conformational states corresponding to a closed S trimer and a trimer with one RBD open, each with three S2H13 Fabs bound, for which 3D reconstructions at 3.0 A (with 3-fold symmetry) and 3.4 A (asymmetric) resolution, respectively, were determined (Figures 30B-30D and 53A-53E; other data not shown). To improve the resolvability of the S2H13 density, which was much lower than most other regions of the map, local refinement was used to determine a reconstruction at ~3.5 A resolution enabling building the S2H13 variable domains and its epitope (Figure 53F, other data not shown).
S2H13 recognizes an epitope located within the crevice formed by the receptor binding motif (RBM) b-hairpin of the RBD, which is accessible in both the closed and open S states, thereby explaining the stoichiometric binding of Fab to each protom er of the S trimer (Figures 30B-30D and 27A). S2H13 recognition of the SARS-CoV-2 RBM is mediated by electrostatic interactions and shape complementarity, and is dominated by unusual contacts involving CDRL2/FRL3, accounting for 55% of the -700 A2 of surface area buried by the Fab, in addition to the 13-residue long CDRH3, CDRH1, FRL1 and the heavy chain N-terminal end. Specifically, S2H13 FRL1 and CDRL2/FRL3 interacts with the SARS-CoV-2 residues 444-449 whereas the heavy chain N-terminus, CDRH1, CDRH3 and CDRL2/FRL3 recognize the tip of the RBM spanning residues 472-498 (Figure 30E). Further analysis (3.0 angstrom resolution) indicated that S2H13 does not contact amino acids 448, 473-478, 487, 491, 492, 495, 496, and 497.
Superimposition of the SARS-CoV-2 RBD/ACE2 structures (Lan et al., 2020; Shang et al., 2020; Wang et al., 2020b; Yan et al., 2020) onto the SARS-CoV-2 S/S2H13 complex reveals that S2H13 and ACE2 would clash upon binding to S and that they share partially overlapping binding sites although they have almost orthogonal orientations relative to the RBD (Figure 30F). These findings were confirmed using biolayer interferometry and ELISA to show that S2H13 competes with ACE2 for recognition of the SARS-CoV-2 RBD (Figures 30G and 25D). Therefore, S2H13 may neutralize SARS-CoV-2 by preventing viral attachment to host cells via recognition of an S epitope that remains accessible in both open and closed S states, which is not the case for the ACE2 -binding site.
Only 6 out of 20 residues within the S2H13 epitope are conserved across SARS- CoV-2 and SARS-CoV, explaining the lack of binding to the latter virus (Figures 30H, 25B and 26A-26B). Substitutions of 7 epitope residues have been reported among the -74,000 SARS-CoV-2 isolates sequenced to date, indicating that potential escape mutants might have already emerged to this site (Figures 30H and 25F; other data not shown).
Structural characterization of the neutralizing S2H14 mAh targeting an RBM epitope accessible uniquely in the open S state
The S2H14 neutralizing mAh was isolated from the plasma cells from the same SARS-CoV-2 convalescent individual from which S2H13 was obtained and does not carry somatic hypermutations in the heavy or light chain variable regions (Figures 31 A and 25A).
CryoEM analysis showed that a subset of the selected particle images corresponded to an S trimer with one RBD closed and two RBDs open (Figures 3 IB and 31C), whereas the rest of the data featured an S trimer with all three RBDs open (Figures 3 ID and 3 IE). In agreement with ELISA data, S2H14 recognizes the RBD (Figures 25B and 27A) and each of the three RBDs interacted with an S2H14 Fab in both conformational states. Asymmetric 3D reconstructions for each of the two conformational states were determined at 7.8 A and 8.5 A resolution, respectively, along with crystal structures of the S2H14 Fab and the RBD bound to the S2H14, S309 and S304 Fabs at 2.5A and 2.65A resolution, respectively (Figures 31B-31E and 53G- 53K; other data not shown).
The observation of SARS-CoV-2 S trimers with two and three RBDs open suggest that S2H14 binding conformationally selects open RBDs in a way reminiscent of the SARS-CoV S230 (Walls et al., 2019) and of the SARS-CoV-2 Cl 05 (Barnes et al., 2020) neutralizing mAbs. Indeed, these findings differ from what those observed for SARS-CoV-2 S without (Walls et al., 2020) or with bound Fabs, such as S309 (Pinto et al., 2020) or S2H13, which recognize epitopes accessible in all prefusion S states, hence no conformational selection occurred. Although the S2H14 epitope is masked in the closed S trimer, the present cryoEM data show that opening of two RBDs is enough to allow three Fabs to bind to an S trimer, as the remaining closed RBD can engage a Fab due to its angle of approach (Figures 26B and 26C).
S2H14 recognizes an epitope overlapping with the RBM which is inaccessible in the closed S state but becomes exposed upon RBD opening (Figures 26B-26E), similar to the ACE2 -binding site (Walls et al., 2020; Wrapp et al., 2020). The crystal structure of the RBD bound to the S2H14, S309 and S304 Fabs show that CDRH1-H3 and CDRL1-L3 participate in the CDRH3 -dominated S2H14 paratope which buries 900A2 at the interface with the RBM. The epitope spans the entire RBM crevice and involves SARS-CoV-2 S residues 403, 444-456, 475 and 485-505 that interact with S2H14 via hydrogen-bonding and shape complementarity (Figure 26A). Further analysis indicated that S2H14 does not contact amino acids 448, 450, 451, 452, 454, 486, 488, 490, 491, 492, 497, 503, and 504.
The structures show that S2H14 and ACE2 bind to largely overlapping sites in the RBM (Figure 4F) and would be sterically incompatible with simultaneous binding to a single SARS-CoV-2 RBD (Figure 4G). This observation was validated using biolayer interferometry and ELISA to show that S2H14 competed with ACE2 for recognition of the SARS-CoV-2 RBD (Figures 4H and 25D), indicating that S2H14 likely neutralizes SARS-CoV-2 through inhibition of virus/host cell interaction.
13 out of 23 epitopes residues are substituted between SARS-CoV-2 and SARS- CoV, thereby rationalizing the lack of cross-reactivity of S2H14 with the latter virus (Figure 41, Figures 25B and 26A-26B; other data not shown). Moreover, SARS-CoV-2 variants have already been detected for 13 epitope residues which suggests that some of the viruses currently circulating in humans might be able to escape S2H14-mediated neutralization (Figure 25F).
The S2A4 mAh recognizes a cryptic epitope leading to release of the Si subunit
The S2A4 mAh was isolated from memory B cells of a hospitalized patient 24 days after disease onset and was found to weakly neutralize SARS-CoV-2 infection (Figures 32A and 25A).
2D and 3D classification of the cryoEM dataset revealed the presence of three distinct open conformations of the S trimer, with three bound S2A4 Fabs and RBDs swung out to various extent, as well as an Si subunit trimer class (Figures 32B-32C and 54A-54H). 3D reconstructions of the three open conformations of the S/S2A4 complex at 3.3 A resolution (applying 3-fold symmetry) and at 3.8Ά and 3.9Ά resolution (asymmetric) were determined (Figures 32B, 32C and 54A-54H; other data not shown). To improve the resolution of the S2A4 density, which was lower than the overall map resolution, local refinement was used to yield a reconstruction at 3.6 A resolution allowing to build the S2A4 variable domains, which was subsequently validated by determining a crystal structure of the S2A4 Fab at 2.5A resolution (Figures 54D-54E; other data not shown). Furthermore, a low-resolution reconstruction of the Si subunit trimer bound to three S2A4 Fabs was obtained (Figures 54G and 54H). S2A4 binds to a cryptic epitope (distinct from the RBM) requiring opening of two adjacent RBDs to be unmasked and allow Fab binding (Figures 32B-32C). This finding along with the detection of an Si subunit turner class, which may be triggered S with a disordered fusion machinery remaining covalently linked (Figure 25G), suggest that S2A4 acts as a molecular ratchet biasing the SARS-CoV-2 S conformational equilibrium towards opened RBDs. These results were confirmed by showing that S2A4 promoted shedding of the Si subunit from cell-surface expressed full-length wild- type S, as was the case with the RBM-targeted S2H14 (Figure 25E). These data are also in line with previous reports of the SARS-CoV neutralizing mAb S230- and ACE2- mediated transition of SARS-CoV S from the prefusion to the postfusion states (Song et ak, 2018; Walls et ah, 2019), the cryoEM observation of Si subunit turners released from the MERS-CoV S ectodomain upon cleavage at S1/S2 (Yuan et ak, 2017) and the fact that S spontaneously refolds to the postfusion state in the absence of the Si subunit (Walls et ak, 2017).
S2A4 binding to the RBD buries an average surface of ~850A2 using all six CDR loops along with contributions from FRH3 and FRL3. CDRH3 and CDRL1 dominate the interface which involve electrostatic and hydrophobic interactions (Figures 32D and 32E). The S2A4 epitope comprises residues 368-388, which form two a -helices and an intervening b-strand participating in the formation of the structurally conserved RBD b-sheet, and residues 407-414 forming an a-helix followed by a loop segment (Figures 32D, 32E and Figure 26 A).
S2A4 recognizes an epitope distinct from the RBM and its footprint does not overlap with the ACE2 -binding site (Figure 32F). However, the present cryoEM structure indicates that upon binding S2A4 would sterically clash with ACE2 interacting with the same protomer within an S turner. Biolayer interferometry and ELISA were used to validate these structural findings and demonstrated that S2A4 and ACE2 compete for binding to the SARS-CoV-2 RBD indicating that the neutralizing activity of this Ab likely results from preventing viral attachment to its host cell receptor, albeit with moderate efficiency (Figures 32G and 25D). Sixteen out of 19 epitope residues are conserved across SARS-CoV-2 and SARS-CoV S glycoproteins (Figures 32H, 26A-26B and 25F; other data not shown). However, S2A4 does not cross-react with the SARS-CoV RBD putatively due to steric hindrance with a glycan at position N357 which is absent in the SARS-CoV-2 RBD (Figures 32H, 25B and 26A).
Identification of a SARS-CoV-2 S cryptic supersite defined by the cross-reactive S304 mAh along with S2A4, S2X35 and CR3022 niAbs
Previously isolated from a SARS survivor were two weakly neutralizing, cross reactive mAbs (S304 and S315) that bind the RBD at sites distinct from both the RBM and the S309 epitope (Figures 25A-25C) (Pinto et al., 2020). Cocktails containing either of these two mAbs with S309 led to synergistic enhancement of the S309 neutralization potency against SARS-CoV-2 (Pinto et al., 2020).
Similar to S2A4, 3D classification of the cryoEM data for the S/S304 complex revealed the presence of three distinct open conformations of the S trimer, with three bound Fabs and RBDs swung out to various extent, as well as an Si subunit trimer class bound to three S304 Fabs (Figures 33A-33C and 541-540; other data not shown). A 3D reconstruction at 4.3 A resolution (applying 3-fold symmetry) for one of the open S states and at 8 A resolution (asymmetric) for the other two classes was determined (Figures 33A-33B and 54I-54M; other data not shown). Furthermore, lOA resolution cryoEM reconstruction of the Si subunit trimer with 3 bound S304 Fabs was obtained (Figures 33C, 547N-540).
S304 recognizes a cryptic epitope, which is buried in the closed S conformation but is distinct from the RBM, with one S304 Fab bound to each of the three open RBDs (Figures 33A-33B). CDRH1-H3, CDRLl and CDRL3 interact with SARS-CoV-2 S through burial of an average surface area of 900A2 at the epitope/paratope interface involving electrostatic interactions and shape complementarity (Figure 33D). Based on the crystal structure of the RBD/S304/S309/S2H14 complex, the S304 epitope comprises residues 366-392, which form two a-helices and an intervening b-strand, as well as residues 515-517 (both regions participating in the formation of the structurally conserved RBD b-sheet), and loop residues 411-414 and 427-430 (Figure 33D and Figure 26A). Although S304 binds away from the RBM, partial competition between S304 and ACE2 for binding to the SARS-CoV-2 RBD was observed, which might be explained by steric hindrance with the ACE2 N322 glycan and/or with the ACE2 N- terminus (through the heavy chain constant domain of S304 bound to a neighboring protomer) (Figures 33E and 25D).
Cross-reactivity of S304 with SARS-CoV-2 S and SARS-CoV S is explained by the conservation of 23 out of 25 epitope residues with neither of the two substitutions (PSARS-COV-2384 ASARS-COV and TSARS-COV-2430MSARS-COV) predicted to affect binding in light of structural data (Figures 33F, 25B and 26A). The conserved nature of the S304 epitope among the 74,000 SARS-CoV-2 isolates sequenced to date along with the high amino acid sequence identity within the epitope among sarbecoviruses indicate that S304 is likely to cross-react with other related sarbecoviruses (Figures 25F, 26B and other data not shown).
The S304 epitope partially overlaps with the epitopes of the weakly neutralizing mAh CR3022 (Huo et ak, 2020; Joyce et ah, 2020; ter Meulen et ah, 2006; Tian et al., 2020; Yuan et ak, 2020) and of the neutralizing mAh S2A4 (Figure 33G). It also overlaps with the mAh S2X35 which was isolated from the memory B cells of a COVID-19 convalescent symptomatic individual 48 days after disease onset and which neutralizes entry of SARS-CoV-2 pseudovirus into cells with ICso values of 500 ng/ml (Figures 33H, 25A-25C and other data not shown). Although these mAbs have distinct angles of approach (Figures 33E, 33G and 33H), they conformationally select for open RBDs through recognition of cryptic epitopes requiring opening of at least two RBDs for binding, and lead to release of the Si subunit (Figure 25E). Comparison of the binding poses of these mAbs relative to the SARS-CoV-2 RBD reveal that their neutralization potencies correlate with the Fab proximity to the RBM. Both S2X35 and S2A4 Fabs sterically clash with ACE2 and are more potent neutralizers than S304, which putatively only partially overlap with ACE2 (Figures 33E, 33G, 33H and 25D). Collectively, these data suggest that the ability to hinder ACE2 binding by some mAbs recognizing this cryptic supersite largely explain their neutralization potencies. Fc-mediated effector activation mechanisms by RBD-specific neutralizing mAbs Natural killer-dependent mAb-mediated cell cytotoxicity (ADCC) or macrophage/dendritic cell-dependent mAb-mediated cellular phagocytosis (ADCP) can participate in controlling infections by clearing viruses and infected cells and by stimulating T cell response via presentation of viral antigens (DiLillo and Ravetch, 2015; He et al., 2017). Among the 6 mAbs structurally characterized in this study, S2H13 and S309 promoted ADCC as measured by FcyRIIIa (V158 allele) activation (Figure 25H). A weak activation of FcyRIIa, which is a reporter for ADCP, was observed for S2H13, S2H14 and S2X35, as compared to the robust activation previously observed with mAb S309 (Pinto et al., 2020) (Figure 251). Similarly to what observed in ADCC, only S2H13 and S309 promoted complement-dependent cytotoxicity (Figure 25J). These findings may result from the different orientation and/or positioning of the S-bound mAb Fc fragments relative to FcyRIIIa and FcyRIIa receptors, as well as to the Clq subcomponent of the classical complement pathway, and suggests that only a fraction of RBD-specific Abs can recruit Fc-dependent protective mechanisms in vivo , as previously shown for other antiviral Abs (Corti et al., 2011; Hessell et al., 2007; Pinto et al., 2020).
Definition of humoral immunodominant responses in SARS-CoV-2 infected individuals
The epitopes recognized by the 5 aforementioned structurally characterized human mAbs along with S309 cover a large fraction of the SARS-CoV-2 RBD surface and collectively define an RBD antigenic map (Figures 34A and 25C). S2H14 and S2H13 define two classes of RBM-targeting mAbs recognizing sites that are referred to here as la and lb, respectively. Site la largely overlaps with the ACE2 -binding site and is only accessible in the open S state (Figure 34B), whereas site lb partially overlaps with the ACE2 footprint and is accessible in both the open and closed S states (Figure 34C). These epitopes are SARS-CoV-2-specific and harbor several naturally occurring mutations among circulating viral isolates (Figure 25F andother data not shown). The S2X35, S2A4 and S304 mAbs recognize overlapping cryptic epitopes, that are only accessible when at least two RBDs are open, respectively termed sites Ila, lib and lie, which are positioned increasingly further away from the ACE2 -binding site (Figures 34D-34F). Finally, S309 binds to a conserved epitope termed site IV, which is accessible independently of the RBD conformation, and neutralizes SARS-CoV-2 without interfering with ACE2 binding (Figure 34G) (Pinto et al., 2020).
S309 and S2H13 are set apart from the other mAbs studied here as they recognize epitopes accessible in both the closed and open S states. Consistent with a recent report that the closed S state is favored at endosomal pH (Zhou et al., 2020b), binding of all mAbs to the S ectodomain was dampened at pH 5.4, except for S309 and S2H13, whereas binding of all these mAbs to the free RBD was not affected at pH 5.4 (Figures 27A and 27B). S309 and S2H13 do not select for a specific S conformation nor promote Si shedding, which are specific features of site la- and site II-targeted mAbs (Figure 25E). Based on these data, high-density binding of S309 or S2H13 to multiple S conformations may explain their unique ability to trigger Fc-mediated effector functions efficiently among the panel of mAbs tested.
To characterize the fine specificity of Ab responses to the RBD in SARS-CoV-2 infected individuals, a quantitative blockade-of-binding assay was developed using the 6 structurally defined mAbs as probes for the corresponding antigenic sites (Figures 34B-34G). Abs against sites la and lb were found at high titers in hospitalized donors and in a fraction of non-hospitalized symptomatic and asymptomatic subjects, and correlated with the titer of Abs blocking binding of the RBD to ACE2 (Figures 34H- 34K). The serological response to the other RBD antigenic sites was overall lower (or null) but showed distinct signatures in different individuals. In particular, Abs to any RBD sites were not detected in 22% of non-hospitalized individuals. Although the possible existence of additional antigenic sites cannot be ruled out, a plausible explanation is that these individuals possess low level of RBD-specific Abs (Figures 34K-34L), putatively with low avidity, compounding their detection in the blockade-of- binding assay. In addition, the overall decline of the total anti-RBD Abs was paralleled by a similar decay of Abs directed to each RBD site (data not shown). Collectively, these results demonstrate that the SARS-CoV-2 RBD is the main target of neutralizing Abs and that sites la and lb are prime antigenic sites.
Discussion This study provides an extensive analysis of Ab responses to SARS-CoV-2 S, RBD and N in more than 600 SARS-CoV-2 infected individuals with different clinical outcomes. Collectively, these data define the immunodominance of the RBD and highlight qualitative and quantitative differences in the serological response of different individuals. The SARS-CoV-2 RBD is immunodominant in terms of total Abs elicited and is the target of 90% of the neutralizing activity present in the sera or plasma of most individuals evaluated. The remaining neutralizing activity observed in certain individuals may be accounted for by Abs targeting domain A (Chi et al., 2020), quaternary epitopes on the S trimer or the S2 subunit (Liu et al., 2020a).
Information gained from 6 different mAh structures to develop a high-resolution serological epitope-mapping approach and define a blueprint of polyclonal Ab responses to the SARS-CoV-2 RBD. These data present a quantitative antigenic map of the epitopes targeted by neutralizing mAbs that explains immunodominance, neutralization properties and activation of effector functions. These studies showed that the RBM is immunodominant and comprises two partially overlapping antigenic sites (la and lb defined by mAbs S2H14 and S2H13, respectively) targeted by neutralizing Abs inhibiting ACE2 attachment. Whereas site la coincides with the ACE2 binding site and is accessible only in the open S conformation, site lb is also exposed in the closed S conformation and is targeted by Abs with both neutralizing activity and effector function. In contrast, the remaining RBD sites, Ila, lib, lie and IV, are subdominant and generate lower and variable Ab responses in different individuals. The immunodominance of sites la and lb may be related to their greater accessibility compared to sites Ila, lib and lie, as the latter epitopes become exposed only after opening of two RBDs, which is a rare event (Ke et al., 2020; Walls et al., 2020; Wrapp et al., 2020). Although site IV is accessible in both open and closed S conformations, its subdominance may result from the masking effect of a conserved glycan (at position N343) within this antigenic site (Pinto et al., 2020). Overall, the observed increase in Ab titers blocking RBD attachment to ACE2 in the context of waning Ab titers is consistent with the putative production of higher affinity RBD-specific Abs, most of them targeting sites la and lb. Numerous amino acid substitutions have been detected in the RBD, with several of them found in the RBM (including the S2H13 and S2H14 epitopes), of the 74,000 SARS-CoV-2 isolates available to date in the GISAID database (Elbe and Buckland- Merrett, 2017). As sites la and lb within the RBM are prime targets of neutralizing Abs, mutations leading to viral escape from mAb neutralization might have been selected, possibly during prolonged infections, eventually resulting in antigenic drift similar to influenza A viruses (Hensley et al., 2009). This is supported by the fact that naturally occurring RBD mutations were recently associated with escape from mAb binding and with reduced recognition by immune sera (Li et al., 2020b).
Fc-mediated effector functions are key antiviral pathways in vivo that can be profoundly affected by the epitope specificities of the mAbs (DiLillo et al., 2014; Hessell et al., 2007). The finding that only S309 and S2H13 (out of the six mAbs evaluated in this study) efficiently activated effector functions underscores the importance of the orientation and distance of the Fc fragment from the plasma membrane (DiLillo et al., 2016; Pinto et al., 2020; Tang et al., 2019) and the requirement for a high density binding of mAbs for efficient FcD receptors cross- linking and engagement of the hexameric Clq. Both S309 and S2H13 mAbs recognize epitopes accessible independent of the RBD conformation and are therefore expected to reach high occupancy on S trimers (Ortiz et al., 2016). Instead, Abs targeting site la and site II promote shedding of the Si subunit which may limit their ability to trigger effector functions. Further studies are performed to address whether bivalent binding by IgG molecules within a single S is possible and what could be role of cross-linking neighboring S proteins on virions or between virions.
Table 3.
STAR METHODS
Figure imgf000169_0001
Figure imgf000170_0001
Figure imgf000171_0001
Figure imgf000172_0001
Figure imgf000173_0001
Figure imgf000174_0001
Figure imgf000175_0001
Figure imgf000176_0001
Figure imgf000177_0001
Figure imgf000178_0001
Figure imgf000179_0001
Figure imgf000180_0001
EXPERIMENTAL MODEL AND SUBJECT DETAILS Cell lines
Cell lines used in this study were obtained from ATCC (HEK293T, Vero-E6), Thermo-Fisher Scientific (HEK293F, Expi293F) or Invitrogen (Expi-CHO-S cells). All cell lines used in this study (except HEK293F and Expi293F) were routinely tested for mycoplasma and found to be mycoplasma-free.
Sample donors and collection
Samples were obtained from 5 cohorts of SARS-CoV-2 infected individuals under study protocols approved by the local Institutional Review Boards (Canton Ticino Ethics Committee, Switzerland, the Ethical committee of Luigi Sacco Hospital, Milan, Italy, and WCG North America, Princeton, NJ, US). All donors provided written informed consent for the use of blood and blood components (such as PBMCs, sera or plasma) and were recruited at hospitals or as outpatients. Based on their availability, participants were enrolled and allocated to either single blood draws or longitudinal follow-up. Donors were categorized as symptomatic if they reported any COVID-19- related symptoms (a, fever; b, respiratory distress; c, cough; d, throat pain; e, common cold; f, taste loss/smell loss; g, diarrhea; h, fatigue; i, muscle bone pain; j, headache). Donors from the Ticino healthcare workers cohort were further categorized based on symptom severity as follows: asymptomatic (declaration of no symptom experience), low symptomatic (1 or 2 symptoms of a-f and any of g-j), mild symptomatic (any 3 symptoms of a-f); high symptomatic (any 4 symptoms of a-f), severe symptomatic (any 4 symptoms of a-f, including b), atypical (all the remaining cases).
METHOD DETAILS
Isolation of peripheral blood mononuclear cells (PBMCs), plasma and sera
PBMCs and plasma were isolated from blood draw performed using tubes or syringes pre-filled with heparin, followed by Ficoll density gradient centrifugation. Sera were obtained from blood collected using tubes containing clot activator, followed by centrifugation. PBMCs, plasma and sera were stored in liquid nitrogen and -80°C freezers until use, respectively.
Ah discovery and recombinant expression
S2H13, S2H14 and S2A4 mAbs were isolated from memory B cells or plasma cells as previously described (Corti et al., 2011; Pinto et al., 2020). S2X35 was isolated from SARS-CoV-2 S-specific CD19+ IgG+ B cells sorted using a C-terminal biotinylated SARS-CoV-2 S ectodomain trimer conjugated to Streptavidin, Alexa Fluor™ 647 (Life Technologies).
Recombinant antibodies were expressed as IgGl or Fab in ExpiCHO-S cells transiently co-transfected with plasmids expressing the heavy and light chain, as previously described (Stettler et al., 2016). Recombinant Abs were affinity purified using HiTrap Protein A columns (Cytiva) followed by desalting against phosphate- buffered saline (PBS) using HiTrap Fast desalting columns (Cytiva). All liquid chromatography purification steps were performed on a AKTA express FPLC (Cytiva). The final products were sterilized by filtration through 0.22 pm filters and stored at 4°C.
Fabs were expressed using transient transfection of ExpiCHO-S cells with ExpiCHO expression medium and ExpiFectamine™ CHO Transfection Kit (Life Technologies), purified by affinity chromatography on AKTA Xpress Mab System (Cytiva) with UNICORN 5.11 software version (Build 407) using CaptureSelect CHI- XL MiniChrom column (ThermoFisher Scientific), buffer exchanged to PBS using a HiPrep™ 26/10 desalting columns (Cytiva) and sterilized through a 0.2 pm filter.
Recombinant glycoprotein production
The SARS-CoV-2 and SARS-CoV prefusion S ectodomain trimers were previously described (Walls et al., 2020; Walls et al., 2019). Briefly, the SARS-CoV-2 and SARS-CoV S ectodomains were synthesized by Genscript or GeneArt, respectively, with a mu-phosphatase signal peptide, 2P stabilizing mutation (Kirchdoerfer et al., 2018; Pallesen et al., 2017), a TEV cleavage site, foldon, and 8X His-tag. The SARS-CoV-2 domain A construct (residue 14-302) was synthesized by Genscript into pcDNA3.1- with an N-terminal mu-phosphatase signal peptide and a C- terminal octa-histidine tag (GSS(H)8). All constructs were produced in HEK293F cells grown in suspension using FreeStyle 293 expression medium (Life technologies) at 37°C in a humidified 8% CO2 incubator rotating at 130 rpm. The cultures were transfected using PEI (9 pg/ml) with cells grown to a density of 2.5 million cells per mL and cultivated for 3-4 days. The supernatants were harvested and cells resuspended for another 3-4 days in fresh media, yielding two harvests. Proteins were purified from clarified supernatants using a 5mL Cobalt affinity column (Takara Bio), concentrated and flash frozen in a buffer containing 20 mM Tris pH 8.0 and 150 mM NaCl prior to analysis. SDS-PAGE or negative stain EM was run to check purity.
For SPR experiments, a SARS-CoV-2 prefusion stabilized S ectodomain with an Avi-tag between the foldon domain and the 8x His-tag was codon optimized, synthesized and cloned into the phCMVl vector by ATUM. For protein expression, Expi293F cells were transfected using ExpiFectamine according to Thermo Fisher’s Expi293 expression system user guide. Supernatants were harvested after 4 days of expression and purified over a 5 mL Cobalt affinity column (Takara Bio). IMAC elution peak was pooled concentrated and injected onto a Superose 6 Increase 10/300 GL size exclusion chromatography column (Cytiva) using lx PBS pH 7.4 as a running buffer. SEC fractions corresponding to the main protein peak were pooled, flash frozen in liquid nitrogen and stored at -80°C.
RBD protein for ELISA was produced in Expi293 cells using the phCMVl SARS-CoV-2 RBD plasmid, which encodes for an N-terminal mu-phosphatase signal peptide, an ‘ETGT linker, SARS-CoV-2 residues 328-531, a linker sequence and Strep-8xHis-tag. Supernatants were harvested five days after transfection, equilibrated with 0.1 M Tris-HCl, 0.15 MNaCl, 10 mM EDTA, pH 8.0 and supplemented with a biotin blocking solution (IBA Lifesciences). RBD was purified by affinity chromatography on a Strep-Trap HP 5 ml column followed by elution with 50 mM biotin and buffer exchange into PBS.
To produce SARS-CoV-2 RBD for crystallization, the phCMVl SARS-CoV-2 RBD expression plasmid was used, which encodes for an N-terminal mu-phosphatase signal peptide, an ‘ETGT’ linker, SARS-CoV-2 residues 328-531 and a C-terminal 8xHis-tag. Protein was expressed in Expi293F cells in the presence of 10 mM kifunensine at 37°C and 8% CO2 in a humidified incubator. Transfection was performed using ExpiFectamine 293 reagent (Thermo Fisher Scientific) and 1 pg plasmid per ml of cell culture. Cell culture supernatant was collected after three days, filtered through a 0.22 pm filter and supplemented with EDTA-free Protease Inhibitor (Thermo Scientific Pierce) and PBS to a final concentration of 2.5x (342.5 mM NaCl, 6.75 mM KC1 and 29.75 mM phosphate). After a second filtration, SARS-CoV-2 RBD was purified using a 5 ml HisTALON Superflow cartridge (Takara Bio) and subsequently dialyzed against 50 mM Tris-HCl pH 7.5, 150 mM NaCl. SARS-CoV-2 RBD was deglycosylated by overnight incubation with EndoH glycosidase at 4°C.
For SPR, SARS-CoV-2 RBD (residues 328-531) with a C-terminal Thrombin- Twin-Strep-8xHis-tag was expressed in Expi293F cells at 37°C and 8% C02 in a humidified incubator. Transfection was performed using ExpiFectamine 293 reagent (Thermo Fisher Scientific) and 1 pg plasmid per ml of cell culture. The protein was purified by affinity chromatography using a 1 ml HisTALON Superflow cartridge as described above (Takara Bio) and subsequently buffer exchanged using a Zeba spin desalting column into Cytiva lx HBS-N buffer. Antibody Fab fragments for mAbs S304, S309 and S2H14 were obtained from ATUM. To form the quaternary SARS-CoV-2 RBD-S304-S309-S2H14 Fab complex, the deglycosylated SARS-CoV-2 RBD was mixed with a 1.3-fold molar excess of S304 Fab, S309 Fab and S2H14 Fab. The complex was purified on a Superdex 200 Increase 10/300 GL column pre-equilibrated with 20 mM Tris-HCl pH 7.5, 150 mM NaCl, and concentrated to 4 mg/ml. 100 mΐ of the protein solution were mixed with 0.3 mg Polyvalan Crystallophore N°1 and this solution was used for setting up crystallization trays.
Recombinant ACE2 was expressed in ExpiCHO-S cells transiently transfected with a plasmid encoding ACE2 residues 19-615, a C-terminal thrombin cleavage site, Twin-Strep-tag and lOxHis-tag. Cell culture supernatant was collected after nine days, filtered through a 0.22 pm filter, supplemented with buffer to a final concentration of 80 mM Tris-HCl pH 8.0, 100 mM NaCl, and then incubated with BioLock solution for one hour. After a second filtration, ACE2 was purified using a 1 ml StrepTrap High Performance column (Cytiva) followed by size exclusion chromatography using a Superdex 200 Increase 10/300 GL column pre-equilibrated in 20 mM Tris-HCl pH 7.5, 150 mM NaCl.
Enzyme-linked immunosorbent assay (ELISA)
Spectraplate-384 with high protein binding treatment (custom made from Perkin Elmer) were coated overnight at 4°C with 1 pg/ml of SARS-CoV-2 S, domain A (in- house produced), N (The Native Antigen company), S2 (The Native Antigen company), SARS-CoV S (in-house produced) or 5 pg/ml of SARS-CoV-2/SARS-CoV RBD (in- house produced) in PBS, pH 7.2, and plates were subsequently blocked with Blocker Casein (1%) in PBS (Thermo Fisher Scientific) supplemeted with 0.05% Tween 20 (Sigma Aldrich). The coated plates were incubated with serial dilutions of human monoclonal antibodies or human plasma or sera for 1 h at room temperature. The plates were then washed with PBS containing 0.1 % Tween-20 (PBS-T), and Alkaline Phosphatase-conjugated Goat Anti-Human IgG, IgM or IgA (Southern Biotech) were added and incubated for 1 h. Plates were washed three times with PBS-T, and 4- NitroPhenyl Phosphate (pNPP, Sigma-Aldrich) substrate was added and incubated for 1 h (IgG) or 2 h (IgA and IgM). The absorbance of 405 nm was measured by a microplate reader (Biotek), and the data was plotted with Graph Prism software.
In the depletion experiments, the efficiency was calculated based on the ratio of the binding titers before and after depletion and is expressed as a percentage: (1- (ED50(after)/ED50(before))* 100.
For chaotropic ELISA, after incubation with sera, plates were washed and incubated with 1 M solution of sodium thiocyanate (NaSCN) for 1 h. Avidity Index was calculated as the ratio (%) between the ED50 in presence and the ED50 in absence of NaSCN.
Depletion of RBD-specific Abs from plasma or serum samples
Magnetic beads (Pierce) were washed with ice-cold 1 mM HC1 solution. 1 mg/ml RBD solution was coupled to magnetic beads in 50 mM borate buffer, pH 8.5, with a 2h incubation at room temperature. Beads were washed 3 times with 0.1 M glycine, pH 2.0, followed by a wash with purified water. Beads were then incubated with quenching buffer (3 M ethanolammine, pH 9.0) for 2 h. Beads were washed with purified water and resuspended in storage buffer (50 mM borate buffer, pH 8.5, with 0.05% sodium azide). Serum or plasma were diluted to 1/50 in 500 mΐ PBS containing 1/20 (25 mΐ) of RBD-magnetic beads and incubated for 1 h at room temperature, rotating. Tubes were placed on a magnetic holder and supernatants were collected.
Pseudovirus neutralization assays
