WO2021205296A1 - Method of treating covid-19 - Google Patents
Method of treating covid-19 Download PDFInfo
- Publication number
- WO2021205296A1 WO2021205296A1 PCT/IB2021/052738 IB2021052738W WO2021205296A1 WO 2021205296 A1 WO2021205296 A1 WO 2021205296A1 IB 2021052738 W IB2021052738 W IB 2021052738W WO 2021205296 A1 WO2021205296 A1 WO 2021205296A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino
- oxo
- methoxy
- oxopyrrolidin
- leucyl
- Prior art date
Links
- 238000000034 method Methods 0.000 title claims abstract description 119
- 208000025721 COVID-19 Diseases 0.000 title claims abstract description 42
- 150000001875 compounds Chemical class 0.000 claims abstract description 153
- 241001678559 COVID-19 virus Species 0.000 claims abstract description 109
- 230000002401 inhibitory effect Effects 0.000 claims abstract description 27
- 108091005804 Peptidases Proteins 0.000 claims abstract description 25
- 239000004365 Protease Substances 0.000 claims abstract description 23
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 20
- 230000029812 viral genome replication Effects 0.000 claims abstract description 12
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 claims abstract 3
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 claims description 210
- RHDYQUZYHZWTCI-UHFFFAOYSA-N 1-methoxy-4-phenylbenzene Chemical compound C1=CC(OC)=CC=C1C1=CC=CC=C1 RHDYQUZYHZWTCI-UHFFFAOYSA-N 0.000 claims description 196
- 150000003839 salts Chemical class 0.000 claims description 50
- -1 butyl 2,6-difluorobenzoate Chemical compound 0.000 claims description 40
- DKPFZGUDAPQIHT-UHFFFAOYSA-N Butyl acetate Natural products CCCCOC(C)=O DKPFZGUDAPQIHT-UHFFFAOYSA-N 0.000 claims description 27
- FUZZWVXGSFPDMH-UHFFFAOYSA-N hexanoic acid Chemical compound CCCCCC(O)=O FUZZWVXGSFPDMH-UHFFFAOYSA-N 0.000 claims description 27
- 239000003795 chemical substances by application Substances 0.000 claims description 25
- XSIFPSYPOVKYCO-UHFFFAOYSA-N butyl benzoate Chemical compound CCCCOC(=O)C1=CC=CC=C1 XSIFPSYPOVKYCO-UHFFFAOYSA-N 0.000 claims description 20
- 239000003814 drug Substances 0.000 claims description 17
- 229940124597 therapeutic agent Drugs 0.000 claims description 14
- FCDMDSDHBVPGGE-UHFFFAOYSA-N butyl 2,2-dimethylpropanoate Chemical compound CCCCOC(=O)C(C)(C)C FCDMDSDHBVPGGE-UHFFFAOYSA-N 0.000 claims description 13
- GMTKGCXSWVRXLE-UHFFFAOYSA-N butyl 2,6-dimethylbenzoate Chemical compound CCCCOC(=O)C1=C(C)C=CC=C1C GMTKGCXSWVRXLE-UHFFFAOYSA-N 0.000 claims description 13
- PBPVJPWUWLGOEC-UHFFFAOYSA-N butyl 4-chlorobenzoate Chemical compound CCCCOC(=O)C1=CC=C(Cl)C=C1 PBPVJPWUWLGOEC-UHFFFAOYSA-N 0.000 claims description 13
- UZAYASXXWOYGDF-UHFFFAOYSA-N butyl 4-cyano-2-fluorobenzoate Chemical compound CCCCOC(=O)C1=CC=C(C#N)C=C1F UZAYASXXWOYGDF-UHFFFAOYSA-N 0.000 claims description 13
- SRGVIBGHRBGAAS-UHFFFAOYSA-N butyl 4-cyanobenzoate Chemical compound CCCCOC(=O)C1=CC=C(C#N)C=C1 SRGVIBGHRBGAAS-UHFFFAOYSA-N 0.000 claims description 13
- UYGHRCCJWWYXMY-UHFFFAOYSA-N butyl 4-methylbenzoate Chemical compound CCCCOC(=O)C1=CC=C(C)C=C1 UYGHRCCJWWYXMY-UHFFFAOYSA-N 0.000 claims description 13
- RWWYLEGWBNMMLJ-YSOARWBDSA-N remdesivir Chemical compound NC1=NC=NN2C1=CC=C2[C@]1([C@@H]([C@@H]([C@H](O1)CO[P@](=O)(OC1=CC=CC=C1)N[C@H](C(=O)OCC(CC)CC)C)O)O)C#N RWWYLEGWBNMMLJ-YSOARWBDSA-N 0.000 claims description 13
- RWWYLEGWBNMMLJ-MEUHYHILSA-N remdesivir Drugs C([C@@H]1[C@H]([C@@H](O)[C@@](C#N)(O1)C=1N2N=CN=C(N)C2=CC=1)O)OP(=O)(N[C@@H](C)C(=O)OCC(CC)CC)OC1=CC=CC=C1 RWWYLEGWBNMMLJ-MEUHYHILSA-N 0.000 claims description 13
- IGBOUVRNGYKPRI-UHFFFAOYSA-N butyl 2,6-dichlorobenzoate Chemical compound CCCCOC(=O)C1=C(Cl)C=CC=C1Cl IGBOUVRNGYKPRI-UHFFFAOYSA-N 0.000 claims description 12
- ISLAUYQUOGCEOU-UHFFFAOYSA-N butyl 2,6-dimethoxybenzoate Chemical compound CCCCOC(=O)C1=C(OC)C=CC=C1OC ISLAUYQUOGCEOU-UHFFFAOYSA-N 0.000 claims description 12
- DXKMHDQQRQRYCI-UHFFFAOYSA-N butyl 4-methoxybenzoate Chemical compound CCCCOC(=O)C1=CC=C(OC)C=C1 DXKMHDQQRQRYCI-UHFFFAOYSA-N 0.000 claims description 12
- VZOMVSGTGYTJQQ-UHFFFAOYSA-N butyl 2-cyanobenzoate Chemical compound CCCCOC(=O)C1=CC=CC=C1C#N VZOMVSGTGYTJQQ-UHFFFAOYSA-N 0.000 claims description 11
- 229960003957 dexamethasone Drugs 0.000 claims description 10
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 claims description 10
- ZKGLXPKJEGYMNT-UHFFFAOYSA-N butyl 4-fluorobenzoate Chemical compound CCCCOC(=O)C1=CC=C(F)C=C1 ZKGLXPKJEGYMNT-UHFFFAOYSA-N 0.000 claims description 9
- WESLSUXBZGCBOK-UHFFFAOYSA-N butyl 4-chloro-2-hydroxybenzoate Chemical compound CCCCOC(=O)C1=CC=C(Cl)C=C1O WESLSUXBZGCBOK-UHFFFAOYSA-N 0.000 claims description 8
- ZCGNOVWYSGBHAU-UHFFFAOYSA-N favipiravir Chemical compound NC(=O)C1=NC(F)=CNC1=O ZCGNOVWYSGBHAU-UHFFFAOYSA-N 0.000 claims description 8
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 claims description 8
- 229940052143 bamlanivimab Drugs 0.000 claims description 7
- 229950000971 baricitinib Drugs 0.000 claims description 7
- XUZMWHLSFXCVMG-UHFFFAOYSA-N baricitinib Chemical compound C1N(S(=O)(=O)CC)CC1(CC#N)N1N=CC(C=2C=3C=CNC=3N=CN=2)=C1 XUZMWHLSFXCVMG-UHFFFAOYSA-N 0.000 claims description 7
- HTNPEHXGEKVIHG-QCNRFFRDSA-N molnupiravir Chemical compound C(OC(=O)C(C)C)[C@H]1O[C@H]([C@@H]([C@@H]1O)O)N1C(=O)N=C(NO)C=C1 HTNPEHXGEKVIHG-QCNRFFRDSA-N 0.000 claims description 7
- KXMZDGSRSGHMMK-VWLOTQADSA-N 1-(6,7-dihydro-5h-benzo[2,3]cyclohepta[2,4-d]pyridazin-3-yl)-3-n-[(7s)-7-pyrrolidin-1-yl-6,7,8,9-tetrahydro-5h-benzo[7]annulen-3-yl]-1,2,4-triazole-3,5-diamine Chemical compound N1([C@H]2CCC3=CC=C(C=C3CC2)NC=2N=C(N(N=2)C=2N=NC=3C4=CC=CC=C4CCCC=3C=2)N)CCCC1 KXMZDGSRSGHMMK-VWLOTQADSA-N 0.000 claims description 5
- 229950009568 bemcentinib Drugs 0.000 claims description 5
- XUFQPHANEAPEMJ-UHFFFAOYSA-N famotidine Chemical compound NC(N)=NC1=NC(CSCCC(N)=NS(N)(=O)=O)=CS1 XUFQPHANEAPEMJ-UHFFFAOYSA-N 0.000 claims description 5
- 229960001596 famotidine Drugs 0.000 claims description 5
- AMFDITJFBUXZQN-KUBHLMPHSA-N (2s,3s,4r,5r)-2-(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)-5-(hydroxymethyl)pyrrolidine-3,4-diol Chemical compound C=1NC=2C(N)=NC=NC=2C=1[C@@H]1N[C@H](CO)[C@@H](O)[C@H]1O AMFDITJFBUXZQN-KUBHLMPHSA-N 0.000 claims description 4
- XCNBGWKQXRQKSA-UHFFFAOYSA-N 2-(2-chloro-4-iodoanilino)-3,4-difluorobenzoic acid Chemical compound OC(=O)C1=CC=C(F)C(F)=C1NC1=CC=C(I)C=C1Cl XCNBGWKQXRQKSA-UHFFFAOYSA-N 0.000 claims description 4
- YZQLWPMZQVHJED-UHFFFAOYSA-N 2-methylpropanethioic acid S-[2-[[[1-(2-ethylbutyl)cyclohexyl]-oxomethyl]amino]phenyl] ester Chemical compound C=1C=CC=C(SC(=O)C(C)C)C=1NC(=O)C1(CC(CC)CC)CCCCC1 YZQLWPMZQVHJED-UHFFFAOYSA-N 0.000 claims description 4
- KKYABQBFGDZVNQ-UHFFFAOYSA-N 6-[5-[(cyclopropylamino)-oxomethyl]-3-fluoro-2-methylphenyl]-N-(2,2-dimethylpropyl)-3-pyridinecarboxamide Chemical compound CC1=C(F)C=C(C(=O)NC2CC2)C=C1C1=CC=C(C(=O)NCC(C)(C)C)C=N1 KKYABQBFGDZVNQ-UHFFFAOYSA-N 0.000 claims description 4
- OZOGDCZJYVSUBR-UHFFFAOYSA-N 8-chloro-n-[4-(trifluoromethoxy)phenyl]quinolin-2-amine Chemical compound C1=CC(OC(F)(F)F)=CC=C1NC1=CC=C(C=CC=C2Cl)C2=N1 OZOGDCZJYVSUBR-UHFFFAOYSA-N 0.000 claims description 4
- 229940125678 AZD7442 Drugs 0.000 claims description 4
- QNZCBYKSOIHPEH-UHFFFAOYSA-N Apixaban Chemical compound C1=CC(OC)=CC=C1N1C(C(=O)N(CC2)C=3C=CC(=CC=3)N3C(CCCC3)=O)=C2C(C(N)=O)=N1 QNZCBYKSOIHPEH-UHFFFAOYSA-N 0.000 claims description 4
- JVHXJTBJCFBINQ-ADAARDCZSA-N Dapagliflozin Chemical compound C1=CC(OCC)=CC=C1CC1=CC([C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)=CC=C1Cl JVHXJTBJCFBINQ-ADAARDCZSA-N 0.000 claims description 4
- 102000004878 Gelsolin Human genes 0.000 claims description 4
- 108090001064 Gelsolin Proteins 0.000 claims description 4
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 claims description 4
- XYQHCMDVGIJOTA-UHFFFAOYSA-N N-(4-amino-3,4-dioxo-1-phenylbutan-2-yl)-4-(2-fluorophenyl)-2-methyl-1,3-oxazole-5-carboxamide Chemical compound NC(C(C(CC1=CC=CC=C1)NC(=O)C1=C(N=C(O1)C)C1=C(C=CC=C1)F)=O)=O XYQHCMDVGIJOTA-UHFFFAOYSA-N 0.000 claims description 4
- 229940125677 REGEN-COV Drugs 0.000 claims description 4
- 108700027322 VIP-ELP fusion molecule PB1046 Proteins 0.000 claims description 4
- UOFYSRZSLXWIQB-UHFFFAOYSA-N abivertinib Chemical compound C1CN(C)CCN1C(C(=C1)F)=CC=C1NC1=NC(OC=2C=C(NC(=O)C=C)C=CC=2)=C(C=CN2)C2=N1 UOFYSRZSLXWIQB-UHFFFAOYSA-N 0.000 claims description 4
- 229940121401 abivertinib Drugs 0.000 claims description 4
- WDENQIQQYWYTPO-IBGZPJMESA-N acalabrutinib Chemical compound CC#CC(=O)N1CCC[C@H]1C1=NC(C=2C=CC(=CC=2)C(=O)NC=2N=CC=CC=2)=C2N1C=CN=C2N WDENQIQQYWYTPO-IBGZPJMESA-N 0.000 claims description 4
- 229950009821 acalabrutinib Drugs 0.000 claims description 4
- 229940119059 actemra Drugs 0.000 claims description 4
- 229960002964 adalimumab Drugs 0.000 claims description 4
- 229960003886 apixaban Drugs 0.000 claims description 4
- LHHCSNFAOIFYRV-DOVBMPENSA-N boceprevir Chemical compound O=C([C@@H]1[C@@H]2[C@@H](C2(C)C)CN1C(=O)[C@@H](NC(=O)NC(C)(C)C)C(C)(C)C)NC(C(=O)C(N)=O)CC1CCC1 LHHCSNFAOIFYRV-DOVBMPENSA-N 0.000 claims description 4
- 229960000517 boceprevir Drugs 0.000 claims description 4
- XASIMHXSUQUHLV-UHFFFAOYSA-N camostat Chemical compound C1=CC(CC(=O)OCC(=O)N(C)C)=CC=C1OC(=O)C1=CC=C(N=C(N)N)C=C1 XASIMHXSUQUHLV-UHFFFAOYSA-N 0.000 claims description 4
- 229960000772 camostat Drugs 0.000 claims description 4
- 229960001838 canakinumab Drugs 0.000 claims description 4
- 229960005338 clevudine Drugs 0.000 claims description 4
- GBBJCSTXCAQSSJ-XQXXSGGOSA-N clevudine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1[C@H](F)[C@@H](O)[C@H](CO)O1 GBBJCSTXCAQSSJ-XQXXSGGOSA-N 0.000 claims description 4
- 229950004181 dalcetrapib Drugs 0.000 claims description 4
- 229960003834 dapagliflozin Drugs 0.000 claims description 4
- XNYZHCFCZNMTFY-UHFFFAOYSA-N diminazene Chemical compound C1=CC(C(=N)N)=CC=C1N\N=N\C1=CC=C(C(N)=N)C=C1 XNYZHCFCZNMTFY-UHFFFAOYSA-N 0.000 claims description 4
- 229950007095 diminazene Drugs 0.000 claims description 4
- XUZICJHIIJCKQQ-ZDUSSCGKSA-N eclitasertib Chemical compound C(C1=CC=CC=C1)C=1NC(=NN=1)C(=O)N[C@@H]1C(N(C2=C(OC1)C=CC=N2)C)=O XUZICJHIIJCKQQ-ZDUSSCGKSA-N 0.000 claims description 4
- 229950008454 favipiravir Drugs 0.000 claims description 4
- 229950002031 galidesivir Drugs 0.000 claims description 4
- 229950009614 gimsilumab Drugs 0.000 claims description 4
- 229960002897 heparin Drugs 0.000 claims description 4
- 229920000669 heparin Polymers 0.000 claims description 4
- 229960000890 hydrocortisone Drugs 0.000 claims description 4
- 229960000598 infliximab Drugs 0.000 claims description 4
- 229950005287 lanadelumab Drugs 0.000 claims description 4
- 229950007439 lenzilumab Drugs 0.000 claims description 4
- 229940121292 leronlimab Drugs 0.000 claims description 4
- 229950003265 losmapimod Drugs 0.000 claims description 4
- GAJWNIKZLYZYSY-OKUPSQOASA-N methanesulfonic acid;n-[(e)-(3-methylphenyl)methylideneamino]-6-morpholin-4-yl-2-(2-pyridin-2-ylethoxy)pyrimidin-4-amine Chemical compound CS(O)(=O)=O.CS(O)(=O)=O.CC1=CC=CC(\C=N\NC=2N=C(OCCC=3N=CC=CC=3)N=C(C=2)N2CCOCC2)=C1 GAJWNIKZLYZYSY-OKUPSQOASA-N 0.000 claims description 4
- RHJLQMVZXQKJKB-FPHSVDBKSA-N n-[(2s)-1-[[(e,3s)-1-(benzenesulfonyl)-5-phenylpent-1-en-3-yl]amino]-1-oxo-3-phenylpropan-2-yl]-4-methylpiperazine-1-carboxamide Chemical compound C1CN(C)CCN1C(=O)N[C@H](C(=O)N[C@@H](CCC=1C=CC=CC=1)\C=C\S(=O)(=O)C=1C=CC=CC=1)CC1=CC=CC=C1 RHJLQMVZXQKJKB-FPHSVDBKSA-N 0.000 claims description 4
- RJMUSRYZPJIFPJ-UHFFFAOYSA-N niclosamide Chemical compound OC1=CC=C(Cl)C=C1C(=O)NC1=CC=C([N+]([O-])=O)C=C1Cl RJMUSRYZPJIFPJ-UHFFFAOYSA-N 0.000 claims description 4
- 229960001920 niclosamide Drugs 0.000 claims description 4
- 229940121480 otilimab Drugs 0.000 claims description 4
- 229950007085 ravulizumab Drugs 0.000 claims description 4
- 229940051283 regdanvimab Drugs 0.000 claims description 4
- 229950006348 sarilumab Drugs 0.000 claims description 4
- 229960003989 tocilizumab Drugs 0.000 claims description 4
- 241000711573 Coronaviridae Species 0.000 abstract description 32
- 230000000694 effects Effects 0.000 abstract description 21
- 239000000137 peptide hydrolase inhibitor Substances 0.000 abstract description 12
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 abstract description 8
- 239000000203 mixture Substances 0.000 abstract description 8
- 229940126247 SARS-CoV-2 inhibitor Drugs 0.000 abstract description 7
- 201000003176 Severe Acute Respiratory Syndrome Diseases 0.000 description 41
- 210000004027 cell Anatomy 0.000 description 40
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 39
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 39
- 239000003112 inhibitor Substances 0.000 description 30
- 102000035195 Peptidases Human genes 0.000 description 22
- 238000002360 preparation method Methods 0.000 description 20
- 229940002612 prodrug Drugs 0.000 description 20
- 239000000651 prodrug Substances 0.000 description 20
- 235000019419 proteases Nutrition 0.000 description 19
- 238000005160 1H NMR spectroscopy Methods 0.000 description 16
- 238000003556 assay Methods 0.000 description 16
- 239000000463 material Substances 0.000 description 16
- 239000000758 substrate Substances 0.000 description 16
- 238000003820 Medium-pressure liquid chromatography Methods 0.000 description 15
- 239000003446 ligand Substances 0.000 description 14
- 241000315672 SARS coronavirus Species 0.000 description 13
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 13
- 108090000765 processed proteins & peptides Proteins 0.000 description 13
- 239000007787 solid Substances 0.000 description 13
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 12
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 11
- 230000005764 inhibitory process Effects 0.000 description 11
- VMGAPWLDMVPYIA-HIDZBRGKSA-N n'-amino-n-iminomethanimidamide Chemical compound N\N=C\N=N VMGAPWLDMVPYIA-HIDZBRGKSA-N 0.000 description 11
- BOLDJAUMGUJJKM-LSDHHAIUSA-N renifolin D Natural products CC(=C)[C@@H]1Cc2c(O)c(O)ccc2[C@H]1CC(=O)c3ccc(O)cc3O BOLDJAUMGUJJKM-LSDHHAIUSA-N 0.000 description 11
- 239000000243 solution Substances 0.000 description 11
- QDIMHKWNHMVDJB-WBAXXEDZSA-N PF-00835231 Chemical compound C([C@H](NC(=O)[C@H](CC(C)C)NC(=O)C=1NC=2C=CC=C(C=2C=1)OC)C(=O)CO)[C@@H]1CCNC1=O QDIMHKWNHMVDJB-WBAXXEDZSA-N 0.000 description 10
- 239000002253 acid Substances 0.000 description 10
- 230000010076 replication Effects 0.000 description 10
- 231100000135 cytotoxicity Toxicity 0.000 description 9
- 230000003013 cytotoxicity Effects 0.000 description 9
- 201000010099 disease Diseases 0.000 description 9
- 238000003032 molecular docking Methods 0.000 description 9
- PGSADBUBUOPOJS-UHFFFAOYSA-N neutral red Chemical compound Cl.C1=C(C)C(N)=CC2=NC3=CC(N(C)C)=CC=C3N=C21 PGSADBUBUOPOJS-UHFFFAOYSA-N 0.000 description 9
- 239000012453 solvate Substances 0.000 description 9
- 101800000504 3C-like protease Proteins 0.000 description 8
- 102000002004 Cytochrome P-450 Enzyme System Human genes 0.000 description 8
- 108010015742 Cytochrome P-450 Enzyme System Proteins 0.000 description 8
- 241000124008 Mammalia Species 0.000 description 8
- 125000004429 atom Chemical group 0.000 description 8
- 239000012043 crude product Substances 0.000 description 8
- 231100000676 disease causative agent Toxicity 0.000 description 8
- 208000015181 infectious disease Diseases 0.000 description 8
- 230000002829 reductive effect Effects 0.000 description 8
- 229940125673 3C-like protease inhibitor Drugs 0.000 description 7
- 101800000535 3C-like proteinase Proteins 0.000 description 7
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 7
- 101800001016 Picornain 3C-like protease Proteins 0.000 description 7
- 101800000596 Probable picornain 3C-like protease Proteins 0.000 description 7
- 235000001014 amino acid Nutrition 0.000 description 7
- 229940024606 amino acid Drugs 0.000 description 7
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 7
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 7
- 208000024891 symptom Diseases 0.000 description 7
- 101800002396 3C-like proteinase nsp5 Proteins 0.000 description 6
- 102100033350 ATP-dependent translocase ABCB1 Human genes 0.000 description 6
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical group N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 6
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 6
- 102000004190 Enzymes Human genes 0.000 description 6
- 108090000790 Enzymes Proteins 0.000 description 6
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 6
- 108010047230 Member 1 Subfamily B ATP Binding Cassette Transporter Proteins 0.000 description 6
- 108091005532 SARS-CoV-2 main proteases Proteins 0.000 description 6
- 241000700605 Viruses Species 0.000 description 6
- 238000006243 chemical reaction Methods 0.000 description 6
- 239000013078 crystal Substances 0.000 description 6
- 230000007423 decrease Effects 0.000 description 6
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 241000494545 Cordyline virus 2 Species 0.000 description 5
- 108010081668 Cytochrome P-450 CYP3A Proteins 0.000 description 5
- 102100039205 Cytochrome P450 3A4 Human genes 0.000 description 5
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 5
- 241000283891 Kobus Species 0.000 description 5
- 150000001413 amino acids Chemical class 0.000 description 5
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical group [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 5
- 238000003776 cleavage reaction Methods 0.000 description 5
- 230000003834 intracellular effect Effects 0.000 description 5
- 238000001990 intravenous administration Methods 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 229910052760 oxygen Inorganic materials 0.000 description 5
- 239000001301 oxygen Chemical group 0.000 description 5
- 108090000623 proteins and genes Proteins 0.000 description 5
- 102000005962 receptors Human genes 0.000 description 5
- 108020003175 receptors Proteins 0.000 description 5
- 230000009467 reduction Effects 0.000 description 5
- 230000007017 scission Effects 0.000 description 5
- 239000002904 solvent Substances 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- 125000000391 vinyl group Chemical group [H]C([*])=C([H])[H] 0.000 description 5
- 230000003612 virological effect Effects 0.000 description 5
- DOUMFZQKYFQNTF-WUTVXBCWSA-N (R)-rosmarinic acid Chemical compound C([C@H](C(=O)O)OC(=O)\C=C\C=1C=C(O)C(O)=CC=1)C1=CC=C(O)C(O)=C1 DOUMFZQKYFQNTF-WUTVXBCWSA-N 0.000 description 4
- IZKCVKAIVRRHDC-UHFFFAOYSA-N 1H,1'H,1''H-[3,2';2',3'']Terindol-3'-on Natural products C1=CC=C2C(C3(C=4C5=CC=CC=C5NC=4)NC4=CC=CC=C4C3=O)=CNC2=C1 IZKCVKAIVRRHDC-UHFFFAOYSA-N 0.000 description 4
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 4
- 102000014150 Interferons Human genes 0.000 description 4
- 108010050904 Interferons Proteins 0.000 description 4
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 4
- 229940049937 Pgp inhibitor Drugs 0.000 description 4
- 108010055591 SARS coronavirus 3C-like protease Proteins 0.000 description 4
- WYURNTSHIVDZCO-UHFFFAOYSA-N Tetrahydrofuran Chemical compound C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 4
- 150000001412 amines Chemical class 0.000 description 4
- 125000000539 amino acid group Chemical group 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 230000000840 anti-viral effect Effects 0.000 description 4
- 229960004099 azithromycin Drugs 0.000 description 4
- MQTOSJVFKKJCRP-BICOPXKESA-N azithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)N(C)C[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 MQTOSJVFKKJCRP-BICOPXKESA-N 0.000 description 4
- 230000003197 catalytic effect Effects 0.000 description 4
- 238000003570 cell viability assay Methods 0.000 description 4
- XJHCXCQVJFPJIK-UHFFFAOYSA-M cesium fluoride Substances [F-].[Cs+] XJHCXCQVJFPJIK-UHFFFAOYSA-M 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 208000035475 disorder Diseases 0.000 description 4
- 239000002748 glycoprotein P inhibitor Substances 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 229940079322 interferon Drugs 0.000 description 4
- 239000002207 metabolite Substances 0.000 description 4
- ARGKVCXINMKCAZ-UHFFFAOYSA-N neohesperidine Natural products C1=C(O)C(OC)=CC=C1C1OC2=CC(OC3C(C(O)C(O)C(CO)O3)OC3C(C(O)C(O)C(C)O3)O)=CC(O)=C2C(=O)C1 ARGKVCXINMKCAZ-UHFFFAOYSA-N 0.000 description 4
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 4
- 239000001100 (2S)-5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)chroman-4-one Substances 0.000 description 3
- MBIZFBDREVRUHY-UHFFFAOYSA-N 2,6-Dimethoxybenzoic acid Chemical compound COC1=CC=CC(OC)=C1C(O)=O MBIZFBDREVRUHY-UHFFFAOYSA-N 0.000 description 3
- ZEYHEAKUIGZSGI-UHFFFAOYSA-N 4-methoxybenzoic acid Chemical compound COC1=CC=C(C(O)=O)C=C1 ZEYHEAKUIGZSGI-UHFFFAOYSA-N 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 3
- 108090000975 Angiotensin-converting enzyme 2 Proteins 0.000 description 3
- 102000053723 Angiotensin-converting enzyme 2 Human genes 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 3
- 206010035664 Pneumonia Diseases 0.000 description 3
- OFOBLEOULBTSOW-UHFFFAOYSA-N Propanedioic acid Natural products OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 108010029485 Protein Isoforms Proteins 0.000 description 3
- 102000001708 Protein Isoforms Human genes 0.000 description 3
- AUNGANRZJHBGPY-SCRDCRAPSA-N Riboflavin Chemical compound OC[C@@H](O)[C@@H](O)[C@@H](O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-SCRDCRAPSA-N 0.000 description 3
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- 239000000969 carrier Substances 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 230000034994 death Effects 0.000 description 3
- 231100000517 death Toxicity 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- VUYDGVRIQRPHFX-UHFFFAOYSA-N hesperidin Natural products COc1cc(ccc1O)C2CC(=O)c3c(O)cc(OC4OC(COC5OC(O)C(O)C(O)C5O)C(O)C(O)C4O)cc3O2 VUYDGVRIQRPHFX-UHFFFAOYSA-N 0.000 description 3
- 239000001257 hydrogen Substances 0.000 description 3
- 229910052739 hydrogen Inorganic materials 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 229910052757 nitrogen Inorganic materials 0.000 description 3
- 229920001184 polypeptide Polymers 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 230000002797 proteolythic effect Effects 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 239000006188 syrup Substances 0.000 description 3
- 235000020357 syrup Nutrition 0.000 description 3
- YLQBMQCUIZJEEH-UHFFFAOYSA-N tetrahydrofuran Natural products C=1C=COC=1 YLQBMQCUIZJEEH-UHFFFAOYSA-N 0.000 description 3
- 231100001274 therapeutic index Toxicity 0.000 description 3
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 3
- 210000003501 vero cell Anatomy 0.000 description 3
- GBLRQXKSCRCLBZ-AJSYEDJNSA-N (1S,2R,1'S,2'R)-doxacurium Chemical compound COC1=C(OC)C(OC)=CC(C[C@@H]2[N@@+](CCC3=C2C(=C(OC)C(OC)=C3)OC)(C)CCCOC(=O)CCC(=O)OCCC[N@+]2(C)[C@H](C3=C(OC)C(OC)=C(OC)C=C3CC2)CC=2C=C(OC)C(OC)=C(OC)C=2)=C1 GBLRQXKSCRCLBZ-AJSYEDJNSA-N 0.000 description 2