VSV-based SARS-CoV-2 S-glycoprotein-pseudotyped viruses were used to test the neutralizing activity of serum or plasma from COVID-19 recovered patients. Briefly, HEK293T cells were transfected with a SARS-CoV-2 S glycoprotein-encoding plasmid harboring the D19 C-terminal truncation (Ou et al., 2020) using the X- tremeGENE HP DNA transfection reagent (Merck) according to the manufacturer’s instructions and then incubated at 37 °C with 8% CO2 for 24 h. Next, the transfected cells were infected with Delta-G-VSV-Luc in DMEM and incubated lh at 37 °C with 5% CO2. After removing the infection medium, the cells were washed twice with PBS and DMEM containing 10% FBS and 1% penicillin-streptomycin was added. Infected cells were further incubated for 24 hours at 37°C before the supernatant containing the VSV-SARS-CoV-2 pseudoviruses was collected, cleaned from cellular debris by centrifugation, and stored at -80°C. VSV-SARS-CoV-2 pseudovirus was incubated with serial dilution of serum or plasma for 1 h in white culture 96 well plate at 37°C. Next, VeroE6 at 20 000 cells/well were added to the mix and incubated 2 h at 37°C. After 2 h, MEM supplemented with 40% FBS and 4% penicillin-streptomycin was added to the cells for additional 24h. Culture medium was then removed from the cells and 50 pL/well of Bio-Glo (Promega) diluted 1:2 with PBS Ca2+Mg2+ was added. After 5 minutes incubation in the dark the luminescence signal was measured using a Synergy HI Hybrid Multi-Mode plate reader (Biotek). Measurements were performed in duplicate and relative luciferase units (RLU) were converted into neutralization percentages and plotted with a nonlinear regression curve fit in Graph Prism.
In the depletion experiments, the efficiency was calculated based on the ratio of the neutralizing titers before and after depletion and is expressed as a percentage: (1- (ID80(after)/ID80(before))* 100.
MLV-based SARS-CoV-2 S-glycoprotein-pseudotyped viruses were used to test the neutralizing activity of recombinant mAbs. MLV-based SARS-CoV-2 S pseudotyped viruses were prepared as previously described (Walls et ak, 2020). HEK293T cells were co-transfected with a SARS-CoV-2 S glycoprotein-encoding- plasmid harboring the D19 C-terminal truncation, an MLV Gag-Pol packaging construct and the MLV transfer vector encoding a luciferase reporter using the X-tremeGENE HP DNA transfection reagent (Merck) according to the manufacturer’s instructions. VeroE6 cells were cultured in MEM containing 10% FBS, 1% penicillin-streptomycin and plated into 96-well plates for 16-24h at 20 000 cells/well. Pseudovirus, pre activated with TPCK (Bioconcept) at 10 pg/mL for lh at 37°, with or without serial dilution of antibodies was incubated for lh and then added to the wells after washing 3X with MEM. A monoclonal antibody of unrelated specificity was used as a negative control. After 2-3h MEM containing 20% FBS and 2% penicillin-streptomycin was added to the cells for 48h. Following 48h of infection, culture medium was removed from the cells and 50 mΐ/well of Bio-Glo (Promega) diluted 1:2 with PBS Ca2+Mg2+ was added to the cells and incubated in the dark for 5 min before reading on a Synergy HI Hybrid Multi-Mode plate reader (Biotek). Measurements were done in duplicate and relative luciferase units were converted to percentage of neutralization and plotted with a nonlinear regression curve fit in Graph Prism.
Blockade of RBD binding to ACE 2
Unlabeled mAbs or plasma/sera were serially diluted, mixed with RBD mouse Fc-tagged antigen (Sino Biological, final concentration 20 ng/ml) and incubated for 30 min at 37°C. The mix was added for 30 min to ELISA 96-well plates (Coming) pre- coated overnight at 4 °C with 2 pg/ml human ACE2 in PBS. Plates were washed and RBD binding was revealed using secondary goat anti-mouse IgG (Southern Biotech). After washing, pNPP substrate was added and plates were read at 405 nm. The percentage of inhibition was calculated as follow: (l-(OD sample-OD neg ctr)/(OD pos ctr-OD neg ctr)]) x 100. Blockade of binding to RBD
Human anti-RBD full IgGl mAbs were biotinylated using the EZ-Link NHS- PEO solid phase biotinylation kit (Pierce). Labelled mAbs were tested for binding to RBD by ELISA and the optimal concentration of each mAh to achieve 80% maximal binding was determined. Unlabeled mAbs or sera/plasma were serially diluted and added to ELISA 96-well plates (Corning) pre-coated overnight at 4 °C with 1 pg/ml of RBD mouse Fc-tagged antigen (Sino Biological) in PBS. After 30 min, biotinylated anti-RBD mAbs were added at the concentration achieving 80% maximal binding and the mixture was incubated at room temperature for 230 min. Plates were washed and antibody binding was revealed using alkaline phosphatase-comjugated streptavidin (Jackson ImmunoResearch). After washing, pNPP substrate (Sigma-Aldrich) was added and plates were read at 405 nm. The percentage of inhibition was calculated as follow: (l-(OD sample-OD neg ctr)/ (OD pos ctr-OD neg ctr)]) x 100.
Cell-surface niA b-mediated Si shedding CHO cells stably expressing wild-type SARS-CoV-2 S were resuspended in wash buffer (PBS 1% BSA, 2 mM EDTA) and treated with 10 pg/ml TPCK-t (Bioconcept) for 30 min at 37°C. Cells were washed and aliquoted (90,000 cells/well). MAbs were added to cells at 15 pg/ml final concentration for 180 min at 37°C. Cells were collected at different time points (5, 15, 30, 60, 120, 180 and 240 min), washed at +4°C and incubated with 1.5 pg/ml secondary goat anti-human IgG, Fey fragment specific (Jackson ImmunoResearch) on ice for 20 min. Cells were washed and resuspended in wash buffer and analysed with ZE5 FACS (Bio-rad).
Western blot
SARS-CoV-2 S was incubated alone or with S2A4, S304 or S2X35 Fabs (molar ratio 1:1.2) during 0.5, 1 or 2 hr at room temperature. Laemmli loading buffer was added prior to boiling the samples for 5 min at 95 °C. Samples were run on a 4%-20% gradient Tris-Glycine Gel (BioRad) and transferred to a PVDF membrane. Membrane was blocked in 5 % milk during 45 min at room temperature. An anti-S2 SARS-CoV S monoclonal primary antibody (1:250 dilution) and an Alexa Fluor 680-conjugated goat anti-human secondary antibody (1:50,000; Jackson Laboratory) were used for Western- blotting. A LI-COR processor was used to develop images.
Measurement of effector functions
Determination of antibody-dependent activation of human FcyRIIIa was performed using SARS CoV-2 S stable transfected CHO cells as target, incubated with titrated concentrations of antibodies and after 10 min incubated with Jurkat expressing FcyRIIIa receptor on their surface and stable transfected with NFAT-driven luciferase gene (Promega, Cat. Nr. G9798 and G7018) at an effector to target ratio of 6:1. Activation of human FcyRIIIa (FI 58 or VI 58 variants) in this bioassay results in the NFAT-mediated expression of the luciferase reporter gene. Luminescence was measured after 21 hours of incubation at 37°C with 5% CO2 with a luminometer using the Bio-Glo-TM Luciferase Assay Reagent according to the manufacturer’s instructions. Determination of antibody-dependent activation of human FcyRIIa was performed using SARS CoV-2 S stable transfected CHO cells as target, incubated with titrated concentrations of antibodies and after 10 min incubated with Jurkat expressing FcyRIIa receptor on their surface and stable transfected with NFAT-driven luciferase gene (Promega, Cat. Nr. G9995) at an effector to target ratio of 5:1. Activation of human FcyRIIa (H131 variant) in this bioassay results in the NFAT-mediated expression of the luciferase reporter gene. Luminescence was measured after 21 hours of incubation at 37°C with 5% CO2 with a luminometer using the Bio-Glo-TM Luciferase Assay Reagent according to the manufacturer’s instructions.
Complement-dependent cytotoxicity (CDC) assays were performed using SARS CoV-2 S stable transfected CHO cells as target, incubated with titrated concentrations of antibodies and after 10 min incubated at a concentration of 1:24 with Low-Tox M Rabbit Complement (Cedarlane Laboratories Limited, Cat. Nr.: CL3051) previously pre-absorbed with target cells alone in excess. Antibody dependent cell killing was measured using LDH release assay (Cytotoxicity Detection Kit (LDH) (Roche; Cat. Nr.: 11644793001) after 2 hours of incubation at 37°C.
Affinity and avidity determination by surface plasmon resonance (SPR)
SPR binding measurements were performed using a Biacore T200 instrument using either anti-AviTag pAb (for capturing S proteins) or StrepTactin XT (for capturing RBDs) covalently immobilized on CM5 chips. Running buffer for neutral pH experiments was Cytiva HBS-EP+ (pH 7.4) and for acidic pH experiments was 20 mM phosphate pH 5.4, 150 mM NaCl, 0.05% P-20. All measurements were performed at 25 °C. Acidic pH experiments were run as single-cycle kinetics. Antibody concentrations for all experiments are a 3-fold dilution series starting from 300 nM. Capture levels for neutral pH RBD experiments were ~75 RU and within 10% of each other except for S2H13 Fab data which was collected separately (capture level of ~60 RU) and scaled proportional to capture level to allow for comparison across datasets. Approximate capture levels for other data sets are: neutral pH Fab-Spike = 190 RU, neutral pH IgG- Spike = 165 RU, acidic Fab-RBD = 80 RU, acidic Fab-Spike = 205 RU, and acidic IgG-Spike = 205 RU. Capture levels were within -10% of each other within each neutral pH dataset, and within 3% of each other within each single-cycle, acidic pH dataset. Double reference-subtracted data were fit to a 1:1 binding model using Biacore Evaluation software, which yields an “apparent KD” for the S-binding data because the kinetics also reflect Spike conformational dynamics and especially for the IgG binding data where the kinetics reflect avidity. RBD-binding data were fit with a Global Rmax. Spike-binding data for the tightly-associating S309 and S2X35 Fabs as well as all IgG were fit with local Rmax, since the Spike is undergoing conformational changes which can affect the accessibility of epitopes across different mAh concentrations (these Kx>,app are indicated to be approximate). For dissociation rates that were too slow to fit, Kx>,app are reported as an upper limit.
Competition experiments using biolayer interferometry (Octet)
The SARS-CoV-2 RBD was loaded for 3 min at 8 pg/ml in kinetics buffer onto anti-Penta-HIS (HIS IK) biosensors (Molecular Devices, ForteBio). Association of mAbs (full-length IgG) was performed in kinetics buffer (0.01% endotoxin-free BSA, 0.002% Tween-20, 0.005% NaN3 in PBS) at 15 pg/ml for 7 min.
Crystallization, data collection, structure determination and analysis
Crystals of the SARS-CoV-2 RBD-S304-S309-S2H14 Fab complex were obtained at 22°C by sitting drop vapor diffusion. A total of 200 nl complex were mixed with 200 nl mother liquor solution containing 16.2% (w/v) PEG 4000, 0.9 M sodium citrate pH 6.0, 0.18 M ammonium acetate, 0.02 M potassium acetate, 0.01 M MES pH 6 and 1.5% Pentaerythritol ethoxylate (15/4 EO/OH).
Data were collected at the Molecular Biology Consortium beamline 4.2.2 at the Advanced Light Source synchrotron facility in Berkeley, CA. Two individual datasets from the same crystal processed with the XDS software package (Kabsch, 2010), were merged for a final dataset at 2.65 A in space group C2. The RBD-S304-S309-S2H14 Fab complex structure was solved by molecular replacement using Phaser (McCoy et ak, 2007) and an X-ray structures of the RBD and Fabs as search models. Several subsequent rounds of model building and refinement were performed using Coot (Emsley et al., 2010), Refmac5 (Murshudov et al., 2011), and MOE (www.chemcomp.com), to arrive at a final model for the ternary complex. Using the RBD-S304-S309-S2H14 Fab complex crystal structure, the S309, S304 and S2H14 binding epitopes on the RBD protein were determined by identifying all RBD residues within a 5.0A distance from any Fab atoms. The analysis was performed using the Molecular Operating Environment (MOE) software package from the Chemical Computing Group (www.chemcomp.com) and the results were manually confirmed.
Optimal crystals of S2H14, S2A4 and S2X35 Fabs were obtained by the hanging-drop vapor diffusion method with a mosquito robot at 20°C. A total of 150 nl of Fabs at 20 mg per mL (for S2H14, S2A4) or at 12 mg per mL (for S2X35) in 20 mM Tris-HCl pH 8.0, 150 mM NaCl were mixed with 150nL mother liquor solution containing 0.2 M magnesium acetate and 20% (w/v) PEG 3350 (for S2H14 Fab), 1.2 M Ammonium sulfate, 0.1M Sodium cacodylate/Hydrochloric acid pH 6,5 (for S2A4 Fab) or 0.16 M MgCh, 0.08 M Tris-HCl, pH 8.5, 24% (w/v) PEG 4000 and 20% (v/v) glycerol (for S2X35 Fab). Drops were equilibrated against reservoir solutions for 1-2 weeks at room temperature after which crystals were flash cooled in liquid nitrogen using the mother liquor solution supplemented with 30% glycerol as a cryoprotectant. Diffraction data were remotely recorded on synchrotron beamline 5.0.2 at ALS, indexed and scaled using Mosfilm (Battye et al., 2011) and SCALA or aimless (Evans and Murshudov, 2013). Initial phases were obtained by molecular replacement in Phaser (McCoy et al., 2007) on the CCP4 suite, using homology models. Refinement was performed in iterations of manual model building in Coot (Emsley et al., 2010) and automatic refinement in Phenix (Liebschner et al., 2019).
CryoEM sample preparation, data collection and data processing
S2H13 Fab was generated by digestion of the corresponding monoclonal IgG with LysC (Thermo Fisher Scientific) at 1:2000 (w/w) ratio during 5 h at 37°C while Fabs S2A4, S2H14, S304 and S2X35 were recombinantly expressed as described above. SARS-CoV-2 S at 1.2 mg per mL was incubated with 1.2 molar excess of Fabs at 4°C at least for 1 h. Three pL of 1-1.5 mg per mL of complexes was loaded onto a freshly glow discharged 1.2/1.3 UltrAuFoil grid (300 mesh) prior to plunge freezing using a vitrobot MarkIV (ThermoFisher Scientific) with a blot force of 0 and 6-7.5 s blot time at 100% humidity and 21°C. Data were acquired on an FEI Titan Krios transmission electron microscope operated at 300 kV and equipped with a Gatan K2 Summit direct detector and Gatan Quantum GIF energy filter, operated in zero-loss mode with a slit width of 20 eV. Automated data collection was carried out using Leginon (Suloway et ak, 2005) at a nominal magnification of 130,000x with a super-resolution pixel size of 0.525 A and stage tilt angles up to 45° (Tan et ak, 2017). The dose rate was adjusted to 8 counts/pixel/s, and each movie was fractionated in 50 frames of 200 ms. For the S/S304 dataset, 2,791 micrographs were collected with a defocus range comprised between -1.5 and -2.8 pm. For the S/S2H13 data set, 6,697 micrographs were collected with a defocus range comprised between -0.4 and -3.4 pm. For S2A4 data set, 1,995 micrographs were collected with a defocus range comprised between -0.4 and -2.4 pm. Movie frame alignment, estimation of the microscope contrast-transfer function parameters, particle picking and extraction were carried out using Warp (Tegunov and Cramer, 2019). Particle images were extracted with a box size of 800 binned to 400 yielding a pixel size of 1.05 A. For the S/S2H14 and S/S2X35 complexes, data were acquired on a FEI Glacios transmission electron microscope operated at 200 kV. Automated data collection was carried out using Leginon (Suloway et ak, 2005) at a nominal magnification of 36,000x with a pixel size of 1.16 A and stage tilt angle of 40° or 30° for S/S2H14 or S/S2X35 complexes, respectively (Tan et ak, 2017). The dose rate was adjusted to 8 counts/pixel/s, and each movie was acquired in counting mode fractionated in 50 frames of 200 ms. For S/S2H14 complex, 1,886 micrographs were collected with a defocus range comprised between -1.0 and -2.5 pm. For S/S2X35 complex, 946 micrographs were collected with a defocus range comprised between -0.8 and -2.5 pm. Warp (Tegunov and Cramer, 2019) was also used for movie frame alignment, estimation of the microscope contrast-transfer function parameters, particle picking and extraction.
For the S/S2H13, S/S2H14, S/S2A4 and S/S304 datasets, two rounds of reference-free 2D classification were performed using cryoSPARC (Punjani et al., 2017) to select well-defined particle images (only one round of reference-free 2D classification was performed for S/S2X35). Subsequently, two rounds of 3D classification with 50 iterations each (angular sampling 7.5° for 25 iterations and 1.8° with local search for 25 iterations), using our previously reported closed SARS-CoV-2 S structure as initial model (PDB 6VXX) or ab initio generated models for S2H14, S304 or S2X35 (Punjani et al., 2017), were carried out using Relion (Scheres, 2012b) without imposing symmetry. 3D refinements were carried out using non-uniform refinement along with per-particle defocus refinement in cryoSPARC (Punjani et al., 2019). Particle images were subjected to Bayesian polishing using Relion (Zivanov et al., 2018; Zivanov et al., 2019) before performing another round of non-uniform refinement in cryoSPARC followed by per-particle defocus refinement and again non- uniform refinement.
To further improve the density of the S2H13, S2A4 and S2X35 Fabs, the particles were symmetry-expanded and subjected to focus 3D classification without refining angles and shifts using a soft mask encompassing the RBM and S2H13 variable domains or RBD and S2A4 variable domains using a tau value of 60 (S2H13 and S2A4) or 40 for (S2X235). Particles belonging to classes with the best resolved local density were selected (all particles were retained for S2X35) and subjected to local refinement using cryoSPARC (Punjani et al., 2017; Punjani et al., 2019). Local resolution estimation, filtering, and sharpening were carried out using CryoSPARC (Cardone et al., 2013). Reported resolutions are based on the gold-standard Fourier shell correlation (FSC) of 0.143 criterion and Fourier shell correlation curves were corrected for the effects of soft masking by high-resolution noise substitution (Chen et al., 2013). CryoEM model building and analysis. UCSF Chimera (Pettersen et al., 2004) and Coot (Emsley et al., 2010) were used to fit atomic models (PDB 6VXX or PDB 6VYB) into the cryoEM maps and the Fab variable domains were manually built or the co-crystal structures of SARS-CoV-2 RBD with S304/S309 was used. Models were refined and relaxed using Rosetta using both sharpened and unsharpened maps (Frenz et al., 2019; Wang et al., 2016). Figures were generated using UCSF ChimeraX (Goddard et al., 2018).
Longitudinal Mixed-Effects Modeling
A non-linear mixed effects model was used to estimate parameters describing the kinetics of RBD, S- and N-specific IgG in individuals with longitudinal data following the onset of disease symptoms. Briefly, a one compartment direct response model with 1st order input and 1st order output was developed to describe the antibody response formation and decay. Individual parameters are assumed to be log-normally distributed and proportional residual error was employed in the modeling. Influence of gender, age and disease severity (hospitalized vs. symptomatic) in antibody response formation and decay were evaluated. The analyses were conducted using NONMEM, version 7.4 (ICON Development Solutions, Hanover, MD, USA). Graphical data presentations were conducted using R 4.0.2 (R Foundation for Statistical Computing). QUANTIFICATION AND STATISTICAL ANALYSIS
Statistical analyses were performed using GraphPad Prism (v8) and Microsoft Excel for Windows 10 (vl6.0.13001.20254). Statistical differences were analyzed with Mann-Whitney U-test. Nonparametric Kruskal-Wallis test was used to perform multiple comparisons between groups analyzed. Correction for multiple comparison was performed with Dunn’s test. Nonparametric Spearman correlation was used to compute correlations between pairs of data. Statistical significance was defined as P < 0.05. ED50, IC50, ID80 and BD80 values were determined by non-linear regression analysis (log(agonist) vs. response - Variable slope (four parameters)). References
Alshukairi, A.N., Khalid, I., Ahmed, W.A., Dada, A.M., Bayumi, D.T., Malic, L.S., Althawadi, S., Ignacio, K., Alsalmi, H.S., Al-Abdely, H.M., et al. (2016). Antibody Response and Disease Severity in Healthcare Worker MERS Survivors. Emerg Infect Dis 22.
Alsoussi, W.B., Turner, J.S., Case, J.B., Zhao, H., Schmitz, A.J., Zhou, J.Q., Chen, R.E., Lei, T., Rizk, A.A., Mclntire, K.M., et al. (2020). A Potently Neutralizing Antibody Protects Mice against SARS-CoV-2 Infection. J Immunol.
Barnes, C.O., West, A.P., Huey-Tubman, K.E., Hoffmann, M.A.G., Sharaf, N.G., Hoffman, P.R., Koranda, N., Gristick, H.B., Gaebler, C., Muecksch, F., et al. (2020). Structures of Human Antibodies Bound to SARS-CoV-2 Spike Reveal Common Epitopes and Recurrent Features of Antibodies. Cell.
Battye, T.G., Kontogiannis, L., Johnson, O., Powell, H.R., and Leslie, A.G. (2011). iMOSFLM: a new graphical interface for diffraction-image processing with MOSFLM. Acta Crystallogr D Biol Crystallogr 67, 271-281.
Baum, A., Fulton, B.O., Wloga, E., Copin, R., Pascal, K.E., Russo, V., Giordano, S., Lanza, K., Negron, N., Ni, M., et al. (2020). Antibody cocktail to SARS- CoV-2 spike protein prevents rapid mutational escape seen with individual antibodies. Science.
Brouwer, P.J.M., Caniels, T.G., van der Straten, K., Snitselaar, J.L., Aldon, Y., Bangaru, S., Torres, J.L., Okba, N.M.A., Claireaux, M., Kerster, G., et al. (2020). Potent neutralizing antibodies from COVID-19 patients define multiple targets of vulnerability. Science.
Callow, K.A. (1985). Effect of specific humoral immunity and some non specific factors on resistance of volunteers to respiratory coronavirus infection. J Hyg (Lond) 95, 173-189.
Callow, K.A., Parry, H.F., Sergeant, M., and Tyrrell, D.A. (1990). The time course of the immune response to experimental coronavirus infection of man. Epidemiol Infect 105, 435-446. Cao, W.C., Liu, W., Zhang, P.H., Zhang, F., and Richardus, J.H. (2007). Disappearance of antibodies to SARS-associated coronavirus after recovery. N Engl J Med 357, 1162-1163.
Cardone, G., Heymann, J.B., and Steven, A.C. (2013). One number does not fit all: mapping local variations in resolution in cryo-EM reconstructions. J Struct Biol 184, 226-236.
Chen, S., McMullan, G., Faruqi, A.R., Murshudov, G.N., Short, J.M., Scheres, S.H., and Henderson, R. (2013). High-resolution noise substitution to measure overfitting and validate resolution in 3D structure determination by single particle electron cryomicroscopy. Ultramicroscopy 735, 24-35.
Chi, X., Yan, R., Zhang, J., Zhang, G., Zhang, Y., Hao, M., Zhang, Z., Fan, P., Dong, Y., Yang, Y., et al. (2020). A neutralizing human antibody binds to the N- terminal domain of the Spike protein of SARS-CoV-2. Science.
Corti, D., Voss, J., Gamblin, S.J., Codoni, G., Macagno, A., Jarrossay, D., Vachieri, S.G., Pinna, D., Minola, A., Vanzetta, F., et al. (2011). A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins. Science 333, 850-856.
Corti, D., Zhao, J., Pedotti, M., Simonelli, L., Agnihothram, S., Fett, C., Fernandez-Rodriguez, B., Foglierini, M., Agatic, G., Vanzetta, F., et al. (2015). Prophylactic and postexposure efficacy of a potent human monoclonal antibody against MERS coronavirus. Proc Natl Acad Sci U S A 772, 10473-10478. de Wit, E., Feldmann, F., Horne, E., Okumura, A., Cameroni, E., Haddock, E., Saturday, G., Scott, D., Gopal, R., Zambon, M., et al. (2019). Prophylactic efficacy of a human monoclonal antibody against MERS-CoV in the common marmoset. Antiviral Res 163 , 70-74.
DiLillo, D.J., Palese, P., Wilson, P.C., and Ravetch, J.V. (2016). Broadly neutralizing anti-influenza antibodies require Fc receptor engagement for in vivo protection. J Clin Invest 126, 605-610.
DiLillo, D.J., and Ravetch, J.V. (2015). Differential Fc-Receptor Engagement Drives an Anti -tumor Vaccinal Effect. Cell 161 , 1035-1045. DiLillo, D.J., Tan, G.S., Palese, P., and Ravetch, J.V. (2014). Broadly neutralizing hemagglutinin stalk-specific antibodies require FcyR interactions for protection against influenza virus in vivo. Nat Med 20, 143-151.
Drosten, C., Meyer, B., Miiller, M.A., Corman, V.M., Al-Masri, M., Hossain,
R., Madani, H., Sieberg, A., Bosch, B.J., Lattwein, E., et al. (2014). Transmission of MERS-coronavirus in household contacts. N Engl J Med 271, 828-835.
Duan, K., Liu, B., Li, C., Zhang, H., Yu, T., Qu, J., Zhou, M., Chen, L., Meng,
S., Hu, Y., et al. (2020). Effectiveness of convalescent plasma therapy in severe COVID-19 patients. Proc Natl Acad Sci U S A 117, 9490-9496.
Edridge, A.W., Kaczorowska, J.M., Hoste, A.C., Bakker, M., Klein, M., Jebbink, M.F., Matser, A., Kinsella, C., Rueda, P., Prins, M., et al. (2020). Coronavirus protective immunity is short-lasting. medRxiv, 2020.2005.2011.20086439.
Elbe, S., and Buckland-Merrett, G. (2017). Data, disease and diplomacy: GISAID's innovative contribution to global health. Glob Chall 1, 33-46.
Emsley, P., Lohkamp, B., Scott, W.G., and Cowtan, K. (2010). Features and development of Coot. Acta Crystallographica Section D 66, 486-501.
Evans, P.R., and Murshudov, G.N. (2013). How good are my data and what is the resolution? Acta Crystallogr D Biol Crystallogr 69, 1204-1214.
Folegatti, P.M., Ewer, K.J., Aley, P.K., Angus, B., Becker, S., Belij- Rammerstorfer, S., Bellamy, D., Bibi, S., Bittaye, M., Clutterbuck, E.A., et al. (2020). Safety and immunogenicity of the ChAdOxl nCoV-19 vaccine against SARS-CoV-2: a preliminary report of a phase 1/2, single-blind, randomised controlled trial. Lancet.
Frenz, B., Ramisch, S., Borst, A.J., Walls, A.C., Adolf-Bryfogle, J., Schief, W.R., Veesler, D., and DiMaio, F. (2019). Automatically Fixing Errors in Glycoprotein Structures with Rosetta. Structure 27, 134-139. el33.
Gimson, A.E., Tedder, R.S., White, Y.S., Eddleston, A.L., and Williams, R. (1983). Serological markers in fulminant hepatitis B. Gut 24, 615-617.
Goddard, T.D., Huang, C.C., Meng, E.C., Pettersen, E.F., Couch, G.S., Morris, J.H., and Ferrin, T.E. (2018). UCSF ChimeraX: Meeting modem challenges in visualization and analysis. Protein Sci 27, 14-25. Grifoni, A., Weiskopf, D., Ramirez, S.I., Mateus, J., Dan, J.M., Moderbacher, C.R., Rawlings, S.A., Sutherland, A., Premkumar, L., Jadi, R.S., et al. (2020). Targets of T Cell Responses to SARS-CoV-2 Coronavirus in Humans with COVID-19 Disease and Unexposed Individuals. Cell 181, 1489-1501. el415. Guo, X., Guo, Z., Duan, C., chen, Z., Wang, G., Lu, Y., Li, M., and Lu, J.
(2020). Long-Term Persistence of IgG Antibodies in SARS-CoV Infected Healthcare Workers. medRxiv, 2020.2002.2012.20021386.
He, W., Chen, C.J., Mullarkey, C.E., Hamilton, J.R., Wong, C.K., Leon, P.E., Uccellini, M.B., Chromikova, V., Henry, C., Hoffman, K.W., et al. (2017). Alveolar macrophages are critical for broadly-reactive antibody-mediated protection against influenza A virus in mice. Nat Commun 8, 846.
Hensley, S.E., Das, S.R., Bailey, A.L., Schmidt, L.M., Hickman, H.D., Jayaraman, A., Viswanathan, K., Raman, R., Sasisekharan, R., Bennink, J.R., et al. (2009). Hemagglutinin receptor binding avidity drives influenza A virus antigenic drift. Science 326, 734-736.
Hessell, A.J., Hangartner, L., Hunter, M., Havenith, C.E., Beurskens, F.J., Bakker, J.M., Lanigan, C.M., Landucci, G., Forthal, D.N., Parren, P.W., et al. (2007). Fc receptor but not complement binding is important in antibody protection against HIV. Nature 449, 101-104. Hoffmann, M., Kleine-Weber, H., and Pohlmann, S. (2020a). A Multibasic
Cleavage Site in the Spike Protein of SARS-CoV-2 Is Essential for Infection of Human Lung Cells. Mol Cell 78, 779-784.e775.
Hoffmann, M., Kleine-Weber, H., Schroeder, S., Kriiger, N., Herrler, T., Erichsen, S., Schiergens, T.S., Herrler, G., Wu, N.H., Nitsche, A., et al. (2020b). SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell 181, 271-280. e278.
Huo, J., Zhao, Y., Ren, J., Zhou, D., Duyvesteyn, H.M.E., Ginn, H.M., Carrique, L., Malinauskas, T., Ruza, R.R., Shah, P.N.M., et al. (2020). Neutralisation of SARS- CoV-2 by destruction of the prefusion Spike. Cell Host & Microbe. Johnson, R.F., Bagci, U., Keith, L., Tang, X., Mollura, D.J., Zeitlin, L., Qin, J., Huzella, L., Bartos, C.J., Bohorova, N., et al. (2016). 3B11-N, a monoclonal antibody against MERS-CoV, reduces lung pathology in rhesus monkeys following intratracheal inoculation of MERS-CoV Jordan-n3/2012. Virology 490, 49-58. Joyce, M.G., Sankhala, R.S., Chen, W.-EL, Choe, M., Bai, EL, Hajduczki, A.,
Yan, L., Sterling, S.L., Peterson, C.E., Green, E.C., et al. (2020). A Cryptic Site of Vulnerability on the Receptor Binding Domain of the SARS-CoV-2 Spike Glycoprotein. bioRxiv, 2020.2003.2015.992883.
Ju, B., Zhang, Q., Ge, X., Wang, R., Yu, J., Shan, S., Zhou, B., Song, S., Tang, X., Yu, J., et al. (2020). Potent human neutralizing antibodies elicited by SARS-CoV-2 infection. bioRxiv, 2020.2003.2021.990770.
Kabsch, W. (2010). XDS. Acta Crystallogr D Biol Crystallogr 66, 125-132.
Ke, Z., Oton, J., Qu, K., Cortese, M., Zila, V., McKeane, L., Nakane, T., Zivanov, J., Neufeldt, C.J., Lu, J.M., et al. (2020). Structures, conformations and distributions of SARS-CoV-2 spike protein trimers on intact virions. bioRxiv, 2020.2006.2027.174979.
Kirchdoerfer, R.N., Wang, N., Pallesen, J., Wrapp, D., Turner, H.L., Cottrell, C.A., Corbett, K.S., Graham, B.S., McLellan, J.S., and Ward, A.B. (2018). Stabilized coronavirus spikes are resistant to conformational changes induced by receptor recognition or proteolysis. Sci Rep 8, 15701.
Lan, J., Ge, J., Yu, J., Shan, S., Zhou, EL, Fan, S., Zhang, Q., Shi, X., Wang, Q., Zhang, L., et al. (2020). Structure of the SARS-CoV-2 spike receptor-binding domain bound to the ACE2 receptor. Nature.
Lau, S.Y., Wang, P., Mok, B.W., Zhang, A.J., Chu, H., Lee, A.C., Deng, S., Chen, P., Chan, K.H., Song, W., et al. (2020). Attenuated SARS-CoV-2 variants with deletions at the S1/S2 junction. Emerg Microbes Infect 9, 837-842.
Letko, M., Marzi, A., and Munster, V. (2020). Functional assessment of cell entry and receptor usage for SARS-CoV-2 and other lineage B betacoronaviruses. Nature Microbiology. Li, L., Zhang, W., Hu, Y., Tong, X., Zheng, S., Yang, L, Kong, Y., Ren, L., Wei, Q., Mei, H., et al. (2020a). Effect of Convalescent Plasma Therapy on Time to Clinical Improvement in Patients With Severe and Life-threatening COVID-19: A Randomized Clinical Trial. JAMA. Li, Q., Wu, J., Nie, J., Zhang, L., Hao, H., Liu, S., Zhao, C., Zhang, Q., Liu, H.,
Nie, L., et al. (2020b). The impact of mutations in SARS-CoV-2 spike on viral infectivity and antigenicity. Cell.
Liebschner, D., Afonine, P.V., Baker, M.L., Bunkoczi, G., Chen, V.B., Croll, T.I., Hintze, B., Hung, L.W., Jain, S., McCoy, A.J., et al. (2019). Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix. Acta Crystallogr D Struct Biol 75, 861-877.
Lindhardt, B.O., Gerstoft, J., Hofmann, B., Pallesen, G., Mathiesen, L., Dickmeiss, E., and Ulrich, K. (1989). Antibodies against the major core protein p24 of human immunodeficiency virus: relation to immunological, clinical and prognostic findings. Eur J Clin Microbiol Infect Dis 8, 614-619.
Liu, L., Wang, P., Nair, M.S., Yu, J., Rapp, M., Wang, Q., Luo, Y., Chan, J.F., Sahi, V., Figueroa, A., et al. (2020a). Potent neutralizing antibodies directed to multiple epitopes on SARS-CoV-2 spike. Nature.
Liu, S.T.H., Lin, H.-M., Baine, L, Wajnberg, A., Gumprecht, J.P., Rahman, F., Rodriguez, D., Tandon, P., Bassily-Marcus, A., Bander, J., et al. (2020b). Convalescent plasma treatment of severe COVID-19: A matched control study. medRxiv, 2020.2005.2020.20102236.
Long, Q.X., Tang, X.J., Shi, Q.L., Li, Q., Deng, H.J., Yuan, J., Hu, J.L., Xu, W., Zhang, Y., Lv, F.J., et al. (2020). Clinical and immunological assessment of asymptomatic SARS-CoV-2 infections. Nat Med.
Luchsinger, L.L., Ransegnola, B., Jin, D., Muecksch, F., Weisblum, Y., Bao, W., George, P.J., Rodriguez, M., Tricoche, N., Schmidt, F., et al. (2020). Serological Analysis of New York City COVID19 Convalescent Plasma Donors. medRxiv. Lund, J.M., Alexopoulou, L., Sato, A., Karow, M., Adams, N.C., Gale, N.W., Iwasaki, A., and Flavell, R.A. (2004). Recognition of single-stranded RNA viruses by Toll-like receptor 7. Proc Natl Acad Sci U S A 101, 5598-5603.
McCoy, A.J., Grosse-Kunstleve, R.W., Adams, P.D., Winn, M.D., Storoni, L.C., and Read, R.J. (2007). Phaser crystallographic software. J Appl Crystallogr 40, 658- 674.
Menachery, V.D., Yount, B.L., Jr., Sims, A.C., Debbink, K., Agnihothram, S.S., Gralinski, L.E., Graham, R.L., Scobey, T., Plante, J.A., Royal, S.R., et al. (2016). SARS-like WIVl-CoV poised for human emergence. Proc Natl Acad Sci U S A 113, 3048-3053.
Millet, J.K., and Whittaker, G.R. (2015). Host cell proteases: Critical determinants of coronavirus tropism and pathogenesis. Virus Res 202, 120-134.
Murshudov, G.N., Skubak, P., Lebedev, A. A., Pannu, N.S., Steiner, R.A., Nicholls, R.A., Winn, M.D., Long, F., and Vagin, A.A. (2011). REFMAC5 for the refinement of macromolecular crystal structures. Acta Crystallogr D Biol Crystallogr 67, 355-367.
Ng, K.W., Faulkner, N., Cornish, G.H., Rosa, A., Harvey, R., Hussain, S., Ulferts, R., Earl, C., Wrobel, A., Benton, D., et al. (2020). Pre-existing and <em>de novo</em> humoral immunity to SARS-CoV-2 in humans. bioRxiv, 2020.2005.2014.095414.
Ortiz, D.F., Lansing, J.C., Rutitzky, L., Kurtagic, E., Prod'homme, T., Choudhury, A., Washburn, N., Bhatnagar, N., Beneduce, C., Holte, K., et al. (2016). Elucidating the interplay between IgG-Fc valency and FcyR activation for the design of immune complex inhibitors. Sci Transl Med 8, 365ral58. Ou, X., Liu, Y., Lei, X., Li, P., Mi, D., Ren, L., Guo, L., Guo, R., Chen, T., Hu,
J., et al. (2020). Characterization of spike glycoprotein of SARS-CoV-2 on virus entry and its immune cross-reactivity with SARS-CoV. Nat Commun 11, 1620.
Pallesen, J., Wang, N., Corbett, K.S., Wrapp, D., Kirchdoerfer, R.N., Turner, H.L., Cottrell, C.A., Becker, M.M., Wang, L., Shi, W., et al. (2017). Immunogenicity and structures of a rationally designed prefusion MERS-CoV spike antigen. Proc Natl Acad Sci U S A 114, E7348-E7357.
Pettersen, E.F., Goddard, T.D., Huang, C.C., Couch, G.S., Greenblatt, D.M., Meng, E.C., and Ferrin, T.E. (2004). UCSF Chimera— a visualization system for exploratory research and analysis. J Comput Chem 25, 1605-1612.
Pinto, D., Park, Y.J., Beltramello, M., Walls, A.C., Tortorici, M.A., Bianchi, S., Jaconi, S., Culap, K., Zatta, F., De Marco, A., et al. (2020). Cross-neutralization of SARS-CoV-2 by a human monoclonal SARS-CoV antibody. Nature 583, 290-295.
Prevost, J., Gasser, R., Beaudoin-Bussieres, G., Richard, J., Duerr, R., Laumaea, A., Anand, S.P., Goyette, G., Ding, S., Medjahed, H., et al. (2020). Cross-sectional evaluation of humoral responses against SARS-CoV-2 Spike. bioRxiv.
Punjani, A., Rubinstein, J.L., Fleet, D.J., and Brubaker, M.A. (2017). cryoSPARC: algorithms for rapid unsupervised cryo-EM structure determination. Nat Methods 14, 290-296. Punjani, A., Zhang, H., and Fleet, D.J. (2019). Non-uniform refinement:
Adaptive regularization improves single particle cryo-EM reconstruction. bioRxiv, 2019.2012.2015.877092.
Robbiani, D.F., Gaebler, C., Muecksch, F., Lorenzi, J.C.C., Wang, Z., Cho, A., Agudelo, M., Barnes, C.O., Gazumyan, A., Finkin, S., et al. (2020). Convergent antibody responses to SARS-CoV-2 in convalescent individuals. Nature.
Rockx, B., Corti, D., Donaldson, E., Sheahan, T., Stadler, K., Lanzavecchia, A., and Baric, R. (2008). Structural basis for potent cross-neutralizing human monoclonal antibody protection against lethal human and zoonotic severe acute respiratory syndrome coronavirus challenge. J Virol 82, 3220-3235. Rogers, T.F., Zhao, F., Huang, D., Beutler, N., Burns, A., He, W.T., Limbo, O.,
Smith, C., Song, G., Woehl, J., et al. (2020). Isolation of potent SARS-CoV-2 neutralizing antibodies and protection from disease in a small animal model. Science.
Scheres, S.H. (2012a). A Bayesian view on cryo-EM structure determination. J Mol Biol 415, 406-418. Scheres, S.H. (2012b). RELION: implementation of a Bayesian approach to cryo-EM structure determination. J Struct Biol 180, 519-530.
Seow, J., Graham, C., Merrick, B., Acors, S., Steel, K.J.A., Hemmings, O., O'Bryne, A., Kouphou, N., Pickering, S., Galao, R., et al. (2020). Longitudinal evaluation and decline of antibody responses in SARS-CoV-2 infection. medRxiv, 2020.2007.2009.20148429.
Seydoux, E., Homad, L.J., MacCamy, A.J., Parks, K.R., Hurlburt, N.K., Jennewein, M.F., Akins, N.R., Stuart, A.B., Wan, Y.-H., Feng, J., et al. (2020). Characterization of neutralizing antibodies from a SARS-CoV-2 infected individual. bioRxiv, 2020.2005.2012.091298.
Shang, J., Ye, G., Shi, K., Wan, Y., Luo, C., Aihara, FL, Geng, Q., Auerbach, A., and Li, F. (2020). Structural basis of receptor recognition by SARS-CoV-2. Nature.
Shen, C., Wang, Z., Zhao, F., Yang, Y., Li, J., Yuan, J., Wang, F., Li, D., Yang, M., Xing, L., et al. (2020). Treatment of 5 Critically Ill Patients With COVID-19 With Convalescent Plasma. JAMA.
Song, W., Gui, M., Wang, X., and Xiang, Y. (2018). Cryo-EM structure of the SARS coronavirus spike glycoprotein in complex with its host cell receptor ACE2. PLoS Pathog 14, el007236.
Stettler, K., Beltramello, M., Espinosa, D.A., Graham, V., Cassotta, A., Bianchi, S., Vanzetta, F., Minola, A., Jaconi, S., Mele, F., et al. (2016). Specificity, cross reactivity, and function of antibodies elicited by Zika virus infection. Science 353, 823- 826.
Suloway, C., Pulokas, J., Fellmann, D., Cheng, A., Guerra, F., Quispe, J., Stagg, S., Potter, C.S., and Carragher, B. (2005). Automated molecular microscopy: the new Leginon system. J Struct Biol 151, 41-60.
Tan, C.W., Chia, W.N., Qin, X., Liu, P., Chen, M.I.C., Tiu, C., Hu, Z., Chen, V.C.-W., Young, B.E., Sia, W.R., et al. (2020). A SARS-CoV-2 surrogate virus neutralization test based on antibody-mediated blockage of ACE2-spike protein- protein interaction. Nature Biotechnology. Tan, Y.Z., Baldwin, P.R., Davis, J.H., Williamson, J.R., Potter, C.S., Carragher, B., and Lyumkis, D. (2017). Addressing preferred specimen orientation in single particle cryo-EM through tilting. Nat Methods 14, 793-796.
Tang, A., Chen, Z., Cox, K.S., Su, H.P., Callahan, C., Fridman, A., Zhang, L., Patel, S.B., Cejas, P.J., Swoyer, R., el al. (2019). A potent broadly neutralizing human RSV antibody targets conserved site IV of the fusion glycoprotein. Nat Commun 10, 4153.
Tegunov, D., and Cramer, P. (2019). Real-time cryo-electron microscopy data preprocessing with Warp. Nat Methods 16, 1146-1152. ter Meulen, T, van den Brink, E.N., Poon, L.L., Marissen, W.E., Leung, C.S.,
Cox, F., Cheung, C.Y., Bakker, A.Q., Bogaards, J.A., van Deventer, E., et al. (2006). Human monoclonal antibody combination against SARS coronavirus: synergy and coverage of escape mutants. PLoS Med 3, e237.
Tian, X., Li, C., Huang, A., Xia, S., Lu, S., Shi, Z., Lu, L., Jiang, S., Yang, Z., Wu, Y., et al. (2020). Potent binding of 2019 novel coronavirus spike protein by a SARS coronavirus-specific human monoclonal antibody. Emerg Microbes Infect 9, 382-385.
Tortorici, M.A., and Veesler, D. (2019). Structural insights into coronavirus entry. Adv Virus Res 105, 93-116. Traggiai, E., Becker, S., Subbarao, K., Kolesnikova, L., Uematsu, Y.,
Gismondo, M.R., Murphy, B.R., Rappuoli, R., and Lanzavecchia, A. (2004). An efficient method to make human monoclonal antibodies from memory B cells: potent neutralization of SARS coronavirus. Nat Med 10, 871-875.
Walls, A.C., Park, Y.J., Tortorici, M.A., Wall, A., McGuire, A.T., and Veesler, D. (2020). Structure, Function, and Antigenicity of the SARS-CoV-2 Spike Glycoprotein. Cell 181, 281-292.e286.
Walls, A.C., Tortorici, M.A., Bosch, B.J., Frenz, B., Rottier, P.J.M., DiMaio, F., Rey, F.A., and Veesler, D. (2016a). Cryo-electron microscopy structure of a coronavirus spike glycoprotein trimer. Nature 531, 114-117. Walls, A.C., Tortorici, M.A., Frenz, B., Snijder, J., Li, W., Rey, F.A., DiMaio, F., Bosch, B.J., and Veesler, D. (2016b). Glycan shield and epitope masking of a coronavirus spike protein observed by cryo-electron microscopy. Nat Struct Mol Biol 23, 899-905. Walls, A.C., Tortorici, M.A., Snijder, J., Xiong, X., Bosch, B.J., Rey, F.A., and
Veesler, D. (2017). Tectonic conformational changes of a coronavirus spike glycoprotein promote membrane fusion. Proc Natl Acad Sci U S A 114, 11157-11162.
Walls, A.C., Xiong, X., Park, Y.J., Tortorici, M.A., Snijder, J., Quispe, J., Cameroni, E., Gopal, R., Dai, M., Lanzavecchia, A., et al. (2019). Unexpected Receptor Functional Mimicry Elucidates Activation of Coronavirus Fusion. Cell 176 , 1026- 1039.el015.
Wang, C., Li, W., Drabek, D., Okba, N.M.A., van Haperen, R., Osterhaus, A.D.M.E., van Kuppeveld, F.J.M., Haagmans, B.L., Grosveld, F., and Bosch, B.-J. (2020a). A human monoclonal antibody blocking SARS-CoV-2 infection. bioRxiv, 2020.2003.2011.987958.
Wang, Q., Zhang, Y., Wu, L., Niu, S., Song, C., Zhang, Z., Lu, G., Qiao, C., Hu, Y., Yuen, K.Y., et al. (2020b). Structural and Functional Basis of SARS-CoV-2 Entry by Using Human ACE2. Cell 181, 894-904.e899.
Wang, R.Y., Song, Y., Barad, B.A., Cheng, Y., Fraser, J.S., and DiMaio, F. (2016). Automated structure refinement of macromolecular assemblies from cryo-EM maps using Rosetta. Elife 5.
Watanabe, Y., Allen, J.D., Wrapp, D., McLellan, J.S., and Crispin, M. (2020). Site-specific glycan analysis of the SARS-CoV-2 spike. Science.
Wee, A.Z., Wrapp, D., Herbert, A.S., Maurer, D.P., Haslwanter, D., Sakharkar, M., Jangra, R.K., Dieterle, M.E., Lilov, A., Huang, D., et al. (2020). Broad neutralization of SARS-related viruses by human monoclonal antibodies. Science.
Wrapp, D., Wang, N., Corbett, K.S., Goldsmith, J.A., Hsieh, C.L., Abiona, O., Graham, B.S., and McLellan, J.S. (2020). Cryo-EM structure of the 2019-nCoV spike in the prefusion conformation. Science 367, 1260-1263. Wu, Y., Wang, F., Shen, C., Peng, W., Li, D., Zhao, C., Li, Z., Li, S., Bi, Y., Yang, Y., et al. (2020). A noncompeting pair of human neutralizing antibodies block COVID-19 virus binding to its receptor ACE2. Science 368, 1274-1278.
Yan, R., Zhang, Y., Li, Y., Xia, L., Guo, Y., and Zhou, Q. (2020). Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2. Science 367, 1444-1448.
Ying, T., Prabakaran, P., Du, L., Shi, W., Feng, Y., Wang, Y., Wang, L., Li, W., Jiang, S., Dimitrov, D.S., et al. (2015). Junctional and allele-specific residues are critical for MERS-CoV neutralization by an exceptionally potent germline-like antibody. Nat Commun 6, 8223.
Yuan, M., Wu, N.C., Zhu, X., Lee, C D., So, R.T.Y., Lv, H., Mok, C.K.P., and Wilson, I.A. (2020). A highly conserved cryptic epitope in the receptor-binding domains of SARS-CoV-2 and SARS-CoV. Science.
Yuan, Y., Cao, D., Zhang, Y., Ma, J., Qi, J., Wang, Q., Lu, G., Wu, Y., Yan, J., Shi, Y., et al. (2017). Cryo-EM structures of MERS-CoV and SARS-CoV spike glycoproteins reveal the dynamic receptor binding domains. Nat Commun 8, 15092.
Zhou, P., Yang, X.L., Wang, X.G., Hu, B., Zhang, L., Zhang, W., Si, H.R., Zhu, Y., Li, B., Huang, C.L., et al. (2020a). A pneumonia outbreak associated with a new coronavirus of probable bat origin. Nature. Zhou, T., Tsybovsky, Y., Olia, A.S., Gorman, J., Rapp, M.A., Cerutti, G.,
Katsamba, P.S., Nazzari, A., Schon, A., Wang, P.D., et al. (2020b). A pH-dependent switch mediates conformational masking of SARS-CoV-2 spike. bioRxiv.
Zivanov, J., Nakane, T., Forsberg, B.O., Kimanius, D., Hagen, W.J., Lindahl, E., and Scheres, S.H. (2018). New tools for automated high-resolution cryo-EM structure determination in RELION-3. Elife 7.
Zivanov, J., Nakane, T., and Scheres, S.H.W. (2019). A Bayesian approach to beam-induced motion correction in cryo-EM single-particle analysis. IUCrJ 6, 5-17. EXAMPLE 3
ULTRAPOTENT HUMAN ANTIBODIES PROTECT AGAINST SARS-COV-2
CHALLENGE VIA MULTIPLE MECHANISMS
Isolation of ultra-potent SARS-CoV-2 neutralizing Abs.
Memory B cells from two individuals recovering from severe COVID-19 disease were sorted using biotinylated prefusion SARS-CoV-2 S ectodomain trimer as bait. Two mAbs, S2E12 and S2M11, stood out for their high neutralization potency against authentic SARS-CoV-2 virus and two different SARS-CoV-2 S pseudotyped viruses (using either murine-leukemia virus (MLV) or vesicular stomatitis virus (VSV) backbones). In an assay that measures inhibition of authentic SARS-CoV-2 entry (SARS-CoV-2-Nluc (34)), half-maximal inhibitory concentrations (ICso) of 3-6 ng/ml (20-40 pM) were determined (Figures 35A-35B). ICso values of 1.9-2.5 ng/ml for SARS-CoV-2 S-VSV (Figure 40A) and 10.3-30.4 ng/ml for SARS-CoV-2 S-MLV were determined (Figure 40B). In an authentic SARS-CoV-2 focus reduction neutralization test that measures inhibition of virus entry and spread (35), the ICso values were 1.2-6.6 ng/ml (Figure 40C). The potency of these mAbs was demonstrated further by the concentrations necessary to inhibit 90% of authentic SARS-CoV-2 -Nluc viral entry (IC90), which was determined as 26.4+7.8 ng/mL and 12.7+3.1 ng/mL for S2E12 and S2M11, respectively. The higher neutralization potency of IgG compared to Fab observed for each mAb suggested that the distinct binding affinities and/or bivalent binding contribute to potency (Figure 35A). The S2E12 heavy chain uses VH1-58*01, D2-15*01 and JH3*02 genes whereas S2M11 derives from VH 1-2*02, D3-3*01 and JH4*02 genes. The heavy chain variable gene nucleotide sequence germline identity is 96.53% for S2M11 and 97.6% for S2E12.
Both S2E12 and S2M11 bound to the SARS-CoV-2 RBD and prefusion- stabilized S ectodomain trimer ( 6 ) but not to the SARS-CoV RBD or S (36) by ELISA (Figures 35C-35F). Using surface plasmon resonance (SPR) and flow cytometry, it was observed that S2E12 and S2M11 compete for binding to the SARS-CoV-2 RBD or to SARS-CoV-2 S, presented either as a recombinantly expressed prefusion-stabilized S ectodomain trimer or as full-length S expressed at the surface of ExpiCHO cells (Figures 41A-41B). When added first, S2M11 competed in a concentration-dependent manner with the sarbecovirus neutralizing S309 mAh for binding to SARS-CoV-2 S, whereas it could bind with minimal competition when added after S309 (Figure 41B). Whereas the S2E12 Fab (or IgG) bound to SARS-CoV-2 S and RBD similarly, the binding affinity of the S2M11 Fab (or IgG) for the S trimer was enhanced relative to the isolated SARS-CoV-2 RBD (Figure 35G and Figure 41C). Specifically, S2M11 binding kinetics to SARS-CoV-2 S were biphasic, including a first phase with identical binding kinetics and affinity as measured for binding to the isolated RBD, and a second phase with a much slower off-rate and therefore higher affinity. Binding of S2M11 Fab and IgG to S was increased at pH 5.4, a condition that favors the closed trimer conformation, compared to pH 7.4 (37) (Figure 35G, Figure 41C and Figure 49). Conversely, binding of the S2E12 Fab to S was diminished at pH 5.4 (and moderately reduced for S2E12 IgG), possibly due to the increased number of S trimers with closed RBDs (Figure 35G, Figures 41 A and 41Cand Figure 49).
Collectively, these findings indicate that S2M11 and S2E12 target overlapping or partially overlapping SARS-CoV-2 RBD epitopes. The finding that S2M11 preferentially interacts with the S trimer relative to the RBD suggest that this mAh may bind to a quaternary epitope only exposed in the context of a native closed prefusion S. Finally, the enhanced binding of S2E12 to SARS-CoV-2 S in conditions favoring RBD opening (pH 7.4) indicates that this mAh may recognize a cryptic epitope not exposed in the closed S trimer.
S2E12 potently neutralizes SARS-CoV-2 by targeting the RBM
To understand the mechanism of S2E12-mediated potent neutralization of SARS-CoV-2, a complex between the SARS-CoV-2 S ectodomain trimer and the S2E12 Fab fragment was characterized using cryo-electron microscopy (cryoEM). 3D classification of the data showed the presence of S trimers with one, two or three Fabs bound to open RBDs for which structures were determined at 3.5 A, 3.3 A and 3.3 A resolution, respectively (Figures 36A-36B, Figures 42A-42G and Figure 50). Local refinement was used to obtain a 3.7 A map of the region corresponding to the S2E12 variable domains and RBD, which improved local resolution due to conformational dynamic relative to the rest of the S trimer, and this map was used along with a 1.4Ά crystal structure of the S2E12 Fab to build a model (Figures 43D-43G, Figure 50 and Figure 51).
S2E12 recognizes an RBD epitope overlapping with the RBM (i.e. ACE2 receptor-binding site) that is partially buried at the interface between protomers in the closed S trimer (Figures 36A-36D and Figures 43A-43B). As a result, based on these data, S2E12 only interacts with open RBDs, as is the case for ACE2 as well as for several previously described neutralizing mAbs including S2H14 (22, 25) (Piccoli, Cell in Press). The concave S2E12 paratope recognizes the convex RBM tip through electrostatic and van der Waals interactions (Figures 36C-36D). Specifically, S2E12 utilizes the heavy chain complementary determining regions (CDR) 1-3 and the light chain CDR1 and CDR3, respectively accounting for 2/3 and 1/3 of the paratope buried surface area, to recognize residues 455-458 and 473-493 of the SARS-CoV-2 RBD (Figures 36C-36D). Most of the S2E12 contacts with the RBD are mediated by germline encoded residues, with only 1 out of 5 heavy chain (Glyl09) and 1 out of 4 light chain (Gly94) mutated residues contributing to the paratope. The structural data explain that S2E12 binds efficiently to both the RBD and the prefusion S trimer (Figure 35G) and potently neutralizes SARS-CoV-2 (Figures 35A-35B and Figures 40A-40C): (i) S2E12 recognizes a tertiary 3D epitope, i.e. an epitope that is fully contained within one S protomer; (ii) -50% of S trimers naturally harbor one open RBD at the viral surface or in recombinantly expressed S ectodomain trimers as observed by cryo- electron tomography and single particle cryoEM, respectively (6, 38), and (iii) S2E12 binding shifts the RBD conformational equilibrium toward open S trimers, as previously described for RBM-targeted mAbs (22, 36) (Piccoli, Cell in Press).
Further studies of S2E12 in complex with RBD achieved a resolution of 2.93 angstroms. Based on these studies, the S2E12 epitope is formed by amino acid residues 417, 453, 455, 456, 473, 475-480, 484-489, and 493. S2M11 locks the SARS-CoV-2 S trimer in the closed state through binding to a quaternary epitope
CryoEM analysis of S2M11 in complex with SARS-CoV-2 S was carried out.
3D classification of the cryoEM data revealed the exclusive presence of S turners adopting a closed conformation, which allowed determination of a 2.6Ά structure of SARS-CoV-2 S bound to three S2M11 Fab fragments (Figures 37A-37B, Figures 44A- 44F and Figure 50). S2M11 recognizes a quaternary epitope through electrostatic interactions and shape complementarity, comprising distinct regions of two neighboring RBDs within an S trimer (Figures 37C-37D). Specifically, S2M11 CDRH1, CDRH2 and the heavy chain framework region 3 (FR3) are docked into the RBM crevice (burying a surface of ~400A2), whereas CDRH3 spans the interface between the RBM and helices 339-343, and 367-374, as well as residue 436 of an adjacent RBD belonging to the neighboring protomer (i.e., burying a total surface of ~500A2) (Figures 37C-37F). S2M11 CDRL2 interacts with residues 440-441 and CDRLl forms key contacts with the glycan at position N343, which is rotated -45° compared to the orientation it adopts in the S309-bound S structure (27), both sets of interactions occurring with the neighboring RBD (quaternary epitope) (Figures 37C-37F and Figure 44G). Three out of eight S2M11 heavy chain residues that are mutated relative to germline contribute to epitope recognition (Ile54, Thr77 and Phel02) whereas none of the two light chain mutated residues participate in RBD binding. Further studies indicated that the S2M11 epitope is formed by: on a first RBD, amino acid residues 339, 342, 343, 367, 368, 371, 372, 373, 374, 436, 440, and 441, and, on a second RBD, amino acid residues 446, 447, 449, 452, 455, 456, 484, 485, 486, 487, 489, 490, 492, 493, 494, 496, and 498.
The observation that all particle images correspond to closed S trimers when bound to S2M11 contrasts with the previous finding of ~50%/50% of trimers closed or with one RBD open in the absence of bound mAh ( 6 ) or in complex with S309 (27) or S2H13 (Piccoli et al. Cell, in press), which do not select for any specific RBD conformation. Based on these data, it appears that S2M11 stabilizes the closed conformation of the S trimer by interacting with a composite epitope including two neighboring RBDs (from two distinct protomers) that are close to each other in the closed state but spread apart upon RBD opening (6) (Figures 43C-43D). These results also explain the enhanced S2M11 binding affinity for S compared to the RBD (Figure 35G), as only the S trimer enables binding to the quaternary epitope which buries a -60% greater paratope surface area compared to binding to the isolated RBM (Figures
37A-37F). The biphasic binding may be interpreted as S2M11 interacting with a tertiary epitope present in open RBDs (fast off-rate), based on the identical kinetics and affinity measured relative to isolated RBD, and S2M11 recognizing its full quaternary epitope (slow off-rate).
S2M11 and S2E12 inhibit SARS-CoV-2 atachment to ACE 2 and trigger Fc-mediated effector functions
The present structural data indicate that both S2E12 and S2M11 would compete with ACE2 attachment to the RBD as they recognize epitopes overlapping with the RBM (Figures 38A-38B). Moreover, S2M11-induced stabilization of SAR.S-CoV-2 S in the closed conformational state yields S trimers with masked RBMs that are incompetent for receptor engagement, as previously shown for an engineered S construct covalently stabilized in the closed state (39). As expected based on the structures, both S2E12 and S2M11 blocked binding of SAR.S-CoV-2 S or RBD to immobilized human recombinant ACE2 measured by biolayer interferometry (Figures 38C-38D). Additionally, both S2E12 and S2M11 inhibited binding of ACE2 to SAR.S- CoV-2 S expressed at the surface of CHO cells (Figure 38E), validating this mechanism of neutralization using full-length native S trimers. The comparable efficiency of S2E12 and S2M11 to block S attachment to ACE2 correlates with their similar neutralization potencies.
To further investigate SAR.S-CoV-2 inhibition by S2E12 and S2M11, a cell-cell fusion assay was performed using VeroE6 cells (which endogenously express ACE2 at their surface) transiently transfected with full-length wildtype SAR.S-CoV-2 S. Although S2E12 and S2M11 bind and stabilize different conformations of the S protein, both mAbs efficiently blocked syncytia formation (Figure 38F), which results from S- mediated membrane fusion. The absence of syncytia formation may be explained by S2E12- or S2M11 -mediated disruption of ACE2 binding along with S2M11-induced inhibition of membrane fusion through conformational trapping of SARS-CoV-2 S in the closed state.
Ab-dependent cell cytotoxicity (ADCC) mediated by natural killer cells or Ab- dependent cell phagocytosis (ADCP) mediated by macrophages or monocytes are Fc- mediated effector functions that can contribute to protection by facilitating virus clearance and by supporting immune responses in vivo, independently of direct neutralization (40). As a prerequisite for ADCC to occur, it was validated that infected cells express SARS-CoV-2 S on their surface (Figures 45A-45B). To evaluate the ability of S2M11 and S2E12 to leverage ADCC and ADCP, these mAbs (IgGl backbone) were tested for induction of FcyRIIa and FcyRIIIa-mediated signaling using a luciferase reporter assay. S2M11 promoted efficient, dose-dependent FcyRIIIa- mediated (but not FcyRIIa-mediated) signaling, in particular for the high affinity (VI 58) variant of the Fc receptor, to levels comparable to the cross-reactive mAb S309 (Figure 38G and Figures 45C-45D) (21). In contrast, S2E12 triggered FcyRIIa-mediated (but not FcyRIIIa-mediated) signaling, possibly as a result of the distinct orientation of the mAb relative to the membrane of the effector cells in comparison to S2M11 and S309. Accordingly, S2M11 but not S2E12 showed FcyRIIIa-dependent ADCC activity (Figure 38H and 45E) and ADCP activity (Figure 381). As efficient activation of effector functions was observed when mixing S2M11 with S2E12 or S309 (Figures 38G, 38H and 45E), cocktails of these mAbs may leverage additional protective mechanisms in vivo besides inhibition of viral entry.
Formulation of ultra-potent neutralizing Ab cocktails against SARS-CoV-2
Surveillance efforts have led to the identification of a number of S mutants among circulating SARS-CoV-2 isolates. Several naturally occurring RBD mutations were shown to abrogate interactions with known mAbs and to reduce immune sera binding, raising concerns that viral neutralization escape mutants could emerge or be selected under pressure from mAb-based anti -viral treatments (41). To investigate if S2E12- and S2M11 -mediated neutralization might be affected by SARS-CoV-2 polymorphism, binding of either mAh to 29 S protein variants (corresponding to mutations detected in circulating SARS-CoV-2 isolates) expressed at the surface of CHO cells was tested. The Y449N, E484K/Q, F490L and S494P RBD variants led to decreased S2M11 binding to S whereas none of the mutants tested affected interactions with S2E12, although several of them are found in the epitope of this latter mAh (Figure 52). The impact of these substitutions on S2M11 binding is explained by the structural data showing that the SARS-CoV-2 S Y449 and E484 side chains are hydrogen-bonded to the S2M11 heavy chain F29 backbone amide and the N52/S55 side chains, respectively, and the F490 and S494 residues are buried at the interface with S2M11. SARS-CoV-2 S-VSV pseudotyped virus entry assays with selected S variants confirmed these results and showed that the Y449N, E484K/Q, F490L/S and S494P individual substitutions abrogated S2M11 -mediated neutralization whereas the L455F variant reduced neutralization potency by an order of magnitude (Figures 46A, 46C, 46E). S2E12 neutralized efficiently all variants tested except G476S that showed an order of magnitude decreased potency (Figures 46B, 46D, 46F). In agreement with deep mutational scanning data (42), it was found that the Y449N variant was impaired in its ability to bind ACE2 (Figure 47) which is expected to reduce viral fitness, likely explaining that this mutation has been reported to date in only one out of 90,287 complete SARS-CoV-2 genome sequences. Although rare, the G476S, E484K/Q,
S494P and F490L mutations have been detected in 20, 10/17, 15 and 5 viral isolates across three continents and in theory could be selected under the selective pressure of S2E12 or S2M11. Overall, fifteen SARS-CoV-2 S variants with a single amino acid substitution within the S2M11 epitope were reported, with a prevalence of less than 0.1% as of September 2020. (Figure 46G).
To circumvent the risk of emergence or selection of neutralization escape mutants, the combination of S2M11, S2E12 and S309 in two-component mAh cocktails based on their complementary mechanisms of action was assessed. SARS-CoV-2 S- VSV pseudotyped virus entry assays showed that mAh cocktails potently neutralized the Y449N, S494P and G476S variants and overcame the neutralization escape phenotype observed with single mAbs (Figures 46H-46I). A concentration matrix of S2E12 and S2M11 revealed their additive neutralization effects without antagonism, despite the fact that both Abs compete for binding to the RBM (Figures 48A-48C). Moreover, the combination of S309 with S2E12, which do not compete for binding to S, and S309 and S2M11, which partially compete (i.e. for attachment to the closed S trimer), also yielded additive neutralization effects (Figures 48D-48F), suggesting that two- (or three-) component mAh cocktails may prevent the emergence or the selection of viral mutants escaping mAh therapy.
S2M11 and S2E12 protect hamsters against SARS-CoV-2 challenge To evaluate the protective efficacy of S2E12 and S2M11 against SARS-CoV-2 challenge in vivo , either mAh or a cocktail of both mAbs were tested in a Syrian hamster model (43). The mAbs were engineered with heavy and light chain constant regions from Syrian hamster IgG2 to allow optimal triggering of Fc-dependent effector functions. mAbs were administered via intraperitoneal injection 48h before intranasal challenge with 2 x 106 TCTDso of SARS-CoV-2. Four days later, lungs were collected for the quantification of viral RNA and infectious virus. Either mAh alone or cocktails with 0.5 mg/kg or 1 mg/kg total mAh decreased the amount of viral RNA detected in the lungs by 2 to 5 orders of magnitude compared to hamsters receiving a control mAh (Figure 39A). The amounts of viral RNA detected at day 4 inversely correlated with serum mAh concentration measured at the time of infection (Spearman R -0.574, p=0.0052) (Figure 39B). Prophylactic administration of these mAbs at all doses tested completely abrogated viral replication in the lungs, with the exception of a single animal which received the low dose cocktail and was partially protected (Figure 39C). These data show protective efficacy of both mAbs at low doses, individually or as cocktails, in line with their ultra-potent in vitro neutralization.
Materials and Methods Reagents
Cell lines were obtained from ATCC (HEK293T, Vero-E6), Thermo-Fisher Scientific (HEK293F) or Invitrogen (Expi-CHO cells). Expi-293 (Invitrogen) and Expi- CHO cells (Invitrogen) were maintained in Expi-293 Expression Medium (Invitrogen) and ExpiCHO- Expression Medium (Gibco), respectively. All cell lines used in this study (except HEK293F) were routinely tested for mycoplasma and found to be mycoplasma-free.
Recombinant glycoprotein production
For B-cell sorting and cryoEM studies, a SARS-CoV-2 prefusion S ectodomain trimer was designed based on a previously described construct (6). Specifically, a gene encoding for the ectodomain of SARS-CoV-2 prefusion S ectodomain trimer (residues 14-1211, GenBank: YP 009724390.1) covering the region from the end of the signal peptide sequence (starting with QCVN) to the beginning of the transmembrane domain (ending with QYIK) was synthesized, codon optimized for human cell expression and placed into a pCVM vector by Genscript. To maximize protein expression, Kozak sequence was added as well as sequences encoding an exogenous N-terminal signal peptide: MGILPSPGMPALLSLV SLLSVLLMGCVAETGT (SEQ ID NO : 160) derived from m-phosphatase, the K986P-V987P substitutions, the substitution of arginines at the S1/S2 cleavage site: R682S, R683G, R685G and a C-terminal extensi on : GSGR/A7. F/ OO'GGGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGSGG L NDIFEAQKIEWHEGSGHHHHHHHH (SEQ ID NO : 161) including a TEV cleavage site (italic), a T4 foldon trimerization motif (underlined), an avi-tag (bold) and 8 histidine residues (SARS-CoV-2 S avi). The SARS-CoV-2 S hexapro construct was previously described (57). Both proteins were expressed in HEK293F cells grown in suspension using FreeStyle 293 expression medium (Life technologies) at 37°C in a humidified 8 % C02 incubator rotating at 130 rpm. The cultures were transfected using PEI (9 pg/mL) with cells grown to a density of 2.5 million cells per mL and cultivated for 4 days. Supernatants were harvested and cells resuspended for another 4 days in fresh media, yielding two harvests. SARS-CoV-2 S hexapro was purified from clarified supernatants using lmL cobalt resin (Takara Bio TALON) and SARS-CoV-2 S avi was purified from supernatants using a lmL HisTrap HP column. Both proteins were concentrated and flash frozen in a buffer containing 20 mM Tris pH 8.0 and 150 mM NaCl prior to analysis. SDS-PAGE and negative stain EM was run to check purity and quality of the proteins.
For SPR and BLI, SARS-CoV-2 S (residues 13-1211) with a mu-phosphatase signal sequence and a C-terminal Avi-His8-EPEA-tag in a pD2610-V5 vector (ATUM Bio) was expressed in Expi293F cells at 37°C and 8% C02 according to manufacturer’s instructions (Thermo Fisher Scientific). Cell culture supernatant was collected after four days and purified over a 5 mL C-tag affinity matrix (Thermo Fisher Scientific). Elution fractions were concentrated and injected on a Superose 6 Increase 10/300 GL column with lx PBS pH 7.4 as running buffer.
SARS-CoV-2 RBD (residues 328-531 with a C-terminal thrombin cleavage site- TwinStrep-8xHis-tag, and N-terminal signal sequence) was expressed in Expi293F cells at 37°C and 8% CO2 in a humidified incubator. Transfection was performed using ExpiFectamine 293 reagent (Thermo Fisher Scientific). Cell culture supernatant was collected three days after transfection and supplemented with 1 Ox PBS to a final concentration of 2.5x PBS (342.5 mM NaCl, 6.75 mM KC1 and 29.75 mM phosphate) and sodium phosphate dibasic to adjust the pH. SARS-CoV-2 RBD was purified using a 1 ml HisTALON Superflow cartridge (Takara Bio) and subsequently buffer exchanged using a Zeba spin desalting column into Cytiva lx HBS-N buffer.
Recombinant ACE2 (residues 19-615 from Uniprot Q9BYF1 with a C-terminal thrombin cleavage site-TwinStrep-lOxHis-GGG-tag, and N-terminal signal sequence) was expressed in Expi293F cells at 37 °C and 8% C02 in a humified incubator. Transfection was performed using ExpiFectamine 293 reagent (Thermo Fisher Scientific). Cell culture supernatant was collected seven days after transfection, supplemented with buffer to a final concentration of 80 mM Tris-HCl pH 8.0, 100 mM NaCl, and then incubated with BioLock solution for one hour. After filtration through a 0.22 pm filter, ACE2 was purified using a 1 ml StrepTrap High Performance column (Cytiva) followed by size exclusion chromatography using a Superdex 200 Increase 10/300 GL column and PBS as running buffer (Gibco 10010-023). ACE2 protein for BLI experiments was expressed in ExpiCHO-S cells. Cell culture supernatant was collected nine days after transfection and protein was purified as described above using 20 mM Tris-HCl pH 7.5, 150 mM NaCl as size exclusion buffer.
Donors. B-cell isolation and mAb expression
Peripheral blood samples were obtained from two donors who have recovered from SARS-CoV-2 infection. Samples were collected 46 and 61 days after symptoms onset, respectively. Donors provided written informed consent. The study was approved by the Scientific and Ethical Committee of the Luigi Sacco Hospital, Milan, Italy. Peripheral blood mononuclear cells were isolated by Ficoll density gradient centrifugation and cryopreserved until use. Upon thawing of cells, B cells were enriched by staining with CD 19 PE-Cy7 (BD Bioscience 341113) and incubation with anti -PE bead (Miltenyi Biotec, cat. 130-048-801), followed by positive selection using LS columns. Enriched B cells were stained with anti-IgM, anti-IgD, anti-CD14 and anti-IgA, all PE labelled, and prefusion SARS-CoV-2 S with a biotinylated avi tag conjugated to Streptavidin Alexa-Fluor 647 (Life Technologies). SARS-CoV-2 S- specific IgG+ memory B cells were sorted by flow cytometry via gating for PE- negative and Alexa-Fluor 647 positive cells. Cells were cultured for the screening of positive supernatants.
S2M11 and S2E12 VH and VL sequences were obtained by RT-PCR and mAbs (including S309) were expressed as recombinant human Fab fragment or as IgGl (Glm3 allotype) carrying the half-life extending M428L/N434S (LS) mutation in the Fc . ExpiCHO cells were transiently transfected with heavy and light chain expression vectors as described previously (57). For in vivo experiments in Syrian hamsters, S2M11, S2E12 and a control mAb (specific to Plasmodium falciparum sporozoite) were produced with a Syrian hamster IgG2 Fc.
Affinity purification of recombinant antibodies was performed on AKTA Xpress FPLC (Cytiva) operated by UNICORN software version 5.11 (Build 407) using HiTrap Protein A columns (Cytiva) for full length human and hamster antibodies and CaptureSelect CH1-XL MiniChrom columns (ThermoFisher Scientific) for Fab fragments, using PBS as mobile phase. Buffer exchange to the appropriate formulation buffer was performed with a HiTrap Fast desalting column (Cytiva).
Enzyme-linked immunosorbent assay (ELISA)
96-well ELISA plates were coated overnight at 4°C with 5 pg/ml of SARS-CoV2 RBD (produced in house; residues 331-550 of S glycoprotein from BetaCoV/Wuhan- Hu-1/2019, accession number MN908947) or 1 pg/ml of SARS-RBD (Sino Biological Europe GmbH), SARS-CoV-2 (6) or SARS-CoV S (36) trimers in PBS. Plates were blocked with a 1% w/v solution of Bovine Serum Albumin (BSA; Sigma) in PBS and incubated with serial dilutions of mAbs for 1 hour at room temperature. Subsequently, the plates were washed, and anti-human IgG coupled to alkaline phosphatase (Jackson Immunoresearch) were added and incubated for 1 hour. After further washing, the substrate (p-NPP, Sigma) was added and plates were read at 405 nm using a microplate reader (Biotek). The data have been plotted with Graphpad Prism software.
Binding measurements using SPR
Binding measurements were performed using a Biacore T200 instrument using either anti-AviTag pAb (for capturing S protein) or StrepTactin XT (for capturing RBD) covalently immobilized on CM5 chips. The running buffer was either Cytiva HBS-EP+ pH 7.4 (for neutral pH experiments) or 20 mM phosphate pH 5.4, 150 mM NaCl, 0.05% P-20 (for acidic pH experiments). All measurements were performed at 25 °C. Affmity/avidity determinations were run as single-cycle kinetics, with a 3-fold dilution series of mAb starting from 300 nM, and each concentration injected for 180 sec. Double reference-subtracted data were fit to either a 1 : 1 binding model or a heterogeneous ligand model (for S2M11), using Biacore Evaluation software. Fit results yielded apparent equilibrium dissociation constants (I<D.app) due to conformational dynamics of the RBDs in the context of the prefusion S trimer and due to avidity for IgG binding. For dissociation rates that were too slow to fit, K r>.app are reported as an upper limit. For IgG competition experiments, the first injection contained 300 nM IgG; the second injection maintained the same 300 nM IgG as the first injection, plus an additional IgG at 300 nM. Each injection was carried out for 420 sec. For all measurements, pH 5.4 data were normalized by capture level to the corresponding pH 7.4 data set to enable plotting the data on the same scale.
Biolaver Interferometry to test ACE2 binding inhibition mAb-mediated inhibition of SARS-CoV-2 RBD or S binding to human recombinant ACE2 was assessed using biolayer interferometry with an Octet Red96 (ForteBio). Before the assay SARS-CoV2 RBD (1 pg/ml) or prefusion S ectodomain trimer (15 pg/ml) were incubated in kinetic buffer KB (PBS + 0.01% BSA) with S2M11, S2E12, S309 (30 pg/ml) or no mAb for 30 minutes at 37°C. Biotinylated recombinant human ACE2 protein in KB (2 pg/ml) was immobilized on High Precision Streptavidin SAX Biosensors (Sartorius). Next, an association step with the RBD/mAb or S/mAb complexes was performed for 6 and 10 minutes, respectively. Results were plotted using Graphpad Prism.