- MHAVMNJPXLZEIG-CNRMHUMKSA-N (1r,3as,5ar,5br,7ar,11ar,11br,13ar,13br)-5a,5b,8,8,11a-pentamethyl-9-oxo-1-prop-1-en-2-yl-2,3,4,5,6,7,7a,10,11,11b,12,13,13a,13b-tetradecahydro-1h-cyclopenta[a]chrysene-3a-carbaldehyde Chemical compound C1CC(=O)C(C)(C)[C@@H]2CC[C@@]3(C)[C@]4(C)CC[C@@]5(C=O)CC[C@@H](C(=C)C)[C@@H]5[C@H]4CC[C@@H]3[C@]21C MHAVMNJPXLZEIG-CNRMHUMKSA-N 0.000 description 2
- VUEPOIYXKZTLMD-ANZZXSATSA-N (3e,4s)-3-[2-[(1r,4as,5r,6r,8as)-6-hydroxy-5,8a-dimethyl-2-methylidene-5-[[(2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxymethyl]-3,4,4a,6,7,8-hexahydro-1h-naphthalen-1-yl]ethylidene]-4-hydroxyoxolan-2-one Chemical compound C([C@@]1(C)[C@H]2CCC(=C)[C@@H](C\C=C/3C(OC[C@H]\3O)=O)[C@]2(C)CC[C@H]1O)O[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O VUEPOIYXKZTLMD-ANZZXSATSA-N 0.000 description 2
- WHTVZRBIWZFKQO-AWEZNQCLSA-N (S)-chloroquine Chemical compound ClC1=CC=C2C(N[C@@H](C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-AWEZNQCLSA-N 0.000 description 2
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 2
- HCBHQDKBSKYGCK-UHFFFAOYSA-N 2,6-dimethylbenzoic acid Chemical compound CC1=CC=CC(C)=C1C(O)=O HCBHQDKBSKYGCK-UHFFFAOYSA-N 0.000 description 2
- XNMLTBUWDJZKPW-UHFFFAOYSA-N 2-(4-hydroxy-3-methoxyphenyl)-4-[(4-hydroxy-3-methoxyphenyl)methyl]-3-(hydroxymethyl)oxolan-3-ol Chemical compound C1=C(O)C(OC)=CC(CC2C(C(C=3C=C(OC)C(O)=CC=3)OC2)(O)CO)=C1 XNMLTBUWDJZKPW-UHFFFAOYSA-N 0.000 description 2
- KWPHXPQQMKLBAA-ZRRGBYNUSA-N 2-[(1R,5R,6R,8aS)-6-hydroxy-5-(hydroxymethyl)-5,8a-dimethyl-2-methylidene-3,4,4a,6,7,8-hexahydro-1H-naphthalen-1-yl]ethyl benzoate Chemical compound C(C1=CC=CC=C1)(=O)OCC[C@@H]1C(CCC2[C@]([C@@H](CC[C@@]12C)O)(C)CO)=C KWPHXPQQMKLBAA-ZRRGBYNUSA-N 0.000 description 2
- IZHVBANLECCAGF-UHFFFAOYSA-N 2-hydroxy-3-(octadecanoyloxy)propyl octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)COC(=O)CCCCCCCCCCCCCCCCC IZHVBANLECCAGF-UHFFFAOYSA-N 0.000 description 2
- 108010091324 3C proteases Proteins 0.000 description 2
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 2
- 208000030507 AIDS Diseases 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 2
- WKKBRRFSRMDTJB-UHFFFAOYSA-N Andrograpanin Chemical compound C=C1CCC2C(C)(CO)CCCC2(C)C1CCC1=CCOC1=O WKKBRRFSRMDTJB-UHFFFAOYSA-N 0.000 description 2
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 2
- 239000005711 Benzoic acid Substances 0.000 description 2
- QAGYKUNXZHXKMR-UHFFFAOYSA-N CPD000469186 Natural products CC1=C(O)C=CC=C1C(=O)NC(C(O)CN1C(CC2CCCCC2C1)C(=O)NC(C)(C)C)CSC1=CC=CC=C1 QAGYKUNXZHXKMR-UHFFFAOYSA-N 0.000 description 2
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 2
- 102000053642 Catalytic RNA Human genes 0.000 description 2
- 108090000994 Catalytic RNA Proteins 0.000 description 2
- GHXZTYHSJHQHIJ-UHFFFAOYSA-N Chlorhexidine Chemical compound C=1C=C(Cl)C=CC=1NC(N)=NC(N)=NCCCCCCN=C(N)N=C(N)NC1=CC=C(Cl)C=C1 GHXZTYHSJHQHIJ-UHFFFAOYSA-N 0.000 description 2
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 2
- 102000004961 Furin Human genes 0.000 description 2
- 108090001126 Furin Proteins 0.000 description 2
- IAJILQKETJEXLJ-UHFFFAOYSA-N Galacturonsaeure Natural products O=CC(O)C(O)C(O)C(O)C(O)=O IAJILQKETJEXLJ-UHFFFAOYSA-N 0.000 description 2
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Chemical compound OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 2
- BRYKYSQCLNCYQW-UHFFFAOYSA-N Gnidicin Natural products COC(=O)C(CC(O)=O)=CC(O)=O BRYKYSQCLNCYQW-UHFFFAOYSA-N 0.000 description 2
- QUQPHWDTPGMPEX-UHFFFAOYSA-N Hesperidine Natural products C1=C(O)C(OC)=CC=C1C1OC2=CC(OC3C(C(O)C(O)C(COC4C(C(O)C(O)C(C)O4)O)O3)O)=CC(O)=C2C(=O)C1 QUQPHWDTPGMPEX-UHFFFAOYSA-N 0.000 description 2
- 101000929928 Homo sapiens Angiotensin-converting enzyme 2 Proteins 0.000 description 2
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- FDQAOULAVFHKBX-UHFFFAOYSA-N Isosilybin A Natural products C1=C(O)C(OC)=CC(C2C(OC3=CC(=CC=C3O2)C2C(C(=O)C3=C(O)C=C(O)C=C3O2)O)CO)=C1 FDQAOULAVFHKBX-UHFFFAOYSA-N 0.000 description 2
- IPMYMEWFZKHGAX-UHFFFAOYSA-N Isotheaflavin Natural products OC1CC2=C(O)C=C(O)C=C2OC1C(C1=C2)=CC(O)=C(O)C1=C(O)C(=O)C=C2C1C(O)CC2=C(O)C=C(O)C=C2O1 IPMYMEWFZKHGAX-UHFFFAOYSA-N 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- 241000127282 Middle East respiratory syndrome-related coronavirus Species 0.000 description 2
- YNAVUWVOSKDBBP-UHFFFAOYSA-N Morpholine Chemical compound C1COCCN1 YNAVUWVOSKDBBP-UHFFFAOYSA-N 0.000 description 2
- SEBFKMXJBCUCAI-UHFFFAOYSA-N NSC 227190 Natural products C1=C(O)C(OC)=CC(C2C(OC3=CC=C(C=C3O2)C2C(C(=O)C3=C(O)C=C(O)C=C3O2)O)CO)=C1 SEBFKMXJBCUCAI-UHFFFAOYSA-N 0.000 description 2
- ZBBHBTPTTSWHBA-UHFFFAOYSA-N Nicardipine Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OCCN(C)CC=2C=CC=CC=2)C1C1=CC=CC([N+]([O-])=O)=C1 ZBBHBTPTTSWHBA-UHFFFAOYSA-N 0.000 description 2
- IPQKDIRUZHOIOM-UHFFFAOYSA-N Oroxin A Natural products OC1C(O)C(O)C(CO)OC1OC(C(=C1O)O)=CC2=C1C(=O)C=C(C=1C=CC=CC=1)O2 IPQKDIRUZHOIOM-UHFFFAOYSA-N 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 241000709664 Picornaviridae Species 0.000 description 2
- GLUUGHFHXGJENI-UHFFFAOYSA-N Piperazine Chemical compound C1CNCCN1 GLUUGHFHXGJENI-UHFFFAOYSA-N 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- 108010076039 Polyproteins Proteins 0.000 description 2
- 206010037660 Pyrexia Diseases 0.000 description 2
- LCTONWCANYUPML-UHFFFAOYSA-N Pyruvic acid Chemical compound CC(=O)C(O)=O LCTONWCANYUPML-UHFFFAOYSA-N 0.000 description 2
- IWUCXVSUMQZMFG-AFCXAGJDSA-N Ribavirin Chemical compound N1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 IWUCXVSUMQZMFG-AFCXAGJDSA-N 0.000 description 2
- NCDNCNXCDXHOMX-UHFFFAOYSA-N Ritonavir Natural products C=1C=CC=CC=1CC(NC(=O)OCC=1SC=NC=1)C(O)CC(CC=1C=CC=CC=1)NC(=O)C(C(C)C)NC(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-UHFFFAOYSA-N 0.000 description 2
- ZZAFFYPNLYCDEP-HNNXBMFYSA-N Rosmarinsaeure Natural products OC(=O)[C@H](Cc1cccc(O)c1O)OC(=O)C=Cc2ccc(O)c(O)c2 ZZAFFYPNLYCDEP-HNNXBMFYSA-N 0.000 description 2
- VLGROHBNWZUINI-UHFFFAOYSA-N Silybin Natural products COc1cc(ccc1O)C2OC3C=C(C=CC3OC2CO)C4Oc5cc(O)cc(O)c5C(=O)C4O VLGROHBNWZUINI-UHFFFAOYSA-N 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- UXRMWRBWCAGDQB-UHFFFAOYSA-N Theaflavin Natural products C1=CC(C2C(CC3=C(O)C=C(O)C=C3O2)O)=C(O)C(=O)C2=C1C(C1OC3=CC(O)=CC(O)=C3CC1O)=CC(O)=C2O UXRMWRBWCAGDQB-UHFFFAOYSA-N 0.000 description 2
- OTTFLYUONKAFGT-UHFFFAOYSA-N UNPD66298 Natural products CC(=C)C12OC(O3)(C=4C=CC=CC=4)OC1C1C4OC4(CO)C(O)C(C(C(C)=C4)=O)(O)C4C31C(C)C2OC(=O)C=CC1=CC=CC=C1 OTTFLYUONKAFGT-UHFFFAOYSA-N 0.000 description 2
- WPVFJKSGQUFQAP-GKAPJAKFSA-N Valcyte Chemical compound N1C(N)=NC(=O)C2=C1N(COC(CO)COC(=O)[C@@H](N)C(C)C)C=N2 WPVFJKSGQUFQAP-GKAPJAKFSA-N 0.000 description 2
- 108700022715 Viral Proteases Proteins 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 125000002252 acyl group Chemical group 0.000 description 2
- 125000004423 acyloxy group Chemical group 0.000 description 2
- 125000003275 alpha amino acid group Chemical group 0.000 description 2
- FAONOYVYMFUUOU-UHFFFAOYSA-N andrographiside Natural products CC1(COC2OC(CO)C(O)C(O)C2O)C(O)CCC3(C)C(CC=C4/C(O)OCC4=O)C(=C)CCC13 FAONOYVYMFUUOU-UHFFFAOYSA-N 0.000 description 2
- QUQPHWDTPGMPEX-UTWYECKDSA-N aurantiamarin Natural products COc1ccc(cc1O)[C@H]1CC(=O)c2c(O)cc(O[C@@H]3O[C@H](CO[C@@H]4O[C@@H](C)[C@H](O)[C@@H](O)[C@H]4O)[C@@H](O)[C@H](O)[C@H]3O)cc2O1 QUQPHWDTPGMPEX-UTWYECKDSA-N 0.000 description 2
- IKIIZLYTISPENI-ZFORQUDYSA-N baicalin Chemical compound O1[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1OC(C(=C1O)O)=CC2=C1C(=O)C=C(C=1C=CC=CC=1)O2 IKIIZLYTISPENI-ZFORQUDYSA-N 0.000 description 2
- AQHDANHUMGXSJZ-UHFFFAOYSA-N baicalin Natural products OC1C(O)C(C(O)CO)OC1OC(C(=C1O)O)=CC2=C1C(=O)C=C(C=1C=CC=CC=1)O2 AQHDANHUMGXSJZ-UHFFFAOYSA-N 0.000 description 2
- 229960003321 baicalin Drugs 0.000 description 2
- 235000010233 benzoic acid Nutrition 0.000 description 2
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical compound NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 2
- 230000005540 biological transmission Effects 0.000 description 2
- 102220344502 c.853A>G Human genes 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 150000001732 carboxylic acid derivatives Chemical group 0.000 description 2
- 238000006555 catalytic reaction Methods 0.000 description 2
- 229960003260 chlorhexidine Drugs 0.000 description 2
- 229960003677 chloroquine Drugs 0.000 description 2
- WHTVZRBIWZFKQO-UHFFFAOYSA-N chloroquine Natural products ClC1=CC=C2C(NC(C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-UHFFFAOYSA-N 0.000 description 2
- RTIXKCRFFJGDFG-UHFFFAOYSA-N chrysin Chemical compound C=1C(O)=CC(O)=C(C(C=2)=O)C=1OC=2C1=CC=CC=C1 RTIXKCRFFJGDFG-UHFFFAOYSA-N 0.000 description 2
- APSNPMVGBGZYAJ-GLOOOPAXSA-N clematine Natural products COc1cc(ccc1O)[C@@H]2CC(=O)c3c(O)cc(O[C@@H]4O[C@H](CO[C@H]5O[C@@H](C)[C@H](O)[C@@H](O)[C@H]5O)[C@@H](O)[C@H](O)[C@H]4O)cc3O2 APSNPMVGBGZYAJ-GLOOOPAXSA-N 0.000 description 2
- 238000002591 computed tomography Methods 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 230000000120 cytopathologic effect Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- WHBIGIKBNXZKFE-UHFFFAOYSA-N delavirdine Chemical compound CC(C)NC1=CC=CN=C1N1CCN(C(=O)C=2NC3=CC=C(NS(C)(=O)=O)C=C3C=2)CC1 WHBIGIKBNXZKFE-UHFFFAOYSA-N 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 229960003722 doxycycline Drugs 0.000 description 2
- XQTWDDCIUJNLTR-CVHRZJFOSA-N doxycycline monohydrate Chemical compound O.O=C1C2=C(O)C=CC=C2[C@H](C)[C@@H]2C1=C(O)[C@]1(O)C(=O)C(C(N)=O)=C(O)[C@@H](N(C)C)[C@@H]1[C@H]2O XQTWDDCIUJNLTR-CVHRZJFOSA-N 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- CCIVGXIOQKPBKL-UHFFFAOYSA-M ethanesulfonate Chemical compound CCS([O-])(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-M 0.000 description 2
- 239000006260 foam Substances 0.000 description 2
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 2
- XOXYHGOIRWABTC-UHFFFAOYSA-N gentisin Chemical compound C1=C(O)C=C2C(=O)C3=C(O)C=C(OC)C=C3OC2=C1 XOXYHGOIRWABTC-UHFFFAOYSA-N 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- OTTFLYUONKAFGT-NXHJWBCESA-N gnidicin Chemical compound O([C@@H]1[C@H]([C@]23[C@H]4[C@](C(C(C)=C4)=O)(O)[C@H](O)[C@@]4(CO)O[C@H]4[C@H]3[C@H]3O[C@@](O2)(O[C@]31C(C)=C)C=1C=CC=CC=1)C)C(=O)\C=C\C1=CC=CC=C1 OTTFLYUONKAFGT-NXHJWBCESA-N 0.000 description 2
- OTTFLYUONKAFGT-FAHDJYCPSA-N gnidicin Natural products C[C@@H]1[C@@H](OC(=O)C=Cc2ccccc2)[C@@]3(O[C@]4(O[C@@H]3[C@@H]5[C@@H]6O[C@]6(CO)[C@@H](O)[C@@]7(O)[C@@H](C=C(C)C7=O)[C@@]15O4)c8ccccc8)C(=C)C OTTFLYUONKAFGT-FAHDJYCPSA-N 0.000 description 2
- QUQPHWDTPGMPEX-QJBIFVCTSA-N hesperidin Chemical compound C1=C(O)C(OC)=CC=C1[C@H]1OC2=CC(O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@@H](CO[C@H]4[C@@H]([C@H](O)[C@@H](O)[C@H](C)O4)O)O3)O)=CC(O)=C2C(=O)C1 QUQPHWDTPGMPEX-QJBIFVCTSA-N 0.000 description 2
- 229940025878 hesperidin Drugs 0.000 description 2
- 102000048657 human ACE2 Human genes 0.000 description 2
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 2
- XXSMGPRMXLTPCZ-UHFFFAOYSA-N hydroxychloroquine Chemical compound ClC1=CC=C2C(NC(C)CCCN(CCO)CC)=CC=NC2=C1 XXSMGPRMXLTPCZ-UHFFFAOYSA-N 0.000 description 2
- 229960004171 hydroxychloroquine Drugs 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 238000000099 in vitro assay Methods 0.000 description 2
- 238000005462 in vivo assay Methods 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000002452 interceptive effect Effects 0.000 description 2
- 150000002576 ketones Chemical class 0.000 description 2
- 150000003951 lactams Chemical group 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 108010026228 mRNA guanylyltransferase Proteins 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- VVOAZFWZEDHOOU-UHFFFAOYSA-N magnolol Chemical compound OC1=CC=C(CC=C)C=C1C1=CC(CC=C)=CC=C1O VVOAZFWZEDHOOU-UHFFFAOYSA-N 0.000 description 2
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- 150000007522 mineralic acids Chemical class 0.000 description 2
- 230000000116 mitigating effect Effects 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 239000001788 mono and diglycerides of fatty acids Substances 0.000 description 2
- 229930014626 natural product Natural products 0.000 description 2
- QAGYKUNXZHXKMR-HKWSIXNMSA-N nelfinavir Chemical compound CC1=C(O)C=CC=C1C(=O)N[C@H]([C@H](O)CN1[C@@H](C[C@@H]2CCCC[C@@H]2C1)C(=O)NC(C)(C)C)CSC1=CC=CC=C1 QAGYKUNXZHXKMR-HKWSIXNMSA-N 0.000 description 2
- 229960000884 nelfinavir Drugs 0.000 description 2
- ARGKVCXINMKCAZ-UZRWAPQLSA-N neohesperidin Chemical compound C1=C(O)C(OC)=CC=C1[C@H]1OC2=CC(O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O[C@H]3[C@@H]([C@H](O)[C@@H](O)[C@H](C)O3)O)=CC(O)=C2C(=O)C1 ARGKVCXINMKCAZ-UZRWAPQLSA-N 0.000 description 2
- 229960001783 nicardipine Drugs 0.000 description 2
- 239000012038 nucleophile Substances 0.000 description 2
- 239000002773 nucleotide Substances 0.000 description 2
- 125000003729 nucleotide group Chemical group 0.000 description 2
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- LPNBBFKOUUSUDB-UHFFFAOYSA-N p-toluic acid Chemical group CC1=CC=C(C(O)=O)C=C1 LPNBBFKOUUSUDB-UHFFFAOYSA-N 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- HYAFETHFCAUJAY-UHFFFAOYSA-N pioglitazone Chemical compound N1=CC(CC)=CC=C1CCOC(C=C1)=CC=C1CC1C(=O)NC(=O)S1 HYAFETHFCAUJAY-UHFFFAOYSA-N 0.000 description 2
- 230000036470 plasma concentration Effects 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 235000019833 protease Nutrition 0.000 description 2
- 235000018102 proteins Nutrition 0.000 description 2
- 102000004169 proteins and genes Human genes 0.000 description 2
- 239000000018 receptor agonist Substances 0.000 description 2
- 229940044601 receptor agonist Drugs 0.000 description 2
- 230000000241 respiratory effect Effects 0.000 description 2
- 229960000329 ribavirin Drugs 0.000 description 2
- HZCAHMRRMINHDJ-DBRKOABJSA-N ribavirin Natural products O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1N=CN=C1 HZCAHMRRMINHDJ-DBRKOABJSA-N 0.000 description 2
- 108091092562 ribozyme Proteins 0.000 description 2
- 229960000311 ritonavir Drugs 0.000 description 2
- NCDNCNXCDXHOMX-XGKFQTDJSA-N ritonavir Chemical compound N([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=1C=CC=CC=1)NC(=O)OCC=1SC=NC=1)CC=1C=CC=CC=1)C(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-XGKFQTDJSA-N 0.000 description 2
- DOUMFZQKYFQNTF-MRXNPFEDSA-N rosemarinic acid Natural products C([C@H](C(=O)O)OC(=O)C=CC=1C=C(O)C(O)=CC=1)C1=CC=C(O)C(O)=C1 DOUMFZQKYFQNTF-MRXNPFEDSA-N 0.000 description 2
- TVHVQJFBWRLYOD-UHFFFAOYSA-N rosmarinic acid Natural products OC(=O)C(Cc1ccc(O)c(O)c1)OC(=Cc2ccc(O)c(O)c2)C=O TVHVQJFBWRLYOD-UHFFFAOYSA-N 0.000 description 2
- 102220008240 rs116840789 Human genes 0.000 description 2
- 102220005682 rs121913116 Human genes 0.000 description 2
- YGSDEFSMJLZEOE-UHFFFAOYSA-N salicylic acid Chemical compound OC(=O)C1=CC=CC=C1O YGSDEFSMJLZEOE-UHFFFAOYSA-N 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- BNRNXUUZRGQAQC-UHFFFAOYSA-N sildenafil Chemical compound CCCC1=NN(C)C(C(N2)=O)=C1N=C2C(C(=CC=1)OCC)=CC=1S(=O)(=O)N1CCN(C)CC1 BNRNXUUZRGQAQC-UHFFFAOYSA-N 0.000 description 2
- SEBFKMXJBCUCAI-HKTJVKLFSA-N silibinin Chemical compound C1=C(O)C(OC)=CC([C@@H]2[C@H](OC3=CC=C(C=C3O2)[C@@H]2[C@H](C(=O)C3=C(O)C=C(O)C=C3O2)O)CO)=C1 SEBFKMXJBCUCAI-HKTJVKLFSA-N 0.000 description 2
- 229940043175 silybin Drugs 0.000 description 2
- 235000014899 silybin Nutrition 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- RMMXLENWKUUMAY-UHFFFAOYSA-N telmisartan Chemical compound CCCC1=NC2=C(C)C=C(C=3N(C4=CC=CC=C4N=3)C)C=C2N1CC(C=C1)=CC=C1C1=CC=CC=C1C(O)=O RMMXLENWKUUMAY-UHFFFAOYSA-N 0.000 description 2
- ABZLKHKQJHEPAX-UHFFFAOYSA-N tetramethylrhodamine Chemical compound C=12C=CC(N(C)C)=CC2=[O+]C2=CC(N(C)C)=CC=C2C=1C1=CC=CC=C1C([O-])=O ABZLKHKQJHEPAX-UHFFFAOYSA-N 0.000 description 2
- IPMYMEWFZKHGAX-ZKSIBHASSA-N theaflavin Chemical compound C1=C2C([C@H]3OC4=CC(O)=CC(O)=C4C[C@H]3O)=CC(O)=C(O)C2=C(O)C(=O)C=C1[C@@H]1[C@H](O)CC2=C(O)C=C(O)C=C2O1 IPMYMEWFZKHGAX-ZKSIBHASSA-N 0.000 description 2
- 229940026509 theaflavin Drugs 0.000 description 2
- 235000014620 theaflavin Nutrition 0.000 description 2
- 238000004809 thin layer chromatography Methods 0.000 description 2
- FPZLLRFZJZRHSY-HJYUBDRYSA-N tigecycline Chemical compound C([C@H]1C2)C3=C(N(C)C)C=C(NC(=O)CNC(C)(C)C)C(O)=C3C(=O)C1=C(O)[C@@]1(O)[C@@H]2[C@H](N(C)C)C(O)=C(C(N)=O)C1=O FPZLLRFZJZRHSY-HJYUBDRYSA-N 0.000 description 2
- 229960004089 tigecycline Drugs 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- NQPDZGIKBAWPEJ-UHFFFAOYSA-N valeric acid Chemical class CCCCC(O)=O NQPDZGIKBAWPEJ-UHFFFAOYSA-N 0.000 description 2
- 229960002149 valganciclovir Drugs 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- CEMAWMOMDPGJMB-UHFFFAOYSA-N (+-)-Oxprenolol Chemical compound CC(C)NCC(O)COC1=CC=CC=C1OCC=C CEMAWMOMDPGJMB-UHFFFAOYSA-N 0.000 description 1
- OGNSCSPNOLGXSM-UHFFFAOYSA-N (+/-)-DABA Natural products NCCC(N)C(O)=O OGNSCSPNOLGXSM-UHFFFAOYSA-N 0.000 description 1
- 229930014124 (-)-epigallocatechin gallate Natural products 0.000 description 1
- 235000004911 (-)-epigallocatechin gallate Nutrition 0.000 description 1
- ARXHRTZAVQOQEU-UHFFFAOYSA-N (10R)-3c,5t,6t-Trihydroxy-10r,13c-dimethyl-17c-((1R:4R)-1,4,5-trimethyl-hexen-(2t)-yl)-(9tH,14tH)-Delta7-tetradecahydro-1H-cyclopenta[a]phenanthren Natural products C1C(O)CCC2(C)C(CCC3(C(C(C)C=CC(C)C(C)C)CCC33)C)C3=CC(O)C21O ARXHRTZAVQOQEU-UHFFFAOYSA-N 0.000 description 1
- QBYIENPQHBMVBV-HFEGYEGKSA-N (2R)-2-hydroxy-2-phenylacetic acid Chemical compound O[C@@H](C(O)=O)c1ccccc1.O[C@@H](C(O)=O)c1ccccc1 QBYIENPQHBMVBV-HFEGYEGKSA-N 0.000 description 1
- XMAYWYJOQHXEEK-OZXSUGGESA-N (2R,4S)-ketoconazole Chemical compound C1CN(C(=O)C)CCN1C(C=C1)=CC=C1OC[C@@H]1O[C@@](CN2C=NC=C2)(C=2C(=CC(Cl)=CC=2)Cl)OC1 XMAYWYJOQHXEEK-OZXSUGGESA-N 0.000 description 1
- RUDATBOHQWOJDD-UHFFFAOYSA-N (3beta,5beta,7alpha)-3,7-Dihydroxycholan-24-oic acid Natural products OC1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)CC2 RUDATBOHQWOJDD-UHFFFAOYSA-N 0.000 description 1
- OQANPHBRHBJGNZ-FYJGNVAPSA-N (3e)-6-oxo-3-[[4-(pyridin-2-ylsulfamoyl)phenyl]hydrazinylidene]cyclohexa-1,4-diene-1-carboxylic acid Chemical compound C1=CC(=O)C(C(=O)O)=C\C1=N\NC1=CC=C(S(=O)(=O)NC=2N=CC=CC=2)C=C1 OQANPHBRHBJGNZ-FYJGNVAPSA-N 0.000 description 1
- KZJWDPNRJALLNS-BWRKXDIJSA-N (8s,9s,10r,13r,14s,17r)-17-[(2r,5r)-5-ethyl-6-methylheptan-2-yl]-10,13-dimethyl-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthren-3-ol Chemical compound C1C=C2CC(O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CC[C@@H](CC)C(C)C)[C@@]1(C)CC2 KZJWDPNRJALLNS-BWRKXDIJSA-N 0.000 description 1
- GHOKWGTUZJEAQD-ZETCQYMHSA-N (D)-(+)-Pantothenic acid Chemical compound OCC(C)(C)[C@@H](O)C(=O)NCCC(O)=O GHOKWGTUZJEAQD-ZETCQYMHSA-N 0.000 description 1
- YIIRVUDGRKEWBV-UHFFFAOYSA-N (E)-3-(2-((1R,4aS,5R,6R,8aS)-6-hydroxy-5-(hydroxymethyl)-5,8a-dimethyl-2-methylenedecahydronaphthalen-1-yl)ethylidene)furan-2(3H)-one Natural products C=C1CCC2C(C)(CO)C(O)CCC2(C)C1CC=C1C=COC1=O YIIRVUDGRKEWBV-UHFFFAOYSA-N 0.000 description 1
- AGBQKNBQESQNJD-SSDOTTSWSA-N (R)-lipoic acid Chemical compound OC(=O)CCCC[C@@H]1CCSS1 AGBQKNBQESQNJD-SSDOTTSWSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- UKAUYVFTDYCKQA-UHFFFAOYSA-N -2-Amino-4-hydroxybutanoic acid Natural products OC(=O)C(N)CCO UKAUYVFTDYCKQA-UHFFFAOYSA-N 0.000 description 1
- WBYWAXJHAXSJNI-VOTSOKGWSA-M .beta-Phenylacrylic acid Natural products [O-]C(=O)\C=C\C1=CC=CC=C1 WBYWAXJHAXSJNI-VOTSOKGWSA-M 0.000 description 1
- OZOMQRBLCMDCEG-CHHVJCJISA-N 1-[(z)-[5-(4-nitrophenyl)furan-2-yl]methylideneamino]imidazolidine-2,4-dione Chemical compound C1=CC([N+](=O)[O-])=CC=C1C(O1)=CC=C1\C=N/N1C(=O)NC(=O)C1 OZOMQRBLCMDCEG-CHHVJCJISA-N 0.000 description 1
- KTPDNYVWXJTUKG-UHFFFAOYSA-O 1-methyl-2-[2-(2-phenyl-1h-indol-3-yl)ethenyl]quinolin-1-ium Chemical compound C1=CC2=CC=CC=C2[N+](C)=C1\C=C\C(C1=CC=CC=C1N1)=C1C1=CC=CC=C1 KTPDNYVWXJTUKG-UHFFFAOYSA-O 0.000 description 1
- 102100038028 1-phosphatidylinositol 3-phosphate 5-kinase Human genes 0.000 description 1
- 101710145421 1-phosphatidylinositol 3-phosphate 5-kinase Proteins 0.000 description 1
- NHUWXMNVGMRODJ-UHFFFAOYSA-P 10-methoxy-2-[2-[4-[1-[2-(10-methoxy-7h-pyrido[4,3-c]carbazol-2-ium-2-yl)ethyl]piperidin-4-yl]piperidin-1-yl]ethyl]-7h-pyrido[4,3-c]carbazol-2-ium Chemical compound N1C2=CC=C(OC)C=C2C(C2=C3)=C1C=CC2=CC=[N+]3CCN(CC1)CCC1C(CC1)CCN1CC[N+]1=CC2=C(C=3C(=CC=C(C=3)OC)N3)C3=CC=C2C=C1 NHUWXMNVGMRODJ-UHFFFAOYSA-P 0.000 description 1
- FUFLCEKSBBHCMO-UHFFFAOYSA-N 11-dehydrocorticosterone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 FUFLCEKSBBHCMO-UHFFFAOYSA-N 0.000 description 1
- XMJAJFVLHDIEHF-CRBRZBHVSA-N 14-Deoxy-11,12-didehydroandrographolide Chemical compound C(/[C@@H]1C(=C)CC[C@H]2[C@@]1(C)CC[C@@H](O)[C@]2(CO)C)=C\C1=CCOC1=O XMJAJFVLHDIEHF-CRBRZBHVSA-N 0.000 description 1
- XMJAJFVLHDIEHF-UHFFFAOYSA-N 14-deoxy-11, 12-didehydroandrographolide Natural products OCC1(C)C(O)CCC2(C)C1CCC(=C)C2C=CC1=CCOC1=O XMJAJFVLHDIEHF-UHFFFAOYSA-N 0.000 description 1
- YIIRVUDGRKEWBV-YSDSKTICSA-N 14-deoxy-11,12-didehydroandrographolide Natural products C[C@@]1(CO)[C@H](O)CC[C@@]2(C)[C@H](CC=C/3C=COC3=O)C(=C)CC[C@H]12 YIIRVUDGRKEWBV-YSDSKTICSA-N 0.000 description 1
- MRUDNSFOFOQZDA-UHFFFAOYSA-M 2,6-dichlorobenzoate Chemical compound [O-]C(=O)C1=C(Cl)C=CC=C1Cl MRUDNSFOFOQZDA-UHFFFAOYSA-M 0.000 description 1
- MRUDNSFOFOQZDA-UHFFFAOYSA-N 2,6-dichlorobenzoic acid Chemical group OC(=O)C1=C(Cl)C=CC=C1Cl MRUDNSFOFOQZDA-UHFFFAOYSA-N 0.000 description 1
- ONOTYLMNTZNAQZ-UHFFFAOYSA-M 2,6-difluorobenzoate Chemical compound [O-]C(=O)C1=C(F)C=CC=C1F ONOTYLMNTZNAQZ-UHFFFAOYSA-M 0.000 description 1
- SGTNSNPWRIOYBX-UHFFFAOYSA-N 2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile Chemical compound C1=C(OC)C(OC)=CC=C1CCN(C)CCCC(C#N)(C(C)C)C1=CC=C(OC)C(OC)=C1 SGTNSNPWRIOYBX-UHFFFAOYSA-N 0.000 description 1
- CIWBSHSKHKDKBQ-SZSCBOSDSA-N 2-[(1s)-1,2-dihydroxyethyl]-3,4-dihydroxy-2h-furan-5-one Chemical compound OC[C@H](O)C1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-SZSCBOSDSA-N 0.000 description 1
- VHVPQPYKVGDNFY-DFMJLFEVSA-N 2-[(2r)-butan-2-yl]-4-[4-[4-[4-[[(2r,4s)-2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]piperazin-1-yl]phenyl]-1,2,4-triazol-3-one Chemical compound O=C1N([C@H](C)CC)N=CN1C1=CC=C(N2CCN(CC2)C=2C=CC(OC[C@@H]3O[C@](CN4N=CN=C4)(OC3)C=3C(=CC(Cl)=CC=3)Cl)=CC=2)C=C1 VHVPQPYKVGDNFY-DFMJLFEVSA-N 0.000 description 1
- AZAANWYREOQRFB-SETSBSEESA-N 2-[(8r)-8-(3,5-difluorophenyl)-10-oxo-6,9-diazaspiro[4.5]decan-9-yl]-n-[(2r)-2'-oxospiro[1,3-dihydroindene-2,3'-1h-pyrrolo[2,3-b]pyridine]-5-yl]acetamide Chemical compound FC1=CC(F)=CC([C@H]2N(C(=O)C3(CCCC3)NC2)CC(=O)NC=2C=C3C[C@]4(CC3=CC=2)C2=CC=CN=C2NC4=O)=C1 AZAANWYREOQRFB-SETSBSEESA-N 0.000 description 1
- KJABUVRFCPPJPD-UHFFFAOYSA-N 2-[2-(5-carboxypentylamino)-2-oxo-1-[(2-phenylacetyl)amino]ethyl]-5,5-dimethyl-1,3-thiazolidine-4-carboxylic acid Chemical compound N1C(C(O)=O)C(C)(C)SC1C(C(=O)NCCCCCC(O)=O)NC(=O)CC1=CC=CC=C1 KJABUVRFCPPJPD-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- DTNSDCJFTHMDAK-UHFFFAOYSA-M 2-cyanobenzoate Chemical compound [O-]C(=O)C1=CC=CC=C1C#N DTNSDCJFTHMDAK-UHFFFAOYSA-M 0.000 description 1
- DTNSDCJFTHMDAK-UHFFFAOYSA-N 2-cyanobenzoic acid Chemical group OC(=O)C1=CC=CC=C1C#N DTNSDCJFTHMDAK-UHFFFAOYSA-N 0.000 description 1
- SLAMLWHELXOEJZ-UHFFFAOYSA-M 2-nitrobenzoate Chemical compound [O-]C(=O)C1=CC=CC=C1[N+]([O-])=O SLAMLWHELXOEJZ-UHFFFAOYSA-M 0.000 description 1
- BRMWTNUJHUMWMS-UHFFFAOYSA-N 3-Methylhistidine Natural products CN1C=NC(CC(N)C(O)=O)=C1 BRMWTNUJHUMWMS-UHFFFAOYSA-N 0.000 description 1
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-M 3-carboxy-2,3-dihydroxypropanoate Chemical compound OC(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-M 0.000 description 1
- MIJYXULNPSFWEK-GTOFXWBISA-N 3beta-hydroxyolean-12-en-28-oic acid Chemical compound C1C[C@H](O)C(C)(C)[C@@H]2CC[C@@]3(C)[C@]4(C)CC[C@@]5(C(O)=O)CCC(C)(C)C[C@H]5C4=CC[C@@H]3[C@]21C MIJYXULNPSFWEK-GTOFXWBISA-N 0.000 description 1
- NZAQRZWBQUIBSF-UHFFFAOYSA-N 4-(4-sulfobutoxy)butane-1-sulfonic acid Chemical compound OS(=O)(=O)CCCCOCCCCS(O)(=O)=O NZAQRZWBQUIBSF-UHFFFAOYSA-N 0.000 description 1
- WCKQPPQRFNHPRJ-UHFFFAOYSA-N 4-[[4-(dimethylamino)phenyl]diazenyl]benzoic acid Chemical compound C1=CC(N(C)C)=CC=C1N=NC1=CC=C(C(O)=O)C=C1 WCKQPPQRFNHPRJ-UHFFFAOYSA-N 0.000 description 1
- LWXFCZXRFBUOOR-UHFFFAOYSA-N 4-chloro-2-hydroxybenzoic acid Chemical group OC(=O)C1=CC=C(Cl)C=C1O LWXFCZXRFBUOOR-UHFFFAOYSA-N 0.000 description 1
- XRHGYUZYPHTUJZ-UHFFFAOYSA-M 4-chlorobenzoate Chemical compound [O-]C(=O)C1=CC=C(Cl)C=C1 XRHGYUZYPHTUJZ-UHFFFAOYSA-M 0.000 description 1
- XRHGYUZYPHTUJZ-UHFFFAOYSA-N 4-chlorobenzoic acid Chemical group OC(=O)C1=CC=C(Cl)C=C1 XRHGYUZYPHTUJZ-UHFFFAOYSA-N 0.000 description 1
- KEJMSTJTAWACNI-UHFFFAOYSA-N 4-cyano-2-fluorobenzoic acid Chemical group OC(=O)C1=CC=C(C#N)C=C1F KEJMSTJTAWACNI-UHFFFAOYSA-N 0.000 description 1
- ADCUEPOHPCPMCE-UHFFFAOYSA-N 4-cyanobenzoic acid Chemical group OC(=O)C1=CC=C(C#N)C=C1 ADCUEPOHPCPMCE-UHFFFAOYSA-N 0.000 description 1
- BBYDXOIZLAWGSL-UHFFFAOYSA-M 4-fluorobenzoate Chemical compound [O-]C(=O)C1=CC=C(F)C=C1 BBYDXOIZLAWGSL-UHFFFAOYSA-M 0.000 description 1
- BBYDXOIZLAWGSL-UHFFFAOYSA-N 4-fluorobenzoic acid Chemical group OC(=O)C1=CC=C(F)C=C1 BBYDXOIZLAWGSL-UHFFFAOYSA-N 0.000 description 1
- GZSOSUNBTXMUFQ-NJGQXECBSA-N 5,7,3'-Trihydroxy-4'-methoxyflavone 7-O-rutinoside Natural products O(C[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@H](Oc2cc(O)c3C(=O)C=C(c4cc(O)c(OC)cc4)Oc3c2)O1)[C@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@H](C)O1 GZSOSUNBTXMUFQ-NJGQXECBSA-N 0.000 description 1
- NYCXYKOXLNBYID-UHFFFAOYSA-N 5,7-Dihydroxychromone Natural products O1C=CC(=O)C=2C1=CC(O)=CC=2O NYCXYKOXLNBYID-UHFFFAOYSA-N 0.000 description 1
- RTATXGUCZHCSNG-KYGWAIEOSA-N 5,7-dihydroxy-2-(4-hydroxyphenyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trihydroxy-6-[[(2r,3r,4r,5r,6s)-3,4,5-trihydroxy-6-methyloxan-2-yl]oxymethyl]oxan-2-yl]oxychromen-4-one Chemical compound O[C@@H]1[C@H](O)[C@@H](O)[C@H](C)O[C@H]1OC[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@H](OC=2C(C3=C(O)C=C(O)C=C3OC=2C=2C=CC(O)=CC=2)=O)O1 RTATXGUCZHCSNG-KYGWAIEOSA-N 0.000 description 1
- LSLYOANBFKQKPT-DIFFPNOSSA-N 5-[(1r)-1-hydroxy-2-[[(2r)-1-(4-hydroxyphenyl)propan-2-yl]amino]ethyl]benzene-1,3-diol Chemical compound C([C@@H](C)NC[C@H](O)C=1C=C(O)C=C(O)C=1)C1=CC=C(O)C=C1 LSLYOANBFKQKPT-DIFFPNOSSA-N 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- USFZMSVCRYTOJT-UHFFFAOYSA-N Ammonium acetate Chemical compound N.CC(O)=O USFZMSVCRYTOJT-UHFFFAOYSA-N 0.000 description 1
- 239000005695 Ammonium acetate Substances 0.000 description 1
- WKKBRRFSRMDTJB-JYBIWHBTSA-N Andrograpanin Natural products C([C@H]1[C@]2(C)CCC[C@]([C@H]2CCC1=C)(CO)C)CC1=CCOC1=O WKKBRRFSRMDTJB-JYBIWHBTSA-N 0.000 description 1
- BOJKULTULYSRAS-OTESTREVSA-N Andrographolide Chemical compound C([C@H]1[C@]2(C)CC[C@@H](O)[C@]([C@H]2CCC1=C)(CO)C)\C=C1/[C@H](O)COC1=O BOJKULTULYSRAS-OTESTREVSA-N 0.000 description 1
- 102400000345 Angiotensin-2 Human genes 0.000 description 1
- 101800000733 Angiotensin-2 Proteins 0.000 description 1
- KMOUJOKENFFTPU-UHFFFAOYSA-N Apigenin-7-glucosid Natural products OC1C(O)C(O)C(CO)OC1OC1=CC(O)=C2C(=O)C=C(C=3C=CC(O)=CC=3)OC2=C1 KMOUJOKENFFTPU-UHFFFAOYSA-N 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Natural products OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 1
- 108010011485 Aspartame Proteins 0.000 description 1
- 241000008904 Betacoronavirus Species 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- LSNNMFCWUKXFEE-UHFFFAOYSA-M Bisulfite Chemical compound OS([O-])=O LSNNMFCWUKXFEE-UHFFFAOYSA-M 0.000 description 1
- BTBUEUYNUDRHOZ-UHFFFAOYSA-N Borate Chemical compound [O-]B([O-])[O-] BTBUEUYNUDRHOZ-UHFFFAOYSA-N 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- 239000005537 C09CA07 - Telmisartan Substances 0.000 description 1
- NEIGQRKMHFDLTK-WHXQJPIOSA-N CCC\C=C\C=C\C=C\C(=O)O[C@@H]1[C@@H](C)[C@@]23O[C@@]4(O[C@H]([C@@H]2[C@@H]2O[C@]2(CO)[C@@H](O)[C@@]2(O)[C@H]3C=C(C)C2=O)[C@]1(O4)C(C)=C)c1ccccc1 Chemical compound CCC\C=C\C=C\C=C\C(=O)O[C@@H]1[C@@H](C)[C@@]23O[C@@]4(O[C@H]([C@@H]2[C@@H]2O[C@]2(CO)[C@@H](O)[C@@]2(O)[C@H]3C=C(C)C2=O)[C@]1(O4)C(C)=C)c1ccccc1 NEIGQRKMHFDLTK-WHXQJPIOSA-N 0.000 description 1
- 101100338269 Caenorhabditis elegans his-41 gene Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- KXDHJXZQYSOELW-UHFFFAOYSA-M Carbamate Chemical compound NC([O-])=O KXDHJXZQYSOELW-UHFFFAOYSA-M 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical group [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- OKTJSMMVPCPJKN-NJFSPNSNSA-N Carbon-14 Chemical compound [14C] OKTJSMMVPCPJKN-NJFSPNSNSA-N 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 238000003734 CellTiter-Glo Luminescent Cell Viability Assay Methods 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- ZAMOUSCENKQFHK-UHFFFAOYSA-N Chlorine atom Chemical group [Cl] ZAMOUSCENKQFHK-UHFFFAOYSA-N 0.000 description 1
- 208000017667 Chronic Disease Diseases 0.000 description 1
- WBYWAXJHAXSJNI-SREVYHEPSA-N Cinnamic acid Chemical compound OC(=O)\C=C/C1=CC=CC=C1 WBYWAXJHAXSJNI-SREVYHEPSA-N 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- HZZVJAQRINQKSD-UHFFFAOYSA-N Clavulanic acid Natural products OC(=O)C1C(=CCO)OC2CC(=O)N21 HZZVJAQRINQKSD-UHFFFAOYSA-N 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 208000001528 Coronaviridae Infections Diseases 0.000 description 1
- MFYSYFVPBJMHGN-ZPOLXVRWSA-N Cortisone Chemical compound O=C1CC[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 MFYSYFVPBJMHGN-ZPOLXVRWSA-N 0.000 description 1
- MFYSYFVPBJMHGN-UHFFFAOYSA-N Cortisone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)(O)C(=O)CO)C4C3CCC2=C1 MFYSYFVPBJMHGN-UHFFFAOYSA-N 0.000 description 1
- ACBOFPQSBWBAQR-UHFFFAOYSA-N Cosmosiin Natural products OCC1OC(Oc2cc(O)c3C(=O)C=C(Oc3c2)c4cccc(O)c4)C(O)C(O)C1O ACBOFPQSBWBAQR-UHFFFAOYSA-N 0.000 description 1
- 206010011224 Cough Diseases 0.000 description 1
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 1
- 108010036949 Cyclosporine Proteins 0.000 description 1
- 108010074922 Cytochrome P-450 CYP1A2 Proteins 0.000 description 1
- 108010026925 Cytochrome P-450 CYP2C19 Proteins 0.000 description 1
- 108010000543 Cytochrome P-450 CYP2C9 Proteins 0.000 description 1
- 108010001237 Cytochrome P-450 CYP2D6 Proteins 0.000 description 1
- 208000009011 Cytochrome P-450 CYP3A Inhibitors Diseases 0.000 description 1
- 102100026533 Cytochrome P450 1A2 Human genes 0.000 description 1
- 102100029363 Cytochrome P450 2C19 Human genes 0.000 description 1
- 102100029358 Cytochrome P450 2C9 Human genes 0.000 description 1
- 102100021704 Cytochrome P450 2D6 Human genes 0.000 description 1
- AUNGANRZJHBGPY-UHFFFAOYSA-N D-Lyxoflavin Natural products OCC(O)C(O)C(O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-UHFFFAOYSA-N 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 1
- MNIVAEKDEDQBEP-UHFFFAOYSA-N Decortinol Natural products OC1C=C2CC(O)CCC2(C)C2C1C1CCC(C(C)CCC(CC)C(C)=C)C1(C)CC2 MNIVAEKDEDQBEP-UHFFFAOYSA-N 0.000 description 1
- YZCKVEUIGOORGS-OUBTZVSYSA-N Deuterium Chemical compound [2H] YZCKVEUIGOORGS-OUBTZVSYSA-N 0.000 description 1
- DKMROQRQHGEIOW-UHFFFAOYSA-N Diethyl succinate Chemical compound CCOC(=O)CCC(=O)OCC DKMROQRQHGEIOW-UHFFFAOYSA-N 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- JKLISIRFYWXLQG-UHFFFAOYSA-N Epioleonolsaeure Natural products C1CC(O)C(C)(C)C2CCC3(C)C4(C)CCC5(C(O)=O)CCC(C)(C)CC5C4CCC3C21C JKLISIRFYWXLQG-UHFFFAOYSA-N 0.000 description 1
- RSEPBGGWRJCQGY-RBRWEJTLSA-N Estradiol valerate Chemical compound C1CC2=CC(O)=CC=C2[C@@H]2[C@@H]1[C@@H]1CC[C@H](OC(=O)CCCC)[C@@]1(C)CC2 RSEPBGGWRJCQGY-RBRWEJTLSA-N 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical group FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- WMBWREPUVVBILR-UHFFFAOYSA-N GCG Natural products C=1C(O)=C(O)C(O)=CC=1C1OC2=CC(O)=CC(O)=C2CC1OC(=O)C1=CC(O)=C(O)C(O)=C1 WMBWREPUVVBILR-UHFFFAOYSA-N 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 206010019799 Hepatitis viral Diseases 0.000 description 1
- 229940122957 Histamine H2 receptor antagonist Drugs 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101001109145 Homo sapiens Receptor-interacting serine/threonine-protein kinase 1 Proteins 0.000 description 1
- 244000309467 Human Coronavirus Species 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- LCWXJXMHJVIJFK-UHFFFAOYSA-N Hydroxylysine Natural products NCC(O)CC(N)CC(O)=O LCWXJXMHJVIJFK-UHFFFAOYSA-N 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 102220521681 Insulin-induced gene 1 protein_S94A_mutation Human genes 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 102000010781 Interleukin-6 Receptors Human genes 0.000 description 1
- 108010038501 Interleukin-6 Receptors Proteins 0.000 description 1
- SHGAZHPCJJPHSC-NUEINMDLSA-N Isotretinoin Chemical compound OC(=O)C=C(C)/C=C/C=C(C)C=CC1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-NUEINMDLSA-N 0.000 description 1
- UETNIIAIRMUTSM-UHFFFAOYSA-N Jacareubin Natural products CC1(C)OC2=CC3Oc4c(O)c(O)ccc4C(=O)C3C(=C2C=C1)O UETNIIAIRMUTSM-UHFFFAOYSA-N 0.000 description 1
- OFFWOVJBSQMVPI-RMLGOCCBSA-N Kaletra Chemical compound N1([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=2C=CC=CC=2)NC(=O)COC=2C(=CC=CC=2C)C)CC=2C=CC=CC=2)CCCNC1=O.N([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=1C=CC=CC=1)NC(=O)OCC=1SC=NC=1)CC=1C=CC=CC=1)C(=O)N(C)CC1=CSC(C(C)C)=N1 OFFWOVJBSQMVPI-RMLGOCCBSA-N 0.000 description 1
- DJOWTWWHMWQATC-KYHIUUMWSA-N Karpoxanthin Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C1(O)C(C)(C)CC(O)CC1(C)O)C=CC=C(/C)C=CC2=C(C)CC(O)CC2(C)C DJOWTWWHMWQATC-KYHIUUMWSA-N 0.000 description 1
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- 239000002211 L-ascorbic acid Substances 0.000 description 1
- 235000000069 L-ascorbic acid Nutrition 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- RHGKLRLOHDJJDR-BYPYZUCNSA-N L-citrulline Chemical compound NC(=O)NCCC[C@H]([NH3+])C([O-])=O RHGKLRLOHDJJDR-BYPYZUCNSA-N 0.000 description 1
- FFFHZYDWPBMWHY-VKHMYHEASA-N L-homocysteine Chemical compound OC(=O)[C@@H](N)CCS FFFHZYDWPBMWHY-VKHMYHEASA-N 0.000 description 1
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-homoserine Chemical compound OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- UCUNFLYVYCGDHP-BYPYZUCNSA-N L-methionine sulfone Chemical compound CS(=O)(=O)CC[C@H](N)C(O)=O UCUNFLYVYCGDHP-BYPYZUCNSA-N 0.000 description 1
- WZNJWVWKTVETCG-YFKPBYRVSA-N L-mimosine Chemical compound OC(=O)[C@@H](N)CN1C=CC(=O)C(O)=C1 WZNJWVWKTVETCG-YFKPBYRVSA-N 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- UCHDWCPVSPXUMX-TZIWLTJVSA-N Montelukast Chemical compound CC(C)(O)C1=CC=CC=C1CC[C@H](C=1C=C(\C=C\C=2N=C3C=C(Cl)C=CC3=CC=2)C=CC=1)SCC1(CC(O)=O)CC1 UCHDWCPVSPXUMX-TZIWLTJVSA-N 0.000 description 1
- JDHILDINMRGULE-LURJTMIESA-N N(pros)-methyl-L-histidine Chemical compound CN1C=NC=C1C[C@H](N)C(O)=O JDHILDINMRGULE-LURJTMIESA-N 0.000 description 1
- FFDGPVCHZBVARC-UHFFFAOYSA-N N,N-dimethylglycine Chemical class CN(C)CC(O)=O FFDGPVCHZBVARC-UHFFFAOYSA-N 0.000 description 1
- 229910002651 NO3 Inorganic materials 0.000 description 1
- 206010028735 Nasal congestion Diseases 0.000 description 1
- RHGKLRLOHDJJDR-UHFFFAOYSA-N Ndelta-carbamoyl-DL-ornithine Natural products OC(=O)C(N)CCCNC(N)=O RHGKLRLOHDJJDR-UHFFFAOYSA-N 0.000 description 1
- 241001292005 Nidovirales Species 0.000 description 1
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 1
- GRYLNZFGIOXLOG-UHFFFAOYSA-N Nitric acid Chemical compound O[N+]([O-])=O GRYLNZFGIOXLOG-UHFFFAOYSA-N 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- YJQPYGGHQPGBLI-UHFFFAOYSA-N Novobiocin Natural products O1C(C)(C)C(OC)C(OC(N)=O)C(O)C1OC1=CC=C(C(O)=C(NC(=O)C=2C=C(CC=C(C)C)C(O)=CC=2)C(=O)O2)C2=C1C YJQPYGGHQPGBLI-UHFFFAOYSA-N 0.000 description 1
- YBRJHZPWOMJYKQ-UHFFFAOYSA-N Oleanolic acid Natural products CC1(C)CC2C3=CCC4C5(C)CCC(O)C(C)(C)C5CCC4(C)C3(C)CCC2(C1)C(=O)O YBRJHZPWOMJYKQ-UHFFFAOYSA-N 0.000 description 1
- MIJYXULNPSFWEK-UHFFFAOYSA-N Oleanolinsaeure Natural products C1CC(O)C(C)(C)C2CCC3(C)C4(C)CCC5(C(O)=O)CCC(C)(C)CC5C4=CCC3C21C MIJYXULNPSFWEK-UHFFFAOYSA-N 0.000 description 1
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 1
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 1
- 239000004100 Oxytetracycline Substances 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 241001596784 Pegasus Species 0.000 description 1
- XQMUICMLSDHQEH-UHFFFAOYSA-N Phyllaemblicin B Natural products CC1COC2(CC1OC(=O)c3ccccc3)OC4CC(CC(O)C4(O)C2O)C(=O)OC5OC(CO)C(O)C(O)C5OC6OC(CO)C(O)C(O)C6O XQMUICMLSDHQEH-UHFFFAOYSA-N 0.000 description 1
- IIXHQGSINFQLRR-UHFFFAOYSA-N Piceatannol Natural products Oc1ccc(C=Cc2c(O)c(O)c3CCCCc3c2O)cc1O IIXHQGSINFQLRR-UHFFFAOYSA-N 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 229940096437 Protein S Drugs 0.000 description 1
- 108010001267 Protein Subunits Proteins 0.000 description 1
- 102000002067 Protein Subunits Human genes 0.000 description 1
- IWYDHOAUDWTVEP-UHFFFAOYSA-N R-2-phenyl-2-hydroxyacetic acid Natural products OC(=O)C(O)C1=CC=CC=C1 IWYDHOAUDWTVEP-UHFFFAOYSA-N 0.000 description 1
- 101710118046 RNA-directed RNA polymerase Proteins 0.000 description 1
- 102100022501 Receptor-interacting serine/threonine-protein kinase 1 Human genes 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 208000004756 Respiratory Insufficiency Diseases 0.000 description 1
- 206010038687 Respiratory distress Diseases 0.000 description 1
- 208000036071 Rhinorrhea Diseases 0.000 description 1
- 206010039101 Rhinorrhoea Diseases 0.000 description 1
- MEFKEPWMEQBLKI-AIRLBKTGSA-N S-adenosyl-L-methioninate Chemical compound O[C@@H]1[C@H](O)[C@@H](C[S+](CC[C@H](N)C([O-])=O)C)O[C@H]1N1C2=NC=NC(N)=C2N=C1 MEFKEPWMEQBLKI-AIRLBKTGSA-N 0.000 description 1
- 108091005774 SARS-CoV-2 proteins Proteins 0.000 description 1
- 108091005634 SARS-CoV-2 receptor-binding domains Proteins 0.000 description 1
- 208000037847 SARS-CoV-2-infection Diseases 0.000 description 1
- 241001678561 Sarbecovirus Species 0.000 description 1
- 102220471183 Scavenger receptor cysteine-rich type 1 protein M130_S65N_mutation Human genes 0.000 description 1
- 241000008910 Severe acute respiratory syndrome-related coronavirus Species 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 229940123518 Sodium/glucose cotransporter 2 inhibitor Drugs 0.000 description 1
- 101710198474 Spike protein Proteins 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Natural products OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229920002253 Tannate Polymers 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 101710198378 Uncharacterized 10.8 kDa protein in cox-rep intergenic region Proteins 0.000 description 1
- 108010075974 Vasoactive Intestinal Peptide Receptors Proteins 0.000 description 1
- 102000012088 Vasoactive Intestinal Peptide Receptors Human genes 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- RLZZBHBWPWGOSA-MYVHNFIBSA-N [(2s,3r,4s,5s,6r)-4,5-dihydroxy-6-(hydroxymethyl)-3-[(2s,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl] (2s,3ar,4r,4's,5'r,6s,7ar)-4'-benzoyloxy-3a,4-dihydroxy-5'-methyl-3-oxospiro[5,6,7,7a-tetrahydro-4h-1-benzofuran-2,2'-oxane]-6- Chemical compound O([C@H]1C[C@@]2(OC[C@H]1C)C([C@@]1(O)[C@H](O)C[C@@H](C[C@H]1O2)C(=O)O[C@H]1[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)O[C@H]1[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)O)=O)C(=O)C1=CC=CC=C1 RLZZBHBWPWGOSA-MYVHNFIBSA-N 0.000 description 1
- WNTYBHLDCKXEOT-UHFFFAOYSA-N acetophenazine Chemical compound C12=CC(C(=O)C)=CC=C2SC2=CC=CC=C2N1CCCN1CCN(CCO)CC1 WNTYBHLDCKXEOT-UHFFFAOYSA-N 0.000 description 1
- 229960000276 acetophenazine Drugs 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 229960001570 ademetionine Drugs 0.000 description 1
- 238000012382 advanced drug delivery Methods 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- IAJILQKETJEXLJ-RSJOWCBRSA-N aldehydo-D-galacturonic acid Chemical compound O=C[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)C(O)=O IAJILQKETJEXLJ-RSJOWCBRSA-N 0.000 description 1
- IAJILQKETJEXLJ-QTBDOELSSA-N aldehydo-D-glucuronic acid Chemical compound O=C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C(O)=O IAJILQKETJEXLJ-QTBDOELSSA-N 0.000 description 1
- WNMJYKCGWZFFKR-UHFFFAOYSA-N alfuzosin Chemical compound N=1C(N)=C2C=C(OC)C(OC)=CC2=NC=1N(C)CCCNC(=O)C1CCCO1 WNMJYKCGWZFFKR-UHFFFAOYSA-N 0.000 description 1
- 229960004607 alfuzosin Drugs 0.000 description 1
- 150000008044 alkali metal hydroxides Chemical class 0.000 description 1
- 229910001860 alkaline earth metal hydroxide Inorganic materials 0.000 description 1
- 125000005907 alkyl ester group Chemical group 0.000 description 1
- OBDOVFRMEYHSQB-UHFFFAOYSA-N almitrine Chemical compound C1=CC(F)=CC=C1C(C=1C=CC(F)=CC=1)N1CCN(C=2N=C(NCC=C)N=C(NCC=C)N=2)CC1 OBDOVFRMEYHSQB-UHFFFAOYSA-N 0.000 description 1
- 229960005039 almitrine Drugs 0.000 description 1
- 229940061720 alpha hydroxy acid Drugs 0.000 description 1
- 150000001280 alpha hydroxy acids Chemical class 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 125000003368 amide group Chemical group 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 229910021529 ammonia Inorganic materials 0.000 description 1
- 229940043376 ammonium acetate Drugs 0.000 description 1
- 235000019257 ammonium acetate Nutrition 0.000 description 1
- YMARZQAQMVYCKC-OEMFJLHTSA-N amprenavir Chemical compound C([C@@H]([C@H](O)CN(CC(C)C)S(=O)(=O)C=1C=CC(N)=CC=1)NC(=O)O[C@@H]1COCC1)C1=CC=CC=C1 YMARZQAQMVYCKC-OEMFJLHTSA-N 0.000 description 1
- 229960001830 amprenavir Drugs 0.000 description 1
- BBDAGFIXKZCXAH-CCXZUQQUSA-N ancitabine Chemical compound N=C1C=CN2[C@@H]3O[C@H](CO)[C@@H](O)[C@@H]3OC2=N1 BBDAGFIXKZCXAH-CCXZUQQUSA-N 0.000 description 1
- ASLUCFFROXVMFL-UHFFFAOYSA-N andrographolide Natural products CC1(CO)C(O)CCC2(C)C(CC=C3/C(O)OCC3=O)C(=C)CCC12 ASLUCFFROXVMFL-UHFFFAOYSA-N 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 230000000507 anthelmentic effect Effects 0.000 description 1
- 229940124339 anthelmintic agent Drugs 0.000 description 1
- 239000000921 anthelmintic agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 239000003146 anticoagulant agent Substances 0.000 description 1
- 229940127219 anticoagulant drug Drugs 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 229940121357 antivirals Drugs 0.000 description 1
- KMOUJOKENFFTPU-QNDFHXLGSA-N apigenin 7-O-beta-D-glucoside Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=CC(O)=C2C(=O)C=C(C=3C=CC(O)=CC=3)OC2=C1 KMOUJOKENFFTPU-QNDFHXLGSA-N 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 229910052786 argon Inorganic materials 0.000 description 1
- IAOZJIPTCAWIRG-QWRGUYRKSA-N aspartame Chemical compound OC(=O)C[C@H](N)C(=O)N[C@H](C(=O)OC)CC1=CC=CC=C1 IAOZJIPTCAWIRG-QWRGUYRKSA-N 0.000 description 1
- 239000000605 aspartame Substances 0.000 description 1
- 229960003438 aspartame Drugs 0.000 description 1
- 235000010357 aspartame Nutrition 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 229960003159 atovaquone Drugs 0.000 description 1
- KUCQYCKVKVOKAY-CTYIDZIISA-N atovaquone Chemical compound C1([C@H]2CC[C@@H](CC2)C2=C(C(C3=CC=CC=C3C2=O)=O)O)=CC=C(Cl)C=C1 KUCQYCKVKVOKAY-CTYIDZIISA-N 0.000 description 1
- 239000002585 base Substances 0.000 description 1
- 150000007514 bases Chemical class 0.000 description 1
- 229940077388 benzenesulfonate Drugs 0.000 description 1
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 1
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 1
- 229940000635 beta-alanine Drugs 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 238000010256 biochemical assay Methods 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- BQDZMZRUXNFTQT-OHMLUKIUSA-N bolazine Chemical compound C([C@]1(C)[C@@H](O)CC[C@H]1[C@@H]1CC2)C[C@@H]1[C@](C[C@H]1C)(C)[C@@H]2C\C1=N/N=C1/C[C@H](CC[C@@H]2[C@@H]3CC[C@]4(C)[C@@H](O)CC[C@H]42)[C@]3(C)C[C@H]1C BQDZMZRUXNFTQT-OHMLUKIUSA-N 0.000 description 1
- 229950009014 bolazine Drugs 0.000 description 1
- 239000012267 brine Substances 0.000 description 1
- OZVBMTJYIDMWIL-AYFBDAFISA-N bromocriptine Chemical compound C1=CC(C=2[C@H](N(C)C[C@@H](C=2)C(=O)N[C@]2(C(=O)N3[C@H](C(N4CCC[C@H]4[C@]3(O)O2)=O)CC(C)C)C(C)C)C2)=C3C2=C(Br)NC3=C1 OZVBMTJYIDMWIL-AYFBDAFISA-N 0.000 description 1
- 229960002802 bromocriptine Drugs 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- OSGAYBCDTDRGGQ-UHFFFAOYSA-L calcium sulfate Chemical compound [Ca+2].[O-]S([O-])(=O)=O OSGAYBCDTDRGGQ-UHFFFAOYSA-L 0.000 description 1
- PASHVRUKOFIRIK-UHFFFAOYSA-L calcium sulfate dihydrate Chemical compound O.O.[Ca+2].[O-]S([O-])(=O)=O PASHVRUKOFIRIK-UHFFFAOYSA-L 0.000 description 1
- MIOPJNTWMNEORI-UHFFFAOYSA-N camphorsulfonic acid Chemical compound C1CC2(CS(O)(=O)=O)C(=O)CC1C2(C)C MIOPJNTWMNEORI-UHFFFAOYSA-N 0.000 description 1
- ZTWZVMIYIIVABD-OEMFJLHTSA-N candoxatril Chemical compound C([C@@H](COCCOC)C(=O)OC=1C=C2CCCC2=CC=1)C1(C(=O)N[C@@H]2CC[C@@H](CC2)C(O)=O)CCCC1 ZTWZVMIYIIVABD-OEMFJLHTSA-N 0.000 description 1
- 229950004548 candoxatril Drugs 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 239000004106 carminic acid Substances 0.000 description 1
- 229940114118 carminic acid Drugs 0.000 description 1
- DGQLVPJVXFOQEV-NGOCYOHBSA-N carminic acid Chemical compound OC1=C2C(=O)C=3C(C)=C(C(O)=O)C(O)=CC=3C(=O)C2=C(O)C(O)=C1[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O DGQLVPJVXFOQEV-NGOCYOHBSA-N 0.000 description 1
- 235000012730 carminic acid Nutrition 0.000 description 1
- 229960004195 carvedilol Drugs 0.000 description 1
- NPAKNKYSJIDKMW-UHFFFAOYSA-N carvedilol Chemical compound COC1=CC=CC=C1OCCNCC(O)COC1=CC=CC2=NC3=CC=C[CH]C3=C12 NPAKNKYSJIDKMW-UHFFFAOYSA-N 0.000 description 1
- OLVCFLKTBJRLHI-AXAPSJFSSA-N cefamandole Chemical compound CN1N=NN=C1SCC1=C(C(O)=O)N2C(=O)[C@@H](NC(=O)[C@H](O)C=3C=CC=CC=3)[C@H]2SC1 OLVCFLKTBJRLHI-AXAPSJFSSA-N 0.000 description 1
- 229960003012 cefamandole Drugs 0.000 description 1
- PWAUCHMQEXVFJR-PMAPCBKXSA-N cefpiramide Chemical compound C1=NC(C)=CC(O)=C1C(=O)N[C@H](C=1C=CC(O)=CC=1)C(=O)N[C@@H]1C(=O)N2C(C(O)=O)=C(CSC=3N(N=NN=3)C)CS[C@@H]21 PWAUCHMQEXVFJR-PMAPCBKXSA-N 0.000 description 1
- 229960005446 cefpiramide Drugs 0.000 description 1
- UNJFKXSSGBWRBZ-BJCIPQKHSA-N ceftibuten Chemical compound S1C(N)=NC(C(=C\CC(O)=O)\C(=O)N[C@@H]2C(N3C(=CCS[C@@H]32)C(O)=O)=O)=C1 UNJFKXSSGBWRBZ-BJCIPQKHSA-N 0.000 description 1