Inhibition of ACE2 binding to SARS-CoV-2 S expressed at the surface of ExpiCHO Cells using flow cytometry
S2M11, S2E12 and S309 were biotinylated using the EZ-Link NHS-PEO solid phase biotinylation kit (Pierce) and mAbs were subsequently buffer exchanged using a 7kDa MWCO Zeba Spin Desalting Columns into PBS. The concentration to achieve the 80 % maximal binding to ExpiCHO cells stably expressing wildtype, full-length spike SARS-CoV-2 S (strain MN908947.3) was determined by flow cytometry.
Unlabeled S2M11, S2E12 and S309 were serially diluted from 10 to 0.056 pg/ml and added to ExpiCHO cells. After 20 minutes, biotinylated mAbs were added at the concentration achieving 80% maximal binding and incubated for additional 20 minutes. Cells were washed and incubated with Streptavidin Alexa Fluor 647 (Life 690Technologies). After 20 minutes and additional washing steps, cells were analyzed with a 855 ZE5 flow-cytometer (Bio-rad).
Flow cytometry of mAb and ACE2 binding on Spike Protein expressing ExpiCHO-S Cells
Transient Expression of SARS-CoV-2 Spike Protein on ExpiCHO-S Cells. The SARS-CoV-2 spike protein coding sequence (YP 009724390.1) was cloned into the pcDNA3.1(+) vector under control of the human CMV promoter to generate pcDNA3.1(+) SARS-CoV-2 D19 spike. SARS-CoV-2 S and variants were generated using site-directed mutagenesis. Immediately before transfection, ExpiCHO-S cells were seeded at 6 x 106 cells cells/mL in a volume of 5 mL in a 50 mL bioreactor. S variant plasmids were diluted in iced OptiPRO SFM, mixed with ExpiFectamine CHO Reagent (Life Technologies) and added to the cells. Transfected cells were then incubated at 37°C, 8% CO2 with an orbital shaking speed of 209 RPM (orbital diameter of 25 mm) for 42 hours.
Generation of fluorescently labeled ACE2
ACE2 was biotinylated by incubation with a 1.5 molar excess of Thermo EZ-Link NHS-PEG4-Biotin and was subsequently buffer exchanged using two successive 0.5 ml 7k MWCO Zeba Spin Desalting Columns into PBS; final concentration 1.1 mg/ml. Biotinylated- ACE2 was incubated with SA-BV421 (Biolegend) at a ratio of 1 : 1 by volume for 20 minutes at room temperature.
Binding to Cell Surface Expressed SARS-CoV-2 S
ExpiCHO cells expressing SARS-CoV-2 S variants were harvested, washed twice with FACS buffer (2% FBS), and dispensed into a 96-well V-bottom plate. Separately, the test antibody or ACE2-BV421 were serially diluted. As a positive control for SARS- CoV-2 S variants expression, a SARS-CoV-2 convalescent plasma sample was tested at a dilution of 1 :500. Cells were stained with mAb for 30 mins on ice and then washed twice in FACS buffer. Alexa Fluor 647-labelled Goat Anti-Human IgG secondary Ab (Jackson Immunoresearch) was diluted 1 :750 in FACS buffer to the cells for 15 min on ice. Cells were washed twice with FACS buffer and resuspended in 1% PFA (Alfa Aesar). Data was acquired by flow-cytometry (CytoFlex LX).
Competition of mAb and ACE2 for S binding
ExpiCHO cells transfected with wildtype or variant SARS-CoV-2 S were seeded in 96 well V bottom plates and incubated with the indicated anti-S mAbs diluted in FACS buffer for 15 minutes on ice. A final concentration of 20 pg/ml ACE2-SA-BV421 was then added to the cells and incubated for 30 minutes on ice. Cells were washed twice with FACS buffer, resuspended in FACS buffer containing Alexa Fluor 647-AffmiPure F(ab’)2 Fragment Goat Anti-Human IgG (1:750 dilution), and incubated for 15 minutes on ice. Cells were washed twice with FACS buffer and analyzed on a CytoFLEX LX Flow Cytometer (Beckman Coulter). Cells were also stained with anti-S mAbs in the absence of ACE2-SA-BV421 to determine the percent spike positive cells. Data were normalized to the percent spike positive cells.
Cell surface staining of SARS-CoV-2 infected Vero cells
Vero E6 cells were infected with authentic SARS-CoV-2 at an MOI 0.1. 24 hours later, cells were harvested, spun down, plated in a 96-well plate and incubated with mAbs in FACS buffer (PBS, 2%FCS). After a 20-minute incubation, cells were washed with FACS buffer and incubated with secondary antibody Alexa Fluor 647-labelled Goat Anti-Human IgG secondary Ab (Jackson Immunoresearch) at a dilution of 1:750 for 10 minutes. Cells were washed and fixed with BD fix/perm solution (BD Biosciences). Finally, cells were washed in FACS buffer and resuspended in FACS buffer for acquisition on a flow cytometer.
MLV-based pseudotyped virus production and neutralization
Pseudotyped viruses bearing the SARS-CoV-2 S-glycoprotein were generated as previously described (6). Briefly, HEK293T-17 cells were co-transfected with a plasmid encoding for SARS-CoV-2 S-glycoprotein harboring a C-terminal 19-residue truncation (55), the packaging and reverse transcriptase/integrase encoding-construct Gag-Pol, and the reporter vector pTG-Luc following X-tremeGENE HP (Merck) manufacturer’s recommendations. Cells were incubated at 37°C with 5% C02 for 72 hours before the supernatants containing the pseudotyped viruses were collected, cleared from cellular debris by centrifugation (1500g x 10 minutes at 4°C) and then stored at -80°C.
To evaluate the mAbs neutralization activity against MLV-based pseudotyped viruses, VeroE6 cells were seeded at 20000 cells/well in 96 well plates using MEM supplemented with 10% FBS, 1% penicillin-streptomycin. After 24 hours, pseudotyped viruses were pre-activated by incubation with 10 pg/ml TPCK-treated trypsin (Bioconcept) for 1 hour at 37°C. Next, serial dilutions of mAbs were mixed with the pseudotyped viruses and incubated for 1 hour at 37°C. VeroE6 cells were washed twice before addition of the mAb/pseudotyped virus mix and were incubated for 2 hours at 37°C. Cells were then supplemented with MEM containing 20% FBS and 2% penicillin-streptomycin and further incubated. After 48 hours culture media was removed and 50 pL/well of Bio-Glo (Promega) was added. Cells were then incubated in the dark for 5 minutes before the luminescence signal was recorded with Synergy HI Hybrid Multi-Mode plate reader (Biotek). Relative luciferase units (RLU) were converted to neutralization percentage and plotted with a nonlinear regression curve fit using Graph Prism.
VSV-based pseudovirus production and neutralization
To generate SARS-CoV-2 pseudotyped vesicular stomatitis virus, Lenti-X 293T cells (Takara) were seeded in 10-cm dishes. The next day, cells were transfected with a plasmid encoding for SARS-CoV-2 S (YP 009724390.1) harboring a C-terminal 19- residue truncation using TransIT-Lenti (Mirus Bio) according to the manufacturer’s instructions. One day post-transfection, cells were infected with VSV(G*AG-luciferase) (Kerafast) at an MOI of 3 infectious units/cell. Viral inoculum was washed off after one hour and cells were incubated for another day at 37°C. The cell supernatant containing SARS-CoV-2 pseudotyped VSV was collected at day 2 post-transfection, centrifuged at 1,000 x g for 5 minutes to remove cellular debris, aliquoted, and frozen at -80°C.
For viral neutralization, Vero E6 cells were seeded into clear bottom white walled 96-well plates at 20,000 cells/well and cultured overnight at 37°C. The next day, 9- point 4-fold serial dilutions of mAbs were prepared in media. SARS-CoV-2 pseudotyped VSV was diluted 1:25 in media and added 1:1 to each antibody dilution. Virus:mAb mixtures were incubated for 1 hour at 37°C. Media was removed from the Vero E6 cells and 50 pL of virus:mAb mixtures were added to the cells. One hour post infection, 100 pL medium was added to all wells. After 17-20 hours incubation at 37°C, medium was removed and 50 pL Bio-Glo reagent (Promega) was added to each well. The plate was shaken on a plate shaker at 300 RPM at room temperature for 15 minutes and luminescence was read on an EnSight plate reader (Perkin-Elmer).
Neutralization of authentic SARS-CoV-2 by entry -inhibition assay
Neutralization was determined using SARS-CoV-2-Nluc, an infectious clone of SARS-CoV-2 (based on strain 2019-nCoV/USA_WAl/2020) encoding nanoluciferase in place of the viral ORF7, which demonstrated comparable growth kinetics to wildtype virus (34). VeroE6 cells were seeded into black-walled, clear-bottom 96-well plates at 2 x 104 cells/well and cultured overnight at 37°C. The next day, 9-point 4-fold serial dilutions of mAbs were prepared in infection media (DMEM + 10% FBS). SARS-CoV- 2-Nluc was diluted in infection media for a final MOI of 0.1 PFU/cell, added to the mAh dilutions and incubated for 30 minutes at 37°C. Media was removed from the VeroE6 cells, mAb-virus complexes were added, and cells were incubated at 37°C for 6 hours. Media was removed from the cells, Nano-Glo luciferase substrate (Promega) was added according to the manufacturer’s recommendations, incubated for 10 minutes at room temperature and luciferase signal was quantified on a VICTOR Nivo plate reader (Perkin Elmer). mAh combination studies
Individual antibodies were 3-fold serially diluted and mixed 1:1 in a checkerboard format before incubation with virus. Combinations of two mAbs were assessed in the respective neutralization assays for the individual viruses as described above. Analysis of drug combination effects was carried out in MacSynergy II (59). For normalization, values obtained from infected, untreated Vero E6 cells were used as positive controls and values from uninfected Vero E6 cells were used as negative controls. Synergy plots at 95% confidence were used for reporting.
Neutralization of authentic SARS-CoV-2 by focus-forming assay
SARS-CoV-2 strain 2019-nCoV/USA_WAl/2020 was obtained from the Centers for Disease Control and Prevention (gift of Natalie Thornburg). Virus was passaged once in Vero CCL81 cells (ATCC) and titrated by focus-forming assay on Vero E6 cells (35). Serial dilutions of indicated mAbs were incubated with 102 focus forming units (FFU) of SARS-CoV-2 for 1 hour at 37°C. MAb-virus complexes were added to Vero E6 cell monolayers in 96-well plates and incubated for 1 hour at 37°C. Subsequently, cells were overlaid with 1% (w/v) methylcellulose in MEM supplemented with 2% FBS. Plates were harvested 30 hours later by removing overlays and fixed with 4% PFA in PBS for 20 minutes at room temperature. Plates were washed and sequentially incubated with 1 pg/mL of CR3022 anti-S antibody and HRP- conjugated goat anti-human IgG in PBS supplemented with 0.1% saponin and 0.1% BSA. SARS-CoV-2-infected cell foci were visualized using TrueBlue peroxidase substrate (KPL) and quantitated on an ImmunoSpot microanalyzer (Cellular Technologies). Data were processed using Prism software (Graphpad Prism 8).
Fusion inhibition assay
Vero E6 cells were seeded in 96 well plates at 15,000 cells per well in 70pl DMEM High glucose + 2.4% Hyclone without antibiotics. After overnight culture the cells were transfected with CoV-2-Spike-D 19_pcDNA3.1 as follows: for 10 wells, 0.57 pg plasmid CoV2-Spike-D19_pcDNA were mixed with 1.68ul X-tremeGENE HP in 30ul OPTIMEM. After 15min incubation time this solution was diluted 1 : 10 in DMEM medium and 30pl was added per well. A 4-fold serial dilution mAbs was prepared and was added to the cells, with a final starting concentration of 20 pg/ml. The following day, 30m1 5x concentrated Draq5 in DMEM was added per well and incubated for 2 hours at 37°C. Nine images of each well were acquired with a Cytation 5 equipment for analysis.
Measurement of Fc-effector functions mAb-dependent activation of human FcyRIIIa was performed with a bioluminescent reporter assay. ExpiCHO cells stably expressing full-length wild-type SARS-CoV-2 S (target cells) were incubated with different amounts of mAbs. After a 15-minute incubation, Jurkat cells stably expressing FcyRIIIa receptor (VI 58 or FI 58 variants) or FcyRIIa receptor (H131 variant) and NFAT-driven luciferase gene (effector cells) were added at an effector to target ratio of 6: 1 for FcyRIIIa and 5:1 for FcyRIIa. Signaling was quantified by the luciferase produced as a result of NFAT pathway activation. Luminescence was measured after 20 hours of incubation at 37°C with 5% C02 with a luminometer using the Bio-Glo-TM Luciferase Assay Reagent according to the manufacturer’s instructions (Promega, Cat. Nr.: G9798, G7018 and G9995)
To test for ADCC, ExpiCHO cells stably expressing SARS-CoV-2 S were used as target cells. NK cells were isolated from the blood of healthy donors with the MACSxpress NK Isolation Kit (Miltenyi Biotec, Cat. Nr.: 130-098-185). Target cells were incubated with mAbs for 10 minutes before addition of NK cells at an effectontarget ratio of 9: 1. After a 4 hour-incubation at 37°C, LDH release as a readout of cellular cytotoxicity was detected with the Cytotoxicity Detection Kit (LDH) (Roche; Cat. Nr.: 11644793001).
To test for ADCP, PMBCs from healthy donors were used as a source of phagocytic cells. PBMCs were stained with Cell Trace Violet (Invitrogen). ExpiCHO cells stably expressing SARS-CoV-2 S were used as target cells and were fluorescently labelled with PKH67 (Sigma Aldrich). Labelled target cells (7500 cells/well) were incubated with serially diluted antibodies. After 10 minutess, stained PBMCs (150,000 cells/well) were added. The next day, cells were washed with FACS buffer (PBS, 1%FBS). Cells were stained with APC-labelled anti-CD14 mAh (BD Pharmingen) for the identification of monocytes. After 20 minutes, cells were washed with FACS buffer and fixed with 4% paraformaldehyde in PBS, 1% FBS. Cells were washed and resuspended in FACS buffer for acquisition on a ZE5 Cell Analyzer (Biorad). Data were analyzed using FlowJo software. The percentage of ADCP was calculated as the % of monocytes (CD14+ cells) that were positive for PKH67.
CryoEM sample preparation data collection and data processing
S2M11 and S2E12 Fabs were generated by digestion of the corresponding mAbs with LysC (Thermo Fisher Scientific) at 1:4000 (w/w) ratio at 37°C during an overnight digestion. SDS-PAGE in reducing and non-reducing condition was used to check quality of digestion. SARS-CoV-2 S avi at 1.2 mg per mL was incubated with a 1.2 molar excess of Fab S2M11 at 4°C for 1 hour. SARS-CoV-2 hexaPro was incubated at 1 mg per ml with a 1.5 molar excess of Fab S2E12 during 1 hour at 4°C after which the complex was further purified by size exclusion chromatography using a Superose 6 increase 10/300 column (GE Healthcare). 3 pL of 1-1.2 mg per mL of complexes were loaded onto a freshly glow discharged R 2/2 UltrAuFoil grids (200 mesh) prior to plunge freezing using a vitrobot MarkIV (ThermoFisher Scientific) with a blot force of 0 and 7-7.5 second blot time at 100% humidity and 21°C.
Data were acquired on a FEI Titan Krios transmission electron microscope operated at 300 kV and equipped with a Gatan K2 Summit direct detector and Gatan Quantum GIF energy filter, operated in zero-loss mode with a slit width of 20 eV. Automated data collection was carried out using Leginon (60) at a nominal magnification of 130,000x with a super-resolution pixel size of 0.525 A. The dose rate was adjusted to 8 counts/pixel/s, and each movie was fractionated in 50 frames of 200 ms. For the S/S2M11 dataset, 4,932 micrographs were collected with a defocus range comprised between -0.8 and -2 pm. For the S/S2E12 data set, 6,697 micrographs were collected also with a defocus range comprised between -0.8 and -2 pm. Movie frame alignment, estimation of the microscope contrast-transfer function parameters, particle picking and extraction were carried out using Warp (60). Particle images were extracted with a box size of 800 pixels2 (S/S2M11) or 1024 pixels2 and respectively binned to 400 or 512 yielding a pixel size of 1.05 A.
For S/S2M11 and S/S2E12 datasets, one round of reference-free 2D classification were performed using cryoSPARC (61). Subsequently, for both datasets one round of 3D classification with 50 iterations (angular sampling 7.5° for 25 iterations and 1.8° with local search for 25 iterations), using ab initio generated models in cryoSPARC (61), were carried out using Relion (62, 63) without imposing symmetry. 3D refinements were carried out using non-uniform refinement (64). Particle images were subjected to Bayesian polishing (65) using Relion before performing another round of non-uniform refinement in cryoSPARC followed by per-particle defocus refinement and again non-uniform refinement.
To improve the density of the S/S2E12 interface, the particles were symmetry-expanded and subjected to focus 3D classification without refining angles and shifts using a soft mask encompassing the RBD and S2E12 variable domains in Relion. Particles belonging to classes with the best resolved local density were selected and subjected to local refinement using cryoSPARC . Local resolution estimation, filtering, and sharpening were carried out using CryoSPARC. Reported resolutions are based on the gold-standard Fourier shell correlation (FSC) of 0.143 criterion and Fourier shell correlation curves were corrected for the effects of soft masking by high-resolution noise substitution (66). CryoEM model building and analysis.
UCSF Chimera (67) and Coot (68) were used to fit atomic models (PDB 6VXX or PDB 6VYB) into the cryoEM maps and the Fab variable domains were manually built. S2E12 was built in the locally refined map and subsequently validated using the Fab crystal structure. Models were refined and relaxed using Rosetta using both sharpened and unsharpened maps (69-71). Validation used Phenix (72), Molprobity (73) and Privateer (74). Figures were generated using UCSF ChimeraX (75).
S2E12 crystallization and structure solution
Crystals of S2E12 Fab were obtained by the sitting-drop vapor diffusion method. A total of 200 nl Fab at approximately 7 mg/ml in 20 mM Tris-HCl pH 7.5,
150 mM NaCl were mixed with 200 nl mother liquor solution containing 0.2 M magnesium chloride hexahydrate, 0.1 M Tris pH 8.5 and 30% (w/v) PEG 4000.
Crystals were flash cooled in liquid nitrogen using the mother liquor solution supplemented with 20% glycerol as a cryoprotectant. Diffraction data were collected on synchrotron beamline XI OS A at the Swiss Light Source, and processed with the XDS software package (76). Initial phases were obtained by molecular replacement using Phaser (77) on the CCP4 suite, using a homology model. Several subsequent rounds of model building and refinement were performed using Coot (68) and Refmac5 (78). Conservation analysis
Conservation analysis was performed as described previously (27), using a GISAID EpiCov dump obtained on September 12th 2020 (n=90,287). We required at least 4 supporting sequences to call a variant.
In vivo mAh testing using a Syrian hamster model
KU LEUVEN R&D has developed and validated a SARS-CoV-2 Syrian Golden hamster infection model (43).
SARS-CoV-2: the SARS-CoV-2 strain used in this study, BetaCov/Belgium/GHB- 03021/2020 (EPI ISL 109407976|2020-02-03), was recovered from a nasopharyngeal swab taken from a RT-qPCR confirmed asymptomatic patient who returned from Wuhan, China in the beginning of February 2020. A close relatedness with the prototypic Wuhan-Hu-1 2019-nCoV (GenBank accession 112 number MN908947.3) strain was confirmed by sequencing and phylogenetic analysis. Infectious virus was isolated by serial passaging on Huh7 and Vero E6 cells (¥3); passage 6 virus was used for the study described here. The titer of the virus stock was determined by end-point dilution on Vero E6 cells by the Reed and Muench method. This work was conducted in the high-containment A3 and BSL3+ facilities of the KU Leuven Rega Institute (3 CAPS) under licenses AMV 30112018 SBB 2192018 0892 and AMV 23102017 SBB 21920170589 according to institutional guidelines.
Cells: Vero E6 cells (African green monkey kidney, ATCC CRL-1586) were cultured in minimal essential medium (Gibco) supplemented with 10% fetal bovine serum (Integra), 1% L- glutamine (Gibco) and 1% bicarbonate (Gibco). End-point titrations were performed with medium containing 2% fetal bovine serum instead of 10%. SARS-CoV-2 infection model in hamsters: Wildtype Syrian hamsters (Mesocricetus auratus) were purchased from Janvier Laboratories and were housed per two in ventilated isolator cages (IsoCage N Biocontainment System, Tecniplast) with ad libitum access to food and water and cage enrichment (wood block). Housing conditions and experimental procedures were approved by the ethical committee of animal experimentation of KU Leuven (license P065-2020). Female hamsters of 6-10 weeks old were anesthetized with ketamine/xylazine/atropine and inoculated intranasally with 50 pL containing 2x106 TCID50. mAb treatment (S2M11 (1 mg/kg), S2E12 (1 mg/kg) or their combinations (1 or 0.5 mg/kg)) was initiated 48 hours before infection by intraperitoneal injection. Hamsters were monitored for appearance, behavior and weight. At day 4 post infection (pi), hamsters were euthanized by intraperitoneal injection of 500 pL Dolethal (200mg/mL sodium pentobarbital, Vetoquinol SA). Lungs were collected, and viral RNA and infectious virus were quantified by RT-qPCR and end-point virus titration, respectively. Blood samples were collected before infection for PK analysis.
SARS-CoV-2 RT-qPCR: Hamster tissues were collected after sacrifice and were homogenized using bead disruption (Precellys) in 350 pL RLT buffer (RNeasy Mini kit, Qiagen) and centrifuged (10,000 rpm, 5 minutes) to pellet the cell debris. RNA was extracted according to the manufacturer’s instructions. To extract RNA from serum, the NucleoSpin kit (Macherey-Nagel) was used. Of 50 pL eluate, 4 pL was used as a template in RT-qPCR reactions. RT-qPCR was performed on a LightCycler96 platform (Roche) using the iTaq Universal Probes One-Step RT-qPCR kit (BioRad) with N2 primers and probes targeting the nucleocapsid (43). Standards of SARS-CoV2 cDNA (IDT) were used to express viral genome copies per mg tissue or per mL serum. End-point virus titrations: Lung tissues were homogenized using bead disruption (Precellys) in 350 pL minimal essential medium and centrifuged (10,000 rpm, 5min, 4°C) to pellet the cell debris. To quantify infectious SARS-CoV-2 particles, endpoint titrations were performed on confluent Vero E6 cells in 96-well plates. Viral titers were calculated by the Reed and Muench method (79) and were expressed as 50% tissue culture infectious dose (TCIDso) per mg tissue.
References
1. P. Zhou et al. , A pneumonia outbreak associated with a new coronavirus of probable bat origin. Nature , (2020).
2. N. Zhu et al. , A Novel Coronavirus from Patients with Pneumonia in China, 2019. N Engl J Med, (2020).
3. H. Zhou et al ., A Novel Bat Coronavirus Closely Related to SARS-CoV-2 Contains Natural Insertions at the S1/S2 Cleavage Site of the Spike Protein. CurrBiol 30, 2196-2203. e2193 (2020).
4. C. Drosten et al. , Identification of a novel coronavirus in patients with severe acute respiratory syndrome. N Engl JMed 348, 1967-1976 (2003).
5. T. G. Ksiazek et al. , A novel coronavirus associated with severe acute respiratory syndrome. N Engl JMed 348, 1953-1966 (2003). 6. A. C. Walls etal ., Structure, Function, and Antigenicity of the SARS-CoV-2 Spike Glycoprotein. Cell 181, 281-292.e286 (2020).
7. D. Wrapp et al. , Cryo-EM structure of the 2019-nCoV spike in the prefusion conformation. Science 367, 1260-1263 (2020).
8. J. Lan et al. , Structure of the SARS-CoV-2 spike receptor-binding domain bound to the ACE2 receptor. Nature , (2020).
9. J. Shang et al. , Structural basis of receptor recognition by SARS-CoV-2. Nature , (2020).
10. R. Yan et al. , Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2. Science 367, 1444-1448 (2020). 11. M. Hoffmann et al. , SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell 181, 271- 280.e278 (2020).
12. Q. Wang et al. , Structural and Functional Basis of SARS-CoV-2 Entry by Using Human ACE2. Cell 181, 894-904.e899 (2020). 13. M. Letko, A. Marzi, V. Munster, Functional assessment of cell entry and receptor usage for SARS-CoV-2 and other lineage B betacoronaviruses. Nature Microbiology , (2020).
14. M. A. Tortorici, D. Veesler, Structural insights into coronavirus entry. A civ Virus Res 105, 93-116 (2019).
15. P. M. Folegatti etal. , Safety and immunogenicity of the ChAdOxl nCoV-19 vaccine against SARS-CoV-2: a preliminary report of a phase 1/2, single-blind, randomised controlled trial. Lancet , (2020).
16. J. Yu et al ., DNA vaccine protection against SARS-CoV-2 in rhesus macaques. Science , (2020).
17. F. C. Zhu et al ., Safety, tolerability, and immunogenicity of a recombinant adenovirus type-5 vectored COVID-19 vaccine: a dose-escalation, open-label, non-randomised, first-in-human trial. Lancet 395, 1845-1854 (2020).
18. L. A. Jackson et al. , An mRNA Vaccine against SARS-CoV-2 - Preliminary Report. N Engl JMed , (2020).
19. U. Sahin et al. , Concurrent human antibody and T<sub>H</sub>l type T-cell responses elicited by a COVID-19 RNA vaccine. medRxiv , 2020.2007.2017.20140533 (2020).
20. M. J. Mulligan et al. , Phase 1/2 Study to Describe the Safety and Immunogenicity of a COVID-19 RNA Vaccine Candidate (BNT162bl) in
Adults 18 to 55 Years of Age: Interim Report. medRxiv , 2020.2006.2030.20142570 (2020).
21. D. Pinto et al. , Cross-neutralization of SARS-CoV-2 by a human monoclonal SARS-CoV antibody. Nature 583, 290-295 (2020). 22. C. O. Barnes etal., Structures of Human Antibodies Bound to SARS-CoV-2
Spike Reveal Common Epitopes and Recurrent Features of Antibodies. Cell , (2020).
23. D. F. Robbiani et al, Convergent antibody responses to SARS-CoV-2 in convalescent individuals. Nature, (2020). 24. C. Wang et al, A human monoclonal antibody blocking SARS-CoV-2 infection. bioRxiv, 2020.2003.2011.987958 (2020).
25. Y. Wu et al , A noncompeting pair of human neutralizing antibodies block COVID-19 virus binding to its receptor ACE2. Science 368, 1274-1278 (2020).
26. P. J. M. Brouwer et al, Potent neutralizing antibodies from COVID-19 patients define multiple targets of vulnerability. Science, (2020).
27. E. Seydoux et al, Characterization of neutralizing antibodies from a SARS- CoV-2 infected individual. bioRxiv, 2020.2005.2012.091298 (2020).
28. W. B. Alsoussi et al, A Potently Neutralizing Antibody Protects Mice against SARS-CoV-2 Infection. J Immunol, (2020). 29. T. F. Rogers et al, Isolation of potent SARS-CoV-2 neutralizing antibodies and protection from disease in a small animal model. Science, (2020).
30. S. J. Zost et al, Potently neutralizing and protective human antibodies against SARS-CoV-2. Nature, (2020).
31. J. Hansen et al , Studies in humanized mice and convalescent humans yield a SARS-CoV-2 antibody cocktail. Science, (2020).
32. R. Shi et al, A human neutralizing antibody targets the receptor-binding site of SARS-CoV-2. Nature 584, 120-124 (2020). 33. B. Ju et al. , Human neutralizing antibodies elicited by SARS-CoV-2 infection. Nature 584, 115-119 (2020).
34. X. Xie et al ., A nanoluciferase SARS-CoV-2 for rapid neutralization testing and screening of anti-infective drugs for COVID-19. bioRxiv , 2020.2006.2022.165712 (2020).
35. J. B. Case et al. , Neutralizing Antibody and Soluble ACE2 Inhibition of a Replication-Competent VSV-SARS-CoV-2 and a Clinical Isolate of SARS- CoV-2. Cell Host Microbe 28, 475-485.e475 (2020).
36. A. C. Walls et al. , Unexpected Receptor Functional Mimicry Elucidates Activation of Coronavirus Fusion. Cell 176, 1026-1039. el015 (2019).
37. T. Zhou et al. , A pH-dependent switch mediates conformational masking of SARS-CoV-2 spike. bioRxiv , (2020).
38. Z. Ke et al. , Structures, conformations and distributions of SARS-CoV-2 spike protein trimers on intact virions. bioRxiv , 2020.2006.2027.174979 (2020). 39. M. McCallum, A. C. Walls, J. E. Bowen, D. Corti, D. Veesler, Structure-guided covalent stabilization of coronavirus spike glycoprotein trimers in the closed conformation. Nat Struct Mol Biol , (2020).
40. S. Bournazos, T. T. Wang, J. V. Ravetch, The Role and Function of Fey Receptors on Myeloid Cells. Microbiol Spectr 4, (2016). 41. Q. Li et al. , The impact of mutations in SARS-CoV-2 spike on viral infectivity and antigenicity. Cell , (2020).
42. T. N. Starr et al ., Deep Mutational Scanning of SARS-CoV-2 Receptor Binding Domain Reveals Constraints on Folding and ACE2 Binding. Cell 182, 1295- 1310.el220 (2020). 43. R. Boudewijns et al. , STAT2 signaling as double-edged sword restricting viral dissemination but driving severe pneumonia in SARS-CoV-2 infected hamsters. bioRxiv , 2020.2004.2023.056838 (2020).
44. L. Liu et al. , Potent neutralizing antibodies against multiple epitopes on SARS- CoV-2 spike. Nature 584, 450-456 (2020). 45. M. Schoof etal. , An ultra-potent synthetic nanobody neutralizes SARS-CoV-2 by locking Spike into an inactive conformation. bioRxiv , 2020.2008.2008.238469 (2020).
46. C. O. Barnes etal., Structural classification of neutralizing antibodies against the SARS-CoV-2 spike receptor-binding domain suggests vaccine and therapeutic strategies. bioRxiv , 2020.2008.2030.273920 (2020).
47. X. Brochet, M. P. Lefranc, V. Giudicelli, IMGT/V-QUEST: the highly customized and integrated system for IG and TR standardized V-J and V-D-J sequence analysis. Nucleic Acids Res 36, W503-508 (2008).
48. J. Snijder et al. , An Antibody Targeting the Fusion Machinery Neutralizes Dual- Tropic Infection and Defines a Site of Vulnerability on Epstein-Barr Virus.
Immunity 48, 799-81 l.e799 (2018).
49. G. Fibriansah, S. M. Lok, The development of therapeutic antibodies against dengue virus. Antiviral Res 128, 7-19 (2016).
50. W. Dejnirattisai et al. , A new class of highly potent, broadly neutralizing antibodies isolated from viremic patients infected with dengue virus. Nat
Immunol 16, 170-177 (2015). E. N. Gallichotte et al , Human dengue vims serotype 2 neutralizing antibodies target two distinct quaternary epitopes. PLoS Pathog14, el006934 (2018). D. G. Widman et al, Transplantation of a quaternary structure neutralizing antibody epitope from dengue vims serotype 3 into serotype 4. Sci Rep 7, 17169 (2017). F. Long et al, Structural basis of a potent human monoclonal antibody against Zika vims targeting a quaternary epitope. Proc Natl Acad Sci U SA 116, 1591 - 1596 (2019). B. R. West et al, Structural Basis of Pan-Ebolavims Neutralization by a Human Antibody against a Conserved, yet Cryptic Epitope. mBio 9, (2018). B. Kaufmann et al, Neutralization of West Nile vims by cross-linking of its surface proteins with Fab fragments of the human monoclonal antibody CR4354. Proc Natl Acad Sci USA 107, 18950-18955 (2010). E. T. Crooks et al, Vaccine-Elicited Tier 2 HIV-1 Neutralizing Antibodies Bind to Quaternary Epitopes Involving Glycan-Deficient Patches Proximal to the
CD4 Binding Site. PLoS Pathog11, el004932 (2015). C. L. Hsieh et al, Stmcture-based design of prefusion-stabilized SARS-CoV-2 spikes. Science, (2020). X. Ou et al, Characterization of spike glycoprotein of SARS-CoV-2 on vims entry and its immune cross-reactivity with SARS-CoV. Nat Commun 11, 1620
(2020). M. N. Prichard, C. Shipman, A three-dimensional model to analyze dmg-dmg interactions. Antiviral Res 14, 181-205 (1990). D. Tegunov, P. Cramer, Real-time cryo-electron microscopy data preprocessing with Warp. Nat Methods 16, 1146-1152 (2019). A. Punjani, J. L. Rubinstein, D. J. Fleet, M. A. Bmbaker, cryoSPARC: algorithms for rapid unsupervised cryo-EM stmcture determination. Nat Methods 14, 290-296 (2017). J. Zivanov et al, New tools for automated high-resolution cryo-EM stmcture determination in RELION-3. Elife 7, (2018). D. Kimanius, B. O. Forsberg, S. H. Scheres, E. Lindahl, Accelerated cryo-EM stmcture determination with parallelisation using GPUs in RELION-2. Elife 5, (2016). A. Punjani, H. Zhang, D. J. Fleet, Non-uniform refinement: Adaptive regularization improves single particle cryo-EM reconstmction. bioRxiv,
2019.2012.2015.877092 (2019). J. Zivanov, T. Nakane, S. H. W. Scheres, A Bayesian approach to beam-induced motion correction in cryo-EM single-particle analysis. IUCrJ 6, 5-17 (2019). S. Chen et al, High-resolution noise substitution to measure overfitting and validate resolution in 3D stmcture determination by single particle electron cryomicroscopy. Ultramicroscopy 135, 24-35 (2013). E. F. Pettersen et al, UCSF Chimera— a visualization system for exploratory research and analysis. J Comput Chem 25, 1605-1612 (2004). P. Emsley, B. Lohkamp, W. G. Scott, K. Cowtan, Features and development of Coot. Acta Crystallographica Section D 66, 486-501 (2010). B. Frenz et al, Automatically Fixing Errors in Glycoprotein Stmctures with Rosetta. Structure 27, 134-139. el33 (2019). 70. R. Y. Wang et al. , Automated structure refinement of macromolecular assemblies from cryo-EM maps using Rosetta. Elife 5, (2016).
71. F. DiMaio et al. , Atomic-accuracy models from 4.5-Ά cryo-electron microscopy data with density -guided iterative local refinement. Nat Methods 12, 361-365 (2015).
72. D. Liebschner et al ., Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix. Acta Crystallogr D Struct Biol 75, 861-877 (2019).
73. V. B. Chen et al. , MolProbity: all-atom structure validation for macromolecular crystallography. Acta Crystallogr D Biol Crystallogr 66, 12-21 (2010).
74. J. Agirre et al. , Privateer: software for the conformational validation of carbohydrate structures. Nat Struct Mol Biol 22, 833-834 (2015).
75. T. D. Goddard et al. , UCSF ChimeraX: Meeting modern challenges in visualization and analysis. Protein Sci 27, 14-25 (2018). 76. W. Kabsch, XDS. Acta Crystallogr D Biol Crystallogr 66, 125-132 (2010).
77. A. J. McCoy et al. , Phaser crystallographic software. J Appl Crystallogr 40, 658-674 (2007).
78. G. N. Murshudov et al. , REFMAC5 for the refinement of macromolecular crystal structures. Acta Crystallogr D Biol Crystallogr 67, 355-367 (2011). 79. L. J. Reed, H. Muench, A SIMPLE METHOD OF ESTIMATING FIFTY PER
CENT ENDPOINTS 12. American Journal of Epidemiology 27, 493-497 (1938).
The various embodiments described above can be combined to provide further embodiments. All of the U.S. patents, U.S. patent application publications, U.S. patent applications, foreign patents, foreign patent applications and non-patent publications referred to in this specification and/or listed in the Application Data Sheet, including U.S. Patent Application No. 63/034,326, filed June 3, 2020, U.S. Patent Application No. 63/055,861, filed July 23, 2020, U.S. Patent Application No. 63/058,368, filed July 29, 2020, U.S. Patent Application No. 63/066,093, filed August 14, 2020, U.S. Patent
Application No. 63/070,803, filed August 26, 2020, U.S. Patent Application No. 63/078,157, filed September 14, 2020, and U.S. Patent Application No. 63/166,874, filed March 26, 2021, are incorporated herein by reference, in their entirety. Aspects of the embodiments can be modified, if necessary to employ concepts of the various patents, applications and publications to provide yet further embodiments.
These and other changes can be made to the embodiments in light of the above- detailed description. In general, in the following claims, the terms used should not be construed to limit the claims to the specific embodiments disclosed in the specification and the claims, but should be construed to include all possible embodiments along with the full scope of equivalents to which such claims are entitled. Accordingly, the claims are not limited by the disclosure.