- 229960004086 ceftibuten Drugs 0.000 description 1
- 229960001668 cefuroxime Drugs 0.000 description 1
- JFPVXVDWJQMJEE-IZRZKJBUSA-N cefuroxime Chemical compound N([C@@H]1C(N2C(=C(COC(N)=O)CS[C@@H]21)C(O)=O)=O)C(=O)\C(=N/OC)C1=CC=CO1 JFPVXVDWJQMJEE-IZRZKJBUSA-N 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 238000012832 cell culture technique Methods 0.000 description 1
- 238000012054 celltiter-glo Methods 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- ARXHRTZAVQOQEU-BRVLHLJYSA-N cerevisterol Chemical compound C1[C@@H](O)CC[C@]2(C)[C@@H](CC[C@@]3([C@@H]([C@H](C)/C=C/[C@H](C)C(C)C)CC[C@H]33)C)C3=C[C@@H](O)[C@]21O ARXHRTZAVQOQEU-BRVLHLJYSA-N 0.000 description 1
- ARXHRTZAVQOQEU-SXOCEXOESA-N cerevisterol Natural products CC(C)[C@@H](C)C=C[C@H](C)[C@H]1CC[C@@H]2C3=C[C@H](O)[C@@]4(O)C[C@@H](O)CC[C@@]4(C)[C@@H]3CC[C@]12C ARXHRTZAVQOQEU-SXOCEXOESA-N 0.000 description 1
- 229960001091 chenodeoxycholic acid Drugs 0.000 description 1
- RUDATBOHQWOJDD-BSWAIDMHSA-N chenodeoxycholic acid Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)CC1 RUDATBOHQWOJDD-BSWAIDMHSA-N 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- 239000000460 chlorine Chemical group 0.000 description 1
- 229910052801 chlorine Chemical group 0.000 description 1
- SKPLBLUECSEIFO-UHFFFAOYSA-N chlorphenesin carbamate Chemical compound NC(=O)OCC(O)COC1=CC=C(Cl)C=C1 SKPLBLUECSEIFO-UHFFFAOYSA-N 0.000 description 1
- 229960004878 chlorphenesin carbamate Drugs 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 229940043370 chrysin Drugs 0.000 description 1
- 235000015838 chrysin Nutrition 0.000 description 1
- 229960001265 ciclosporin Drugs 0.000 description 1
- DHSUYTOATWAVLW-WFVMDLQDSA-N cilastatin Chemical compound CC1(C)C[C@@H]1C(=O)N\C(=C/CCCCSC[C@H](N)C(O)=O)C(O)=O DHSUYTOATWAVLW-WFVMDLQDSA-N 0.000 description 1
- 229960004912 cilastatin Drugs 0.000 description 1
- 235000013985 cinnamic acid Nutrition 0.000 description 1
- 229930016911 cinnamic acid Natural products 0.000 description 1
- 229960002173 citrulline Drugs 0.000 description 1
- 235000013477 citrulline Nutrition 0.000 description 1
- 229940090805 clavulanate Drugs 0.000 description 1
- HZZVJAQRINQKSD-PBFISZAISA-N clavulanic acid Chemical compound OC(=O)[C@H]1C(=C/CO)/O[C@@H]2CC(=O)N21 HZZVJAQRINQKSD-PBFISZAISA-N 0.000 description 1
- 229960000562 conivaptan Drugs 0.000 description 1
- JGBBVDFNZSRLIF-UHFFFAOYSA-N conivaptan Chemical compound C12=CC=CC=C2C=2[N]C(C)=NC=2CCN1C(=O)C(C=C1)=CC=C1NC(=O)C1=CC=CC=C1C1=CC=CC=C1 JGBBVDFNZSRLIF-UHFFFAOYSA-N 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 239000010949 copper Substances 0.000 description 1
- 229960004544 cortisone Drugs 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 229960000265 cromoglicic acid Drugs 0.000 description 1
- IOJUPLGTWVMSFF-UHFFFAOYSA-N cyclobenzothiazole Natural products C1=CC=C2SC=NC2=C1 IOJUPLGTWVMSFF-UHFFFAOYSA-N 0.000 description 1
- 229930182912 cyclosporin Natural products 0.000 description 1
- 229960000288 dabigatran etexilate Drugs 0.000 description 1
- KSGXQBZTULBEEQ-UHFFFAOYSA-N dabigatran etexilate Chemical compound C1=CC(C(N)=NC(=O)OCCCCCC)=CC=C1NCC1=NC2=CC(C(=O)N(CCC(=O)OCC)C=3N=CC=CC=3)=CC=C2N1C KSGXQBZTULBEEQ-UHFFFAOYSA-N 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 229960001987 dantrolene Drugs 0.000 description 1
- XMJAJFVLHDIEHF-YSDSKTICSA-N dehydroandrographolide Natural products C([C@@H]1C(=C)CC[C@H]2[C@@]1(C)CC[C@@H](O)[C@]2(CO)C)=CC1=CCOC1=O XMJAJFVLHDIEHF-YSDSKTICSA-N 0.000 description 1
- 229960005319 delavirdine Drugs 0.000 description 1
- YSMODUONRAFBET-UHFFFAOYSA-N delta-DL-hydroxylysine Natural products NCC(O)CCC(N)C(O)=O YSMODUONRAFBET-UHFFFAOYSA-N 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 229910052805 deuterium Inorganic materials 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- ACYGYJFTZSAZKR-UHFFFAOYSA-J dicalcium;2-[2-[bis(carboxylatomethyl)amino]ethyl-(carboxylatomethyl)amino]acetate Chemical compound [Ca+2].[Ca+2].[O-]C(=O)CN(CC([O-])=O)CCN(CC([O-])=O)CC([O-])=O ACYGYJFTZSAZKR-UHFFFAOYSA-J 0.000 description 1
- DEQITUUQPICUMR-HJPBWRTMSA-N dihydroergocristine Chemical compound C([C@H]1C(=O)N2CCC[C@H]2[C@]2(O)O[C@](C(N21)=O)(NC(=O)[C@H]1CN(C)[C@H]2[C@@H](C=3C=CC=C4NC=C(C=34)C2)C1)C(C)C)C1=CC=CC=C1 DEQITUUQPICUMR-HJPBWRTMSA-N 0.000 description 1
- 229960004318 dihydroergocristine Drugs 0.000 description 1
- IJKVHSBPTUYDLN-UHFFFAOYSA-N dihydroxy(oxo)silane Chemical compound O[Si](O)=O IJKVHSBPTUYDLN-UHFFFAOYSA-N 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- GZSOSUNBTXMUFQ-YFAPSIMESA-N diosmin Chemical compound C1=C(O)C(OC)=CC=C1C(OC1=C2)=CC(=O)C1=C(O)C=C2O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO[C@H]2[C@@H]([C@H](O)[C@@H](O)[C@H](C)O2)O)O1 GZSOSUNBTXMUFQ-YFAPSIMESA-N 0.000 description 1
- IGBKNLGEMMEWKD-UHFFFAOYSA-N diosmin Natural products COc1ccc(cc1)C2=C(O)C(=O)c3c(O)cc(OC4OC(COC5OC(C)C(O)C(O)C5O)C(O)C(O)C4O)cc3O2 IGBKNLGEMMEWKD-UHFFFAOYSA-N 0.000 description 1
- 229960004352 diosmin Drugs 0.000 description 1
- HYPPXZBJBPSRLK-UHFFFAOYSA-N diphenoxylate Chemical compound C1CC(C(=O)OCC)(C=2C=CC=CC=2)CCN1CCC(C#N)(C=1C=CC=CC=1)C1=CC=CC=C1 HYPPXZBJBPSRLK-UHFFFAOYSA-N 0.000 description 1
- 229960004192 diphenoxylate Drugs 0.000 description 1
- 239000001177 diphosphate Substances 0.000 description 1
- XPPKVPWEQAFLFU-UHFFFAOYSA-J diphosphate(4-) Chemical compound [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- VLARUOGDXDTHEH-UHFFFAOYSA-L disodium cromoglycate Chemical compound [Na+].[Na+].O1C(C([O-])=O)=CC(=O)C2=C1C=CC=C2OCC(O)COC1=CC=CC2=C1C(=O)C=C(C([O-])=O)O2 VLARUOGDXDTHEH-UHFFFAOYSA-L 0.000 description 1
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 1
- 238000013104 docking experiment Methods 0.000 description 1
- POULHZVOKOAJMA-UHFFFAOYSA-M dodecanoate Chemical compound CCCCCCCCCCCC([O-])=O POULHZVOKOAJMA-UHFFFAOYSA-M 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 208000017574 dry cough Diseases 0.000 description 1
- 229940009662 edetate Drugs 0.000 description 1
- 238000000132 electrospray ionisation Methods 0.000 description 1
- QFNHIDANIVGXPE-FNZWTVRRSA-N eluxadoline Chemical compound C1=C(C(O)=O)C(OC)=CC=C1CN(C(=O)[C@@H](N)CC=1C(=CC(=CC=1C)C(N)=O)C)[C@@H](C)C1=NC(C=2C=CC=CC=2)=CN1 QFNHIDANIVGXPE-FNZWTVRRSA-N 0.000 description 1
- 229960002658 eluxadoline Drugs 0.000 description 1
- 229950005627 embonate Drugs 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- VFSWRBJYBQXUTE-UHFFFAOYSA-N epi-Gallocatechin 3-O-gallate Natural products Oc1ccc2C(=O)C(OC(=O)c3cc(O)c(O)c(O)c3)C(Oc2c1)c4cc(O)c(O)c(O)c4 VFSWRBJYBQXUTE-UHFFFAOYSA-N 0.000 description 1
- YSMODUONRAFBET-UHNVWZDZSA-N erythro-5-hydroxy-L-lysine Chemical compound NC[C@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-UHNVWZDZSA-N 0.000 description 1
- HCZKYJDFEPMADG-UHFFFAOYSA-N erythro-nordihydroguaiaretic acid Natural products C=1C=C(O)C(O)=CC=1CC(C)C(C)CC1=CC=C(O)C(O)=C1 HCZKYJDFEPMADG-UHFFFAOYSA-N 0.000 description 1
- 229950000206 estolate Drugs 0.000 description 1
- 229960004766 estradiol valerate Drugs 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 206010016256 fatigue Diseases 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 229960001022 fenoterol Drugs 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 238000003818 flash chromatography Methods 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- 239000011737 fluorine Chemical group 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000012458 free base Substances 0.000 description 1
- 229940050411 fumarate Drugs 0.000 description 1
- 239000001530 fumaric acid Substances 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 229960003692 gamma aminobutyric acid Drugs 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 229960001731 gluceptate Drugs 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- KWMLJOLKUYYJFJ-VFUOTHLCSA-N glucoheptonic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(O)=O KWMLJOLKUYYJFJ-VFUOTHLCSA-N 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- 229940097043 glucuronic acid Drugs 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 229940049906 glutamate Drugs 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 235000003969 glutathione Nutrition 0.000 description 1
- 229940074045 glyceryl distearate Drugs 0.000 description 1
- 229940075507 glyceryl monostearate Drugs 0.000 description 1
- 229960004275 glycolic acid Drugs 0.000 description 1
- NEIGQRKMHFDLTK-UHFFFAOYSA-N gniditrin Natural products O1C(C2C3C(O3)(CO)C(O)C3(O)C(C(C)=CC43)=O)C(C(C)=C)(O3)C(OC(=O)C=CC=CC=CCCC)C(C)C24OC31C1=CC=CC=C1 NEIGQRKMHFDLTK-UHFFFAOYSA-N 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000002672 hepatitis B Diseases 0.000 description 1
- AIONOLUJZLIMTK-AWEZNQCLSA-N hesperetin Chemical compound C1=C(O)C(OC)=CC=C1[C@H]1OC2=CC(O)=CC(O)=C2C(=O)C1 AIONOLUJZLIMTK-AWEZNQCLSA-N 0.000 description 1
- 229960001587 hesperetin Drugs 0.000 description 1
- 235000010209 hesperetin Nutrition 0.000 description 1
- AIONOLUJZLIMTK-UHFFFAOYSA-N hesperetin Natural products C1=C(O)C(OC)=CC=C1C1OC2=CC(O)=CC(O)=C2C(=O)C1 AIONOLUJZLIMTK-UHFFFAOYSA-N 0.000 description 1
- IPCSVZSSVZVIGE-UHFFFAOYSA-M hexadecanoate Chemical compound CCCCCCCCCCCCCCCC([O-])=O IPCSVZSSVZVIGE-UHFFFAOYSA-M 0.000 description 1
- 125000004051 hexyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 238000004896 high resolution mass spectrometry Methods 0.000 description 1
- FTODBIPDTXRIGS-UHFFFAOYSA-N homoeriodictyol Natural products C1=C(O)C(OC)=CC(C2OC3=CC(O)=CC(O)=C3C(=O)C2)=C1 FTODBIPDTXRIGS-UHFFFAOYSA-N 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940125698 hormone suppressant Drugs 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- XGIHQYAWBCFNPY-AZOCGYLKSA-N hydrabamine Chemical compound C([C@@H]12)CC3=CC(C(C)C)=CC=C3[C@@]2(C)CCC[C@@]1(C)CNCCNC[C@@]1(C)[C@@H]2CCC3=CC(C(C)C)=CC=C3[C@@]2(C)CCC1 XGIHQYAWBCFNPY-AZOCGYLKSA-N 0.000 description 1
- BHEPBYXIRTUNPN-UHFFFAOYSA-N hydridophosphorus(.) (triplet) Chemical group [PH] BHEPBYXIRTUNPN-UHFFFAOYSA-N 0.000 description 1
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-M hydrogensulfate Chemical compound OS([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-M 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 125000004356 hydroxy functional group Chemical group O* 0.000 description 1
- QJHBJHUKURJDLG-UHFFFAOYSA-N hydroxy-L-lysine Natural products NCCCCC(NO)C(O)=O QJHBJHUKURJDLG-UHFFFAOYSA-N 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000036737 immune function Effects 0.000 description 1
- 229960003444 immunosuppressant agent Drugs 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 239000013038 irreversible inhibitor Substances 0.000 description 1
- SUMDYPCJJOFFON-UHFFFAOYSA-N isethionic acid Chemical compound OCCS(O)(=O)=O SUMDYPCJJOFFON-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960005280 isotretinoin Drugs 0.000 description 1
- 229960004130 itraconazole Drugs 0.000 description 1
- 229960004125 ketoconazole Drugs 0.000 description 1
- 229940043355 kinase inhibitor Drugs 0.000 description 1
- WZNJWVWKTVETCG-UHFFFAOYSA-N kojic acid Natural products OC(=O)C(N)CN1C=CC(=O)C(O)=C1 WZNJWVWKTVETCG-UHFFFAOYSA-N 0.000 description 1
- COOBKIBQQIIVKX-YBJOZTBGSA-N kouitchenside I Natural products O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=CC=C2OC=3C(C(C2=C1O)=O)=C(O)C=C(C=3)OC)[C@@H]1O[C@@H](C)[C@H](O)[C@@H](O)[C@H]1O COOBKIBQQIIVKX-YBJOZTBGSA-N 0.000 description 1
- 229940001447 lactate Drugs 0.000 description 1
- 229940099584 lactobionate Drugs 0.000 description 1
- JYTUSYBCFIZPBE-AMTLMPIISA-N lactobionic acid Chemical compound OC(=O)[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O JYTUSYBCFIZPBE-AMTLMPIISA-N 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 229940070765 laurate Drugs 0.000 description 1
- VRTWBAAJJOHBQU-KMWAZVGDSA-N ledipasvir Chemical compound COC(=O)N[C@@H](C(C)C)C(=O)N([C@@H](C1)C=2NC(=CN=2)C=2C=C3C(F)(F)C4=CC(=CC=C4C3=CC=2)C=2C=C3NC(=NC3=CC=2)[C@H]2N([C@@H]3CC[C@H]2C3)C(=O)[C@@H](NC(=O)OC)C(C)C)CC21CC2 VRTWBAAJJOHBQU-KMWAZVGDSA-N 0.000 description 1
- 229960002461 ledipasvir Drugs 0.000 description 1
- PTVWPYVOOKLBCG-ZDUSSCGKSA-N levodropropizine Chemical compound C1CN(C[C@H](O)CO)CCN1C1=CC=CC=C1 PTVWPYVOOKLBCG-ZDUSSCGKSA-N 0.000 description 1
- 229960002265 levodropropizine Drugs 0.000 description 1
- 238000012417 linear regression Methods 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 229910052744 lithium Inorganic materials 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 229940113983 lopinavir / ritonavir Drugs 0.000 description 1
- UFSKUSARDNFIRC-UHFFFAOYSA-N lumacaftor Chemical compound N1=C(C=2C=C(C=CC=2)C(O)=O)C(C)=CC=C1NC(=O)C1(C=2C=C3OC(F)(F)OC3=CC=2)CC1 UFSKUSARDNFIRC-UHFFFAOYSA-N 0.000 description 1
- 229960000998 lumacaftor Drugs 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 229960005375 lutein Drugs 0.000 description 1
- 239000001656 lutein Substances 0.000 description 1
- 235000012680 lutein Nutrition 0.000 description 1
- KBPHJBAIARWVSC-RGZFRNHPSA-N lutein Chemical compound C([C@H](O)CC=1C)C(C)(C)C=1\C=C\C(\C)=C\C=C\C(\C)=C\C=C\C=C(/C)\C=C\C=C(/C)\C=C\[C@H]1C(C)=C[C@H](O)CC1(C)C KBPHJBAIARWVSC-RGZFRNHPSA-N 0.000 description 1
- ORAKUVXRZWMARG-WZLJTJAWSA-N lutein Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C1=C(C)CCCC1(C)C)C=CC=C(/C)C=CC2C(=CC(O)CC2(C)C)C ORAKUVXRZWMARG-WZLJTJAWSA-N 0.000 description 1
- AHEVKYYGXVEWNO-UEPZRUIBSA-N lymecycline Chemical compound C1=CC=C2[C@](O)(C)[C@H]3C[C@H]4[C@H](N(C)C)C(O)=C(C(=O)NCNCCCC[C@H](N)C(O)=O)C(=O)[C@@]4(O)C(O)=C3C(=O)C2=C1O AHEVKYYGXVEWNO-UEPZRUIBSA-N 0.000 description 1
- 229960004196 lymecycline Drugs 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 229940049920 malate Drugs 0.000 description 1
- 239000011976 maleic acid Substances 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-N malic acid Chemical compound OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 1
- IWYDHOAUDWTVEP-UHFFFAOYSA-M mandelate Chemical compound [O-]C(=O)C(O)C1=CC=CC=C1 IWYDHOAUDWTVEP-UHFFFAOYSA-M 0.000 description 1
- 229960002510 mandelic acid Drugs 0.000 description 1
- WPBNNNQJVZRUHP-UHFFFAOYSA-L manganese(2+);methyl n-[[2-(methoxycarbonylcarbamothioylamino)phenyl]carbamothioyl]carbamate;n-[2-(sulfidocarbothioylamino)ethyl]carbamodithioate Chemical compound [Mn+2].[S-]C(=S)NCCNC([S-])=S.COC(=O)NC(=S)NC1=CC=CC=C1NC(=S)NC(=O)OC WPBNNNQJVZRUHP-UHFFFAOYSA-L 0.000 description 1
- HCZKYJDFEPMADG-TXEJJXNPSA-N masoprocol Chemical compound C([C@H](C)[C@H](C)CC=1C=C(O)C(O)=CC=1)C1=CC=C(O)C(O)=C1 HCZKYJDFEPMADG-TXEJJXNPSA-N 0.000 description 1
- 229960003951 masoprocol Drugs 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 238000005399 mechanical ventilation Methods 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 230000034217 membrane fusion Effects 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- VSDUZFOSJDMAFZ-UHFFFAOYSA-N methyl 2-amino-3-phenylpropanoate Chemical compound COC(=O)C(N)CC1=CC=CC=C1 VSDUZFOSJDMAFZ-UHFFFAOYSA-N 0.000 description 1
- WBYWAXJHAXSJNI-UHFFFAOYSA-N methyl p-hydroxycinnamate Natural products OC(=O)C=CC1=CC=CC=C1 WBYWAXJHAXSJNI-UHFFFAOYSA-N 0.000 description 1
- JZMJDSHXVKJFKW-UHFFFAOYSA-M methyl sulfate(1-) Chemical compound COS([O-])(=O)=O JZMJDSHXVKJFKW-UHFFFAOYSA-M 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- 238000004452 microanalysis Methods 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 229950002289 mimosine Drugs 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 229960005127 montelukast Drugs 0.000 description 1
- 230000000877 morphologic effect Effects 0.000 description 1
- AJFDBNQQDYLMJN-UHFFFAOYSA-N n,n-diethylacetamide Chemical compound CCN(CC)C(C)=O AJFDBNQQDYLMJN-UHFFFAOYSA-N 0.000 description 1
- UPSFMJHZUCSEHU-JYGUBCOQSA-N n-[(2s,3r,4r,5s,6r)-2-[(2r,3s,4r,5r,6s)-5-acetamido-4-hydroxy-2-(hydroxymethyl)-6-(4-methyl-2-oxochromen-7-yl)oxyoxan-3-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl]acetamide Chemical compound CC(=O)N[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@H]1[C@H](O)[C@@H](NC(C)=O)[C@H](OC=2C=C3OC(=O)C=C(C)C3=CC=2)O[C@@H]1CO UPSFMJHZUCSEHU-JYGUBCOQSA-N 0.000 description 1
- QEFAQIPZVLVERP-UHFFFAOYSA-N nepafenac Chemical compound NC(=O)CC1=CC=CC(C(=O)C=2C=CC=CC=2)=C1N QEFAQIPZVLVERP-UHFFFAOYSA-N 0.000 description 1
- 229960001002 nepafenac Drugs 0.000 description 1
- RTATXGUCZHCSNG-UHFFFAOYSA-N nicotiflorine Natural products OC1C(O)C(O)C(C)OC1OCC1C(O)C(O)C(O)C(OC=2C(C3=C(O)C=C(O)C=C3OC=2C=2C=CC(O)=CC=2)=O)O1 RTATXGUCZHCSNG-UHFFFAOYSA-N 0.000 description 1
- 229910017604 nitric acid Inorganic materials 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 229960002950 novobiocin Drugs 0.000 description 1
- YJQPYGGHQPGBLI-KGSXXDOSSA-N novobiocin Chemical compound O1C(C)(C)[C@H](OC)[C@@H](OC(N)=O)[C@@H](O)[C@@H]1OC1=CC=C(C(O)=C(NC(=O)C=2C=C(CC=C(C)C)C(O)=CC=2)C(=O)O2)C2=C1C YJQPYGGHQPGBLI-KGSXXDOSSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- NEIGQRKMHFDLTK-JTJSJVBBSA-N odoratrin Natural products CCCC=CC=CC=CC(=O)O[C@@H]1[C@@H](C)[C@@]23O[C@@]4(O[C@H]([C@@H]2[C@@H]5O[C@]5(CO)[C@@H](O)[C@@]6(O)[C@H]3C=C(C)C6=O)[C@]1(O4)C(=C)C)c7ccccc7 NEIGQRKMHFDLTK-JTJSJVBBSA-N 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 229940100243 oleanolic acid Drugs 0.000 description 1
- 229940049964 oleate Drugs 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 239000006186 oral dosage form Substances 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 239000012044 organic layer Substances 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- 229940116315 oxalic acid Drugs 0.000 description 1
- 235000006408 oxalic acid Nutrition 0.000 description 1
- 229960004570 oxprenolol Drugs 0.000 description 1
- 229960000625 oxytetracycline Drugs 0.000 description 1
- IWVCMVBTMGNXQD-PXOLEDIWSA-N oxytetracycline Chemical compound C1=CC=C2[C@](O)(C)[C@H]3[C@H](O)[C@H]4[C@H](N(C)C)C(O)=C(C(N)=O)C(=O)[C@@]4(O)C(O)=C3C(=O)C2=C1O IWVCMVBTMGNXQD-PXOLEDIWSA-N 0.000 description 1
- 235000019366 oxytetracycline Nutrition 0.000 description 1
- LPNBBFKOUUSUDB-UHFFFAOYSA-M p-toluate Chemical compound CC1=CC=C(C([O-])=O)C=C1 LPNBBFKOUUSUDB-UHFFFAOYSA-M 0.000 description 1
- NPIJXCQZLFKBMV-YTGGZNJNSA-L pancuronium bromide Chemical compound [Br-].[Br-].C[N+]1([C@@H]2[C@@H](OC(C)=O)C[C@@H]3CC[C@H]4[C@@H]5C[C@@H]([C@@H]([C@]5(CC[C@@H]4[C@@]3(C)C2)C)OC(=O)C)[N+]2(C)CCCCC2)CCCCC1 NPIJXCQZLFKBMV-YTGGZNJNSA-L 0.000 description 1
- 229960003379 pancuronium bromide Drugs 0.000 description 1
- 229940014662 pantothenate Drugs 0.000 description 1
- 235000019161 pantothenic acid Nutrition 0.000 description 1
- 239000011713 pantothenic acid Substances 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N papa-hydroxy-benzoic acid Natural products OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 239000001814 pectin Substances 0.000 description 1
- 235000010987 pectin Nutrition 0.000 description 1
- 229920001277 pectin Polymers 0.000 description 1
- 229960005079 pemetrexed Drugs 0.000 description 1
- WBXPDJSOTKVWSJ-ZDUSSCGKSA-N pemetrexed Chemical compound C=1NC=2NC(N)=NC(=O)C=2C=1CCC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 WBXPDJSOTKVWSJ-ZDUSSCGKSA-N 0.000 description 1
- YVTWVVANWZQLQY-PBHICJAKSA-N phaitanthrin D Natural products O=C1OC[C@@]23N(C(=O)c4c(N2)cccc4)c2c([C@H]13)cccc2 YVTWVVANWZQLQY-PBHICJAKSA-N 0.000 description 1
- YVTWVVANWZQLQY-WMLDXEAASA-N phaitanthrin d Chemical compound C12=CC=CC=C2[C@H]2C(=O)OC[C@]32N1C(=O)C1=CC=CC=C1N3 YVTWVVANWZQLQY-WMLDXEAASA-N 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- NONJJLVGHLVQQM-JHXYUMNGSA-N phenethicillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C(C)OC1=CC=CC=C1 NONJJLVGHLVQQM-JHXYUMNGSA-N 0.000 description 1
- 229960004894 pheneticillin Drugs 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 125000005541 phosphonamide group Chemical group 0.000 description 1
- 150000003014 phosphoric acid esters Chemical class 0.000 description 1
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 1
- 229960005095 pioglitazone Drugs 0.000 description 1
- 229950010765 pivalate Drugs 0.000 description 1
- IUGYQRQAERSCNH-UHFFFAOYSA-N pivalic acid Chemical compound CC(C)(C)C(O)=O IUGYQRQAERSCNH-UHFFFAOYSA-N 0.000 description 1
- 125000005546 pivalic acid group Chemical group 0.000 description 1
- 229930189407 platycodin Natural products 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 150000003141 primary amines Chemical class 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- DWEQWXSKOHHBNT-SAPNQHFASA-N progabide Chemical compound C=1C=C(Cl)C=CC=1C(/NCCCC(=O)N)=C1/C=C(F)C=CC1=O DWEQWXSKOHHBNT-SAPNQHFASA-N 0.000 description 1
- 229960002752 progabide Drugs 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- HZLWUYJLOIAQFC-UHFFFAOYSA-N prosapogenin PS-A Natural products C12CC(C)(C)CCC2(C(O)=O)CCC(C2(CCC3C4(C)C)C)(C)C1=CCC2C3(C)CCC4OC1OCC(O)C(O)C1O HZLWUYJLOIAQFC-UHFFFAOYSA-N 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 239000003586 protic polar solvent Substances 0.000 description 1
- 238000000425 proton nuclear magnetic resonance spectrum Methods 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- PMXCMJLOPOFPBT-HNNXBMFYSA-N purvalanol A Chemical compound C=12N=CN(C(C)C)C2=NC(N[C@@H](CO)C(C)C)=NC=1NC1=CC=CC(Cl)=C1 PMXCMJLOPOFPBT-HNNXBMFYSA-N 0.000 description 1
- 229940107700 pyruvic acid Drugs 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 239000011535 reaction buffer Substances 0.000 description 1
- WVLAAKXASPCBGT-UHFFFAOYSA-N reproterol Chemical compound C1=2C(=O)N(C)C(=O)N(C)C=2N=CN1CCCNCC(O)C1=CC(O)=CC(O)=C1 WVLAAKXASPCBGT-UHFFFAOYSA-N 0.000 description 1
- 229960002720 reproterol Drugs 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 201000004193 respiratory failure Diseases 0.000 description 1
- 230000036387 respiratory rate Effects 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 230000000284 resting effect Effects 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 239000002151 riboflavin Substances 0.000 description 1
- 235000019192 riboflavin Nutrition 0.000 description 1
- 229960002477 riboflavin Drugs 0.000 description 1
- 102220244688 rs1398808477 Human genes 0.000 description 1
- 102220093873 rs781163298 Human genes 0.000 description 1
- YGSDEFSMJLZEOE-UHFFFAOYSA-M salicylate Chemical compound OC1=CC=CC=C1C([O-])=O YGSDEFSMJLZEOE-UHFFFAOYSA-M 0.000 description 1
- 229960001860 salicylate Drugs 0.000 description 1
- 229960004889 salicylic acid Drugs 0.000 description 1
- 150000003335 secondary amines Chemical class 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 229960003310 sildenafil Drugs 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- NLQLSVXGSXCXFE-UHFFFAOYSA-N sitosterol Natural products CC=C(/CCC(C)C1CC2C3=CCC4C(C)C(O)CCC4(C)C3CCC2(C)C1)C(C)C NLQLSVXGSXCXFE-UHFFFAOYSA-N 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 229960001940 sulfasalazine Drugs 0.000 description 1
- NCEXYHBECQHGNR-UHFFFAOYSA-N sulfasalazine Natural products C1=C(O)C(C(=O)O)=CC(N=NC=2C=CC(=CC=2)S(=O)(=O)NC=2N=CC=CC=2)=C1 NCEXYHBECQHGNR-UHFFFAOYSA-N 0.000 description 1
- 229940124530 sulfonamide Drugs 0.000 description 1
- 150000003456 sulfonamides Chemical class 0.000 description 1
- 150000003871 sulfonates Chemical class 0.000 description 1
- 150000003467 sulfuric acid derivatives Chemical class 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 229940037128 systemic glucocorticoids Drugs 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- 229940095064 tartrate Drugs 0.000 description 1
- 229960005187 telmisartan Drugs 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 229950002757 teoclate Drugs 0.000 description 1
- IWVCMVBTMGNXQD-UHFFFAOYSA-N terramycin dehydrate Natural products C1=CC=C2C(O)(C)C3C(O)C4C(N(C)C)C(O)=C(C(N)=O)C(=O)C4(O)C(O)=C3C(=O)C2=C1O IWVCMVBTMGNXQD-UHFFFAOYSA-N 0.000 description 1
- 150000003512 tertiary amines Chemical class 0.000 description 1
- CZDYPVPMEAXLPK-UHFFFAOYSA-N tetramethylsilane Chemical compound C[Si](C)(C)C CZDYPVPMEAXLPK-UHFFFAOYSA-N 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- WZDGZWOAQTVYBX-XOINTXKNSA-N tibolone Chemical compound C([C@@H]12)C[C@]3(C)[C@@](C#C)(O)CC[C@H]3[C@@H]1[C@H](C)CC1=C2CCC(=O)C1 WZDGZWOAQTVYBX-XOINTXKNSA-N 0.000 description 1
- 229960001023 tibolone Drugs 0.000 description 1
- 238000003354 tissue distribution assay Methods 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 231100000027 toxicology Toxicity 0.000 description 1
- KBPHJBAIARWVSC-XQIHNALSSA-N trans-lutein Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C1=C(C)CC(O)CC1(C)C)C=CC=C(/C)C=CC2C(=CC(O)CC2(C)C)C KBPHJBAIARWVSC-XQIHNALSSA-N 0.000 description 1
- 238000012384 transportation and delivery Methods 0.000 description 1
- ZOTHAEBAWXWVID-HXEFRTELSA-N uk-432,097 Chemical compound O[C@@H]1[C@H](O)[C@@H](C(=O)NCC)O[C@H]1N1C2=NC(C(=O)NCCNC(=O)NC3CCN(CC3)C=3N=CC=CC=3)=NC(NCC(C=3C=CC=CC=3)C=3C=CC=CC=3)=C2N=C1 ZOTHAEBAWXWVID-HXEFRTELSA-N 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- FHCUMDQMBHQXKK-CDIODLITSA-N velpatasvir Chemical compound C1([C@@H](NC(=O)OC)C(=O)N2[C@@H](C[C@@H](C2)COC)C=2NC(=CN=2)C=2C=C3C(C4=CC5=CC=C6NC(=NC6=C5C=C4OC3)[C@H]3N([C@@H](C)CC3)C(=O)[C@@H](NC(=O)OC)C(C)C)=CC=2)=CC=CC=C1 FHCUMDQMBHQXKK-CDIODLITSA-N 0.000 description 1
- 229960000863 velpatasvir Drugs 0.000 description 1
- LQBVNQSMGBZMKD-UHFFFAOYSA-N venetoclax Chemical compound C=1C=C(Cl)C=CC=1C=1CC(C)(C)CCC=1CN(CC1)CCN1C(C=C1OC=2C=C3C=CNC3=NC=2)=CC=C1C(=O)NS(=O)(=O)C(C=C1[N+]([O-])=O)=CC=C1NCC1CCOCC1 LQBVNQSMGBZMKD-UHFFFAOYSA-N 0.000 description 1
- 229960001183 venetoclax Drugs 0.000 description 1
- 229960001722 verapamil Drugs 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 201000001862 viral hepatitis Diseases 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- JNELGWHKGNBSMD-UHFFFAOYSA-N xanthone powder Natural products C1=CC=C2C(=O)C3=CC=CC=C3OC2=C1 JNELGWHKGNBSMD-UHFFFAOYSA-N 0.000 description 1
- FJHBOVDFOQMZRV-XQIHNALSSA-N xanthophyll Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C1=C(C)CC(O)CC1(C)C)C=CC=C(/C)C=CC2C=C(C)C(O)CC2(C)C FJHBOVDFOQMZRV-XQIHNALSSA-N 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/005—Enzyme inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/16—Amides, e.g. hydroxamic acids
- A61K31/165—Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide
- A61K31/167—Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide having the nitrogen of a carboxamide group directly attached to the aromatic ring, e.g. lidocaine, paracetamol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
- A61K31/403—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
- A61K31/403—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
- A61K31/404—Indoles, e.g. pindolol
- A61K31/405—Indole-alkanecarboxylic acids; Derivatives thereof, e.g. tryptophan, indomethacin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/513—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim having oxo groups directly attached to the heterocyclic ring, e.g. cytosine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/519—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/56—Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids
- A61K31/57—Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids substituted in position 17 beta by a chain of two carbon atoms, e.g. pregnane or progesterone
- A61K31/573—Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids substituted in position 17 beta by a chain of two carbon atoms, e.g. pregnane or progesterone substituted in position 21, e.g. cortisone, dexamethasone, prednisone or aldosterone
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/60—Salicylic acid; Derivatives thereof
- A61K31/609—Amides, e.g. salicylamide
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/655—Azo (—N=N—), diazo (=N2), azoxy (>N—O—N< or N(=O)—N<), azido (—N3) or diazoamino (—N=N—N<) compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7042—Compounds having saccharide radicals and heterocyclic rings
- A61K31/7052—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
- A61K31/706—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
Definitions
- the invention relates to methods of inhibiting viral replication activity comprising contacting a SARS-Cov-2-related 3C-like (“3CL”) proteinase with a therapeutically effective amount of a SARS-Cov-2-related 3C-like protease inhibitor.
- the invention also relates to methods of treating Coronavirus Disease 2019 (“COVID-19”) in a patient by administering a therapeutically effective amount of a SARS-Cov-2-related 3C-like protease inhibitor to a patient in need thereof.
- the invention further relates to methods of treating COVID-19 in a patient, the method comprising administering a pharmaceutical composition comprising a therapeutically effective amount of the SARS- Cov-2-related 3C-like protease inhibitor to a patient in need thereof.
- Coronavirus Disease 2019 (“COVID-19”) has been associated with exposures originating in late 2019 in Wuhan, Hubei province, China.
- SARS-CoV-2 Severe Acute Respiratory Syndrome Corona Virus 2
- the genome sequence of SARS-CoV-2 has been sequenced from isolates obtained from nine patients in Wuhan, China and has been found to be of the subgenus Sarbecovirus of the genus Betacoronovirus. Lu, R. et al. The Lancet, January 29, 2020; http://doi .
- SARS-CoV-2 was found to have 88% homology with two bat-derived SARS-like coronaviruses, bat-SL-CoVZC45 and bat-SL-CoVZXC21 which were collected in 2018 in Zhoushan, eastern China.
- SARS-CoV-2 was also found to share about 79% homology with Severe Acute Respiratory Syndrome Corona Virus (“SARS-CoV”), the causative agent of the SARS outbreak in 2002-2003, and about 50% homology with Middle East Respiratory Syndrome Coronavirus (“MERS-CoV”), the causative agent of a respiratory viral outbreak originating in the Middle East in 2012.
- SARS-CoV Severe Acute Respiratory Syndrome Corona Virus
- MERS-CoV Middle East Respiratory Syndrome Coronavirus
- SARS-CoV-2 can be divided into two major types (L and S types) with the S type being ancestral and the L type having evolved from the S-type.
- L and S types can be clearly defined by just two tightly linked SNPs at positions 8,782 (orf1ab ⁇ T8517C, synonymous) and 28,144 ( ORF8 ⁇ C251T, S84L).
- SNPs can be clearly defined by just two tightly linked SNPs at positions 8,782 (orf1ab ⁇ T8517C, synonymous) and 28,144 ( ORF8 ⁇ C251T, S84L).
- approximately 70% were of the L-type and approximately 30% were of the S-type.
- RRAR Arginine-Arginine-Alanine-Arginine
- SARS-CoV-2 acts as a furin cleavage site which enhances receptor affinity and leads to higher membrane fusion efficiency thereby resulting in higher transmissibility of SARS-CoV-2 when compared to all other subtype B beta- coronaviruses, none of which contain the RRAR sequence.
- Coronavirus replication and transcription function is encoded by the so-called “replicase” gene (Ziebuhr, J., Snijder, E.J., and Gorbaleya, A.E.; Virus-encoded proteinases and proteolytic processing in Nidovirales. J. Gen. Virol. 2000, 81, 853-879; and Fehr, A.R.; Perlman, S.; Coronaviruses: An Overview of Their Replication and Pathogenesis Methods Mol Biol. 2015; 1282: 1-23. doi:10.1007/978-1-4939-2438-7_1), which consists of two overlapping polyproteins that are extensively processed by viral proteases.
- the C-proximal region is processed at eleven conserved interdomain junctions by the coronavirus main or “3C-like” protease (Ziebuhr, Snijder, Gorbaleya, 2000 and Fehr, Perlman et al. , 2015).
- the name “3C-like” protease derives from certain similarities between the coronavirus enzyme and the well-known picornavirus 3C proteases. These include substrate preferences, use of cysteine as an active site nucleophile in catalysis, and similarities in their putative overall polypeptide folds.
- SARS-CoV-2 3CL protease sequence accesion No.
- YP_009725301.1 has been found to share 96.08% homology when compared with the SARS-CoV 3CL protease (Accession No. YP_009725301.1) Xu, J.; Zhao, S.; Teng, T.; Abdalla, A.E.; Zhu, W.; Xie, L; Wang, Y.; Guo, X.; Systematic Comparison of Two Animal-to-Human Transmitted Human Coronaviruses: SARS-CoV-2and SARS-CoV; Viruses 2020, 12, 244; doi:10.3390/v12020244.
- the Thr285Ala replacement observed in the SARS-CoV-2 3CL protease allows the two domains III to approach each other somewhat closer (the distance between the Cot atoms of residues 285 in molecules A and B is 6.77 A in SARS-CoV 3CL protease and 5.21 A in SARS- CoV-2 3CL protease and the distance between the centers of mass of the two domains III shrinks from 33.4 A to 32.1 A).
- E1 is a method of treating COVID-19 in a patient, the method comprising administering to a patient in need thereof a therapeutically effective amount of a compound selected from the group consisting of: (3S)-3-( ⁇ / ⁇ /-[(4-methoxy-1/-/-indol-2- yl)carbonyl]-L-leucyl ⁇ amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate; (3S)-3 -( ⁇ N- [(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl ⁇ amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3- yl]butyl pivalate; (3S)-3-( ⁇ / ⁇ /-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leu
- E2 is the method of E1 wherein the compound or pharmaceutically acceptable salt thereof is administered orally, by inhalation or intranasally.
- E3 is the method of E2 wherein the compound or pharmaceutically acceptable salt thereof is administered orally.
- E4 is the method of E2 wherein the compound or pharmaceutically acceptable salt thereof is administered intranasally.
- E5 is the method of E1 wherein the compound or pharmaceutically acceptable salt thereof is administered sublingually.
- E6 is the method of any one of E1 to E5 wherein the compound or pharmaceutically acceptable salt thereof is administered one to four times over a 24-hour period.
- E7 is the method of any one of E1 to E7 further comprising the administration of one or more additional therapeutic agents.
- E8 is the method of E7 wherein the additional therapeutic agent is selected from the group consisting of azithromycin and remdesivir.
- E9 is a method of inhibiting or preventing SARS-CoV-2 viral replication comprising contacting a SARS-CoV-2 coronavirus protease with a therapeutically effective amount of a compound selected from the group consisting of: (3S)-3-( ⁇ / ⁇ /-[(4-methoxy-1/-/-indol- 2-yl)carbonyl]-L-leucyl ⁇ amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate; (3S)-3- ( ⁇ / ⁇ /-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl ⁇ amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3- yl]butyl pivalate; (3S)-3-( ⁇ / ⁇ /-[(4-methoxy-1/-/-indol-2-y
- E10 is a method of inhibiting or preventing SARS-CoV-2 viral replication comprising contacting the SARS-CoV-2 coronavirus 3CL protease with a therapeutically effective amount of a compound selected from the group consisting of: (3S)-3-( ⁇ / ⁇ /-[(4-methoxy- 1/-/-indol-2-yl)carbonyl]-L-leucyl ⁇ amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate; (3S)-3-( ⁇ / ⁇ /-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl ⁇ amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl pivalate; (3S)-3-( ⁇ / ⁇ /-[(4-methoxy-1/-/-indol-2
- E11 is a method of treating COVID-19 in a patient, the method comprising administering to a patient in need thereof a pharmaceutical composition, the pharmaceutical composition comprising a therapeutically effective amount of a compound selected from the group consisting of: (3S)-3-( ⁇ / ⁇ /-[(4-methoxy-1/-/-indol-2- yl)carbonyl]-L-leucyl ⁇ amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate; (3S)-3 -( ⁇ N- [(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl ⁇ amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3- yl]butyl pivalate; (3S)-3-( ⁇ / ⁇ /-[(4-methoxy-1/-/-indol-2-yl
- E13 is the method of E12 wherein the one or more additional therapeutic agent is selected from the group consisting of azithromycin and remdesivir.
- E14 is the method of any one of E11 to E13 wherein the pharmaceutical composition is administered orally.
- E15 is the method of any one of E11 to E13 wherein the pharmaceutical composition is administered by inhalation or intranasally.
- E16 is a compound selected from the group consisting of: (3S)-3-( ⁇ / ⁇ /-[(4-methoxy- 1/-/-indol-2-yl)carbonyl]-L-leucyl ⁇ amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate; (3S)-3-( ⁇ / ⁇ /-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl ⁇ amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl pivalate; (3S)-3-( ⁇ / ⁇ /-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L- leucyl ⁇ amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl
- E17 is a compound selected from the group consisting of: (3S)-3-( ⁇ / ⁇ /-[(4-methoxy- 1/-/-indol-2-yl)carbonyl]-L-leucyl ⁇ amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate; (3S)-3-( ⁇ / ⁇ /-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl ⁇ amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl pivalate; (3S)-3-( ⁇ / ⁇ /-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L- leucyl ⁇ amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl
- E18 is the method of E7 or E12 wherein the one or more additional agent is selected from the group consisting of remdesivir, galidesivir, favilavir/avifavir, mulnupiravir (MK- 4482/EIDD 2801), AT-527, AT-301, BLD-2660, favipiravir, camostat, SLV213 emtrictabine/tenofivir, clevudine, dalcetrapib, boceprevir, ABX464, dexamethasone, hydrocortisone, convalescent plasma, gelsolin (Rhu-p65N), monoclonal antibodies, regdanvimab (Regkirova), ravulizumab (Ultomiris), VIR-7831/VIR-7832, BRII-196/BRII- 198, COVI-AMG/COVI DROPS (STI-2020), bamlanivimab (LY-CoV555), mdress
- E19 is the method of E18 wherein the one or more additional agent is selected from the group consisting of remdesivir, dexamethasone, malnupiravir, bamlanivimab and baricitinib.
- E20 is a compound selected from the group consisting of: (3S)-3-( ⁇ / ⁇ /-[(4-methoxy- 1/-/-indol-2-yl)carbonyl]-L-leucyl ⁇ amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate; (3S)-3-( ⁇ / ⁇ /-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl ⁇ amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl pivalate; (3S)-3-( ⁇ / ⁇ /-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L- leucyl ⁇ amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl
- the present invention also provides a method of treating a condition that is mediated by SARS-CoV-2 coronavirus 3C-like protease activity in a patient by administering to said patient a pharmaceutically effective amount of a SARS-CoV-2 protease inhibitor as described herein.
- the present invention also provides a method of targeting SARS-CoV-2 inhibition as a means of treating indications caused by SARS-CoV-2-related viral infections.
- the present invention also provides a method of identifying cellular or viral pathways interfering with the functioning of the members of which could be used for treating indications caused by SARS-CoV-2 infections by administering a SARS-CoV-2 protease inhibitor as described herein.
- the present invention also provides a method of using SARS-CoV-2 protease inhibitors as described herein as tools for understanding mechanism of action of other SARS-CoV-2 inhibitors.
- the present invention also provides a method of using SARS-CoV-2 3C-like protease inhibitors for carrying out gene profiling experiments for monitoring the up or down regulation of genes for the purposed of identifying inhibitors for treating indications caused by SARS-CoV-2 infections such as COVID-19.
- the present invention further provides a pharmaceutical composition for the treatment of COVID-19 in a mammal containing an amount of a SARS-CoV-2 3C-like protease inhibitor that is effective in treating COVID-19 and a pharmaceutically acceptable carrier.
- Figure 1 depicts the residue differences between SARS-CoV and SARS-CoV-2, with an inhibitor compound shown at the active site.
- Figure 2 depicts binding site of homology model of SARS-CoV-2 3CL with a core- docked ligand (Compound B, N-((1S)-1- ⁇ [((1S)-3-hydroxy-2-oxo-1- ⁇ [(3S)-2-oxopyrrolidin- 3-yl]methyl ⁇ propyl)amino]carbonyl ⁇ -3-methylbutyl)-4-methoxy-1H-indole-2- carboxamide).
- the terms “comprising” and “including” are used in their open, non-limiting sense.
- the term “treating”, as used herein, unless otherwise indicated, means reversing, alleviating, inhibiting the progress of, or preventing the disorder of condition to which such term applies, or one or more symptoms of such disorder or condition.
- COVID-19 is the disease caused in patients by infection with the SARS-CoV-2 virus.
- the SARS- CoV-2 virus is to be understood to encompass the initially discovered strain of the virus as well as mutant strains which emerge, such as but not limited to, strains such as B.1.1.7 (UK variant), B.1.351 (South African variant) and P.1 (Brazilian variant).
- treatment refers to the act of treating as “treating” is defined immediately above.
- phrases “pharmaceutically acceptable salts(s)”, as used herein, unless otherwise indicated, includes salts of acidic or basic groups which may be present in the compounds described herein.
- the compounds used in the methods of the invention that are basic in nature are capable of forming a wide variety of salts with various inorganic and organic acids.
- the acids that may be used to prepare pharmaceutically acceptable acid addition salts of such basic compounds are those that form non-toxic acid addition salts, i.e., salts containing pharmacologically acceptable anions, such as the acetate, benzenesulfonate, benzoate, bicarbonate, bisulfate, bitartrate, borate, bromide, calcium edetate, camsylate, carbonate, chloride, clavulanate, citrate, dihydrochloride, edetate, edislyate, estolate, esylate, ethylsuccinate, fumarate, gluceptate, gluconate, glutamate, glycollylarsanilate, hexyl resorcinate, hydrabamine, hydrobromide, hydrochloride, iodide, isethionate, lactate, lactobionate, laurate, malate, maleate, mandelate, mesylate, methylsulfate
- this invention relates to the use of all such tautomers and mixtures thereof.
- the subject invention also includes methods of treatment of COVID-19 and methods of inhibiting SARS-CoV-2 with isotopically-labelled compounds, which are identical to those recited herein, but for the fact that one or more atoms are replaced by an atom having an atomic mass or mass number different from the atomic mass or mass number usually found in nature.
- isotopes that can be incorporated into compounds of the invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine and chlorine, such as 2 H, 3 H, 13 C, 14 C, 15 N, 18 0, 17 0, 31 P, 32 P, 35 S, 18 F, and 36 CI, respectively.
- Isotopically labelled compounds used in the methods of this invention and prodrugs thereof can generally be prepared by carrying out the procedures for preparing the compounds disclosed in the art by substituting a readily available isotopically labelled reagent for a non-isotopically labelled reagent.
- This invention also encompasses methods using pharmaceutical compositions and methods of treating COVID-19 infections through administering prodrugs of compounds of the invention.
- Compounds having free amido or hydroxy groups can be converted into prodrugs.
- Prodrugs include compounds wherein an amino acid residue, or a polypeptide chain of two or more (e.g., two, three or four) amino acid residues is covalently joined through an ester bond to a hydroxy of compounds used in the methods of this invention.
- the amino acid residues include but are not limited to the 20 naturally occurring amino acids commonly designated by three letter symbols and also includes 4-hydroxyproline, hydroxylysine, demosine, isodemosine, 3-methylhistidine, norvalin, beta-alanine, gamma-aminobutyric acid, citrulline homocysteine, homoserine, ornithine and methionine sulfone. Additional types of prodrugs are also encompassed. For instance, free hydroxy groups may be derivatized using groups including but not limited to hemisuccinates, phosphate esters, dimethylaminoacetates, and phosphoryloxymethyloxycarbonyls, as outlined in Advanced Drug Delivery Reviews, 1996, 19, 115.
- Carbamate prodrugs of hydroxy and amino groups are also included, as are carbonate prodrugs, sulfonate esters and sulfate esters of hydroxy groups.
- Derivatization of hydroxy groups as (acyloxy) methyl and (acyloxy)ethyl ethers wherein the acyl group may be an alkyl ester, optionally substituted with groups including but not limited to ether, amine and carboxylic acid functionalities, or where the acyl group is an amino acid ester as described above, are also encompassed.
- Prodrugs of this type are described in J. Med. Chem., 1996, 29, 10. Free amines can also be derivatized as amides, sulfonamides or phosphonamides. All of these prodrug moieties may incorporate groups including but not limited to ether, amine and carboxylic acid functionalities.
- the compounds used in the methods of the invention can also be used in combination with other drugs.
- dosing a SARS-CoV-2 coronavirus infected patient i.e. a patient with COVID-19
- an interferon such as interferon alpha
- a pegylated interferon such as PEG-lntron or Pegasus
- Examples of greater clinical benefits could include a larger reduction in COVID-19 symptoms, a faster time to alleviation of symptoms, reduced lung pathology, a larger reduction in the amount of SARS-Cov-2 coronavirus in the patient (viral load), and decreased mortality.
- the SARS-Cov-2 coronavirus infects cells which express p-glycoprotein.
- Some of the SARS-Cov-2 coronavirus 3CL protease inhibitors of the invention are p- glycoprotein substrates.
- Compounds which inhibit the SARS-Cov-2 coronavirus which are also p-glycoprotein substrates may be dosed with p-glycoprotein inhibitor.
- p-glycoprotein inhibitors examples include verapamil, vinblastine, ketoconazole, nelfinavir, ritonavir or cyclosporine.
- the p-glycoprotein inhibitors act by inhibiting the efflux of the SARS-Cov-2 coronavirus inhibitors of the invention out of the cell.
- the inhibition of the p-glycoprotein based efflux will prevent reduction of intracellular concentrations of the SARS-Cov-2 coronavirus inhibitor due to p-glycoprotein efflux. Inhibition of the p-glycoprotein efflux will result in larger intracellular concentrations of the SARS-CoV-2 coronavirus inhibitors.