Claims

CLAIMS What is claimed is:
1. An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 16 and a VL amino acid sequence according to SEQ ID NO: 26 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
2. An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein:
(a) binding comprises contacting one or more of amino acid residues 369- 386, 404-411, and 499-508 of SEQ ID NO: 3; and/or
(b) binding comprises binding an epitope formed by amino acid residues 369-386, 404-411, and 499-508 of SEQ ID NO: 3.
3. The antibody or antigen-binding fragment of claim 2, which does not contact one or more of amino acids 406, 409, 410, 411, 499, 500, 505, and 507 of SEQ ID NO.:3 when binding to the S glycoprotein.
4. The antibody or antigen-binding fragment of any one of claims 1-3, which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and one or zero RBDs of the trimer is in a closed conformation, and optionally is not capable of binding to the S glycoprotein when only one RBD of the trimer is in an open conformation and two RBDs of the trimer are in a closed conformation.
5. An antibody, or an antigen-binding fragment thereof, which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and one or zero RBDs of the trimer is in a closed conformation, and optionally is not capable of binding to the S protein when only one RBD of the trimer is in an open conformation and two RBDs of the trimer are in a closed conformation.
6. An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 31 and a VL amino acid sequence according to SEQ ID NO: 35 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
7. An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SAR.S CoV-2 S glycoprotein of a S glycoprotein trimer, wherein:
(a) binding comprises contacting one or more of amino acid residues 444- 449 and 472-498 of SEQ ID NO: 3; and/or
(b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 444-449 and 472-498 of SEQ ID NO: 3; and/or
(c) binding comprises binding within a crevice formed by a receptor binding motif (RBM) b-hairpin in a receptor binding domain (RBD) of the S glycoprotein.
8. The antibody or antigen-binding fragment of claim 7, which does not contact one or more of amino acids 448, 473-478, 487, 491, 492, 495, 496, and 497 of SEQ ID NO.:3 when binding to the SARS-CoV-2 S glycoprotein.
9. The antibody or antigen-binding fragment of any one of claims 6-8, which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein one or zero receptor binding domains (RBDs) of the trimer are in an open conformation and two or three RBDs of the trimer are in a closed conformation.
10. An antibody, or an antigen-binding fragment thereof, which is capable of binding to a SARS-CoV-2 S glycoprotein protein of a S glycoprotein trimer wherein one or zero receptor binding domains (RBDs) of the trimer are in an open conformation and two or three RBDs of the trimer are in a closed conformation.
11. An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 47 and a VL amino acid sequence according to SEQ ID NO: 51 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
12. An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein, wherein:
(a) binding comprises contacting one or more of amino acid residues 403, 444-456, 475, and 485-505 of SEQ ID NO: 3; and/or
(b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 403, 444-456, 475, and 485-505 of SEQ ID NO: 3.
13. The antibody or antigen-binding fragment of claim 12, which does not contact one or more of amino acids 448, 450, 451, 452, 454, 486, 488, 490, 491, 492, 497, 503, and 504 of SEQ ID NO.:3 when binding to the S glycoprotein.
14. The antibody or antigen-binding fragment of any one of claims 11-13, which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein one, two, or three receptor binding domains (RBDs) of the trimer are in an open conformation.
15. An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 64 and a VL amino acid sequence according to SEQ ID NO: 68 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
16. An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein:
(a) binding comprises contacting one or more of amino acid residues 368- 388 and 407-414 of SEQ ID NO: 3; and/or
(b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 368-388 and 407-414 of SEQ ID NO: 3.
17. The antibody or antigen-binding fragment of claim 15 or 16, which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and zero or one RBDs of the trimer is in a closed conformation.
18. An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 150 and a VL amino acid sequence according to SEQ ID NO: 154 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
19. An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein:
(a) binding comprises contacting one or more of amino acid residues 369- 392, 411-414, 427-430, and 515-517 of SEQ ID NO: 3; and/or
(b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 369-392, 411-414, 427-430, and 515-517 of SEQ ID NO: 3.
20. The antibody or antigen-binding fragment of claim 18 or 19, which is capable of binding to a SARS-CoV-2 S protein of a S protein trimer wherein two or three receptor binding domains (RBDs) of the trimer are in an open conformation and zero or one RBDs of the trimer is in a closed conformation.
21. The antibody or antigen-binding fragment of any one of claims 15-20, wherein binding of the antibody or antigen-binding fragment to the S glycoprotein promotes or leads to release of the SI subunit from the S glycoprotein.
22. An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 123 and a VL amino acid sequence according to SEQ ID NO: 138 for binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer.
23. An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein of a S glycoprotein trimer, wherein:
(a) binding comprises contacting one or more of amino acid residues 417, 453, 455, 456, 473, 475-480, 484-489, and 493 of SEQ ID NO: 3; and/or
(b) the antibody or antigen-binding fragment recognizes an epitope formed by amino acid residues 417, 453, 455, 456, 473, 475-480, 484-489, and 493of SEQ ID NO.: 3.
24. The antibody or antigen-binding fragment of claim 22 or 23, which is capable of binding to a SARS-CoV-2 S glycoprotein of a S glycoprotein trimer wherein one, two, or three receptor binding domains (RBDs) of the trimer are in an open conformation and zero, one, or two RBDs of the trimer are in a closed conformation.
25. An antibody, or an antigen-binding fragment thereof, that competes with an antibody or antigen-binding fragment comprising a VH amino acid sequence according to SEQ ID NO: 142 and a VL amino acid sequence according to SEQ ID NO: 146 for binding to a SARS-CoV-2 S glycoprotein trimer.
26. An antibody, or an antigen-binding fragment thereof, that is capable of binding to a SARS CoV-2 S glycoprotein trimer, wherein: (a) binding comprises contacting one or more of amino acid residues on each of two receptor binding domains (RBDs), wherein binding comprises contacting, on a first RBD, one or more of amino acid residues 339, 342, 343, 367, 368, 371, 372, 373, 374, 436, 440, and 441, and, on a second RBD, one or more of amino acid residues 446, 447, 449, 452, 455, 456, 484, 485, 486, 487, 489, 490, 492, 493, 494, 496, and 498, wherein the amino acid numbering is according to SEQ ID NO.:3; and/or
(b) the antibody or antigen-binding fragment recognizes an epitope formed by the following:
(b)(i) on a first RBD, amino acid residues 339, 342, 343, 367, 368, 371, 372, 373, 374, 436, 440, and 441, and,
(b)(ii) on a second RBD, amino acid residues 446, 447, 449, 452, 455, 456, 484, 485, 486, 487, 489, 490, 492, 493, 494, 496, and 498, wherein the amino acid numbering is according to SEQ ID NO.:3.
27. The antibody or antigen-binding fragment of claim 25 or 26, which is capable of binding to the S glycoprotein trimer wherein three receptor binding domains (RBDs) of the trimer are in a closed conformation.
28. The antibody or antigen-binding fragment of any one of claims 25-27, wherein binding of the antibody or antigen-binding fragment to the S glycoprotein trimer inhibits or prevents an RBD of the trimer from assuming an open conformation.
29. The antibody or antigen-binding fragment of any one of claims 1-28, wherein binding of the antibody or antigen-binding fragment to the S glycoprotein or S glycoprotein trimer, respectively, blocks an interaction between the S glycoprotein and a human ACE2.
30 The antibody or antigen-binding fragment of any one of claims 1-28, wherein binding of the antibody or antigen-binding fragment to the S glycoprotein or S glycoprotein trimer, respectively, does not block an interaction between the S glycoprotein and a human ACE2.
31. The antibody or antigen-binding fragment of any one of claims 1-30, which is capable of neutralizing an infection by a SARS-CoV-2.
32. An isolated polynucleotide encoding the antibody or antigen-binding fragment of any one of claims 1-31.
33. A vector comprising the polynucleotide of claim 32.
34. A recombinant host cell that: (i) expresses the antibody or antigen binding fragment of any one of claims 1-31; (ii) comprises the polynucleotide of claim 32; and/or (iii) comprises the vector of claim 33.
35. A composition comprising:
(i) the antibody or antigen-binding fragment of any one of claims 1-31;
(ii) the polynucleotide of claim 32;
(iii) the vector of claim 33; and/or
(iv) the host cell of claim 34, and a pharmaceutically acceptable carrier, excipient, or diluent.
36. A combination comprising (i) any two or more of the antibodies or antigen-binding fragments of any of claims 1-31 or (ii) a first antibody or antigen binding fragment of any of claims 1-31 and a second antibody or antigen-binding fragment that is antibody S309 or an antibody that competes with antibody S309 for binding to a SARS CoV-2 S glycoprotein.
37. A composition comprising (i) any two or more of the antibodies or antigen-binding fragments of any of claims 1-31 or (ii) a first antibody or antigen- binding fragment of any of claims 1-31 and a second antibody or antigen-binding fragment that is antibody S309 or that competes with antibody S309 for binding to a SARS-CoV-2 S glycoprotein and a pharmaceutically acceptable carrier, excipient, or diluent.
38. A method for treating a SARS-CoV-2 infection in a subject, the method administering to the subject an effective amount of:
(i) the antibody or antigen-binding fragment of any one of claims 1-31;
(ii) the polynucleotide of claim 32;
(iii) the vector of claim 33;
(iv) the host cell of claim 34;
(v) the composition of claim 35;
(vi) the combination of claim 36;
(vii) the composition of claim 37;
(viii) any two or more of the antibodies or antigen-binding fragments of any one of claims 1-31; or
(ix) any combination of (i)-(viii).
39. The antibody or antigen-binding fragment of any one of claims 1-31, the polynucleotide of claim 32, the vector of claim 33, the host cell of claim 34, the composition of claim 35, the combination of claim 36, the composition of claim 37, and/or the any two or more of the antibodies or antigen-binding fragments of any one of claims 1-31, for use in a method of treating a SARS-CoV-2 infection in a subject.
40. An immunogenic composition comprising:
(a) a SARS-CoV-2 nucleocapsid (N) protein (SEQ ID NO.: 170), or an immunogenic fragment thereof;
(b) a SARS-CoV-2 S polypeptide or multimer thereof comprising (i) one, two, or three Receptor Binding Domains (RBDs) in an open conformation and (ii) a Site la polypeptide, the Site la polypeptide capable of being bound by antibody S2H14; (c) a SARS-CoV-2 Spike (S) polypeptide comprising (i) a RBD in an open conformation or in a closed conformation and (ii) a Site lb polypeptide, the Site lb polypeptide capable of being bound by antibody S2H13;
(d) a SARS-CoV-2 S polypeptide or multimer thereof comprising (i) two or three Receptor Binding Domains (RBDs) in an open conformation and (ii) a Site Ila polypeptide, the Site Ila polypeptide capable of being bound by antibody S2X35;
(e) a SARS-CoV-2 S polypeptide or multimer thereof comprising (i) two adjacent RBDs in an open conformation and (ii) a Site lib polypeptide, the Site lib polypeptide capable of being bound by antibody S2A4;
(f) a SARS-CoV-2 S polypeptide or multimer thereof comprising (i) two adjacent RBDs in an open conformation and (ii) a Site lie polypeptide, the Site lie polypeptide capable of being bound by antibody S304;
(g) a SARS-CoV-2 S polypeptide capable of being bound by antibody CR3022;
(h) a SARS-CoV-2 Spike (S) polypeptide or multimer thereof comprising (i) a RBD in an open conformation or in a closed conformation and (ii) a Site IV polypeptide, the Site IV polypeptide capable of being bound by antibody S309;
(i) a polynucleotide encoding the SARS-CoV-2 N or S protein polypeptide of any one or more of (a)-(h); or
(j) any combination of (a)-(i) above.
41. The immunogenic composition of claim 40, further comprising a pharmaceutically acceptable carrier, excipient, or diluent, and/or comprising an adjuvant.
42. The immunogenic composition of claim 40 or claim 41, wherein the SARS-COV-2 S polypeptide comprises a prefusion-stabilized S ectodomain and/or does not comprise a R1 domain, a CH domain, a CD domain, a HR1 domain, a HR2 domain, a TM domain, and/or a CT domain.
43. A method comprising administering the immunogenic composition or composition of any one of claims 40-42 to a subject having, suspected of having, or at risk for having a SARS-CoV-2 infection.
44. Use of:
(a) (a)(i) antibody S2H14, or an antigen-binding fragment thereof, or (a)(ii) an antibody or antigen-binding fragment thereof that competes with (a)(i) for binding to a SARS-CoV-2 S glycoprotein;
(b) (b)(i) antibody S2H13, or an antigen-binding fragment thereof, or (b)(ii) an antibody or antigen-binding fragment thereof that competes with (b)(i) for binding to a SARS-CoV-2 S glycoprotein;
(c) (c)(i) antibody S2X35, or an antigen-binding fragment thereof, or (c)(ii) an antibody or antigen-binding fragment thereof that competes with (i) for binding to a SARS-CoV-2 S glycoprotein;
(d) (d)(i) antibody S2A4 or an antigen-binding fragment thereof, or (d)(ii) an antibody or antigen-binding fragment thereof that competes with (d)(i) for binding to a SARS-CoV-2 S glycoprotein;
(e) (e)(i) antibody S304 or an antigen-binding fragment thereof, or (e)(ii) an antibody or antigen-binding fragment thereof that competes with (e)(i) for binding to a SARS-CoV-2 S glycoprotein;
(f) (f)(i) antibody S309 or an antigen-binding fragment thereof, or (f)(ii) an antibody or antigen-binding fragment thereof that competes with (f)(i) for binding to a SARS-CoV-2 S glycoprotein; and/or
(g) (g)(i) antibody CR3022, or an antigen-binding fragment thereof, or (g)(ii) an antibody or antigen-binding fragment thereof that competes with (g)(i) for binding to a SARS-CoV-2 S glycoprotein, in the diagnosis of a SARS-CoV-2 infection, wherein the diagnosis comprises contacting the antibody or antigen-binding fragment thereof with a sample from a subject, and detecting the presence or absence of a complex comprising the antibody or antigen-binding fragment with an antigen.
45. Use of:
(a) (a)(i) antibody S2H14, or an antigen-binding fragment thereof, or (a)(ii) an antibody or antigen-binding fragment thereof that competes with (a)(i) for binding to a SARS-CoV-2 S glycoprotein;
(b) (b)(i) antibody S2H13, or an antigen-binding fragment thereof, or (b)(ii) an antibody or antigen-binding fragment thereof that competes with (b)(i) for binding to a SARS-CoV-2 S glycoprotein;
(c) (c)(i) antibody S2X35, or an antigen-binding fragment thereof, or (c)(ii) an antibody or antigen-binding fragment thereof that competes with (c)(i) for binding to a SARS-CoV-2 S glycoprotein;
(d) (d)(i) antibody S2A4 or an antigen-binding fragment thereof, or (d)(ii) an antibody or antigen-binding fragment thereof that competes with (d)(i) for binding to a SARS-CoV-2 S glycoprotein;
(e) (e)(i) antibody S304 or an antigen-binding fragment thereof, or (e)(ii) an antibody or antigen-binding fragment thereof that competes with (e)(i) for binding to a SARS-CoV-2 S glycoprotein;
(f) (f)(i) antibody S309 or an antigen-binding fragment thereof, or (f)(ii) an antibody or antigen-binding fragment thereof that competes with (f)(i) for binding to a SARS-CoV-2 Spike S glycoprotein; and/or
(g) (g)(i) antibody CR3022, or an antigen-binding fragment thereof, or (g)(ii) an antibody or antigen-binding fragment thereof that competes with (g)(i) for binding to a SARS-CoV-2 S glycoprotein, in determining whether a SARS-CoV-2 vaccine composition comprises an epitope in a correct conformation for binding by the antibody or antigen-binding fragment thereof.
46. A method comprising detecting, in sera from one or more subject having (hospitalized, symptomatic, or asymptomatic) or recovered from a SARS-CoV-2 infection:
(a) the titer of antibody (e.g., IgG, IgA, and/or IgM) that binds to SARS- CoV-2 S glycoprotein;
(b) the titer of antibody that binds to SARS-CoV-2 RBD and optionally neutralizes the SARS-CoV-2 infection;
(c) the titer of antibody that binds to SARS-CoV-2 Domain A and optionally neutralizes the SARS CoV-2 infection;
(d) the titer of antibody that binds to SARS-CoV-2 S2 and optionally neutralizes the SARS CoV-2 infection; and/or
(e) the titer of antibody that binds to SARS-CoV-2 N protein and optionally neutralizes the SARS-CoV-2 infection.
47. The method of claim 45, further comprising preparing an immunogenic composition comprising whichever of SARS-CoV-2 S glycoprotein, RBD, Domain A, or N protein that resulted in the highest titer of antibody.
48. The method of claim 46 or 47, wherein the sera is from a subject who experienced a symptom of a SARS-CoV-2 infection and the method further comprises preparing an immunogenic composition comprising whichever of the SARS-CoV-2 S protein, RBD, Domain A, or N protein against which the highest titer of antibody is detected at 25, preferably 50, more preferably 75, still more preferably 100, even more preferably 125, still more preferably 150 days after the onset of the symptom.
49. A composition or combination comprising any two, any three, or all four of (a)-(d):
(a) (a)(i) an antibody or antigen-binding fragment thereof (e.g., Fv, scFv,
Fab, scFab, or the like) that is capable of binding to a SARS CoV-2 S glycoprotein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 143, a CDRH2 comprising the sequence set forth in SEQ ID NO: 144, a CDRH3 comprising the sequence set forth in SEQ ID NO: 145, a CDRL1 comprising the sequence set forth in SEQ ID NO: 147, a CDRL2 comprising the sequence set forth in SEQ ID NO: 148, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 149, or (a)(ii) an antibody or antigen-binding fragment thereof that competes with the antibody or antigen-binding fragment of (a)(i) for binding to the SARS CoV-2 S glycoprotein;
(b) (b)(i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S glycoprotein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 109, a CDRH2 comprising the sequence set forth in SEQ ID NO: 110, a CDRH3 comprising the sequence set forth in SEQ ID NO: 111, a CDRL1 comprising the sequence set forth in SEQ ID NO: 133, a CDRL2 comprising the sequence set forth in SEQ ID NO: 134, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 135, or (b)(ii) an antibody or antigen-binding fragment thereof that competes with the antibody or antigen-binding fragment of (b)(i) for binding to the SARS CoV-2 S glycoprotein;
(c) (c)(i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S glycoprotein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRL1 comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 108, or (c)(ii) an antibody or antigen-binding fragment thereof that competes with the antibody or antigen-binding fragment of (c)(i) for binding to the SARS CoV-2 S glycoprotein;
(d) (d)(i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S glycoprotein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRL1 comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO:99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100, or (d)(ii) an antibody or antigen-binding fragment thereof that competes with the antibody or antigen-binding fragment of (d)(i) for binding to the SARS CoV-2 S glycoprotein.
50. The composition of claim 49, further comprising a pharmaceutically acceptable carrier, excipient, or diluent.
51. The composition of claim 49 or 50, wherein:
(1) the antibody or antigen-binding fragment of (a)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity ( e.g ., as determined using BLAST) (e.g., 100% identity) to the amino acid sequence set forth in SEQ ID NO: 142 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 146;
(2) the antibody or antigen-binding fragment thereof of (b)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 123 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO: 138;
(3) the antibody or antigen-binding fragment thereof of (c)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 101 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 105; and/or
(4) the antibody or antigen-binding fragment thereof of (d)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO:93 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO:97.
52. A composition comprising:
(a) (a)(i) antibody S2M11, or an antigen-binding fragment thereof, or (a)(ii) an antibody or antigen-binding fragment thereof that competes with (a)(i) for binding to a SARS-CoV-2 S glycoprotein;
(b) (b)(i) antibody S2E12, or an antigen-binding fragment thereof, or (b)(ii) an antibody or antigen-binding fragment thereof that competes with (b)(i) for binding to a SARS-CoV-2 S glycoprotein;
(c) (c)(i) antibody S309, or an antigen-binding fragment thereof, or (c)(ii) an antibody or antigen-binding fragment thereof that competes with (c)(i) for binding to a SARS-CoV-2 S glycoprotein; or
(d) any combination of (a)-(c) above.
53. The composition of claim 52, further comprising a pharmaceutically acceptable carrier, excipient, or diluent.
54. The antibody or antigen-binding fragment of any one of claims 1-31, the combination of claim 36, or the composition of any one of claims 37, 38, and 49-53, wherein any one or more of the antibodies or antigen binding fragments comprises a Fc polypeptide comprising:
(i) a mutation that enhances binding to a human FcRn and/or extends an in vivo half-life of antibody or antigen-binding fragment, optionally a M428L mutation, a N434S mutation, YTE mutation, or any combination thereof; and/or
(ii) a mutation that that enhances binding to a human FcyR, optionally a G236A mutation, a A330L mutation, a I332E, a S239D mutation, or any combination thereof.
55. The composition of any one of claims 49-54 for use in treating or preventing SARS-CoV-2 infection.
56. A method of treating or preventing SARS-CoV-2 infection in a subject, comprising administering to the subject an effective amount of the composition of any one of claims 49-54.
57. A method of treating or preventing a SARS-CoV-2 infection in a subject, comprising administering to the subject an effective amount of any one or more of:
(a) (i) an antibody or antigen-binding fragment thereof ( e.g ., Fv, scFv, Fab, scFab, or the like) that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 143, a CDRH2 comprising the sequence set forth in SEQ ID NO: 144, a CDRH3 comprising the sequence set forth in SEQ ID NO: 145, a CDRL1 comprising the sequence set forth in SEQ ID NO: 147, a CDRL2 comprising the sequence set forth in SEQ ID NO: 148, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 149, or (ii) an antibody or antigen binding fragment thereof that competes with the antibody or antigen-binding fragment of (i) for binding to the SARS CoV-2 S protein;
(b) (i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 109, a CDRH2 comprising the sequence set forth in SEQ ID NO: 110, a CDRH3 comprising the sequence set forth in SEQ ID NO: 111, a CDRLl comprising the sequence set forth in SEQ ID NO: 133, a CDRL2 comprising the sequence set forth in SEQ ID NO: 134, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 135, or (ii) an antibody or antigen-binding fragment thereof that competes the antibody or antigen-binding fragment of (i) for binding to the SARS CoV- 2 S protein;
(c) (i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRL1 comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 108, or (ii) an antibody or antigen-binding fragment thereof that competes the antibody or antigen-binding fragment of (i) for binding to the SARS CoV- 2 S protein;
(d) (i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRLl comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO:99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100, or (ii) an antibody or antigen-binding fragment thereof that competes the antibody or antigen-binding fragment of (i) for binding to the SARS CoV- 2 S protein.
58. The method of claim 57, wherein:
(1) the antibody or antigen-binding fragment of (a)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity ( e.g ., as determined using BLAST) (e.g., 100% identity) to the amino acid sequence set forth in SEQ ID NO: 142 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 146;
(2) the an antibody or antigen-binding fragment thereof of (b)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 123 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO: 138; (3) the an antibody or antigen-binding fragment thereof of (c)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 101 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 105; and/or
(4) the antibody or antigen-binding fragment thereof of (d)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO:93 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO:97.
59. A method of treating or preventing a SARS-CoV-2 infection in a subject, comprising administering to the subject an effective amount of one of (a)-(d):
(a) (i) an antibody or antigen-binding fragment thereof ( e.g ., Fv, scFv, Fab, scFab, or the like) that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 143, a CDRH2 comprising the sequence set forth in SEQ ID NO: 144, a CDRH3 comprising the sequence set forth in SEQ ID NO: 145, a CDRL1 comprising the sequence set forth in SEQ ID NO: 147, a CDRL2 comprising the sequence set forth in SEQ ID NO: 148, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 149, or (ii) an antibody or antigen binding fragment thereof that competes with the antibody or antigen-binding fragment of (i) for binding to the SARS CoV-2 S protein;
(b) (i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 109, a CDRH2 comprising the sequence set forth in SEQ ID NO: 110, a CDRH3 comprising the sequence set forth in SEQ ID NO: 111, a CDRL1 comprising the sequence set forth in SEQ ID NO: 133, a CDRL2 comprising the sequence set forth in SEQ ID NO: 134, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 135, or (ii) an antibody or antigen-binding fragment thereof that competes the antibody or antigen-binding fragment of (i) for binding to the SARS CoV- 2 S protein;
(c) (i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRLl comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID
NO: 108, or (ii) an antibody or antigen-binding fragment thereof that competes the antibody or antigen-binding fragment of (i) for binding to the SARS CoV-2 S protein;
(d) (i) an antibody or antigen-binding fragment thereof that is capable of binding to a SARS CoV-2 S protein and comprises a CDRH1 comprising the sequence set forth in SEQ ID NO:94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRLl comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO:99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100, or (ii) an antibody or antigen-binding fragment thereof that competes the antibody or antigen-binding fragment of (i) for binding to the SARS CoV- 2 S protein; wherein the subject has received, or is receiving, any one or more of the other of (a)-(d) ( e.g ., administering an effective amount of (a) to a subject who has received or is receiving (b), (c), and/or (d).
60. The method of claim 59, wherein:
(1) the antibody or antigen-binding fragment of (a)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity (e.g., as determined using BLAST) (e.g, 100% identity) to the amino acid sequence set forth in SEQ ID NO: 142 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 146;
(2) the antibody or antigen-binding fragment thereof of (b)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 123 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the sequence set forth in SEQ ID NO: 138;
(3) the antibody or antigen-binding fragment thereof of (c)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 101 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO: 105; and/or
(4) the antibody or antigen-binding fragment thereof of (d)(i) comprises a VH comprising or consisting of an amino acid sequence having at least 80%, 85%,
90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO:93 and a VL comprising or consisting of an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96,%, 97%, 98%, or 99% identity to the amino acid sequence set forth in SEQ ID NO:97.
61. The method of any one of claims 57-60, wherein an antibody or antigen binding fragment administered to the subject comprises a Fc polypeptide comprising:
(i) a mutation that enhances binding to a human FcRn and/or extends an in vivo half-life of antibody or antigen-binding fragment, optionally a M428L mutation, a N434S mutation, YTE mutation, or any combination thereof; and/or
(ii) a mutation that that enhances binding to a human FcyR, optionally a G236A mutation, a A330L mutation, a I332E, a S239D mutation, or any combination thereof.
62. A method of diagnosing a SARS-CoV-2 infection, comprising contacting the composition of any one of claims 49-54 with a sample from a subject and detecting the presence or absence of a complex comprising the antibody or antigen binding fragment and an antigen.
63. The composition of any one of claims 49-54 for use in determining whether a SARS-CoV-2 vaccine composition comprises an epitope in a correct conformation for binding by the antibody(ies) or antigen-binding fragment(s) thereof.
64. An immunogenic composition comprising:
(a) a SARS-CoV-2 S polypeptide or multimer thereof that comprises two or three receptor binding domains (RBDs) in a closed-conformation, wherein two adjacent RBDs are in a closed conformation;
(b) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 143, a CDRH2 comprising the sequence set forth in SEQ ID NO: 144, a CDRH3 comprising the sequence set forth in SEQ ID NO: 145, a CDRL1 comprising the sequence set forth in SEQ ID NO: 147, a CDRL2 comprising the sequence set forth in SEQ ID NO: 148, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 149;
(c) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 109, a CDRH2 comprising the sequence set forth in SEQ ID NO: 110, a CDRH3 comprising the sequence set forth in SEQ ID NO: 111, a CDRLl comprising the sequence set forth in SEQ ID NO: 133, a CDRL2 comprising the sequence set forth in SEQ ID NO: 134, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 135; or any combination of (a)-(c).
65. The immunogenic composition of claim 64, further comprising: (d) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRL1 comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 108;
(e) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO:94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRL1 comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO: 99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100; or a combination thereof.
66. An immunogenic composition comprising:
(a) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a VH comprising the sequence set forth in SEQ ID NO: 142 and a VL comprising the sequence set forth in SEQ ID NO: 146;
(b) a SARS-CoV-2 S polypeptide or multimer thereof capable of being bound by an antibody or antigen-binding fragment thereof comprising a VH comprising the sequence set forth in SEQ ID NO: 123 and a VL comprising the sequence set forth in SEQ ID NO: 138; or a combination thereof.
67. The immunogenic composition of claim 66, further comprising:
(c) a SARS-CoV-2 S protein polypeptide capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 102, a CDRH2 comprising the sequence set forth in SEQ ID NO: 103, a CDRH3 comprising the sequence set forth in SEQ ID NO: 104, a CDRL1 comprising the sequence set forth in SEQ ID NO: 106, a CDRL2 comprising the sequence set forth in SEQ ID NO: 107, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 108;
(d) a SARS-CoV-2 S protein polypeptide capable of being bound by an antibody or antigen-binding fragment thereof comprising a CDRH1 comprising the sequence set forth in SEQ ID NO: 94, a CDRH2 comprising the sequence set forth in SEQ ID NO:95, a CDRH3 comprising the sequence set forth in SEQ ID NO:96, a CDRL1 comprising the sequence set forth in SEQ ID NO:98, a CDRL2 comprising the sequence set forth in SEQ ID NO:99, and a CDRL3 comprising the sequence set forth in SEQ ID NO: 100; or a combination thereof.
68. An immunogenic composition comprising:
(a) a SARS-CoV-2 S polypeptide capable of being bound by antibody S2M11, or an antigen-binding fragment thereof;
(b) a SARS-CoV-2 S polypeptide capable of being bound by antibody S2E12, or an antigen-binding fragment thereof;
(c) a SARS-CoV-2 S polypeptide capable of being bound by antibody S309, or an antigen-binding fragment thereof; or
(d) any combination of (a)-(c) above.
69. The immunogenic composition of any one of claims 64-68, further comprising a pharmaceutically acceptable carrier, excipient, or diluent, and/or comprising an adjuvant.
PCT/US2021/035782 2020-06-03 2021-06-03 Structure-guided immunotherapy against sars-cov-2 Ceased WO2021247925A1 (en)

Applications Claiming Priority (14)

Application Number Priority Date Filing Date Title
US202063034326P 2020-06-03 2020-06-03
US63/034,326 2020-06-03
US202063055861P 2020-07-23 2020-07-23
US63/055,861 2020-07-23
US202063058368P 2020-07-29 2020-07-29
US63/058,368 2020-07-29
US202063066093P 2020-08-14 2020-08-14
US63/066,093 2020-08-14
US202063070803P 2020-08-26 2020-08-26
US63/070,803 2020-08-26
US202063078157P 2020-09-14 2020-09-14
US63/078,157 2020-09-14
US202163166874P 2021-03-26 2021-03-26
US63/166,874 2021-03-26

Publications (1)

Publication Number Publication Date
WO2021247925A1 true WO2021247925A1 (en) 2021-12-09

Family

ID=76943089

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/035782 Ceased WO2021247925A1 (en) 2020-06-03 2021-06-03 Structure-guided immunotherapy against sars-cov-2

Country Status (1)

Country Link
WO (1) WO2021247925A1 (en)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11479599B2 (en) 2020-02-26 2022-10-25 Vir Biotechnology, Inc. Antibodies against SARS-CoV-2 and methods of using the same
WO2023201256A1 (en) * 2022-04-12 2023-10-19 Vir Biotechnology, Inc. High dose antibody therapies for sars-cov-2 infection
WO2023154402A3 (en) * 2022-02-09 2023-11-09 University Of Maryland, College Park Compositions and methods for fcrn-targeted intranasal coronavirus vaccination
US11981725B2 (en) 2020-07-06 2024-05-14 Flagship Pioneering Innovations Vi, Llc Antigen binding molecules targeting SARS-CoV-2
US11987616B2 (en) 2020-08-26 2024-05-21 Flagship Pioneering Innovations Vi, Llc Antigen binding molecules targeting SARS-CoV-2
WO2024118998A3 (en) * 2022-12-01 2024-07-11 Vir Biotechnology, Inc. Engineered anti-sars-cov-2 antibodies and methods of using the same
US12473560B2 (en) 2020-07-06 2025-11-18 Flagship Pioneering Innovations Vi, Llc Antigen binding molecules targeting SARS-CoV-2

Citations (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4751180A (en) 1985-03-28 1988-06-14 Chiron Corporation Expression using fused genes providing for protein product
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4935233A (en) 1985-12-02 1990-06-19 G. D. Searle And Company Covalently linked polypeptide cell modulators
US5283173A (en) 1990-01-24 1994-02-01 The Research Foundation Of State University Of New York System to detect protein-protein interactions
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
US6596541B2 (en) 2000-10-31 2003-07-22 Regeneron Pharmaceuticals, Inc. Methods of modifying eukaryotic cells
WO2004076677A2 (en) 2003-02-26 2004-09-10 Institute For Research In Biomedicine Monoclonal antibody production by ebv transformation of b cells
US7049426B2 (en) 1999-06-10 2006-05-23 Abgenix, Inc. Transgenic animals for producing specific isotypes of human antibodies via non-cognate switch regions
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
US7498415B2 (en) 2003-09-24 2009-03-03 Kyowa Hakko Kogyo Co., Ltd. Recombinant antibody against human insulin-like growth factor
US8119772B2 (en) 2006-09-29 2012-02-21 California Institute Of Technology MART-1 T cell receptors
US8258268B2 (en) 2005-08-19 2012-09-04 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
WO2015103072A1 (en) 2013-12-30 2015-07-09 Epimab Biotherapeutics Fabs-in-tandem immunoglobulin and uses thereof
WO2016181357A1 (en) 2015-05-13 2016-11-17 Zumutor Biologics, Inc. Afucosylated protein, cell expressing said protein and associated methods
WO2019025391A1 (en) 2017-07-31 2019-02-07 Institute For Research In Biomedicine Antibodies with functional domains in the elbow region between variable adn constant domain
WO2019057122A1 (en) 2017-09-22 2019-03-28 Wuxi Biologics (Shanghai) Co., Ltd. Novel bispecific polypeptide complexes