- Dosing a SARS-CoV-2 coronavirus infected patient with the SARS-CoV-2 coronavirus 3CL protease inhibitors of the invention and a p-glycoprotein inhibitor may lower the amount of SARS-Cov-2 coronavirus 3CL protease inhibitor required to achieve an efficacious dose by increasing the intracellular concentration of the SARS-CoV-2 coronavirus 3CL protease inhibitor.
- agents that may be used to increase the exposure of a mammal to a compound of the present invention are those that can as inhibitors of at least one isoform of the cytochrome P450 (CYP450) enzymes.
- CYP450 cytochrome P450
- the isoforms of CYP450 that may be beneficially inhibited included, but are not limited to CYP1A2, CYP2D6, CYP2C9, CYP2C19 and CYP3A4.
- the compounds used in the methods of the invention include compounds that may be CYP3A4 substrates and are metabolized by CYP3A4.
- a SARS-CoV-2 coronavirus inhibitor which is a CYP3A4 substrate, such as SARS-CoV-2 coronavirus 3CL protease inhibitor, and a CYP3A4 inhibitor, such as ritonavir, nelfinavir or delavirdine will reduce the metabolism of the SARS-Cov-2 coronavirus inhibitor by CYP3A4. This will result in reduced clearance of the SARS-CoV-2 coronavirus inhibitor and increased SARS-Cov-2 coronavirus inhibitor plasma concentrations. The reduced clearance and higher plasma concentrations may result in a lower efficacious dose of the SARS-CoV-2 coronavirus inhibitor.
- Additional therapeutic agents that can be used in combination with the SARS-CoV-2 inhibitors in the methods of the present invention include the following:
- PLpro inhibitors Ribavirin, Valganciclovir, /3-Thymidine, Aspartame, Oxprenolol, Doxycycline, Acetophenazine, lopromide, Riboflavin, Reproterol, 2,2'-Cyclocytidine, Chloramphenicol, Chlorphenesin carbamate, Levodropropizine, Cefamandole, Floxuridine, Tigecycline, Pemetrexed, L(+)-Ascorbic acid, Glutathione, Hesperetin, Ademetionine, Masoprocol, Isotretinoin, Dantrolene, Sulfasalazine Anti-bacterial,
- 3CLpro inhibitors Lymecycline, Chlorhexidine, Alfuzosin, Cilastatin, Famotidine, Almitrine, Progabide, Nepafenac, Carvedilol, Amprenavir, Tigecycline, Montelukast, Carminic acid, Mimosine, Flavin, Lutein, Cefpiramide, Phenethicillin, Candoxatril, Nicardipine, Estradiol valerate, Pioglitazone, Conivaptan, Telmisartan, Doxycycline, Oxytetracycline, (1 S,2R,4aS,5R,8aS)-1-Formamido-1 ,4a-dimethyl-6-methylene-5-((E)- 2-(2-oxo-2,5-dihydrofuran-3-yl)ethenyl)decahydronaphthalen-2-yl5-((R)-1,2-dithiolan-3- yl) pentan
- RdRp inhibitors Valganciclovir, Chlorhexidine, Ceftibuten, Fenoterol, Fludarabine, Itraconazole, Cefuroxime, Atovaquone, Chenodeoxycholic acid, Cromolyn, Pancuronium bromide, Cortisone, Tibolone, Novobiocin, Silybin, Idarubicin Bromocriptine, Diphenoxylate, Benzylpenicilloyl G, Dabigatran etexilate, Betulonal, Gnidicin, 2/3,30/3-Dihydroxy-3,4-seco-friedelolactone-27-lactone, 14-Deoxy-11,12-didehydroandrographolide, Gniditrin, Theaflavin 3,3'-di-0-gallate, ( R )- ((1R,5aS,6R,9aS)-1,5a-Dimethyl-7-methylene-3-oxo-6-((£)-2-
- Additional therapeutic agents that can be used in the methods of the invention include Diosmin, Hesperidin, MK-3207, Venetoclax, Dihydroergocristine, Bolazine,
- Other additional agents useful in the methods of the present invention include chloroquine, hydroxychloroquine, azithromycin and remdisivir.
- Additional agents that can be used in the methods of the present invention include RIG 1 pathway activators such as those described in US Patent No. 9,884,876.
- Another embodiment of the present invention is a method of treating COVID-19 in a patient wherein an additional agent is administered and the additional agent is selected from antivirals such as remdesivir, galidesivir, favilavir/avifavir, mulnupiravir (MK-4482/EIDD 2801), AT-527, AT-301, BLD-2660, favipiravir, camostat, SLV213 emtrictabine/tenofivir, clevudine, dalcetrapib, boceprevir and ABX464, glucocorticoids such as dexamethasone and hydrocortisone, convalescent plasma, a recombinant human plasma such as gelsolin (Rhu-p65N), monoclonal antibodies such as regdanvimab (Regkirova), ravulizumab (Ultomiris), VIR-7831/VIR-7832, BRI 1-196/BRI I- 198, COVI-
- SARS-Cov-2 inhibiting agent means any SARS-CoV-2 related coronavirus 3C like protease inhibitor compound described herein or a pharmaceutically acceptable salt, hydrate, prodrug, active metabolite or solvate thereof or a compound which inhibits replication of SARS-CoV-2 in any manner.
- SARS-CoV-2-related coronavirus means to reduce SARS-CoV-2 replication or production of SARS-CoV-2 components necessary for progeny virus in a cell as compared to a cell not being transiently or stably transduced with the ribozyme or a vector encoding the ribozyme.
- Simple and convenient assays to determine if SARS- CoV-2 viral replication has been reduced include an ELISA assay for the presence, absence, or reduced presence of anti-SARS-CoV-2 antibodies in the blood of the subject (Nasoff, et al., PNAS 88:5462-5466, 1991), RT-PCR (Yu, et al., in Viral Hepatitis and Liver Disease 574-577, Nishioka, Suzuki and Mishiro (Eds.); Springer-Verlag,
- RNA from transduced and infected “control” cells can be isolated and subjected to analysis by dot blot or northern blot and probed with SARS-CoV-2 specific DNA to determine if SARS-CoV-2 replication is reduced.
- reduction of SARS-CoV-2 protein expression can also be used as an indicator of inhibition of SARS- CoV-2 replication. A greater than fifty percent reduction in SARS-CoV-2 replication as compared to control cells typically quantitates a prevention of SARS-CoV-2 replication.
- an SARS-CoV-2 inhibitor compound used in the method of the invention is a base
- a desired salt may be prepared by any suitable method known to the art, including treatment of the free base with an inorganic acid (such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like), or with an organic acid (such as acetic acid, maleic acid, succinic acid, mandelic acid, fumaric acid, malonic acid, pyruvic acid, oxalic acid, glycolic acid, salicylic acid, pyranosidyl acid (such as glucuronic acid or galacturonic acid), alpha-hydroxy acid (such as citric acid or tartaric acid), amino acid (such as aspartic acid or glutamic acid), aromatic acid (such as benzoic acid or cinnamic acid), sulfonic acid (such as p-toluenesulfonic acid or ethanesulfonic acid), and the like.
- an SARS-CoV-2 inhibitor compound used in the method of the invention is an acid
- a desired salt may be prepared by any suitable method known to the art, including treatment of the free acid with an inorganic or organic base (such as an amine (primary, secondary, or tertiary)), an alkali metal hydroxide, or alkaline earth metal hydroxide.
- suitable salts include organic salts derived from amino acids (such as glycine and arginine), ammonia, primary amines, secondary amines, tertiary amines, and cyclic amines (such as piperidine, morpholine, and piperazine), as well as inorganic salts derived from sodium, calcium, potassium, magnesium, manganese, iron, copper, zinc, aluminum and lithium.
- amino acids such as glycine and arginine
- ammonia such as primary amines, secondary amines, tertiary amines, and cyclic amines (such as piperidine, morpholine, and piperazine)
- inorganic salts derived from sodium, calcium, potassium, magnesium, manganese, iron, copper, zinc, aluminum and lithium.
- hydroxamate compound, prodrugs, salts, and solvates used in the method of the invention may exist in different polymorph or crystal forms, all of which are intended to be within the scope of the present invention and specified formulas.
- hydroxamate compound, salts, prodrugs and solvates used in the method of the invention may exist as tautomers, all of which are intended to be within the broad scope of the present invention.
- Solubilizing agents may also be used with the compounds of the invention to increase the compounds solubility in water of physiologically acceptable solutions.
- These solubilizing agents include cyclodextrans, propylene glycol, diethylacetamide, polyethylene glycol, Tween, ethanol and micelle forming agents.
- Offered solubilizing agents are cyclodextrans, particularly beta cyclodextrans and in particular hydroxypropyl betacyclodextran and sulfobutylether betacyclodextran.
- the SARS-CoV-2 inhibitor compounds, salts, prodrugs and solvates used in the method of the invention may have chiral centers.
- the hydroxamate compound, salts, prodrugs and solvates may exist as single stereoisomers, racemates, and/or mixtures of enantiomers and/or disastereomers. All such single stereoisomers, racemates, and mixtures thereof are intended to be within the broad scope of the present invention.
- an optically pure compound is one that is enantiomerically pure.
- the term “optically pure” is intended to mean a compound comprising at least a sufficient activity.
- an optically pure amount of a single enantiomer to yield a compound having the desired pharmacological pure compound of the invention comprised at least 90% of a single isomer (80% enantiomeric excess), more preferably at least 95% (90% e.e.), even more preferably at least 97.5% (95%) e.e.), and most preferably at least 99% (98% e.e.).
- treating means reversing, alleviating, inhibiting the progress of, or preventing the disorder or condition to which such term applies, or one or more symptoms of such disorder or condition.
- treatment refers to the act of treating as “treating” is defined immediately above.
- “treating” or “treatment” means at least the mitigation of a disease condition in a human, that is alleviated by the inhibition of the activity of the SARS-CoV-2 3C-like protease which is the main protease of SARS-CoV-2, the causative agent for COVID- 19.
- COVID-19 fever, fatigue, and dry cough are the main manifestations of the disease, while nasal congestion, runny nose, and other symptoms of the upper respiratory tract are rare.
- COVID-19 can be classified into light, normal, severe, and critical types based on the severity of the disease National Health Commission of the People’s Republic of China. Diagnosis and Treatment of Pneumonia Caused by 2019-nCoV (Trial Version 4).
- Methods of treatment for mitigation of a disease condition such as COVID-19 include the use of one or more of the compounds in the invention in any conventionally acceptable manner.
- the compound or compounds used in the methods of the present invention are administered to a mammal, such as a human, in need thereof.
- the mammal in need thereof is infected with a coronavirus such as the causative agent of COVID-19, namely SARS-CoV-2.
- the present invention also includes prophylactic methods, comprising administering an effective amount of a SARS-CoV-2 inhibitor of the invention, or a pharmaceutically acceptable salt, prodrug, pharmaceutically active metabolite, or solvate thereof to a mammal, such as a human at risk for infection by SARS-CoV-2.
- a mammal such as a human at risk for infection by SARS-CoV-2.
- an effective amount of one or more compounds of the invention, or a pharmaceutically acceptable salt, prodrug, pharmaceutically active metabolite, or solvate thereof is administered to a human at risk for infection by SARS-CoV-2, the causative agent for COVID-19.
- the prophylactic methods of the invention include the use of one or more of the compounds in the invention in any conventionally acceptable manner.
- SARS-Cov-2 is the causative agent of COVID-19.
- the nucleotide sequence of the SARS-CoV-2 coronavirus as well as the recently determined L- and S- subtypes have recently been determined and made publicly available.
- the activity of the inhibitor compounds as inhibitors of SARS-CoV-2 viral activity may be measured by any of the suitable methods available in the art, including in vivo and in vitro assays.
- the activity of the compounds of the present invention as inhibitors of coronavirus 3C-like protease activity may be measured by any of the suitable methods known to those skilled in the art, including in vivo and in vitro assays.
- suitable assays for activity measurements include the antiviral cell culture assays described herein as well as the antiprotease assays described herein, such as the assays described in the Example section.
- SARS-CoV-2 inhibitor compounds and their pharmaceutically acceptable prodrugs, salts, active metabolites, and solvates may be performed according to any of the accepted modes of administration available to those skilled in the art.
- suitable modes of administration include oral, nasal, pulmonary, by inhalation, parenteral, topical, intravenous, injected, transdermal, and rectal.
- Oral, intravenous, by inhalation and nasal deliveries are preferred.
- a SARS-CoV-2-inhibiting agent may be administered as a pharmaceutical composition in any suitable pharmaceutical form.
- suitable pharmaceutical forms include solid, semisolid, liquid, or lyophilized formulations, such as tablets, powders, capsules, suppositories, suspensions, liposomes, and aerosols.
- the SARS-CoV-2- inhibiting agent may be prepared as a solution using any of a variety of methodologies. For example, SARS-CoV-2-inhibiting agent can be dissolved with acid (e.g., 1 M HCI) and diluted with a sufficient volume of a solution of 5% dextrose in water (D5W) to yield the desired final concentration of SARS-Cov-2-inhibiting agent (e.g., about 15 mM).
- acid e.g., 1 M HCI
- D5W dextrose in water
- a solution of D5W containing about 15 mM HCI can be used to provide a solution of the SARS-CoV-2-inhibiting agent at the appropriate concentration.
- the SARS-Cov-2-inhibiting agent can be prepared as a suspension using, for example, a 1% solution of carboxymethylcellulose (CMC).
- compositions are known or may be routinely determined by those skilled in the art.
- pharmaceutical preparations may be prepared following conventional techniques of the pharmaceutical chemist involving steps such as mixing, granulating, and compressing when necessary for tablet forms, or mixing, filling and dissolving the ingredients as appropriate, to give the desired products for intravenous, oral, parenteral, topical, intravaginal, intranasal, intrabronchial, intraocular, intraaural, and/or rectal administration.
- compositions of the invention may also include suitable excipients, diluents, vehicles, and carriers, as well as other pharmaceutically active agents, depending upon the intended use.
- Solid or liquid pharmaceutically acceptable carriers, diluents, vehicles, or excipients may be employed in the pharmaceutical compositions.
- Illustrative solid carriers include starch, lactose, calcium sulfate dihydrate, terra alba, sucrose, talc, gelatin, pectin, acacia, magnesium stearate, and stearic acid.
- Illustrative liquid carriers include syrup, peanut oil, olive oil, saline solution, and water.
- the carrier or diluent may include a suitable prolonged-release material, such as glyceryl monostearate or glyceryl distearate, alone or with a wax.
- a suitable prolonged-release material such as glyceryl monostearate or glyceryl distearate, alone or with a wax.
- the preparation may be in the form of a syrup, elixir, emulsion, soft gelatin capsule, sterile injectable liquid (e.g., solution), or a nonaqueous or aqueous liquid suspension.
- a dose of the pharmaceutical composition may contain at least a therapeutically effective amount of a SARS-CoV-2-inhibiting agent and preferably is made up of one or more pharmaceutical dosage units.
- the selected dose may be administered to a mammal, for example, a human patient, in need of treatment mediated by inhibition of SARS-Cov-2 related coronavirus activity, by any known or suitable method of administering the dose, including topically, for example, as an ointment or cream; orally; rectally, for example, as a suppository; parenterally by injection; intravenously; or continuously by intravaginal, intranasal, intrabronchial, intraaural, or intraocular infusion.
- therapeutically effective amount and “effective amount” are intended to mean the amount of an inventive agent that, when administered to a mammal in need of treatment, is sufficient to effect treatment for injury or disease conditions alleviated by the inhibition of SARS-CoV-2 viral replication.
- the amount of a given SARS-CoV-2-inhibiting agent used in the method of the invention that will be therapeutically effective will vary depending upon factors such as the particular SARS- CoV-2-inhibiting agent, the disease condition and the severity thereof, the identity and characteristics of the mammal in need thereof, which amount may be routinely determined by those skilled in the art.
- the actual dosages of the SARS-CoV-2-inhibiting agents used in the pharmaceutical compositions of this invention will be selected according to the properties of the particular agent being used, the particular composition formulated, the mode of administration and the particular site, and the host and condition being treated. Optimal dosages for a given set of conditions can be ascertained by those skilled in the art using conventional dosage-determination tests.
- a dose that may be employed is from about 0.01 to about 1000 mg/kg body weight, preferably from about 0.1 to about 500 mg/kg body weight, and even more preferably from about 1 to about 500 mg/kg body weight, with courses of treatment repeated at appropriate intervals.
- the compounds employed in the methods of the invention can be administered orally in known oral dosage forms such as tablets, capsules or oral suspensions.
- the oral administration of the compounds to the patient can occur one, two, three or four times a day with each dose containing 10 mg, 25 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg or 1000 mg.
- a dose of up to 5 grams per day of the compound may be employed. Intravenous administration can occur for intermittent periods during a day or continuously over a 24-hour period.
- cytochrome P450-inhibiting amount and “cytochrome P450 enzyme activity-inhibiting amount”, as used herein, refer to an amount of a compound required to decrease the activity of cytochrome P450 enzymes or a particular cytochrome P450 enzyme isoform in the presence of such compound. Whether a particular compound of decreases cytochrome P450 enzyme activity, and the amount of such a compound required to do so, can be determined by methods know to those of ordinary skill in the art and the methods described herein.
- Protein functions required for coronavirus replication and transcription are encoded by the so-called “replicase” gene. Two overlapping polyproteins are translated from this gene and extensively processed by viral proteases. The C-proximal region is processed at eleven conserved interdomain junctions by the coronavirus main or “SC- like protease.
- the name “3C-like” protease derives from certain similarities between the coronavirus enzyme and the well-known picornavirus 3C proteases. These include substrate preferences, use of cysteine as an active site nucleophile in catalysis, and similarities in their putative overall polypeptide folds.
- a comparison of the amino acid sequence of the SARS-Cov-2-associated coronavirus 3C-like protease shows the amino acid sequences have approximately 96% shared homology.
- Amino acids of the substrate in the protease cleavage site are numbered from the N to the C terminus as follows: -P3-P2-P1-PT-P2’-P3’, with cleavage occurring between the P1 and PT residues (Schechter & Berger, 1967). Substrate specificity is largely determined by the P2, P1 and PT positions. Coronavirus main protease cleavage site specificities are highly conserved with a requirement for glutamine at P1 and a small amino acid at PT ( Journal of General Virology , 83, pp. 595-599 (2002)).
- the compounds used in the methods of the present invention can be prepared as set forth in Examples 36, 38, 40-45 and 47-52 of W02005/113580 and as reproduced below.
- HPLC chromatography is referred to in the preparations and examples below, the general conditions used, unless otherwise indicated, are as follows.
- the column used is a ZORBAXp RXC18 column (manufactured by Hewlett Packard) of 150 mm distance and 4.6 mm interior diameter.
- the samples are run on a Hewlett Packard- 1100 system A gradient solvent method is used running 100 percent ammonium acetate / acetic acid buffer (0.2 M) to 100 percent acetonitrile over 10 minutes.
- the system then proceeds on a wash cycle with 100 percent acetonitrile for 1.5 minutes and then 100 percent buffer solution for 3 minutes.
- the flow rate over this period is a constant 3 ml/minute.
- DMF refers to A/,/ ⁇ /-dimethylformamide.
- DMSO refers to dimethylsulfoxide.
- CsF refers to cesium fluoride.
- ESI electrospray ionization, mg is milligram, mmol is millimole, M is molar, MHz is megahertz, MPLC is medium pressure liquid chromatography, MS is mass spectrometry, HRMS is high resolution mass spectrometry and RT is room temperature.
- Example 12 (Described as Example 49 in WO20Q5/1135801: (3S1-3-(f/V-r(4-methoxy-1H-indol-2- yl)carbonyll-L-leucyl ⁇ amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yllbutyl 2,6- dimethoxybenzoate
- FDVVRQCSGVTFQ A homology model was built from a crystal structure of SARS 3C-like protease in Pfizer’s database using Schrodinger’s PRIME 3 . Minimization of the homology model in complex with ligands was used to remove clashes with ligands containing benzothiazole ketones or a benzyl side chains after examining the protein conformations of other SARS 3C-like crystal structures with these ligand moieties. Relaxation of residues in the 185-190 loop, His41 and Met49 to led to three differently minimized versions of the homology model. The catalytic Cys was mutated to Gly (C145G) to facilitate AGDOCK core docking and subsequent scoring without a clash with the catalytic Cys.
- Homology model The sequence homology between SARS-CoV and SARS-CoV-2 is 96.1%. There are 12 of 306 residues that are different (T35V, A46S, S65N, L86V, R88K, S94A, H134F, K180N, L202V, A267S, T285A & I286L highlighted in cyan in Figure A) which translates to 96.1 % identity.
- the ligand associated with the crystal structure used to build the homology model is Compound B, N-((1S)-1- ⁇ [((1S)-3-hydroxy-2-oxo-1- ⁇ [(3S)-2-oxopyrrolidin-3- yl]methyl ⁇ propyl)amino]carbonyl ⁇ -3-methylbutyl)-4-methoxy-1H-indole-2-carboxamide.
- Figure 1 depicts the residue differences between SARS-CoV and SARS-CoV-2. Residue changes are highlighted in cyan in this ribbon depiction of SARS-CoV-2 homology model.
- the Compound B N-((1S)-1- ⁇ [((1S)-3-hydroxy-2-oxo-1- ⁇ [(3S)-2- oxopyrrolidin-3-yl]methyl ⁇ propyl)amino]carbonyl ⁇ -3-methylbutyl)-4-methoxy-1H-indole-2- carboxamide, location is shown in magenta.
- the approximately 96% homology of SARS-CoV-2 3CL to SARS-CoV 3CL and the similarity between ligands allows a comparison of the RMSD between the peptide backbone of xtal ligand in SARS-CoV (see Figure 2) and the docked ligand in the SARS-CoV-2 3CL model.
- the core-docked ligand RMSD to the peptide backbone did not differ by more than 0.32A (average 0.28A). See Figure 2 for an example.
- Binding site of homology model of SARS-CoV-2 3CL with a core-docked ligand (Compound B, N-((1S)-1- ⁇ [((1S)-3-hydroxy-2-oxo-1- ⁇ [(3S)-2-oxopyrrolidin-3- yl]methyl ⁇ propyl)amino]carbonyl ⁇ -3-methylbutyl)-4-methoxy-1H-indole-2-carboxamide) present (purple carbons, red oxygen, blue nitrogen).
- the docking result(s) in Table 2 below indicate that the compound(s) have predicted affinities (AGbind, kcal/mol) that are generally commensurate with target recognition and binding.
- the effective potency can differ from the DQ binding terms depending on several factors such as cell uptake, efflux, cofactor competition or substrate competition. Table 2:
- the compounds described above are analyzed by a FRET biochemical assay and by in vitro virological assays using cell culture techniques.
- the ability of compounds to protect cells against infection by the SARS coronavirus is measured by a cell viability assay similar to that described in Borenfreund, E., and Puerner, J. 1985. Toxicity determined in vitro by morphological alterations and neutral red absorption Toxicology Letters. 24:119-124, utilizing neutral red staining as an endpoint. Briefly, medium containing appropriate concentrations of compound or medium only is added to Vero cells. Cells are infected with SARS-associated virus or mock-infected with medium only. One to seven days later, the medium is removed and medium containing neutral red is added to the test plates.
- CC50 50% cytotoxicity concentration
- the ability of compounds to protect cells against infection by the SARS-CoV-2 coronavirus can also be measured by a cell viability assay utilizing luciferase to measure intracellular ATP as an endpoint. Briefly, medium containing appropriate concentrations of compound or medium only is added to Vero cells. Cells are infected with SARS-CoV-2 virus or mock-infected with medium only. One to seven days later, the medium is removed and the amount of intracellular ATP is measured as per Promega Technical Bulletin No. 288: CellTiter-Glo® Luminescent Cell Viability Assay (Promega, Madison, Wl).
- the CellTiter-Glo® reagent is added to the test plates and following incubation at 37°C for 1.25 hours, the amount of signal is quantified using a luminometer at 490nm. Data is expressed as the percent of luminescent signal from wells of compound-treated cells compared to the luminescent signal from wells of uninfected, compound-free cells.
- the fifty percent effective concentration (EC50) is calculated as the concentration of compound that increases the percent of the luminescent signal from infected, compound-treated cells to 50% of the luminescent signal from uninfected, compound-free cells.
- the 50% cytotoxicity concentration (CC50) is calculated as the concentration of compound that decreases the percentage of the luminescent signal from uninfected, compound-treated cells to 50% of the luminescent signal from uninfected, compound-free cells.
- the therapeutic index is calculated by dividing the cytotoxicity (CC50) by the antiviral activity (EC50).
- XTT and PMS are added to the test plates and following incubation at 37°C for two hours the amount of formazan produced is quantified spectrophotometrically at 540nm. Data is expressed as the percent of formazan produced in compound-treated cells compared to formazan produced in wells of compound-free cells.
- the 50% cytotoxicity concentration (CC50) is calculated as the concentration of compound that decreases the percentage of formazan produced in uninfected, compound-treated cells to 50% of that produced in uninfected, compound-free cells.
- the 50% cytotoxicity concentration (CC50) is calculated as the concentration of compound that decreases the percentage of formazan produced in uninfected, compound-treated cells to 50% of that produced in uninfected, compound-free cells.
- the therapeutic index is calculated by dividing the cytotoxicity (CC50) by the antiviral activity (EC50).
- the proteolytic activity of the main protease, 3CLpro, of SARS-CoV-2 was monitored using a continuous fluorescence resonance energy transfer (FRET) assay.
- the SARS- CoV-2 3CLpro assay measures the activity of full-length SARS-CoV-2 3CL protease to cleave a synthetic fluorogenic substrate peptide with the following sequence: Dabcyl- KTSAVLQ-SGFRKME-Edans modelled on a consensus peptide (V. Grum-Tokars et al. Evaluating the 3C-like protease activity of SARS-coronavirus: recommendations for standardized assays for drug discovery. Virus Research 133 (2008) 63-73).
- the fluorescence of the cleaved Edans peptide is measured using a fluorescence intensity protocol on a Flexstation reader (Molecular Devices).
- the fluorescent signal is reduced in the present of PF-835231, a potent inhibitor of SARS-CoV-2 3CLpro.
- the assay reaction buffer contained 20 mM Tris-HCI (pH 7.3), 100 nM NaCI, 1 mM EDTA and 25 mM peptide substrate. Enzyme reactions were initiated with the addition of 15 nM SARS-CoV-2 3CL protease and allowed to proceed for 60 minutes at 23 °C.
- Percent inhibition or activity was calculated based on control wells containing no compound (0% inhibition/100% activity) and a control compound (100% inhibition/0% activity).
- ICso values were generated using a four- parameter fit model using ABASE software (I DBS). Ki values were fit to the Morrison equation with the enzyme concentration parameter fixed to 15 nM, the Km parameter fixed to 14 pM and the substrate concentration parameter fixed to 25 pM using ABASE software (I DBS).
- Proteolytic activity of SARS-CoV-2 Coronavirus 3CL protease is measured using a continuous fluorescence resonance energy transfer assay.
- the SARS-CoV-2 3CL pro FRET assay measures the protease catalyzed cleavage of TAMRA- SITSAVLQSGFRKMK-(DABCYL)-OH to TAMRA - SITSAVLQ and SGFRKMK(DABCYL)-OH.
- the fluorescence of the cleaved TAMRA (ex. 558 nm / em. 581 nm) peptide was measured using a TECAN SAFI RE fluorescence plate reader over the course of 10 min.
- Typical reaction solutions contained 20 mM HEPES (pH 7.0), 1 mM EDTA, 4.0 pM FRET substrate, 4% DMSO and 0.005% Tween-20. Assays were initiated with the addition of 25 nM SARS 3CL pro (nucleotide sequence 9985-10902 of the Urbani strain of SARS coronavirus complete genome sequence (NCBI accession number AY278741)). Percent inhibition was determined in duplicate at 0.001 mM level of inhibitor. Data was analyzed with the non-linear regression analysis program Kalidagraph using the equation:
- FU offset+ (limit)(1- e (kobs H) where offset equals the fluorescence signal of the un-cleaved peptide substrate, and limit equals the fluorescence of fully cleaved peptide substrate.
- the kobs is the first order rate constant for this reaction, and in the absence of any inhibitor represents the utilization of substrate.
- the calculated kobs represents the rate of inactivation of coronavirus 3C protease.
- the slope (kobs/ 1) of a plot of kobs vs. [I] is a measure of the avidity of the inhibitor for an enzyme. For very fast irreversible inhibitors, kobs/l is calculated from observations at only one or two [I] rather than as a slope.
Abstract
The invention relates to methods of treating COVID-19 in a patient by administering therapeutically effective amounts of certain SARS-CoV-2 inhibitor compounds or pharmaceutical compositions containing them to a patient in need thereof. The invention also relates to inhibiting SARS-CoV-2 coronavirus viral replication activity comprising contacting SARS-CoV-2-related coronavirus protease with a therapeutically effective amount of a SARS-Cov-2 protease inhibitor, such as a SARS-Cov-2 3CL protease inhibitor and compositions comprising the same.
Description
Method of Treating COVID-19 Background of the Invention
The invention relates to methods of inhibiting viral replication activity comprising contacting a SARS-Cov-2-related 3C-like (“3CL”) proteinase with a therapeutically effective amount of a SARS-Cov-2-related 3C-like protease inhibitor. The invention also relates to methods of treating Coronavirus Disease 2019 (“COVID-19”) in a patient by administering a therapeutically effective amount of a SARS-Cov-2-related 3C-like protease inhibitor to a patient in need thereof. The invention further relates to methods of treating COVID-19 in a patient, the method comprising administering a pharmaceutical composition comprising a therapeutically effective amount of the SARS- Cov-2-related 3C-like protease inhibitor to a patient in need thereof.
A worldwide outbreak of Coronavirus Disease 2019 (“COVID-19”) has been associated with exposures originating in late 2019 in Wuhan, Hubei Province, China.
By early April 2020 the outbreak of COVID-19 had evolved into a global pandemic with approximately one million people having been confirmed as infected and resulting in approximately 50,000 deaths and by January 2021 approximately 100 million people had been infected globally with over 2 million deaths. The causative agent for COVID- 19 has been identified as a novel coronavirus which has been named Severe Acute Respiratory Syndrome Corona Virus 2 (“SARS-CoV-2”). The genome sequence of SARS-CoV-2 has been sequenced from isolates obtained from nine patients in Wuhan, China and has been found to be of the subgenus Sarbecovirus of the genus Betacoronovirus. Lu, R. et al. The Lancet, January 29, 2020; http://doi . org/10.1016/S0140-6736(20) . The sequence of SARS-CoV-2 was found to have 88% homology with two bat-derived SARS-like coronaviruses, bat-SL-CoVZC45 and bat-SL-CoVZXC21 which were collected in 2018 in Zhoushan, eastern China. SARS-CoV-2 was also found to share about 79% homology with Severe Acute Respiratory Syndrome Corona Virus (“SARS-CoV”), the causative agent of the SARS outbreak in 2002-2003, and about 50% homology with Middle East Respiratory Syndrome Coronavirus (“MERS-CoV”), the causative agent of a respiratory viral outbreak originating in the Middle East in 2012. Based on a recent analysis of 103 sequenced genomes of SARS-CoV-2 it has been proposed that SARS-CoV-2 can be divided into two major types (L and S types) with the S type being ancestral and the L type having evolved from the S-type. Lu, J.; Cui, J. et al. On the origin and continuing
evolution of SARS-CoV-2; http://doi.org/10.1093/nsr/nwaa036. The S and L types can be clearly defined by just two tightly linked SNPs at positions 8,782 (orf1ab\ T8517C, synonymous) and 28,144 ( ORF8\ C251T, S84L). In the 103 genomes analyzed approximately 70% were of the L-type and approximately 30% were of the S-type. It is unclear if the evolution of the L-type from the S-type occurred in humans or through a zoonotic intermediate but it appears that the L-type is more aggressive than the S-type and human interference in attempting to contain the outbreak may have shifted the relative abundance of the L and S types soon after the SARS-CoV-2 outbreak began. The discovery of the proposed S- and L- subtypes of SARS-CoV-2 raises the possibility that an individual could potentially be infected sequentially with the individual subtypes or be infected with both subtypes at the same time. In view of this evolving threat there is an acute need in the art for an effective treatment for COVID-19 and for methods of inhibiting replication of the SARS-CoV-2 coronavirus.
Recent evidence clearly shows that the newly emerged coronavirus SARS-CoV- 2, the causative agent of COVID-19 (Centers for Disease Control, CDC) has acquired the ability of human to human transmission leading to community spread of the virus. The sequence of the SARS-CoV-2 receptor binding domain (“RBD”), including its receptor-binding motif (RBM) that directly contacts the angiotensin 2 receptor, ACE2, is similar to the RBD and RBM of SARS-CoV, strongly suggesting that SARS-CoV-2 uses ACE2 as its receptor. Yushun Wan, Y.; Shang, J.; Graham, R.; 2, Baric, R.S.; Li, F.; Receptor recognition by novel coronavirus from Wuhan: An analysis based on decade- long structural studies of SARS; J. Virol. 2020; doi:10.1128/JVI.00127-20. Several critical residues in SARS-CoV-2 RBM (particularly Gin493) provide favorable interactions with human ACE2, consistent with SARS-CoV-2's capacity for human cell infection. Several other critical residues in SARS-CoV-2’s RBM (particularly Asn501) are compatible with, but not ideal for, binding human ACE2, suggesting that SARS-CoV-2 uses ACE2 binding in some capacity for human-to-human transmission. More recent evidence indicates that a unique RRAR (Arginine-Arginine-Alanine-Arginine) sequence in the spike protein of SARS-CoV-2 acts as a furin cleavage site which enhances receptor affinity and leads to higher membrane fusion efficiency thereby resulting in higher transmissibility of SARS-CoV-2 when compared to all other subtype B beta- coronaviruses, none of which contain the RRAR sequence. Wu, C. et al. iScience 23, 101642, October 23, 2020.
Coronavirus replication and transcription function is encoded by the so-called “replicase” gene (Ziebuhr, J., Snijder, E.J., and Gorbaleya, A.E.; Virus-encoded
proteinases and proteolytic processing in Nidovirales. J. Gen. Virol. 2000, 81, 853-879; and Fehr, A.R.; Perlman, S.; Coronaviruses: An Overview of Their Replication and Pathogenesis Methods Mol Biol. 2015; 1282: 1-23. doi:10.1007/978-1-4939-2438-7_1), which consists of two overlapping polyproteins that are extensively processed by viral proteases. The C-proximal region is processed at eleven conserved interdomain junctions by the coronavirus main or “3C-like” protease (Ziebuhr, Snijder, Gorbaleya, 2000 and Fehr, Perlman et al. , 2015). The name “3C-like” protease derives from certain similarities between the coronavirus enzyme and the well-known picornavirus 3C proteases. These include substrate preferences, use of cysteine as an active site nucleophile in catalysis, and similarities in their putative overall polypeptide folds. The SARS-CoV-2 3CL protease sequence (Accession No. YP_009725301.1) has been found to share 96.08% homology when compared with the SARS-CoV 3CL protease (Accession No. YP_009725301.1) Xu, J.; Zhao, S.; Teng, T.; Abdalla, A.E.; Zhu, W.; Xie, L; Wang, Y.; Guo, X.; Systematic Comparison of Two Animal-to-Human Transmitted Human Coronaviruses: SARS-CoV-2and SARS-CoV; Viruses 2020, 12, 244; doi:10.3390/v12020244. Very recently Hilgenfeld and colleagues published a high- resolution X-ray structure of the SARS-CoV-2 coronavirus main protease (3CL) Zhang, L.; Lin, D.; Sun, X.; Rox, K.; Hilgenfeld, R.; X-ray Structure of Main Protease of the Novel Coronavirus SARS-CoV-2 Enables Design of a-Ketoamide Inhibitors; bioRxiv preprint doi: https://doi.orq/10.T101/2020.02.17.952879. The structure indicates that there are differences when comparing the 3CL proteases of SARS-CoV-2 and SARS- CoV. In the SARS-CoV but not in the SARS-CoV-2 3CL protease dimer, there is a polar interaction between the two domains III involving a 2.60-A hydrogen bond between the side-chain hydroxyl groups of residue Thr285 of each protomer, and supported by a hydrophobic contact between the side-chain of lie286 and Thr285 Cy2. In the SARS-CoV-2 3CL, the threonine is replaced by alanine, and the isoleucine by leucine when compared with the same residues in the SARS-CoV 3CL. The Thr285Ala replacement observed in the SARS-CoV-2 3CL protease allows the two domains III to approach each other somewhat closer (the distance between the Cot atoms of residues 285 in molecules A and B is 6.77 A in SARS-CoV 3CL protease and 5.21 A in SARS- CoV-2 3CL protease and the distance between the centers of mass of the two domains III shrinks from 33.4 A to 32.1 A). In the active site of SARS-CoV-2 3CL Cys145 and His 41 form a catalytic dyad which when taken together with a with a buried water molecule that is hydrogen bonded to His41 can be considered to constitute a catalytic triad of the SARS-CoV-2 3CL protease. In view of the ongoing SARS-CoV-2 spread which has
caused the current worldwide COVID-19 outbreak it is desirable to have new methods of inhibiting SARS-CoV-2 viral replication and of treating COVID-19 in patients.
Summary of The Invention
The following are embodiments of the present invention, referred to as E followed by a number, and are not to be construed in a limiting manner.
E1 is a method of treating COVID-19 in a patient, the method comprising administering to a patient in need thereof a therapeutically effective amount of a compound selected from the group consisting of: (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate; (3S)-3 -({N- [(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3- yl]butyl pivalate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo- 4-[(3S)-2-oxopyrrolidin-3-yl]butyl benzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-methylbenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-fluorobenzoate; (3S)-3-({/\/-[(4-methoxy-1 /-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-cyanobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methoxy benzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-chlorobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dimethyl benzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-lndol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6- difluorobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo- 4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6-dimethoxy benzoate; (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-chloro-2- hydroxybenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2- oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6-dichlorobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-cyano-2- fluorobenzoate; and (3S)-3-({/\/-[(4-methoxy-1 /-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2- oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2-cyanobenzoate; or a pharmaceutically acceptable salt thereof.
E2 is the method of E1 wherein the compound or pharmaceutically acceptable salt thereof is administered orally, by inhalation or intranasally. E3 is the method of E2 wherein the compound or pharmaceutically acceptable salt thereof is administered
orally. E4 is the method of E2 wherein the compound or pharmaceutically acceptable salt thereof is administered intranasally. E5 is the method of E1 wherein the compound or pharmaceutically acceptable salt thereof is administered sublingually. E6 is the method of any one of E1 to E5 wherein the compound or pharmaceutically acceptable salt thereof is administered one to four times over a 24-hour period. E7 is the method of any one of E1 to E7 further comprising the administration of one or more additional therapeutic agents. E8 is the method of E7 wherein the additional therapeutic agent is selected from the group consisting of azithromycin and remdesivir.
E9 is a method of inhibiting or preventing SARS-CoV-2 viral replication comprising contacting a SARS-CoV-2 coronavirus protease with a therapeutically effective amount of a compound selected from the group consisting of: (3S)-3-({/\/-[(4-methoxy-1/-/-indol- 2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate; (3S)-3- ({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3- yl]butyl pivalate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo- 4-[(3S)-2-oxopyrrolidin-3-yl]butyl benzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-methylbenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-fluorobenzoate; (3S)-3-({/\/-[(4-methoxy-1 /-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-cyanobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methoxy benzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-chlorobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dichlorobenzoate; (3S)-3-({/\/-[(4-methoxy-1 /-/-indol-2-yl) carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6-dimethyl benzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-lndol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)- 2-oxopyrrolidin-3-yl]butyl 2,6-difluorobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6-dimethoxy benzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)- 2-oxopyrrolidin-3-yl]butyl 4-chloro-2-hydroxybenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol- 2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-cyano-2- fluorobenzoate; and (3S)-3-({/\/-[(4-methoxy-1 /-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2- oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2-cyanobenzoate; or a pharmaceutically acceptable salt thereof.
E10 is a method of inhibiting or preventing SARS-CoV-2 viral replication comprising contacting the SARS-CoV-2 coronavirus 3CL protease with a therapeutically effective amount of a compound selected from the group consisting of: (3S)-3-({/\/-[(4-methoxy- 1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl pivalate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L- leucyl}amino)-2-oxo-4-[(3S)-2-oxo pyrrolidin-3-yl]butyl benzoate; (3S)-3-({/V-[(4- methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-methylbenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2- oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-fluorobenzoate; (3S)-3-({/\/-[(4-methoxy-1 H- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4- cyanobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo- 4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-methoxy benzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol- 2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-chlorobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dichlorobenzoate; (3S)-3-({/\/-[(4-methoxy-1 /-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6- dimethylbenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-lndol-2-yl)carbonyl]-L-leucyl}amino)-2- oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6-difluorobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6- dimethoxybenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2- oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-chloro-2-hydroxybenzoate; (3S)-3-({/V-[(4- methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-cyano-2-fluorobenzoate; and (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L- leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2-cyanobenzoate; or a pharmaceutically acceptable salt thereof.
E11 is a method of treating COVID-19 in a patient, the method comprising administering to a patient in need thereof a pharmaceutical composition, the pharmaceutical composition comprising a therapeutically effective amount of a compound selected from the group consisting of: (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate; (3S)-3 -({N- [(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3- yl]butyl pivalate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo- 4-[(3S)-2-oxopyrrolidin-3-yl]butyl benzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-methylbenzoate;
(3S)-3-({/V-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-fluorobenzoate; (3S)-3-({/\/-[(4-methoxy-1 /-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-cyanobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methoxy benzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-chlorobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dichlorobenzoate; (3S)-3-({/\/-[(4-methoxy-1 /-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6- dimethylbenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-lndol-2-yl)carbonyl]-L-leucyl}amino)-2- oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6-difluorobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6- dimethoxybenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2- oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-chloro-2-hydroxybenzoate; (3S)-3-({/V-[(4- methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-cyano-2-fluorobenzoate; and (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L- leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2-cyanobenzoate; or a pharmaceutically acceptable salt thereof together with a pharmaceutically acceptable carrier E12 is the method of E11 wherein the pharmaceutical composition further comprises one or more additional therapeutic agent. E13 is the method of E12 wherein the one or more additional therapeutic agent is selected from the group consisting of azithromycin and remdesivir. E14 is the method of any one of E11 to E13 wherein the pharmaceutical composition is administered orally. E15 is the method of any one of E11 to E13 wherein the pharmaceutical composition is administered by inhalation or intranasally.
E16 is a compound selected from the group consisting of: (3S)-3-({/\/-[(4-methoxy- 1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl pivalate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L- leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl benzoate; (3S)-3-({/\/-[(4-methoxy- 1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4- methylbenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo- 4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-fluorobenzoate; (3S)-3-({/\/-[(4-methoxy-1 /-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-cyanobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-
oxopyrrolidin-3-yl]butyl 4-methoxybenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-chlorobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dichlorobenzoate; (3S)-3-({/\/-[(4-methoxy-1 /-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6- dimethylbenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-lndol-2-yl)carbonyl]-L-leucyl}amino)-2- oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6-difluorobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6- dimethoxybenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2- oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-chloro-2-hydroxybenzoate; (3S)-3-({/V-[(4- methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-cyano-2-fluorobenzoate; and (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L- leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2-cyanobenzoate; or a pharmaceutically acceptable salt thereof, for use in the treatment of COVID-19 in a patient.
E17 is a compound selected from the group consisting of: (3S)-3-({/\/-[(4-methoxy- 1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl pivalate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L- leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl benzoate; (3S)-3-({/\/-[(4-methoxy- 1/-/-indol-2-yl) carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4- methylbenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo- 4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-fluorobenzoate; (3S)-3-({/\/-[(4-methoxy-1 /-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-cyanobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methoxybenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-chlorobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dichlorobenzoate; (3S)-3-({/\/-[(4-methoxy-1 /-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6- dimethylbenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-lndol-2-yl)carbonyl]-L-leucyl}amino)-2- oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6-difluorobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6- dimethoxybenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2- oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-chloro-2-hydroxybenzoate; (3S)-3-({/V-[(4-
methoxy-1H-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-cyano-2-fluorobenzoate; and (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L- leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2-cyanobenzoate; or a pharmaceutically acceptable salt thereof, for use in inhibiting or preventing SARS-CoV- 2 viral replication
E18 is the method of E7 or E12 wherein the one or more additional agent is selected from the group consisting of remdesivir, galidesivir, favilavir/avifavir, mulnupiravir (MK- 4482/EIDD 2801), AT-527, AT-301, BLD-2660, favipiravir, camostat, SLV213 emtrictabine/tenofivir, clevudine, dalcetrapib, boceprevir, ABX464, dexamethasone, hydrocortisone, convalescent plasma, gelsolin (Rhu-p65N), monoclonal antibodies, regdanvimab (Regkirova), ravulizumab (Ultomiris), VIR-7831/VIR-7832, BRII-196/BRII- 198, COVI-AMG/COVI DROPS (STI-2020), bamlanivimab (LY-CoV555), mavrilimab, leronlimab (PRO140), AZD7442, lenzilumab, infliximab, adalimumab, JS 016, STI-1499 (COVIGUARD), lanadelumab (Takhzyro), canakinumab (llaris), gimsilumab, otilimab, casirivimab/imdevimab (REGN-Cov2), MK-7110 (CD24Fc/SACCOVID), heparin, apixaban, tocilizumab (Actemra), sarilumab (Kevzara), apilimod dimesylate, DNL758, PB1046, dapaglifozin, abivertinib, ATR-002, bemcentinib, acalabrutinib, baricitinib, losmapimod, famotidine, niclosamide and diminazene.
E19 is the method of E18 wherein the one or more additional agent is selected from the group consisting of remdesivir, dexamethasone, malnupiravir, bamlanivimab and baricitinib.
It is to be understood that the method of treatment embodiments of the invention can also to be construed as medical use-type embodiments (such as E16 above) or alternatively second medical use-type embodiments (such as E20 below).
E20 is a compound selected from the group consisting of: (3S)-3-({/\/-[(4-methoxy- 1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl pivalate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L- leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl benzoate; (3S)-3-({/\/-[(4-methoxy- 1/-/-indol-2-yl) carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4- methylbenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo- 4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-fluorobenzoate; (3S)-3-({/\/-[(4-methoxy-1 /-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-cyanobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methoxybenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-
yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-chlorobenzoate; (3S)-3-({/V-[(4-methoxy-1H-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dichlorobenzoate; (3S)-3-({/\/-[(4-methoxy-1 /-/-indol-2- yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6- dimethylbenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/-lndol-2-yl)carbonyl]-L-leucyl}amino)-2- oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6-difluorobenzoate; (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2,6- dimethoxybenzoate; (3S)-3-({/V-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2- oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-chloro-2-hydroxybenzoate; (3S)-3-({/V-[(4- methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 4-cyano-2-fluorobenzoate; and (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L- leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl 2-cyanobenzoate; or a pharmaceutically acceptable salt thereof, for use in the preparation of a medicament for the treatment of CGVID-19 in a patient.
Il ls to be understood that for embodiments E9, E10, E11, E16, E17 and E20 additional dependent embodiments analogous to embodiments E2 to E8 and E18 and E19 (which depend directly or indirectly from E1) can depend from each of E9, E10,
E11, E16, E17 and E20 and are included in the present invention.
The present invention also provides a method of treating a condition that is mediated by SARS-CoV-2 coronavirus 3C-like protease activity in a patient by administering to said patient a pharmaceutically effective amount of a SARS-CoV-2 protease inhibitor as described herein.
The present invention also provides a method of targeting SARS-CoV-2 inhibition as a means of treating indications caused by SARS-CoV-2-related viral infections.
The present invention also provides a method of identifying cellular or viral pathways interfering with the functioning of the members of which could be used for treating indications caused by SARS-CoV-2 infections by administering a SARS-CoV-2 protease inhibitor as described herein.
The present invention also provides a method of using SARS-CoV-2 protease inhibitors as described herein as tools for understanding mechanism of action of other SARS-CoV-2 inhibitors.
The present invention also provides a method of using SARS-CoV-2 3C-like protease inhibitors for carrying out gene profiling experiments for monitoring the up or
down regulation of genes for the purposed of identifying inhibitors for treating indications caused by SARS-CoV-2 infections such as COVID-19.
The present invention further provides a pharmaceutical composition for the treatment of COVID-19 in a mammal containing an amount of a SARS-CoV-2 3C-like protease inhibitor that is effective in treating COVID-19 and a pharmaceutically acceptable carrier.
Brief Description of the Drawings
Figure 1 depicts the residue differences between SARS-CoV and SARS-CoV-2, with an inhibitor compound shown at the active site.
Figure 2 depicts binding site of homology model of SARS-CoV-2 3CL with a core- docked ligand (Compound B, N-((1S)-1-{[((1S)-3-hydroxy-2-oxo-1-{[(3S)-2-oxopyrrolidin- 3-yl]methyl}propyl)amino]carbonyl}-3-methylbutyl)-4-methoxy-1H-indole-2- carboxamide).
Detailed Description of The Invention
For the purposes of the present invention, as described and claimed herein, the following terms are defined as follows:
As used herein, the terms “comprising” and “including” are used in their open, non-limiting sense. The term “treating”, as used herein, unless otherwise indicated, means reversing, alleviating, inhibiting the progress of, or preventing the disorder of condition to which such term applies, or one or more symptoms of such disorder or condition. In the methods of treating COVID-19 it is to be understood that COVID-19 is the disease caused in patients by infection with the SARS-CoV-2 virus. The SARS- CoV-2 virus is to be understood to encompass the initially discovered strain of the virus as well as mutant strains which emerge, such as but not limited to, strains such as B.1.1.7 (UK variant), B.1.351 (South African variant) and P.1 (Brazilian variant). The term “treatment”, as used herein, unless otherwise indicated, refers to the act of treating as “treating” is defined immediately above.
The phrase “pharmaceutically acceptable salts(s)”, as used herein, unless otherwise indicated, includes salts of acidic or basic groups which may be present in the compounds described herein. The compounds used in the methods of the invention that are basic in nature are capable of forming a wide variety of salts with various
inorganic and organic acids. The acids that may be used to prepare pharmaceutically acceptable acid addition salts of such basic compounds are those that form non-toxic acid addition salts, i.e., salts containing pharmacologically acceptable anions, such as the acetate, benzenesulfonate, benzoate, bicarbonate, bisulfate, bitartrate, borate, bromide, calcium edetate, camsylate, carbonate, chloride, clavulanate, citrate, dihydrochloride, edetate, edislyate, estolate, esylate, ethylsuccinate, fumarate, gluceptate, gluconate, glutamate, glycollylarsanilate, hexyl resorcinate, hydrabamine, hydrobromide, hydrochloride, iodide, isethionate, lactate, lactobionate, laurate, malate, maleate, mandelate, mesylate, methylsulfate, mucate, napsylate, nitrate, oleate, oxalate, pamoate (embonate), palmitate, pantothenate, phosphate/diphosphate, polygalacturonate, salicylate, stearate, subacetate, succinate, tannate, tartrate, teoclate, tosylate, triethiodode, and valerate salts.
With respect to the compounds used in the methods of the invention, if the compounds also exist as tautomeric forms then this invention relates to the use of all such tautomers and mixtures thereof.
The subject invention also includes methods of treatment of COVID-19 and methods of inhibiting SARS-CoV-2 with isotopically-labelled compounds, which are identical to those recited herein, but for the fact that one or more atoms are replaced by an atom having an atomic mass or mass number different from the atomic mass or mass number usually found in nature. Examples of isotopes that can be incorporated into compounds of the invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine and chlorine, such as 2H, 3H, 13C, 14C, 15N, 180, 170, 31 P, 32P, 35S, 18F, and 36CI, respectively. Compounds of the present invention, prodrugs thereof, and pharmaceutically acceptable salts of said compounds or of said prodrugs which contain the aforementioned isotopes and/or isotopes of other atoms are with the scope of this invention. Certain isotopically-labelled compounds of the present invention, for example those into which radioactive isotopes such as 3H and 14C are incorporated, are useful in drug and/or substrate tissue distribution assays. Tritiated, i.e., 3H, and carbon-14, i.e., 14C, isotopes are particularly preferred for their ease of preparation and detectability. Further, substitution with heavier isotopes such as deuterium, i.e., 2H, can afford certain therapeutic advantages resulting from greater metabolic stability, for example increased in vivo half-life or reduced dosage requirements and, hence, may be preferred in some circumstances. Isotopically labelled compounds used in the methods of this invention and prodrugs thereof can generally be prepared by carrying out the procedures for
preparing the compounds disclosed in the art by substituting a readily available isotopically labelled reagent for a non-isotopically labelled reagent.
This invention also encompasses methods using pharmaceutical compositions and methods of treating COVID-19 infections through administering prodrugs of compounds of the invention. Compounds having free amido or hydroxy groups can be converted into prodrugs. Prodrugs include compounds wherein an amino acid residue, or a polypeptide chain of two or more (e.g., two, three or four) amino acid residues is covalently joined through an ester bond to a hydroxy of compounds used in the methods of this invention. The amino acid residues include but are not limited to the 20 naturally occurring amino acids commonly designated by three letter symbols and also includes 4-hydroxyproline, hydroxylysine, demosine, isodemosine, 3-methylhistidine, norvalin, beta-alanine, gamma-aminobutyric acid, citrulline homocysteine, homoserine, ornithine and methionine sulfone. Additional types of prodrugs are also encompassed. For instance, free hydroxy groups may be derivatized using groups including but not limited to hemisuccinates, phosphate esters, dimethylaminoacetates, and phosphoryloxymethyloxycarbonyls, as outlined in Advanced Drug Delivery Reviews, 1996, 19, 115. Carbamate prodrugs of hydroxy and amino groups are also included, as are carbonate prodrugs, sulfonate esters and sulfate esters of hydroxy groups. Derivatization of hydroxy groups as (acyloxy) methyl and (acyloxy)ethyl ethers wherein the acyl group may be an alkyl ester, optionally substituted with groups including but not limited to ether, amine and carboxylic acid functionalities, or where the acyl group is an amino acid ester as described above, are also encompassed. Prodrugs of this type are described in J. Med. Chem., 1996, 29, 10. Free amines can also be derivatized as amides, sulfonamides or phosphonamides. All of these prodrug moieties may incorporate groups including but not limited to ether, amine and carboxylic acid functionalities.
The compounds used in the methods of the invention can also be used in combination with other drugs. For example, dosing a SARS-CoV-2 coronavirus infected patient (i.e. a patient with COVID-19) with the SARS-CoV-2 coronavirus 3CL protease inhibitor of the invention and an interferon, such as interferon alpha, or a pegylated interferon, such as PEG-lntron or Pegasus, may provide a greater clinical benefit than dosing either the interferon, pegylated interferon or the SARS-CoV-2 coronavirus inhibitor alone. Other additional agents that can be used in the methods of the present invention include chloroquine, hydroxychloroquine, azithromycin and remdesivir.
Examples of greater clinical benefits could include a larger reduction in COVID-19 symptoms, a faster time to alleviation of symptoms, reduced lung pathology, a larger reduction in the amount of SARS-Cov-2 coronavirus in the patient (viral load), and decreased mortality.
The SARS-Cov-2 coronavirus infects cells which express p-glycoprotein. Some of the SARS-Cov-2 coronavirus 3CL protease inhibitors of the invention are p- glycoprotein substrates. Compounds which inhibit the SARS-Cov-2 coronavirus which are also p-glycoprotein substrates may be dosed with p-glycoprotein inhibitor.
Examples of p-glycoprotein inhibitors are verapamil, vinblastine, ketoconazole, nelfinavir, ritonavir or cyclosporine. The p-glycoprotein inhibitors act by inhibiting the efflux of the SARS-Cov-2 coronavirus inhibitors of the invention out of the cell. The inhibition of the p-glycoprotein based efflux will prevent reduction of intracellular concentrations of the SARS-Cov-2 coronavirus inhibitor due to p-glycoprotein efflux. Inhibition of the p-glycoprotein efflux will result in larger intracellular concentrations of the SARS-CoV-2 coronavirus inhibitors. Dosing a SARS-CoV-2 coronavirus infected patient with the SARS-CoV-2 coronavirus 3CL protease inhibitors of the invention and a p-glycoprotein inhibitor may lower the amount of SARS-Cov-2 coronavirus 3CL protease inhibitor required to achieve an efficacious dose by increasing the intracellular concentration of the SARS-CoV-2 coronavirus 3CL protease inhibitor.
Among the agents that may be used to increase the exposure of a mammal to a compound of the present invention are those that can as inhibitors of at least one isoform of the cytochrome P450 (CYP450) enzymes. The isoforms of CYP450 that may be beneficially inhibited included, but are not limited to CYP1A2, CYP2D6, CYP2C9, CYP2C19 and CYP3A4. The compounds used in the methods of the invention include compounds that may be CYP3A4 substrates and are metabolized by CYP3A4. Dosing a SARS-CoV-2 coronavirus infected patient with a SARS-CoV-2 coronavirus inhibitor which is a CYP3A4 substrate, such as SARS-CoV-2 coronavirus 3CL protease inhibitor, and a CYP3A4 inhibitor, such as ritonavir, nelfinavir or delavirdine, will reduce the metabolism of the SARS-Cov-2 coronavirus inhibitor by CYP3A4. This will result in reduced clearance of the SARS-CoV-2 coronavirus inhibitor and increased SARS-Cov-2 coronavirus inhibitor plasma concentrations. The reduced clearance and higher plasma concentrations may result in a lower efficacious dose of the SARS-CoV-2 coronavirus inhibitor.
Additional therapeutic agents that can be used in combination with the SARS-CoV-2 inhibitors in the methods of the present invention include the following:
PLpro inhibitors : Ribavirin, Valganciclovir, /3-Thymidine, Aspartame, Oxprenolol, Doxycycline, Acetophenazine, lopromide, Riboflavin, Reproterol, 2,2'-Cyclocytidine, Chloramphenicol, Chlorphenesin carbamate, Levodropropizine, Cefamandole, Floxuridine, Tigecycline, Pemetrexed, L(+)-Ascorbic acid, Glutathione, Hesperetin, Ademetionine, Masoprocol, Isotretinoin, Dantrolene, Sulfasalazine Anti-bacterial,
Silybin, Nicardipine, Sildenafil, Platycodin, Chrysin, Neohesperidin, Baicalin, Sugetriol- 3, 9- di acetate, (-)-Epigallocatechin gallate, Phaitanthrin D, 2-(3,4-Dihydroxyphenyl)-2- [[2-(3,4-dihydroxyphenyl)-3,4-dihydro-5,7-dihydroxy-2/-/-1-benzopyran-3-yl]oxy]-3,4- dihydro-2/-/-1-benzopyran-3,4,5,7-tetrol, 2,2-Di(3-indolyl)-3 -indolone, (S)- (1S,2R,4aS,5R,8aS)-1-Formamido-1,4a-dimethyl-6-methylene-5-((£)-2-(2-oxo-2,5- dihydrofuran-3-yl)ethenyl)decahydronaphthalen-2-yl-2-amino-3-phenylpropanoate, Piceatannol, Rosmarinic acid, and Magnolol.