Patent Citations (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4751180A (en) 1985-03-28 1988-06-14 Chiron Corporation Expression using fused genes providing for protein product
US4935233A (en) 1985-12-02 1990-06-19 G. D. Searle And Company Covalently linked polypeptide cell modulators
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US6417429B1 (en) 1989-10-27 2002-07-09 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US5283173A (en) 1990-01-24 1994-02-01 The Research Foundation Of State University Of New York System to detect protein-protein interactions
US5468614A (en) 1990-01-24 1995-11-21 The Research Foundation Of State University Of New York System to detect protein-protein interactions
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
US7049426B2 (en) 1999-06-10 2006-05-23 Abgenix, Inc. Transgenic animals for producing specific isotypes of human antibodies via non-cognate switch regions
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
US6596541B2 (en) 2000-10-31 2003-07-22 Regeneron Pharmaceuticals, Inc. Methods of modifying eukaryotic cells
WO2004076677A2 (en) 2003-02-26 2004-09-10 Institute For Research In Biomedicine Monoclonal antibody production by ebv transformation of b cells
US7498415B2 (en) 2003-09-24 2009-03-03 Kyowa Hakko Kogyo Co., Ltd. Recombinant antibody against human insulin-like growth factor
US8258268B2 (en) 2005-08-19 2012-09-04 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
US8119772B2 (en) 2006-09-29 2012-02-21 California Institute Of Technology MART-1 T cell receptors
WO2015103072A1 (en) 2013-12-30 2015-07-09 Epimab Biotherapeutics Fabs-in-tandem immunoglobulin and uses thereof
WO2016181357A1 (en) 2015-05-13 2016-11-17 Zumutor Biologics, Inc. Afucosylated protein, cell expressing said protein and associated methods
WO2019025391A1 (en) 2017-07-31 2019-02-07 Institute For Research In Biomedicine Antibodies with functional domains in the elbow region between variable adn constant domain
WO2019024979A1 (en) 2017-07-31 2019-02-07 Institute For Research In Biomedicine Antibodies with functional domains in the elbow region
WO2019057122A1 (en) 2017-09-22 2019-03-28 Wuxi Biologics (Shanghai) Co., Ltd. Novel bispecific polypeptide complexes

Non-Patent Citations (232)

* Cited by examiner, † Cited by third party
Title
"Epidemiological update: Occurrence of variants of SARS-CoV-2 in the Americas", 20 January 2021, PAN AMERICAN HEALTH ORGANIZATION
"GenBank", Database accession no. YP -009724390.1
"Remington: The Science and Practice of Pharmacy", 2000, PHILADELPHIA COLLEGE OF PHARMACY AND SCIENCE
"Uniprot", Database accession no. Q9BYF1
A. J. MCCOY ET AL.: "Phaser crystallographic software", JAPPL CRYSTALLOGR, vol. 40, 2007, pages 658 - 674
AHMED ET AL., J. STRUC. BIOL., vol. 194, no. 1, 2016, pages 78
ALSHUKAIRI, A.N.KHALID, I.AHMED, W.A.DADA, A.M.BAYUMI, D.T.MALIC, L.S.ALTHAWADI, S.IGNACIO, K.ALSALMI, H.S.AL-ABDELY, H.M. ET AL.: "Antibody Response and Disease Severity in Healthcare Worker MERS Survivors", EMERG INFECT DIS, vol. 22, 2016
ALSOUSSI, W.B.TURNER, J.S.CASE, J.B.ZHAO, H.SCHMITZ, A.J.ZHOU, J.Q.CHEN, R.E.LEI, T.RIZK, A.A.MCINTIRE, K.M. ET AL.: "A Potently Neutralizing Antibody Protects Mice against SARS-CoV-2 Infection", J IMMUNOL., 2020
ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402
ARMOUR, K. L. ET AL., EUR. J. IMMUNOL., vol. 29, 1999, pages 2613 - 2624
B. JU ET AL.: "Human neutralizing antibodies elicited by SARS-CoV-2 infection", NATURE, vol. 584, 2020, pages 115 - 119, XP037211705, DOI: 10.1038/s41586-020-2380-z
B. KAUFMANN ET AL.: "Neutralization of West Nile virus by cross-linking of its surface proteins with Fab fragments of the human monoclonal antibody CR4354", PROCNATLACADSCI USA, vol. 107, 2010, pages 18950 - 18955
B. R. WEST ET AL.: "Structural Basis of Pan-Ebolavirus Neutralization by a Human Antibody against a Conserved, yet Cryptic Epitope", MBIO, vol. 9, 2018
BARNES, C.O.WEST, A.P.HUEY-TUBMAN, K.E.HOFFMANN, M.A.G.SHARAF, N.G.HOFFMAN, P.R.KORANDA, N.GRISTICK, H.B.GAEBLER, C.MUECKSCH, F. E: "Structures of Human Antibodies Bound to SARS-CoV-2 Spike Reveal Common Epitopes and Recurrent Features of Antibodies", CELL, 2020
BATTYE, T.G.KONTOGIANNIS, L.JOHNSON, O.POWELL, H.R.LESLIE, A.G.: "iMOSFLM: a new graphical interface for diffraction-image processing with MOSFLM", ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 67, 2011, pages 271 - 281
BAUM, A.FULTON, B.O.WLOGA, E.COPIN, R.PASCAL, K.E.RUSSO, V.GIORDANO, S.LANZA, K.NEGRON, N.NI, M. ET AL.: "Antibody cocktail to SARS-CoV-2 spike protein prevents rapid mutational escape seen with individual antibodies", SCIENCE, 2020
BIOINFORMATICS, vol. 15, 2016, pages 298 - 300
BRINKMANNKONTERMANN, MABS, vol. 9, no. 2, 2017, pages 182 - 212
BROUWER, P.J.M.CANIELS, T.G.VAN DER STRATEN, K.SNITSELAAR, J.L.ALDON, Y.BANGARU, S.TORRES, J.L.OKBA, N.M.A.CLAIREAUX, M.KERSTER, G: "Potent neutralizing antibodies from COVID-19 patients define multiple targets of vulnerability", SCIENCE, 2020
BRUHNS ET AL., BLOOD, vol. 113, 2009, pages 3716 - 3725
BURTON, D. R., MOL. IMMUNOL., vol. 22, 1985, pages 161 - 206
C. DROSTEN ET AL.: "Identification of a novel coronavirus in patients with severe acute respiratory syndrome", NENGL J MED, vol. 348, 2003, pages 1967 - 1976, XP002288120, DOI: 10.1056/NEJMoa030747
C. L. HSIEH ET AL.: "Structure-based design of prefusion-stabilized SARS-CoV-2 spikes", SCIENCE, 2020
C. O. BARNES ET AL.: "Structural classification of neutralizing antibodies against the SARS-CoV-2 spike receptor-binding domain suggests vaccine and therapeutic strategies", BIORXIV 2020.2008.2030.273920 [PREPRINT, 30 August 2020 (2020-08-30)
C. O. BARNES ET AL.: "Structural classification of neutralizing antibodies against the SARS-CoV-2 spike receptor-binding domain suggests vaccine and therapeutic strategies", BIORXIV, 2020.2008.2030.273920, 2020
CALLOW, K.A.: "Effect of specific humoral immunity and some non-specific factors on resistance of volunteers to respiratory coronavirus infection", J HYG (LOND, vol. 95, 1985, pages 173 - 189
CALLOW, K.A.PARRY, H.F.SERGEANT, M.TYRRELL, D.A.: "The time course of the immune response to experimental coronavirus infection of man", EPIDEMIOL INFECT, vol. 105, 1990, pages 435 - 446
CAO, W.C.LIU, W.ZHANG, P.H.ZHANG, F.RICHARDUS, J.H.: "Disappearance of antibodies to SARS-associated coronavirus after recovery", N ENGL J MED, vol. 357, 2007, pages 1162 - 1163
CAPEL, P. J. ET AL., IMMUNOMETHODS, vol. 113, 1994, pages 269 - 315
CARDONE, G.HEYMANN, J.B.STEVEN, A.C.: "One number does not fit all: mapping local variations in resolution in cryo-EM reconstructions", J STRUCT BIOL, vol. 184, 2013, pages 226 - 236, XP028768071, DOI: 10.1016/j.jsb.2013.08.002
CHAUDHARY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 1066 - 1070
CHEN, S.MCMULLAN, G.FARUQI, A.R.MURSHUDOV, G.N.SHORT, J.M.SCHERES, S.H.HENDERSON, R.: "High-resolution noise substitution to measure overfitting and validate resolution in 3D structure determination by single particle electron cryomicroscopy", ULTRAMICROSCOPY, vol. 135, 2013, pages 24 - 35
CHI, X.YAN, R.ZHANG, J.ZHANG, G.ZHANG, Y.HAO, M.ZHANG, Z.FAN, P.DONG, Y.YANG, Y. ET AL.: "A neutralizing human antibody binds to the N-terminal domain of the Spike protein of SARS-CoV-2", SCIENCE, 2020
CHOTHIALESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHU, S. ET AL.: "Am J Respir Crit", 2014, AMERICAN THORACIC SOCIETY INTERNATIONAL CONFERENCE ABSTRACTS, article "Accelerated Clearance of IgE In Chimpanzees Is Mediated By Xmab7195, An Fc-Engineered Antibody With Enhanced Affinity For Inhibitory Receptor FcyRIIb"
CHU, S. Y. ET AL.: "Inhibition of B cell receptor-mediated activation of primary human B cells by coengagement of CD19 and FcgammaRIIb with Fc-engineered antibodies", MOLECULAR IMMUNOLOGY, vol. 45, 2008, pages 3926 - 3933, XP002498116, DOI: 10.1016/j.molimm.2008.06.027
CHU, S. Y. ET AL.: "Inhibition of B cell receptor-mediated activation of primary human B cells by coengagement of CD19 and FcgammaRIIb with Fc-engineered antibodies", MOLECULARIMMUNOLOGY, vol. 45, 2008, pages 3926 - 3933, XP002498116, DOI: 10.1016/j.molimm.2008.06.027
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
COFFIN, J. M. ET AL.: "Fundamental Virology", 1996, LIPPINCOTT-RAVEN PUBLISHERS, article "Retroviridae: The viruses and their replication"
CORTI, D.VOSS, J.GAMBLIN, S.J.CODONI, G.MACAGNO, A.JARROSSAY, D.VACHIERI, S.G.PINNA, D.MINOLA, A.VANZETTA, F. ET AL.: "A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins", SCIENCE, vol. 333, 2011, pages 850 - 856, XP002689150, DOI: 10.1126/science.1205669
CORTI, D.ZHAO, J.PEDOTTI, M.SIMONELLI, L.AGNIHOTHRAM, S.FETT, C.FERNANDEZ-RODRIGUEZ, B.FOGLIERINI, M.AGATIC, G.VANZETTA, F. ET AL.: "Prophylactic and postexposure efficacy of a potent human monoclonal antibody against MERS coronavirus", PROC NATL ACAD SCI U S A, vol. 112, 2015, pages 10473 - 10478
D. G. WIDMAN ET AL.: "Transplantation of a quaternary structure neutralizing antibody epitope from dengue virus serotype 3 into serotype 4", SCI REP, vol. 7, 2017, pages 17169
D. KIMANIUSB. O. FORSBERGS. H. SCHERESE. LINDAHL: "Accelerated cryo-EM structure determination with parallelisation using GPUs in RELION-2", ELIFE, vol. 5, 2016
DE HAAS, M. ET AL., J LAB. CLIN. MED., vol. 126, 1995, pages 330 - 341
DE WIT, E.FELDMANN, F.HOME, E.OKUMURA, A.CAMERONI, E.HADDOCK, E.SATURDAY, G.SCOTT, D.GOPAL, R.ZAMBON, M. ET AL.: "Prophylactic efficacy of a human monoclonal antibody against MERS-CoV in the common marmoset", ANTIVIRAL RES, vol. 163, 2019, pages 70 - 74
DILILLO, D.J.PALESE, P.WILSON, P.C.RAVETCH, J.V.: "Broadly neutralizing anti-influenza antibodies require Fc receptor engagement for in vivo protection", J CLIN INVEST, vol. 126, 2016, pages 605 - 610
DILILLO, D.J.RAVETCH, J.V.: "Differential Fc-Receptor Engagement Drives an Anti-tumor Vaccinal Effect", CELL, vol. 161, no. 5, 2015, pages 1035 - 1045, XP029129128, DOI: 10.1016/j.cell.2015.04.016
DILILLO, D.J.TAN, G.S.PALESE, P.RAVETCH, J.V.: "Broadly neutralizing hemagglutinin stalk-specific antibodies require FcyR interactions for protection against influenza virus in vivo", NAT MED, vol. 20, 2014, pages 143 - 151
DROSTEN, C.MEYER, B.MULLER, M.A.CORMAN, V.M.AL-MASRI, M.HOSSAIN, R.MADANI, H.SIEBERG, A.BOSCH, B.J.LATTWEIN, E. ET AL.: "Transmission of MERS-coronavirus in household contacts", N ENGL J MED, vol. 371, 2014, pages 828 - 835
DUAN, K.LIU, B.LI, C.ZHANG, H.YU, T.QU, J.ZHOU, M.CHEN, L.MENG, S.HU, Y. ET AL.: "Effectiveness of convalescent plasma therapy in severe COVID-19 patients", PROC NATL ACAD SCI U S A, vol. 117, 2020, pages 9490 - 9496, XP055729885, DOI: 10.1073/pnas.2004168117
DUNCAN, A. R.WINTER, G., NATURE, vol. 332, 1988, pages 323 - 327
E. N. GALLICHOTTE ET AL.: "Human dengue virus serotype 2 neutralizing antibodies target two distinct quaternary epitopes", PLOSPATHOG, vol. 14, 2018, pages e1006934
E. T. CROOKS ET AL.: "Vaccine-Elicited Tier 2 HIV-1 Neutralizing Antibodies Bind to Quaternary Epitopes Involving Glycan-Deficient Patches Proximal to the CD4 Binding Site", PLOS PATHOG, vol. 11, 2015, pages e1004932
EDRIDGE, A.W.KACZOROWSKA, J.M.HOSTE, A.C.BAKKER, M.KLEIN, M.JEBBINK, M.F.MATSER, A.KINSELLA, C.RUEDA, P.PRINS, M. ET AL.: "Coronavirus protective immunity is short-lasting", MEDRXIV, 2020.2005.2011.20086439, 2020
ELBE, S.BUCKLAND-MERRETT, G.: "Data, disease and diplomacy: GISAID's innovative contribution to global health", GLOB CHALL, vol. 7, 2017, pages 33 - 46
ELLIOTT ET AL., NPJ VACCINES, vol. 18, 2017
EMSLEY, P.LOHKAMP, B.SCOTT, W.G.COWTAN, K.: "Features and development of Coot", ACTA CRYSTALLOGRAPHICA SECTION D, vol. 66, 2010, pages 486 - 501
ENGELS ET AL., HUM. GENE THER., vol. 14, 2003, pages 1155
EVANS, P.R.MURSHUDOV, G.N.: "How good are my data and what is the resolution?", ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 69, 2013, pages 1204 - 1214
F. C. ZHU ET AL.: "Safety, tolerability, and immunogenicity of a recombinant adenovirus type-5 vectored COVID-19 vaccine: a dose-escalation, open-label, non-randomised, first-in-human trial", LANCET, vol. 395, 2020, pages 1845 - 1854, XP086181839, DOI: 10.1016/S0140-6736(20)31208-3
F. DIMAIO ET AL.: "Atomic-accuracy models from 4.5-A cryo-electron microscopy data with density-guided iterative local refinement", NAT METHODS, vol. 12, 2015, pages 361 - 365
F. LONG ET AL.: "Structural basis of a potent human monoclonal antibody against Zika virus targeting a quaternary epitope", PROC NATL ACAD SCI USA, vol. 116, 2019, pages 1591 - 1596, XP055803459, DOI: 10.1073/pnas.1815432116
FLINGAI ET AL., SCI REP., vol. 5, 2015, pages 12616
FOLEGATTI, P.M.EWER, K.J.ALEY, P.K.ANGUS, B.BECKER, S.BELIJ-RAMMERSTORFER, S.BELLAMY, D.BIBI, S.BITTAYE, M.CLUTTERBUCK, E.A. ET AL: "Safety and immunogenicity of the ChAdOxl nCoV-19 vaccine against SARS-CoV-2: a preliminary report of a phase 1/2, single-blind, randomised controlled trial", LANCET, 2020
FRECHA ET AL., MOL. THER., vol. 18, 2010, pages 1748
FRENZ, B.RAMISCH, S.BORST, A.J.WALLS, A.C.ADOLF-BRYFOGLE, J.SCHIEF, W.R.VEESLER, D.DIMAIO, F.: "Automatically Fixing Errors in Glycoprotein Structures with Rosetta", STRUCTURE, vol. 27, 2019, pages 134 - 139.e133
G. FIBRIANSAHS. M. LOK: "The development of therapeutic antibodies against dengue virus", ANTIVIRAL RES, vol. 128, 2016, pages 7 - 19, XP029444582, DOI: 10.1016/j.antiviral.2016.01.002
GANESAN, L. P. ET AL.: "FcyRIIb on liver sinusoidal endothelium clears small immune complexes", JOURNAL OF IMMUNOLOGY, vol. 189, 2012, pages 4981 - 4988, XP002724347, DOI: 10.4049/jimmunol.1202017
GERNGROSS, NAT. BIOTECH., vol. 22, 2004, pages 1409 - 1414
GESSNER, J. E. ET AL., ANN. HEMATOL., vol. 76, 1998, pages 231 - 248
GEURTS ET AL., MOL. THER., vol. 8, 2003, pages 108
GIMSON, A.E.TEDDER, R.S.WHITE, Y.S.EDDLESTON, A.L.WILLIAMS, R.: "Serological markers in fulminant hepatitis B", GUT, vol. 24, 1983, pages 615 - 617
GODDARD, T.D.HUANG, C.C.MENG, E.C.PETTERSEN, E.F.COUCH, G.S.MORRIS, J.H.FERRIN, T.E.: "UCSF ChimeraX: Meeting modern challenges in visualization and analysis", PROTEIN SCI, vol. 27, 2018, pages 14 - 25
GRIFONI, A.WEISKOPF, D.RAMIREZ, S.I.MATEUS, J.DAN, J.M.MODERBACHER, C.R.RAWLINGS, S.A.SUTHERLAND, A.PREMKUMAR, L.JADI, R.S. ET AL.: "Targets of T Cell Responses to SARS-CoV-2 Coronavirus in Humans with COVID-19 Disease and Unexposed Individuals", CELL, vol. 181, 2020, pages 1489 - 1501.e1415
GUO, X.GUO, Z.DUAN, C.CHEN, Z.WANG, G.LU, Y.LI, M.LU, J.: "Long-Term Persistence of IgG Antibodies in SARS-CoV Infected Healthcare Workers", MEDRXIV, 2020.2002.2012.20021386, 2020
H. ZHOU ET AL.: "A Novel Bat Coronavirus Closely Related to SARS-CoV-2 Contains Natural Insertions at the S 1/S2 Cleavage Site of the Spike Protein", CURR BIOL, vol. 30, 2020, pages 2196 - 2203.e2193
HE, W.CHEN, C.J.MULLARKEY, C.E.HAMILTON, J.R.WONG, C.K.LEON, P.E.UCCELLINI, M.B.CHROMIKOVA, V.HENRY, C.HOFFMAN, K.W. ET AL.: "Alveolar macrophages are critical for broadly-reactive antibody-mediated protection against influenza A virus in mice", NAT COMMUN, vol. 8, 2017, pages 846
HENSLEY, S.E.DAS, S.R.BAILEY, A.L.SCHMIDT, L.M.HICKMAN, H.D.JAYARAMAN, A.VISWANATHAN, K.RAMAN, R.SASISEKHARAN, R.BENNINK, J.R. ET : "Hemagglutinin receptor binding avidity drives influenza A virus antigenic drift", SCIENCE, vol. 326, 2009, pages 734 - 736
HESSELL, A.J.HANGARTNER, L.HUNTER, M.HAVENITH, C.E.BEURSKENS, F.J.BAKKER, J.M.LANIGAN, C.M.LANDUCCI, G.FORTHAL, D.N.PARREN, P.W. E: "Fc receptor but not complement binding is important in antibody protection against HIV", NATURE, vol. 449, 2007, pages 101 - 104, XP055077687, DOI: 10.1038/nature06106
HOFFMANN, M.KLEINE-WEBER, H.POHLMANN, S.: "A Multibasic Cleavage Site in the Spike Protein of SARS-CoV-2 Is Essential for Infection of Human Lung Cells", MOL CELL, vol. 78, 2020, pages 779 - 784.e775
HOFFMANN, M.KLEINE-WEBER, H.SCHROEDER, S.KRUGER, N.HERRLER, T.ERICHSEN, S.SCHIERGENS, T.S.HERRLER, G.WU, N.H.NITSCHE, A. ET AL.: "SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor", CELL, vol. 181, 2020, pages 271 - 280.e278
HONEGGERPLUCKTHUN, J. MOL. BIO., vol. 309, 2001, pages 657 - 670
HUANG ET AL., MABS, vol. 6, 2018, pages 1 - 12
HUO, J.ZHAO, Y.REN, J.ZHOU, D.DUYVESTEYN, H.M.E.GINN, H.M.CARRIQUE, L.MALINAUSKAS, T.RUZA, R.R.SHAH, P.N.M. ET AL.: "Neutralisation of SARS-CoV-2 by destruction of the prefusion Spike", CELL HOST & MICROBE, 2020
J. AGIRRE ET AL.: "Privateer: software for the conformational validation of carbohydrate structures", NAT STRUCT MOL BIOL, vol. 22, 2015, pages 833 - 834
J. B. CASE ET AL.: "Neutralizing Antibody and Soluble ACE2 Inhibition of a Replication-Competent VSV-SARS-CoV-2 and a Clinical Isolate of SARS-CoV-2", CELL HOST MICROBE, vol. 28, 2020, pages 475 - 485.e475
J. HANSEN ET AL.: "Studies in humanized mice and convalescent humans yield a SARS-CoV-2 antibody cocktail", SCIENCE, 2020
J. SNIJDER ET AL.: "An Antibody Targeting the Fusion Machinery Neutralizes Dual-Tropic Infection and Defines a Site of Vulnerability on Epstein-Barr Virus", IMMUNITY, vol. 48, 2018, pages 799 - 811.e799
J. YU ET AL.: "DNA vaccine protection against SARS-CoV-2 in rhesus macaques", SCIENCE, 2020
JOHNSON, R.F.BAGCI, U.KEITH, L.TANG, X.MOLLURA, D.J.ZEITLIN, L.QIN, J.HUZELLA, L.BARTOS, C.J.BOHOROVA, N. ET AL.: "3B 11-N, a monoclonal antibody against MERS-CoV, reduces lung pathology in rhesus monkeys following intratracheal inoculation of MERS-CoV Jordan-n3/2012", VIROLOGY, vol. 490, 2016, pages 49 - 58
JOLLY, D J: "The Development of Human Gene Therapy", 1999, COLD SPRING HARBOR LAB, article "Emerging Viral Vectors"
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
JOYCE, M.G.SANKHALA, R.S.CHEN, W.-H.CHOE, M.BAI, H.HAJDUCZKI, A.YAN, L.STERLING, S.L.PETERSON, C.E.GREEN, E.C. ET AL.: "A Cryptic Site of Vulnerability on the Receptor Binding Domain of the SARS-CoV-2 Spike Glycoprotein", BIORXIV, 2020.2003.2015.992883, 2020
JU, B.ZHANG, Q.GE, X.WANG, R.YU, J.SHAN, S.ZHOU, B.SONG, S.TANG, X.YU, J. ET AL.: "Potent human neutralizing antibodies elicited by SARS-CoV-2 infection", BIORXIV, 2020.2003.2021.990770, 2020
KABSCH, W.: "XDS", ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 66, 2010, pages 125 - 132
KE, Z.OTON, J.QU, K.CORTESE, M.ZILA, V.MCKEANE, L.NAKANE, T.ZIVANOV, J.NEUFELDT, C.J.LU, J.M. ET AL.: "Structures, conformations and distributions of SARS-CoV-2 spike protein trimers on intact virions", BIORXIV, 2020.2006.2027.174979, 2020
KIRCHDOERFER, R.N.WANG, N.PALLESEN, J.WRAPP, D.TURNER, H.L.COTTRELL, C.A.CORBETT, K.S.GRAHAM, B.S.MCLELLAN, J.S.WARD, A.B.: "Stabilized coronavirus spikes are resistant to conformational changes induced by receptor recognition or proteolysis", SCI REP, vol. 8, 2018, pages 15701, XP055734535, DOI: 10.1038/s41598-018-34171-7
KOHLER ET AL., NATURE, vol. 256, 1975, pages 495
KOSE ET AL., SCI. IMMUNOL., vol. 4, 2019, pages eaaw6647
KRISKY ET AL., GENE THER., vol. 5, 1998, pages 1517
L. A. JACKSON ET AL.: "An mRNA Vaccine against SARS-CoV-2 - Preliminary Report", NENGL J MED, 2020
L. J. REEDH. MUENCH: "A SIMPLE METHOD OF ESTIMATING FIFTY PER CENT ENDPOINTS12", AMERICAN JOURNAL OF EPIDEMIOLOGY, vol. 27, 1938, pages 493 - 497
L. LIU ET AL.: "Potent neutralizing antibodies against multiple epitopes on SARS-CoV-2 spike", NATURE, vol. 584, 2020, pages 450 - 456, XP037223585, DOI: 10.1038/s41586-020-2571-7
LAN, J.GE, J.YU, J.SHAN, S.ZHOU, H.FAN, S.ZHANG, Q.SHI, X.WANG, Q.ZHANG, L. ET AL.: "Structure of the SARS-CoV-2 spike receptor-binding domain bound to the ACE2 receptor", NATURE, vol. 583, 2020, pages 290 - 295
LAU, S.Y.WANG, P.MOK, B.W.ZHANG, A.J.CHU, H.LEE, A.C.DENG, S.CHEN, P.CHAN, K.H.SONG, W. ET AL.: "Attenuated SARS-CoV-2 variants with deletions at the S1/S2 junction", EMERG MICROBES INFECT, vol. 9, 2020, pages 837 - 842
LEFRANC ET AL., DEV. COMP. IMMUNOL., vol. 27, 2003, pages 55
LETKO, M.MARZI, A.MUNSTER, V.: "Functional assessment of cell entry and receptor usage for SARS-CoV-2 and other lineage B betacoronaviruses", NATURE MICROBIOLOGY, 2020
LEUNG, K. ET AL.: "Early empirical assessment of the N501Y mutant strains of SARS-CoV-2 in the United Kingdom, October to November 2020", MEDRXIV, 2020
LI ET AL., NAT. BIOTECH., vol. 24, 2006, pages 210 - 215
LI ET AL., WILERY INTERDISCIP REV. NANOMEDNANOBIOTECHNOL., vol. 11, no. 2, 2019, pages e1530
LI, L.ZHANG, W.HU, Y.TONG, X.ZHENG, S.YANG, J.KONG, Y.REN, L.WEI, Q.MEI, H. ET AL.: "Effect of Convalescent Plasma Therapy on Time to Clinical Improvement in Patients With Severe and Life-threatening COVID-19: A Randomized Clinical Trial", JAMA, 2020
LI, Q.WU, J.NIE, J.ZHANG, L.HAO, H.LIU, S.ZHAO, C.ZHANG, Q.LIU, H.NIE, L. ET AL.: "The impact of mutations in SARS-CoV-2 spike on viral infectivity and antigenicity", CELL, 2020
LIEBSCHNER, D.AFONINE, P.V.BAKER, M.L.BUNKOCZI, G.CHEN, V.B.CROLL, T.I.HINTZE, B.HUNG, L.W.JAIN, S.MCCOY, A.J. ET AL.: "Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix", ACTA CRYSTALLOGR D STRUCT BIOL, vol. 75, 2019, pages 861 - 877
LINDHARDT, B.O.GERSTOFT, J.HOFMANN, B.PALLESEN, G.MATHIESEN, L.DICKMEISS, E.ULRICH, K.: "Antibodies against the major core protein p24 of human immunodeficiency virus: relation to immunological, clinical and prognostic findings", EUR J CLIN MICROBIOL INFECT DIS, vol. 8, 1989, pages 614 - 619
LIU, L.WANG, P.NAIR, M.S.YU, J.RAPP, M.WANG, Q.LUO, Y.CHAN, J.F.SAHI, V.FIGUEROA, A. ET AL.: "Potent neutralizing antibodies directed to multiple epitopes on SARS-CoV-2 spike", NATURE, 2020
LIU, S.T.H.LIN, H.-M.BAINE, I.WAJNBERG, A.GUMPRECHT, J.P.RAHMAN, F.RODRIGUEZ, D.TANDON, P.BASSILY-MARCUS, A.BANDER, J. ET AL.: "Convalescent plasma treatment of severe COVID-19: A matched control study", MEDRXIV, 2020.2005.2020.20102236, 2020
LONG, Q.X.TANG, X.J.SHI, Q.L.LI, Q.DENG, H.J.YUAN, J.HU, J.L.XU, W.ZHANG, Y.LV, F.J. ET AL.: "Clinical and immunological assessment of asymptomatic SARS-CoV-2 infections", NAT MED., 2020
LUCHSINGER, L.L.RANSEGNOLA, B.JIN, D.MUECKSCH, F.WEISBLUM, Y.BAO, W.GEORGE, P.J.RODRIGUEZ, M.TRICOCHE, N.SCHMIDT, F. ET AL.: "Serological Analysis of New York City COVID19 Convalescent Plasma Donors", MEDRXIV, 2020
LUND, J.M.ALEXOPOULOU, L.SATO, A.KAROW, M.ADAMS, N.C.GALE, N.W.IWASAKI, A.FLAVELL, R.A.: "Recognition of single-stranded RNA viruses by Toll-like receptor 7", PROC NATL ACAD SCI U S A, vol. 101, 2004, pages 5598 - 5603, XP002725552, DOI: 10.1073/pnas.0400937101
M. J. MULLIGAN ET AL.: "Phase 1/2 Study to Describe the Safety and Immunogenicity of a COVID-19 RNA Vaccine Candidate (BNT162b1) in Adults 18 to 55 Years of Age: Interim Report", MEDRXIV, 2020.2006.2030.20142570, 2020
M. MCCALLUMA. C. WALLSJ. E. BOWEND. CORTID. VEESLER: "Structure-guided covalent stabilization of coronavirus spike glycoprotein trimers in the closed conformation", NAT STRUCT MOL BIOL, 2020
M. N. PRICHARDC. SHIPMAN: "A three-dimensional model to analyze drug-drug interactions", ANTIVIRAL RES, vol. 14, 1990, pages 181 - 205
M. SCHOOF ET AL.: "An ultra-potent synthetic nanobody neutralizes SARS-CoV-2 by locking Spike into an inactive conformation", BIORXIV 2020.2008.2008.238469 [PREPRINT, 17 August 2020 (2020-08-17)
M. SCHOOF ET AL.: "An ultra-potent synthetic nanobody neutralizes SARS-CoV-2 by locking Spike into an inactive conformation", BIORXIV, 2020.2008.2008.238469, 2020
MARATEA ET AL., GENE, vol. 40, 1985, pages 39 46
MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597
MATES ET AL., NAT. GENET., vol. 41, 2009, pages 753
MCCOY, A.J.GROSSE-KUNSTLEVE, R.W.ADAMS, P.D.WINN, M.D.STORONI, L.C.READ, R.J.: "Phaser crystallographic software", J APPL CRYSTALLOGR, vol. 40, 2007, pages 658 - 674
MENACHERY, V.D.YOUNT, B.L., JR.SIMS, A.C.DEBBINK, K.AGNIHOTHRAM, S.S.GRALINSKI, L.E.GRAHAM, R.L.SCOBEY, T.PLANTE, J.A.ROYAL, S.R. : "SARS-like WIV1-CoV poised for human emergence", PROC NATL ACAD SCI U S A, vol. 113, 2016, pages 3048 - 3053
MENG YUAN ET AL: "A highly conserved cryptic epitope in the receptor binding domains of SARS-CoV-2 and SARS-CoV", SCIENCE, vol. 368, no. 6491, 8 May 2020 (2020-05-08), pages 630 - 633, XP055707792, DOI: 10.1126/science.abb7269 *
MILLET, J.K.WHITTAKER, G.R.: "Host cell proteases: Critical determinants of coronavirus tropism and pathogenesis", VIRUS RES, vol. 202, 2015, pages 120 - 134, XP029185495, DOI: 10.1016/j.virusres.2014.11.021
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855
MURPHY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 83, 1986, pages 8258 8262
MURSHUDOV, G.N.SKUBAK, P.LEBEDEV, A.A.PANNU, N.S.STEINER, R.A.NICHOLLS, R.A.WINN, M.D.LONG, F.VAGIN, A.A.: "REFMAC5 for the refinement of macromolecular crystal structures", ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 67, 2011, pages 355 - 367
MUTHUMANI ET AL., HUM VACCIN IMMUNOTHER, vol. 9, 2013, pages 2253 - 2262
MUTHUMANI ET AL., J INFECT DIS., vol. 214, no. 3, 2016, pages 369 - 378
N. ZHU ET AL.: "A Novel Coronavirus from Patients with Pneumonia in China, 2019", NENGL J MED, 2020
NG, K.W.FAULKNER, N.CORNISH, G.H.ROSA, A.HARVEY, R.HUSSAIN, S.ULFERTS, R.EARL, C.WROBEL, A.BENTON, D. ET AL.: "Pre-existing and <em>de novo</em> humoral immunity to SARS-CoV-2 in humans", BIORXIV, 2020.2005.2014.095414, 2020
ORTIZ, D.F.LANSING, J.C.RUTITZKY, L.KURTAGIC, E.PROD'HOMME, T.CHOUDHURY, A.WASHBURN, N.BHATNAGAR, N.BENEDUCE, C.HOLTE, K. ET AL.: "Elucidating the interplay between IgG-Fc valency and FcyR activation for the design of immune complex inhibitors", SCI TRANSL MED, vol. 8, 2016, pages 365ra158
OU, X.LIU, Y.LEI, X.LI, P.MI, D.REN, L.GUO, L.GUO, R.CHEN, T.HU, J. ET AL.: "Characterization of spike glycoprotein of SARS-CoV-2 on virus entry and its immune cross-reactivity with SARS-CoV", NAT COMMUN, vol. 11, 2020, pages 1620
PALLESEN, J.WANG, N.CORBETT, K.S.WRAPP, D.KIRCHDOERFER, R.N.TURNER, H.L.COTTRELL, C.A.BECKER, M.M.WANG, L.SHI, W. ET AL.: "Immunogenicity and structures of a rationally designed prefusion MERS-CoV spike antigen", PROC NATL ACAD SCI U S A, vol. 114, 2017, pages E7348 - E7357, XP055692891, DOI: 10.1073/pnas.1707304114
PALMBERGER ET AL., J. BIOTECHNOL., vol. 153, no. 3-4, 2011, pages 160 - 166
PARDI ET AL., J CONTROL RELEASE, 2015, pages 217345 - 351
PETTERSEN, E.F.GODDARD, T.D.HUANG, C.C.COUCH, G.S.GREENBLATT, D.M.MENG, E.C.FERRIN, T.E.: "UCSF Chimera--a visualization system for exploratory research and analysis", J COMPUT CHEM, vol. 25, 2004, pages 1605 - 1612
PICCOLI LUCA ET AL: "Mapping Neutralizing and Immunodominant Sites on the SARS-CoV-2 Spike Receptor-Binding Domain by Structure-Guided High-Resolution Serology", CELL, ELSEVIER, AMSTERDAM NL, vol. 183, no. 4, 16 September 2020 (2020-09-16), pages 1024, XP086341451, ISSN: 0092-8674, [retrieved on 20200916], DOI: 10.1016/J.CELL.2020.09.037 *
PICCOLI: "Mapping Neutralizing and Immunodominant Sites on the SARS-CoV-2 Spike Receptor-Binding Domain by Structure-Guided High-Resolution Serology", CELL, vol. 183, 2020, pages 1024 - 1042.e21
PINTO DORA ET AL: "Cross-neutralization of SARS-CoV-2 by a human monoclonal SARS-CoV antibody", NATURE, MACMILLAN JOURNALS LTD., ETC, LONDON, vol. 583, no. 7815, 18 May 2020 (2020-05-18), pages 290 - 295, XP037289888, ISSN: 0028-0836, [retrieved on 20200518], DOI: 10.1038/S41586-020-2349-Y *
PINTO, D.PARK, Y.J.BELTRAMELLO, M.WALLS, A.C.TORTORICI, M.A.BIANCHI, S.JACONI, S.CULAP, K.ZATTA, F.DE MARCO, A. ET AL.: "Cross-neutralization of SARS-CoV-2 by a human monoclonal SARS-CoV antibody", NATURE, vol. 583, 2020, pages 290 - 295, XP037289888, DOI: 10.1038/s41586-020-2349-y
PLUCKTHUN, A., BIO/TECHNOLOGY, vol. 9, 1991, pages 545 - 551
PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596
PREVOST, J.GASSER, R.BEAUDOIN-BUSSIERES, G.RICHARD, J.DUERR, R.LAUMAEA, A.ANAND, S.P.GOYETTE, G.DING, S.MEDJAHED, H. ET AL.: "Cross-sectional evaluation of humoral responses against SARS-CoV-2 Spike", BIORXIV, 2020
PUNJANI, A.RUBINSTEIN, J.L.FLEET, D.J.BRUBAKER, M.A.: "cryoSPARC: algorithms for rapid unsupervised cryo-EM structure determination", NAT METHODS, vol. 14, 2017, pages 290 - 296, XP055631965, DOI: 10.1038/nmeth.4169
PUNJANI, A.ZHANG, H.FLEET, D.J.: "Non-uniform refinement: Adaptive regularization improves single particle cryo-EM reconstruction", BIORXIV, 2019.2012.2015.877092, 2019
R. BOUDEWIJNS ET AL.: "STAT2 signaling as double-edged sword restricting viral dissemination but driving severe pneumonia in SARS-CoV-2 infected hamsters", BIORXIV, 2020.2004.2023.056838, 2020
R. SHI ET AL.: "A human neutralizing antibody targets the receptor-binding site of SARS-CoV-2", NATURE, vol. 584, 2020, pages 120 - 124, XP037211681, DOI: 10.1038/s41586-020-2381-y
RAMBAUT, A. ET AL.: "A dynamic nomenclature proposal for SARS-CoV-2 lineages to assist genomic epidemiology", NAT MICROBIOL, vol. 5, 2020, pages 1403 - 1407, XP037277086, DOI: 10.1038/s41564-020-0770-5
RAVETCH, J. V.KINET, J. P., ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 492
ROBBIANI, D.F.GAEBLER, C.MUECKSCH, F.LORENZI, J.C.C.WANG, Z.CHO, A.AGUDELO, M.BARNES, C.O.GAZUMYAN, A.FINKIN, S. ET AL.: "Convergent antibody responses to SARS-CoV-2 in convalescent individuals", NATURE, 2020
ROCKX, B.CORTI, D.DONALDSON, E.SHEAHAN, T.STADLER, K.LANZAVECCHIA, A.BARIC, R.: "Structural basis for potent cross-neutralizing human monoclonal antibody protection against lethal human and zoonotic severe acute respiratory syndrome coronavirus challenge", J VIROL, vol. 82, 2008, pages 3220 - 3235, XP002668044, DOI: 10.1128/JVI.02377-07
ROGERS, T.F.ZHAO, F.HUANG, D.BEUTLER, N.BURNS, A.HE, W.T.LIMBO, O.SMITH, C.SONG, G.WOEHL, J. ET AL.: "Isolation of potent SARS-CoV-2 neutralizing antibodies and protection from disease in a small animal model", SCIENCE, 2020
S. BOURNAZOST. T. WANGJ. V. RAVETCH: "The Role and Function of Fey Receptors on Myeloid Cells", MICROBIOL SPECTR, vol. 4, 2016
S. J. ZOST ET AL.: "Potently neutralizing and protective human antibodies against SARS-CoV-2", NATURE, 2020
SABNIS ET AL., MOL. THER., vol. 26, 2018, pages 1509 - 1519
SCATCHARD ET AL., ANN. N.Y. ACAD. SCI., vol. 51, 1949, pages 660
SCHERES, S.H.: "A Bayesian view on cryo-EM structure determination", J MOL BIOL, vol. 415, 2012, pages 406 - 418, XP028438072, DOI: 10.1016/j.jmb.2011.11.010
SCHERES, S.H.: "RELION: implementation of a Bayesian approach to cryo-EM structure determination", J STRUCT BIOL, vol. 180, 2012, pages 519 - 530
SCHOLTEN ET AL., CLIN. IMMUNOL., vol. 119, 2006, pages 135
SEOW, J.GRAHAM, C.MERRICK, B.ACORS, S.STEEL, K.J.A.HEMMINGS, O.O'BRYNE, A.KOUPHOU, N.PICKERING, S.GALAO, R. ET AL.: "Longitudinal evaluation and decline of antibody responses in SARS-CoV-2 infection", MEDRXIV, 2020.2007.2009.20148429, 2020
SEYDOUX, E.HOMAD, L.J.MACCAMY, A.J.PARKS, K.R.HURLBURT, N.K.JENNEWEIN, M.F.AKINS, N.R.STUART, A.B.WAN, Y.-H.FENG, J. ET AL.: "Characterization of neutralizing antibodies from a SARS-CoV-2 infected individual", BIORXIV, 2020.2005.2012.091298, 2020
SHANG, J.YE, G.SHI, K.WAN, Y.LUO, C.AIHARA, H.GENG, Q.AUERBACH, A.LI, F.: "Structural basis of receptor recognition by SARS-CoV-2", NATURE, 2020
SHEN, C.WANG, Z.ZHAO, F.YANG, Y.LI, J.YUAN, J.WANG, F.LI, D.YANG, M.XING, L. ET AL.: "Treatment of 5 Critically III Patients With COVID-19 With Convalescent Plasma", JAMA, 2020
SHI RUI ET AL: "A human neutralizing antibody targets the receptor-binding site of SARS-CoV-2", NATURE, MACMILLAN JOURNALS LTD., ETC, LONDON, vol. 584, no. 7819, 26 May 2020 (2020-05-26), pages 120 - 124, XP037211681, ISSN: 0028-0836, [retrieved on 20200526], DOI: 10.1038/S41586-020-2381-Y *
SHIELDS, R. L. ET AL., J. BIOL. CHEM., vol. 276, 2001, pages 6591 - 6604
SONG, W.GUI, M.WANG, X.XIANG, Y.: "Cryo-EM structure of the SARS coronavirus spike glycoprotein in complex with its host cell receptor ACE2", PLOS PATHOG, vol. 14, 2018, pages e1007236, XP055815677, DOI: 10.1371/journal.ppat.1007236
SPIESS ET AL., MOL. IMMUNOL., vol. 67, no. 2, 2015, pages 95
STETTLER, K.BELTRAMELLO, M.ESPINOSA, D.A.GRAHAM, V.CASSOTTA, A.BIANCHI, S.VANZETTA, F.MINOLA, A.JACONI, S.MELE, F. ET AL.: "Specificity, cross-reactivity, and function of antibodies elicited by Zika virus infection", SCIENCE, vol. 353, no. 6301, 2016, pages 823 - 826, XP055352097, DOI: 10.1126/science.aaf8505
SULOWAY, C.PULOKAS, J.FELLMANN, D.CHENG, A.GUERRA, F.QUISPE, J.STAGG, S.POTTER, C.S.CARRAGHER, B.: "Automated molecular microscopy: the new Leginon system", J STRUCT BIOL, vol. 151, 2005, pages 41 - 60, XP004949561, DOI: 10.1016/j.jsb.2005.03.010
SUZUKI ET AL., CLIN. CANCER RES., vol. 13, no. 6, 2007, pages 1875 - 82
T. G. KSIAZEK ET AL.: "A novel coronavirus associated with severe acute respiratory syndrome", NENGL J MED, vol. 348, 2003, pages 1953 - 1966, XP002486657, DOI: 10.1056/NEJMoa030781
T. N. STARR ET AL.: "Deep Mutational Scanning of SARS-CoV-2 Receptor Binding Domain Reveals Constraints on Folding and ACE2 Binding", CELL, vol. 182, 2020, pages 1295 - 1310.e1220
TAN, C.W.CHIA, W.N.QIN, X.LIU, P.CHEN, M.I.C.TIU, C.HU, Z.CHEN, V.C.-W.YOUNG, B.E.SIA, W.R. ET AL.: "A SARS-CoV-2 surrogate virus neutralization test based on antibody-mediated blockage of ACE2-spike protein-protein interaction", NATURE BIOTECHNOLOGY, 2020
TAN, Y.Z.BALDWIN, P.R.DAVIS, J.H.WILLIAMSON, J.R.POTTER, C.S.CARRAGHER, B.LYUMKIS, D.: "Addressing preferred specimen orientation in single-particle cryo-EM through tilting", NAT METHODS, vol. 14, 2017, pages 793 - 796
TANG, A.CHEN, Z.COX, K.S.SU, H.P.CALLAHAN, C.FRIDMAN, A.ZHANG, L.PATEL, S.B.CEJAS, P.J.SWOYER, R. ET AL.: "A potent broadly neutralizing human RSV antibody targets conserved site IV of the fusion glycoprotein", NAT COMMUN, vol. 10, 2019, pages 4153
TEGALLY, H. ET AL.: "Emergence and rapid spread of a new severe acute respiratory syndrome-related coronavirus 2 (SARS-CoV-2) lineage with multiple spike mutations in South Africa", MEDRXIV, 2020
TEGUNOV, D.CRAMER, P.: "Real-time cryo-electron microscopy data preprocessing with Warp", NAT METHODS, vol. 16, 2019, pages 1146 - 1152, XP036917491, DOI: 10.1038/s41592-019-0580-y
TER MEULEN, J.VAN DEN BRINK, E.N.POON, L.L.MARISSEN, W.E.LEUNG, C.S.COX, F.CHEUNG, C.Y.BAKKER, A.Q.BOGAARDS, J.A.VAN DEVENTER, E. : "Human monoclonal antibody combination against SARS coronavirus: synergy and coverage of escape mutants", PLOS MED, vol. 3, 2006, pages e237
THESS ET AL., MOL THER, vol. 23, 2015, pages 1456 - 1464
THOMSON, E.C. ET AL.: "The circulating SARS-CoV-2 spike variant N439K maintains fitness while evading antibody-mediated immunity", BIORXIV, 2020
THRAN ET AL., EMBO MOL MED, vol. 9, no. 10, 2017, pages 1434 - 1448
TIAN, X.LI, C.HUANG, A.XIA, S.LU, S.SHI, Z.LU, L.JIANG, S.YANG, Z.WU, Y. ET AL.: "Potent binding of 2019 novel coronavirus spike protein by a SARS coronavirus-specific human monoclonal antibody", EMERG MICROBES INFECT, vol. 9, 2020, pages 382 - 385, XP055736759, DOI: 10.1080/22221751.2020.1729069
TORTORICI M. ALEJANDRA ET AL: "Broad sarbecovirus neutralization by a human monoclonal antibody", NATURE, vol. 597, no. 7874, 2 September 2021 (2021-09-02), London, pages 103 - 108, XP055845075, ISSN: 0028-0836, Retrieved from the Internet <URL:https://www.nature.com/articles/s41586-021-03817-4.pdf> DOI: 10.1038/s41586-021-03817-4 *
TORTORICI, M.A.VEESLER, D.: "Structural insights into coronavirus entry", ADV VIRUS RES, vol. 105, 2019, pages 93 - 116
TRAGGIAI, E.BECKER, S.SUBBARAO, K.KOLESNIKOVA, L.UEMATSU, Y.GISMONDO, M.R.MURPHY, B.R.RAPPUOLI, R.LANZAVECCHIA, A.: "An efficient method to make human monoclonal antibodies from memory B cells: potent neutralization of SARS coronavirus", NAT MED, vol. 10, 2004, pages 871 - 875, XP037065944, DOI: 10.1038/nm1080
U. SAHIN ET AL.: "Concurrent human antibody and T<sub>H</sub>l type T-cell responses elicited by a COVID-19 RNA vaccine", MEDRXIV, 2020.2007.2017.20140533, 2020
URLAUB ET AL., PNAS, vol. 77, 1980, pages 4216
V. B. CHEN ET AL.: "MolProbity: all-atom structure validation for macromolecular crystallography", ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 66, 2010, pages 12 - 21
VAN DE WINKEL, J. G., ANDERSON, C. L., J. LEUKOC. BIOL., vol. 49, 1991, pages 511 - 524
VERHOEYEN ET AL., METHODS MOL. BIOL., vol. 506, 2009, pages 97
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536
W. B. ALSOUSSI ET AL.: "A Potently Neutralizing Antibody Protects Mice against SARS-CoV-2 Infection", J IMMUNOL, 2020
W. DEJNIRATTISAI ET AL.: "A new class of highly potent, broadly neutralizing antibodies isolated from viremic patients infected with dengue virus", NAT IMMUNOL, vol. 16, 2015, pages 170 - 177, XP055230957, DOI: 10.1038/ni.3058
WALCHLI ET AL., PLOS ONE, vol. 6, 2011, pages 327930
WALLS, A.C.PARK, Y.J.TORTORICI, M.A.WALL, A.MCGUIRE, A.T.VEESLER, D.: "Structure, Function, and Antigenicity of the SARS-CoV-2 Spike Glycoprotein", CELL, vol. 181, 2020, pages 281 - 292.e286
WALLS, A.C.TORTORICI, M.A.BOSCH, B.J.FRENZ, B.ROTTIER, P.J.M.DIMAIO, F.REY, F.A.VEESLER, D.: "Cryo-electron microscopy structure of a coronavirus spike glycoprotein trimer", NATURE, vol. 531, 2016, pages 114 - 117, XP037065821, DOI: 10.1038/nature16988
WALLS, A.C.TORTORICI, M.A.FRENZ, B.SNIJDER, J.LI, W.REY, F.A.DIMAIO, F.BOSCH, B.J.VEESLER, D.: "Glycan shield and epitope masking of a coronavirus spike protein observed by cryo-electron microscopy", NAT STRUCT MOL BIOL, vol. 23, 2016, pages 899 - 905, XP037066006, DOI: 10.1038/nsmb.3293
WALLS, A.C.TORTORICI, M.A.SNIJDER, J.XIONG, X.BOSCH, B.J.REY, F.A.VEESLER, D.: "Tectonic conformational changes of a coronavirus spike glycoprotein promote membrane fusion", PROC NATL ACAD SCI U S A, vol. 114, 2017, pages 11157 - 11162
WALLS, A.C.XIONG, X.PARK, Y.J.TORTORICI, M.A.SNIJDER, J.QUISPE, J.CAMERONI, E.GOPAL, R.DAI, M.LANZAVECCHIA, A. ET AL.: "Unexpected Receptor Functional Mimicry Elucidates Activation of Coronavirus Fusion", CELL, vol. 176, 2019, pages 1026 - 1039.e1015
WANG, C.LI, W.DRABEK, D.OKBA, N.M.A.VAN HAPEREN, R.OSTERHAUS, A.D.M.E.VAN KUPPEVELD, F.J.M.HAAGMANS, B.L.GROSVELD, F.BOSCH, B.-J.: "A human monoclonal antibody blocking SARS-CoV-2 infection", BIORXIV, 2020.2003.2011.987958, 2020
WANG, Q.ZHANG, Y.WU, L.NIU, S.SONG, C.ZHANG, Z.LU, G.QIAO, C.HU, Y.YUEN, K.Y. ET AL.: "Structural and Functional Basis of SARS-CoV-2 Entry by Using Human ACE2", CELL, vol. 181, 2020, pages 894 - 904.e899
WANG, R.Y.SONG, Y.BARAD, B.A.CHENG, Y.FRASER, J.S.DIMAIO, F.: "Automated structure refinement of macromolecular assemblies from cryo-EM maps using Rosetta", ELIFE, vol. 5, 2016
WARD, E. S.GHETIE, V., THER. IMMUNOL., vol. 2, 1995, pages 77 - 94
WATANABE, Y.ALLEN, J.D.WRAPP, D.MCLELLAN, J.S.CRISPIN, M.: "Site-specific glycan analysis of the SARS-CoV-2 spike", SCIENCE, 2020
WEC ANNA Z. ET AL: "Broad neutralization of SARS-related viruses by human monoclonal antibodies", SCIENCE, vol. 369, no. 6504, 15 June 2020 (2020-06-15), US, pages 731 - 736, XP055845076, ISSN: 0036-8075, DOI: 10.1126/science.abc7424 *
WEC, A.Z.WRAPP, D.HERBERT, A.S.MAURER, D.P.HASLWANTER, D.SAKHARKAR, M.JANGRA, R.K.DIETERLE, M.E.LILOV, A.HUANG, D. ET AL.: "Broad neutralization of SARS-related viruses by human monoclonal antibodies", SCIENCE, 2020
WILSON, SCIENCE, vol. 295, 2002, pages 2103
WINES, B.D. ET AL., J. IMMUNOL., vol. 164, 2000, pages 5313 - 5318
WOLFF ET AL., CANCER RES., vol. 53, 1993, pages 2560
WRAPP, D.WANG, N.CORBETT, K.S.GOLDSMITH, J.A.HSIEH, C.L.ABIONA, O.GRAHAM, B.S.MCLELLAN, J.S.: "Cryo-EM structure of the 2019-nCoV spike in the prefusion conformation", SCIENCE, vol. 367, 2020, pages 1260 - 1263
WU, Y.WANG, F.SHEN, C.PENG, W.LI, D.ZHAO, C.LI, Z.LI, S.BI, Y.YANG, Y. ET AL.: "A noncompeting pair of human neutralizing antibodies block COVID-19 virus binding to its receptor ACE2", SCIENCE, vol. 368, 2020, pages 1274 - 1278, XP055799109, DOI: 10.1126/science.abc2241
X. BROCHETM. P. LEFRANCV. GIUDICELLI: "IMGT/V-QUEST: the highly customized and integrated system for IG and TR standardized V-J and V-D-J sequence analysis", NUCLEIC ACIDS RES, vol. 36, 2008, pages W503 - 508
X. XIE ET AL.: "A nanoluciferase SARS-CoV-2 for rapid neutralization testing and screening of anti-infective drugs for COVID-19", BIORXIV, 2020.2006.2022.165712, 2020
XIONG ET AL., NATURE STRUTURAL & MOLECULAR BIOLOGY, vol. 27, 2020, pages 934 - 941
YAN, R.ZHANG, Y.LI, Y.XIA, L.GUO, Y.ZHOU, Q.: "Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2", SCIENCE, vol. 367, 2020, pages 1444 - 1448, XP055798878, DOI: 10.1126/science.abb2762
YING, T.PRABAKARAN, P.DU, L.SHI, W.FENG, Y.WANG, Y.WANG, L.LI, W.JIANG, S.DIMITROV, D.S. ET AL.: "Junctional and allele-specific residues are critical for MERS-CoV neutralization by an exceptionally potent germline-like antibody", NAT COMMUN, vol. 6, 2015, pages 8223, XP055692286, DOI: 10.1038/ncomms9223
YUAN, M.WU, N.C.ZHU, X.LEE, C.D.SO, R.T.Y.LV, H.MOK, C.K.P.WILSON, I.A.: "A highly conserved cryptic epitope in the receptor-binding domains of SARS-CoV-2 and SARS-CoV", SCIENCE, 2020
YUAN, Y.CAO, D.ZHANG, Y.MA, J.QI, J.WANG, Q.LU, G.WU, Y.YAN, J.SHI, Y. ET AL.: "Cryo-EM structures of MERS-CoV and SARS-CoV spike glycoproteins reveal the dynamic receptor binding domains", NAT COMMUN, vol. 8, 2017, pages 15092
ZALEVSKY ET AL.: "Enhanced antibody half-life improves in vivo activity", NATURE BIOTECHNOLOGY, vol. 28, no. 2, 2010, pages 157 - 159, XP055308991, DOI: 10.1038/nbt.1601
ZHAO ET AL., J. IMMUNOL., vol. 174, 2005, pages 4415
ZHOU, P.YANG, X.L.WANG, X.G.HU, B.ZHANG, L.ZHANG, W.SI, H.R.ZHU, Y.LI, B.HUANG, C.L. ET AL.: "A pneumonia outbreak associated with a new coronavirus of probable bat origin", NATURE, 2020
ZHOU, T.TSYBOVSKY, Y.OLIA, A.S.GORMAN, J.RAPP, M.A.CERUTTI, G.KATSAMBA, P.S.NAZZARI, A.SCHON, A.WANG, P.D. ET AL.: "A pH-dependent switch mediates conformational masking of SARS-CoV-2 spike", BIORXIV, 2020
ZIVANOV, J.NAKANE, T.FORSBERG, B.O.KIMANIUS, D.HAGEN, W.J.LINDAHL, E.SCHERES, S.H.: "New tools for automated high-resolution cryo-EM structure determination in RELION-3", ELIFE, vol. 7, 2018
ZIVANOV, J.NAKANE, T.SCHERES, S.H.W.: "A Bayesian approach to beam-induced motion correction in cryo-EM single-particle analysis", IUCRJ, vol. 6, 2019, pages 5 - 17

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11479599B2 (en) 2020-02-26 2022-10-25 Vir Biotechnology, Inc. Antibodies against SARS-CoV-2 and methods of using the same
EP3872091B1 (en) * 2020-02-26 2023-06-14 VIR Biotechnology, Inc. Antibodies against sars-cov-2
EP4245373A3 (en) * 2020-02-26 2023-12-20 VIR Biotechnology, Inc. Antibodies against sars-cov-2
US11981725B2 (en) 2020-07-06 2024-05-14 Flagship Pioneering Innovations Vi, Llc Antigen binding molecules targeting SARS-CoV-2
US12473560B2 (en) 2020-07-06 2025-11-18 Flagship Pioneering Innovations Vi, Llc Antigen binding molecules targeting SARS-CoV-2
US11987616B2 (en) 2020-08-26 2024-05-21 Flagship Pioneering Innovations Vi, Llc Antigen binding molecules targeting SARS-CoV-2
WO2023154402A3 (en) * 2022-02-09 2023-11-09 University Of Maryland, College Park Compositions and methods for fcrn-targeted intranasal coronavirus vaccination
WO2023201256A1 (en) * 2022-04-12 2023-10-19 Vir Biotechnology, Inc. High dose antibody therapies for sars-cov-2 infection
WO2024118998A3 (en) * 2022-12-01 2024-07-11 Vir Biotechnology, Inc. Engineered anti-sars-cov-2 antibodies and methods of using the same

Similar Documents

Publication Publication Date Title
JP7275405B2 (en) Antibodies against SARS-COV-2 and methods of using same
WO2021203053A1 (en) Immunotherapy targeting a conserved region in sars coronaviruses
JP2023523549A (en) Antibodies against SARS-CoV-2 and methods of using same
WO2022204202A1 (en) Antibodies that bind to multiple sarbecoviruses
US20240092876A1 (en) Broadly neutralizing antibodies against influenza neuraminidase
WO2022115486A1 (en) Antibodies that bind to multiple betacoronaviruses
EP4217385A2 (en) Antibodies against sars-cov-2
JP2025522295A (en) Broadly neutralizing antibodies against influenza neuraminidase
EP4562034A1 (en) Broadly neutralizing antibodies against rsv and mpv paramyxoviruses
WO2023230448A1 (en) Combination immunotherapy for influenza
EP4695286A1 (en) Antibodies that bind to multiple sarbecoviruses
HK40059225B (en) Antibodies against sars-cov-2
HK40098455A (en) Antibodies against sars-cov-2
HK40059225A (en) Antibodies against sars-cov-2

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21742564

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 21742564

Country of ref document: EP

Kind code of ref document: A1