3CLpro inhibitors: Lymecycline, Chlorhexidine, Alfuzosin, Cilastatin, Famotidine, Almitrine, Progabide, Nepafenac, Carvedilol, Amprenavir, Tigecycline, Montelukast, Carminic acid, Mimosine, Flavin, Lutein, Cefpiramide, Phenethicillin, Candoxatril, Nicardipine, Estradiol valerate, Pioglitazone, Conivaptan, Telmisartan, Doxycycline, Oxytetracycline, (1 S,2R,4aS,5R,8aS)-1-Formamido-1 ,4a-dimethyl-6-methylene-5-((E)- 2-(2-oxo-2,5-dihydrofuran-3-yl)ethenyl)decahydronaphthalen-2-yl5-((R)-1,2-dithiolan-3- yl) pentanoate, Betulonal, Chrysin-7-0-/3-glucuronide, Andrographiside, (1S,2R,4aS,5R,8aS)-1-Formamido-1,4a-dimethyl-6-methylene-5-((£)-2-(2-oxo-2,5- dihydrofuran-3-yl)ethenyl)decahydronaphthalen-2-yl 2-nitrobenzoate, 2/3- Hydroxy-3, 4- seco-friedelolactone-27-oic acid (S)-(1 S,2R,4aS,5R,8aS)-1-Formamido-1 ,4a-dimethyl- 6-methylene-5-((£)-2-(2-oxo-2,5-dihydrofuran-3-yl)ethenyl) decahydronaphthalen-2-yl-2- amino-3-phenylpropanoate, Isodecortinol, Cerevisterol, Hesperidin, Neohesperidin, Andrograpanin, 2-((1R,5R,6R,8aS)-6-Hydroxy-5-(hydroxymethyl)-5,8a-dimethyl-2- methylenedecahydronaphthalen-1-yl)ethyl benzoate, Cosmosiin, Cleistocaltone A, 2,2-Di(3-indolyl)-3-indolone, Biorobin, Gnidicin, Phyllaemblinol, Theaflavin 3,3'-di-0- gallate, Rosmarinic acid, Kouitchenside I, Oleanolic acid, Stigmast-5-en-3-ol, Deacetylcentapicrin, and Berchemol.
RdRp inhibitors: Valganciclovir, Chlorhexidine, Ceftibuten, Fenoterol, Fludarabine, Itraconazole, Cefuroxime, Atovaquone, Chenodeoxycholic acid, Cromolyn,
Pancuronium bromide, Cortisone, Tibolone, Novobiocin, Silybin, Idarubicin Bromocriptine, Diphenoxylate, Benzylpenicilloyl G, Dabigatran etexilate, Betulonal, Gnidicin, 2/3,30/3-Dihydroxy-3,4-seco-friedelolactone-27-lactone, 14-Deoxy-11,12-didehydroandrographolide, Gniditrin, Theaflavin 3,3'-di-0-gallate, ( R )- ((1R,5aS,6R,9aS)-1,5a-Dimethyl-7-methylene-3-oxo-6-((£)-2-(2-oxo-2,5-dihydrofuran-3- yl)ethenyl)decahydro-1/-/-benzo[c]azepin-1-yl)methyl2-amino-3-phenylpropanoate, 2/3- Hydroxy-3,4-seco-friedelolactone-27-oic acid, 2-(3,4-Dihydroxyphenyl)-2-[[2-(3,4- dihydroxyphenyl)-3,4-dihydro-5,7-dihydroxy-2H-1-benzopyran-3-yl]oxy]-3,4-dihydro-2H- 1-benzopyran-3,4,5,7~tetrol, Phyllaemblicin B, 14-hydroxycyperotundone, Andrographiside, 2-((1R,5R,6R,8aS)-6-Hydroxy-5-(hydroxymethyl)-5,8a-dimethyl-2- methylenedecahydro naphthalen-1-yl)ethyl benzoate, Andrographolide, Sugetriol-3,9- diacetate, Baicalin, (1S,2R,4aS,5R,8aS)-1-Formamido-1,4a-dimethyl-6-methylene-5- ((£)-2-(2-oxo-2,5-dihydrofuran-3-yl)ethenyl)decahydronaphthalen-2-yl 5-((R)-1 ,2-dithiolan-3-yl)pentanoate, 1 ,7-Dihydroxy-3-methoxyxanthone, 1 ,2,6- Trimethoxy-8-[(6-0-/3-D-xylopyranosyl-/3-D-glucopyranosyl)oxy]-9/-/-xanthen-9-one, and 1,8-Dihydroxy-6-methoxy-2-[(6-0-/3-D-xylopyranosyl-/3-D-glucopyranosyl)oxy]-9/-/- xanthen-9-one, 8-(/3-D-Glucopyranosyloxy)-1,3,5-trihydroxy-9/-/-xanthen-9-one,
Additional therapeutic agents that can be used in the methods of the invention include Diosmin, Hesperidin, MK-3207, Venetoclax, Dihydroergocristine, Bolazine,
R428, Ditercalinium, Etoposide, Teniposide, UK-432097, Irinotecan, Lumacaftor, Velpatasvir, Eluxadoline, Ledipasvir, Lopinavir/ Ritonavir + Ribavirin, Alferon, and prednisone. Other additional agents useful in the methods of the present invention include chloroquine, hydroxychloroquine, azithromycin and remdisivir.
Other additional agents that can be used in the methods of the present invention include a-ketoamides compounds designated as 11 r, 13a and 13b, shown below, as described in Zhang, L; Lin, D.; Sun, X.; Rox, K.; Hilgenfeld, R.; X-ray Structure of Main Protease of the Novel Coronavirus SARS-CoV-2 Enables Design of a-Ketoamide Inhibitors; bioRxiv preprint doi: https://doi.org/10.1101/2020.02.17.952879
Additional agents that can be used in the methods of the present invention include RIG 1 pathway activators such as those described in US Patent No. 9,884,876.
Another embodiment of the present invention is a method of treating COVID-19 in a patient wherein an additional agent is administered and the additional agent is selected from antivirals such as remdesivir, galidesivir, favilavir/avifavir, mulnupiravir (MK-4482/EIDD 2801), AT-527, AT-301, BLD-2660, favipiravir, camostat, SLV213 emtrictabine/tenofivir, clevudine, dalcetrapib, boceprevir and ABX464, glucocorticoids such as dexamethasone and hydrocortisone, convalescent plasma, a recombinant human plasma such as gelsolin (Rhu-p65N), monoclonal antibodies such as regdanvimab (Regkirova), ravulizumab (Ultomiris), VIR-7831/VIR-7832, BRI 1-196/BRI I- 198, COVI-AMG/COVI DROPS (STI-2020), bamlanivimab (LY-CoV555), mavrilimab, leronlimab (PRO140), AZD7442, lenzilumab, infliximab, adalimumab, JS 016, STI-1499 (COVIGUARD), lanadelumab (Takhzyro), canakinumab (Maris), gimsilumab and otilimab, antibody cocktails such as casirivimab/imdevimab (REGN-Cov2), recombinant fusion protein such as MK-7110 (CD24Fc/SACCOVID), anticoagulants such as heparin and apixaban, IL-6 receptor agonists such as tocilizumab (Actemra) and sarilumab (Kevzara), PIKfyve inhibitors such as apilimod dimesylate, RIPK1 inhibitors such as DNL758, VIP receptor agonists such as PB1046, SGLT2 inhibitors such as dapaglifozin, TYK inhibitors such as abivertinib, kinase inhibitors such as ATR-002, bemcentinib, acalabrutinib, baricitinib and losmapimod, H2 blockers such as famotidine, anthelmintics such as niclosamide, furin inhibitors such as diminazene.
The term “SARS-Cov-2 inhibiting agent” means any SARS-CoV-2 related coronavirus 3C like protease inhibitor compound described herein or a pharmaceutically acceptable salt, hydrate, prodrug, active metabolite or solvate thereof or a compound which inhibits replication of SARS-CoV-2 in any manner.
The term “interfering with or preventing” SARS-CoV-2-related coronavirus (“SARS-CoV-2”) viral replication in a cell means to reduce SARS-CoV-2 replication or production of SARS-CoV-2 components necessary for progeny virus in a cell as
compared to a cell not being transiently or stably transduced with the ribozyme or a vector encoding the ribozyme. Simple and convenient assays to determine if SARS- CoV-2 viral replication has been reduced include an ELISA assay for the presence, absence, or reduced presence of anti-SARS-CoV-2 antibodies in the blood of the subject (Nasoff, et al., PNAS 88:5462-5466, 1991), RT-PCR (Yu, et al., in Viral Hepatitis and Liver Disease 574-577, Nishioka, Suzuki and Mishiro (Eds.); Springer-Verlag,
Tokyo, 1994). Such methods are well known to those of ordinary skill in the art. Alternatively, total RNA from transduced and infected “control” cells can be isolated and subjected to analysis by dot blot or northern blot and probed with SARS-CoV-2 specific DNA to determine if SARS-CoV-2 replication is reduced. Alternatively, reduction of SARS-CoV-2 protein expression can also be used as an indicator of inhibition of SARS- CoV-2 replication. A greater than fifty percent reduction in SARS-CoV-2 replication as compared to control cells typically quantitates a prevention of SARS-CoV-2 replication.
If an SARS-CoV-2 inhibitor compound used in the method of the invention is a base, a desired salt may be prepared by any suitable method known to the art, including treatment of the free base with an inorganic acid (such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like), or with an organic acid (such as acetic acid, maleic acid, succinic acid, mandelic acid, fumaric acid, malonic acid, pyruvic acid, oxalic acid, glycolic acid, salicylic acid, pyranosidyl acid (such as glucuronic acid or galacturonic acid), alpha-hydroxy acid (such as citric acid or tartaric acid), amino acid (such as aspartic acid or glutamic acid), aromatic acid (such as benzoic acid or cinnamic acid), sulfonic acid (such as p-toluenesulfonic acid or ethanesulfonic acid), and the like.
If an SARS-CoV-2 inhibitor compound used in the method of the invention is an acid, a desired salt may be prepared by any suitable method known to the art, including treatment of the free acid with an inorganic or organic base (such as an amine (primary, secondary, or tertiary)), an alkali metal hydroxide, or alkaline earth metal hydroxide. Illustrative examples of suitable salts include organic salts derived from amino acids (such as glycine and arginine), ammonia, primary amines, secondary amines, tertiary amines, and cyclic amines (such as piperidine, morpholine, and piperazine), as well as inorganic salts derived from sodium, calcium, potassium, magnesium, manganese, iron, copper, zinc, aluminum and lithium.
In the case of SARS-CoV-2 inhibitor compounds, prodrugs, salts, or solvates that are solids, it is understood by those skilled in the art that the hydroxamate compound,
prodrugs, salts, and solvates used in the method of the invention, may exist in different polymorph or crystal forms, all of which are intended to be within the scope of the present invention and specified formulas. In addition, the hydroxamate compound, salts, prodrugs and solvates used in the method of the invention may exist as tautomers, all of which are intended to be within the broad scope of the present invention.
Solubilizing agents may also be used with the compounds of the invention to increase the compounds solubility in water of physiologically acceptable solutions. These solubilizing agents include cyclodextrans, propylene glycol, diethylacetamide, polyethylene glycol, Tween, ethanol and micelle forming agents. Offered solubilizing agents are cyclodextrans, particularly beta cyclodextrans and in particular hydroxypropyl betacyclodextran and sulfobutylether betacyclodextran.
In some cases, the SARS-CoV-2 inhibitor compounds, salts, prodrugs and solvates used in the method of the invention may have chiral centers. When chiral centers are present, the hydroxamate compound, salts, prodrugs and solvates may exist as single stereoisomers, racemates, and/or mixtures of enantiomers and/or disastereomers. All such single stereoisomers, racemates, and mixtures thereof are intended to be within the broad scope of the present invention.
As generally understood by those skilled in the art, an optically pure compound is one that is enantiomerically pure. As used herein, the term “optically pure” is intended to mean a compound comprising at least a sufficient activity. Preferably, an optically pure amount of a single enantiomer to yield a compound having the desired pharmacological pure compound of the invention comprised at least 90% of a single isomer (80% enantiomeric excess), more preferably at least 95% (90% e.e.), even more preferably at least 97.5% (95%) e.e.), and most preferably at least 99% (98% e.e.).
The term “treating”, as used herein, unless otherwise indicated, means reversing, alleviating, inhibiting the progress of, or preventing the disorder or condition to which such term applies, or one or more symptoms of such disorder or condition. The term “treatment”, as used herein, unless otherwise indicated, refers to the act of treating as “treating” is defined immediately above. In a preferred embodiment of the present invention, “treating” or “treatment” means at least the mitigation of a disease condition in a human, that is alleviated by the inhibition of the activity of the SARS-CoV-2 3C-like protease which is the main protease of SARS-CoV-2, the causative agent for COVID-
19. For patients suffering from COVID- 19 fever, fatigue, and dry cough are the main manifestations of the disease, while nasal congestion, runny nose, and other symptoms of the upper respiratory tract are rare. Beijing Centers for Diseases Control and Prevention indicated that the typical case of COVID-19 has a progressive aggravation process. COVID-19 can be classified into light, normal, severe, and critical types based on the severity of the disease National Health Commission of the People’s Republic of China. Diagnosis and Treatment of Pneumonia Caused by 2019-nCoV (Trial Version 4). Available online: http://www.nhc.gov.cn/jkj/s3577/202002/573340613ab243b3a7f61df260551dd4/files/c7 91e5a7ea5149f680fdcb34dac0f54e.pdf (accessed on 6 February 2020).: (1) Mild cases — the clinical symptoms were mild, and no pneumonia was found on the chest computed tomography (CT); (2) normal cases — fever, respiratory symptoms, and patients found to have imaging manifestations of pneumonia; (3) severe cases — one of the following three conditions: Respiratory distress, respiratory rate ³ 30 times / min (in resting state, refers to oxygen saturation £ 93%), partial arterial oxygen pressure (Pa02)/oxygen absorption concentration (Fi02) £300 mmHg (1 mmHg = 0.133 kPa); (4) critical cases — one of the following three conditions: Respiratory failure and the need for mechanical ventilation, shock, or the associated failure of other organs requiring the intensive care unit. The current clinical data shows that the majority of the deaths occurred in the older patients. However, severe cases have been documented in young adults who have unique factors, particularly those with chronic diseases, such as diabetes or hepatitis B. Those with a long-term use of hormones or immunosuppressants, and decreased immune function, are likely to get severely infected.
Methods of treatment for mitigation of a disease condition such as COVID-19 include the use of one or more of the compounds in the invention in any conventionally acceptable manner. According to certain preferred embodiments of the invention, the compound or compounds used in the methods of the present invention are administered to a mammal, such as a human, in need thereof. Preferably, the mammal in need thereof is infected with a coronavirus such as the causative agent of COVID-19, namely SARS-CoV-2.
The present invention also includes prophylactic methods, comprising administering an effective amount of a SARS-CoV-2 inhibitor of the invention, or a pharmaceutically acceptable salt, prodrug, pharmaceutically active metabolite, or solvate thereof to a mammal, such as a human at risk for infection by SARS-CoV-2.
According to certain preferred embodiments, an effective amount of one or more compounds of the invention, or a pharmaceutically acceptable salt, prodrug, pharmaceutically active metabolite, or solvate thereof is administered to a human at risk for infection by SARS-CoV-2, the causative agent for COVID-19. The prophylactic methods of the invention include the use of one or more of the compounds in the invention in any conventionally acceptable manner.
The following are examples of specific embodiments of the invention:
Certain of the compounds used in the methods of the invention are known and can be made by methods known in the art.
Recent evidence indicates that a new coronavirus SARS-Cov-2 is the causative agent of COVID-19. The nucleotide sequence of the SARS-CoV-2 coronavirus as well as the recently determined L- and S- subtypes have recently been determined and made publicly available.
The activity of the inhibitor compounds as inhibitors of SARS-CoV-2 viral activity may be measured by any of the suitable methods available in the art, including in vivo and in vitro assays. The activity of the compounds of the present invention as inhibitors of coronavirus 3C-like protease activity (such as the 3C-like protease of the SARS-CoV- 2 coronavirus) may be measured by any of the suitable methods known to those skilled in the art, including in vivo and in vitro assays. Examples of suitable assays for activity measurements include the antiviral cell culture assays described herein as well as the antiprotease assays described herein, such as the assays described in the Example section.
Administration of the SARS-CoV-2 inhibitor compounds and their pharmaceutically acceptable prodrugs, salts, active metabolites, and solvates may be performed according to any of the accepted modes of administration available to those skilled in the art. Illustrative examples of suitable modes of administration include oral, nasal, pulmonary, by inhalation, parenteral, topical, intravenous, injected, transdermal, and rectal. Oral, intravenous, by inhalation and nasal deliveries are preferred.
A SARS-CoV-2-inhibiting agent may be administered as a pharmaceutical composition in any suitable pharmaceutical form. Suitable pharmaceutical forms include solid, semisolid, liquid, or lyophilized formulations, such as tablets, powders, capsules, suppositories, suspensions, liposomes, and aerosols. The SARS-CoV-2-
inhibiting agent may be prepared as a solution using any of a variety of methodologies. For example, SARS-CoV-2-inhibiting agent can be dissolved with acid (e.g., 1 M HCI) and diluted with a sufficient volume of a solution of 5% dextrose in water (D5W) to yield the desired final concentration of SARS-Cov-2-inhibiting agent (e.g., about 15 mM). Alternatively, a solution of D5W containing about 15 mM HCI can be used to provide a solution of the SARS-CoV-2-inhibiting agent at the appropriate concentration. Further, the SARS-Cov-2-inhibiting agent can be prepared as a suspension using, for example, a 1% solution of carboxymethylcellulose (CMC).
Acceptable methods of preparing suitable pharmaceutical forms of the pharmaceutical compositions are known or may be routinely determined by those skilled in the art. For example, pharmaceutical preparations may be prepared following conventional techniques of the pharmaceutical chemist involving steps such as mixing, granulating, and compressing when necessary for tablet forms, or mixing, filling and dissolving the ingredients as appropriate, to give the desired products for intravenous, oral, parenteral, topical, intravaginal, intranasal, intrabronchial, intraocular, intraaural, and/or rectal administration.
Pharmaceutical compositions of the invention may also include suitable excipients, diluents, vehicles, and carriers, as well as other pharmaceutically active agents, depending upon the intended use. Solid or liquid pharmaceutically acceptable carriers, diluents, vehicles, or excipients may be employed in the pharmaceutical compositions. Illustrative solid carriers include starch, lactose, calcium sulfate dihydrate, terra alba, sucrose, talc, gelatin, pectin, acacia, magnesium stearate, and stearic acid. Illustrative liquid carriers include syrup, peanut oil, olive oil, saline solution, and water. The carrier or diluent may include a suitable prolonged-release material, such as glyceryl monostearate or glyceryl distearate, alone or with a wax. When a liquid carrier is used, the preparation may be in the form of a syrup, elixir, emulsion, soft gelatin capsule, sterile injectable liquid (e.g., solution), or a nonaqueous or aqueous liquid suspension.
A dose of the pharmaceutical composition may contain at least a therapeutically effective amount of a SARS-CoV-2-inhibiting agent and preferably is made up of one or more pharmaceutical dosage units. The selected dose may be administered to a mammal, for example, a human patient, in need of treatment mediated by inhibition of SARS-Cov-2 related coronavirus activity, by any known or suitable method of administering the dose, including topically, for example, as an ointment or cream; orally;
rectally, for example, as a suppository; parenterally by injection; intravenously; or continuously by intravaginal, intranasal, intrabronchial, intraaural, or intraocular infusion.
The phrases “therapeutically effective amount” and “effective amount” are intended to mean the amount of an inventive agent that, when administered to a mammal in need of treatment, is sufficient to effect treatment for injury or disease conditions alleviated by the inhibition of SARS-CoV-2 viral replication. The amount of a given SARS-CoV-2-inhibiting agent used in the method of the invention that will be therapeutically effective will vary depending upon factors such as the particular SARS- CoV-2-inhibiting agent, the disease condition and the severity thereof, the identity and characteristics of the mammal in need thereof, which amount may be routinely determined by those skilled in the art.
It will be appreciated that the actual dosages of the SARS-CoV-2-inhibiting agents used in the pharmaceutical compositions of this invention will be selected according to the properties of the particular agent being used, the particular composition formulated, the mode of administration and the particular site, and the host and condition being treated. Optimal dosages for a given set of conditions can be ascertained by those skilled in the art using conventional dosage-determination tests.
For oral administration, e.g., a dose that may be employed is from about 0.01 to about 1000 mg/kg body weight, preferably from about 0.1 to about 500 mg/kg body weight, and even more preferably from about 1 to about 500 mg/kg body weight, with courses of treatment repeated at appropriate intervals. The compounds employed in the methods of the invention can be administered orally in known oral dosage forms such as tablets, capsules or oral suspensions. The oral administration of the compounds to the patient can occur one, two, three or four times a day with each dose containing 10 mg, 25 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg or 1000 mg. For intravenous dosing a dose of up to 5 grams per day of the compound may be employed. Intravenous administration can occur for intermittent periods during a day or continuously over a 24-hour period.
The terms “cytochrome P450-inhibiting amount” and “cytochrome P450 enzyme activity-inhibiting amount”, as used herein, refer to an amount of a compound required to decrease the activity of cytochrome P450 enzymes or a particular cytochrome P450 enzyme isoform in the presence of such compound. Whether a particular compound of decreases cytochrome P450 enzyme activity, and the amount of such a compound
required to do so, can be determined by methods know to those of ordinary skill in the art and the methods described herein.
Protein functions required for coronavirus replication and transcription are encoded by the so-called “replicase” gene. Two overlapping polyproteins are translated from this gene and extensively processed by viral proteases. The C-proximal region is processed at eleven conserved interdomain junctions by the coronavirus main or “SC- like protease. The name “3C-like” protease derives from certain similarities between the coronavirus enzyme and the well-known picornavirus 3C proteases. These include substrate preferences, use of cysteine as an active site nucleophile in catalysis, and similarities in their putative overall polypeptide folds. A comparison of the amino acid sequence of the SARS-Cov-2-associated coronavirus 3C-like protease to that of other known coronaviruses such as SARS-CoV shows the amino acid sequences have approximately 96% shared homology.
Amino acids of the substrate in the protease cleavage site are numbered from the N to the C terminus as follows: -P3-P2-P1-PT-P2’-P3’, with cleavage occurring between the P1 and PT residues (Schechter & Berger, 1967). Substrate specificity is largely determined by the P2, P1 and PT positions. Coronavirus main protease cleavage site specificities are highly conserved with a requirement for glutamine at P1 and a small amino acid at PT ( Journal of General Virology , 83, pp. 595-599 (2002)).
REFERENCE EXAMPLES
The compounds used in the methods of the present invention can be prepared as set forth in Examples 36, 38, 40-45 and 47-52 of W02005/113580 and as reproduced below.
In the examples described below, unless otherwise indicated, all temperatures are set forth in degrees Celsius and all parts and percentages are by weight. Reagents may be purchased from commercial suppliers, such as Sigma-Aldrich Chemical Company, or Lancaster Synthesis Ltd. and may be used without further purification unless otherwise indicated. Tetrahydrofuran (THF) and N, N-dimethylformamide (DMF) may be purchased from Aldrich in Sure Seal bottles and used as received. All solvents may be purified using standard methods known to those skilled in the art, unless otherwise indicated.
The structures of the compounds of the following examples are confirmed by one or more of the following: proton magnetic resonance spectroscopy, elemental microanalysis and melting point. Proton magnetic resonance (1H NMR) spectra are determined using a Bruker spectrometers operating at a field strength of 300 to 400 megahertz (MHz). Chemical shifts are reported in parts per million (ppm, d) downfield from an internal tetramethylsilane standard. Alternatively, 1H NMR spectra were referenced to residual protic solvent signals as follows: CHCb = 7.26 ppm, DMSO =
2.49 ppm, C6HD5 = 7.15 ppm. Peak multiplicities are designated as follows: s, singlet; d, doublet; dd, doublet of doublets; t, triplet; q, quartet; br, broad resonance; m, multiplet. Coupling constants are given in Hertz. Elemental microanalyses are performed by Atlantic Microlab Inc., Norcross, GA and gave results for the elements stated with ±0.4% of the theoretical values. Flash column chromatography is performed using Silica gel 60 (Merck Art 9385) or various MPLC systems. Analytical thin layer chromatography (TLC) was performed using precoated sheets of Silica 60 F254 (Merck Art 5719). All reactions are performed in septum-sealed flasks under a slight positive pressure of argon or dry nitrogen unless otherwise noted.
Other preferred compounds used in the methods of the invention may be prepared in manners analogous to those specifically described below.
The examples and preparations provided below further illustrate and exemplify the compounds of the present invention and methods of preparing such compounds. It is to be understood that the scope of the present invention is not limited in any way by the scope of the following examples and preparations. In the following examples molecules with a single chiral center, unless otherwise notes, exist as a racemic mixture. Those molecules with two or more chiral centers, unless otherwise noted, exits as a racemic mixture of diastereomers. Single enantiomers/diastereomers may be obtained by methods known to those skilled in the art.
Where HPLC chromatography is referred to in the preparations and examples below, the general conditions used, unless otherwise indicated, are as follows. The column used is a ZORBAXp RXC18 column (manufactured by Hewlett Packard) of 150 mm distance and 4.6 mm interior diameter. The samples are run on a Hewlett Packard- 1100 system A gradient solvent method is used running 100 percent ammonium acetate / acetic acid buffer (0.2 M) to 100 percent acetonitrile over 10 minutes. The system then proceeds on a wash cycle with 100 percent acetonitrile for 1.5 minutes and then 100
percent buffer solution for 3 minutes. The flow rate over this period is a constant 3 ml/minute.
In the examples and specification DMF refers to A/,/\/-dimethylformamide. DMSO refers to dimethylsulfoxide. CsF refers to cesium fluoride. ESI is electrospray ionization, mg is milligram, mmol is millimole, M is molar, MHz is megahertz, MPLC is medium pressure liquid chromatography, MS is mass spectrometry, HRMS is high resolution mass spectrometry and RT is room temperature.
The following Reference Examples (Examples 1-15 as set forth below) are compounds used in the methods of the present invention and are the compounds of Examples 36, 38 and 40-52 of W02005/113580.
Example 1
(Described as Example 36 in WO20Q5/1135801: (3S1-3-(f/V-r(4-methoxy-1H-indol-2- yl)carbonyll-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yllbutyl acetate
An oven-dried 40 ml_ scintillation vial with spinbar was charged with acetic acid (27 mg, 0.46 mmol) followed by a solution of A/-((1S)-1-{[((1S)-3-chloro-2-oxo-1-{[(3S)-2- oxopyrrolidin-3-yl]methyl}propyl)amino]carbonyl}-3-methylbutyl)-4-methoxy-1 /-/-indole-2- carboxamide (172 mg, 0.35 mmol) in DMF (3.5 ml_), and purged with Nå. This pale yellow solution was then treated with CsF (122 mg, 0.81 mmol), sealed with a Teflon- lined screwcap, and heated at 65°C on a reaction block with vigorous stirring. After 3 hours, the reaction was cooled to RT, diluted with water (30 ml_), and extracted with dichloromethane (4 x 7 ml_). The combined organic layers were washed with water (2 x 20 ml_), brine (20 ml_), and concentrated in vacuo. This material was purified by Biotage MPLC (25M, 2.5-4.5% methanol/dichloromethane) to afford 78 mg (45%) of the title compound as a white solid. 1H NMR (400 MHz, DMSO-cie) d 11.57 (s, 1 H), 8.57 (d, J = 7.8 Hz, 1 H), 8.43 (d, J = 7.6 Hz, 1 H), 7.64 (s, 1 H), 7.36 (d, J = 1.8 Hz, 1 H), 7.08 (t, J = 8.0 Hz, 1 H), 6.99 (d, J= 8.1 Hz, 1 H), 6.49 (d, J= 7.6 Hz, 1 H), 4.83 (d, J= 3.0 Hz, 1 H), 4.76 - 4.95 (m, 1 H), 4.35 - 4.50 (m, 2 H), 3.87 (s, 3 H), 3.03 - 3.17 (m, 2 H), 2.22 -
2.35 (m, 1 H), 2.09 - 2.22 (m, 1 H), 2.07 (s, 3 H), 1.90 - 2.04 (m, 1 H), 1.65 - 1.77 (m, 2 H), 1.48 - 1.65 (m, 3 H), 0.94 (d, J = 6.3 Hz, 3 H), 0.89 (d, J = 6.3 Hz, 3 H); MS (ESI+) for C26H34N4O7 m/z 515.2 (M+H)+. Example 2
(Described as Example 38 in WO20Q5/1135801: (3S1-3-(f/V-r(4-methoxy-1H-indol-2- yl)carbonyll-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yllbutyl pivalate
Following the procedure described for the preparation of (3S)-3-({/V-[(4-methoxy-1H- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate but substituting pivalic acid and making non-critical variations provided a crude product.
This material was purified by Biotage MPLC (25M, 2.5-4.5% methanol/dichloromethane) to afford 152 mg (78%) of the title compound. 1H NMR (400 MHz, DMSO-de) d 11.58 (s, 1 H), 8.56 (d, J= 7.8 Hz, 1 H), 8.44 (d, J= 7.8 Hz, 1 H), 7.64 (s, 1 H), 7.36 (s, 1 H), 7.08 (t, J = 8.0 Hz, 1 H), 6.99 (d, 1 H), 6.49 (d, J = 7.6 Hz, 1 H), 4.84 (s, 1 H), 4.77 - 4.94 (m,
1 H), 4.34 - 4.51 (m, 2 H), 3.87 (s, 3 H); 3.02 - 3.16 (m, 2 H), 1.91 - 2.36 (m, 3 H), 1.48 - 1.78 (m, 5 H), 1.16 (s, 9 H), 0.94 (d, J= 6.320 Hz, 3 H), 0.89 (d, J= 6.3 Hz, 3 H); MS (ESI+) for C29H40N4O7 m/z 557.2 (M+H)+. Example 3
(Described as Example 40 in WO20Q5/113580): (3S)-3-(f/V-r(4-methoxy-1H-indol-2- yl)carbonyll-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yllbutyl benzoate
Following the procedure described for the preparation of (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate but
substituting benzoic acid and making non-critical variations provided a crude product. This material was purified by Biotage MPLC (25M, 2.5-4.5% methanol/dichloromethane) to afford 183 mg (91%) of the title compound. 1H NMR (400 MHz, DMSO-de) d 11.59 (s, 1 H), 8.64 (d, J= 8.1 Hz, 1 H), 8.46 (d, J= 7.6 Hz, 1 H), 7.98 (d, J= 8.1 Hz, 2 H), 7.91 - 7.95 (m, 1 H), 7.66 - 7.71 (m, 1 H), 7.66 (s, 1 H), 7.52 - 7.57 (m, 1 H), 7.37 (d, J = 1.8
Hz, 1 H), 7.08 (t, J = 8.0 Hz, 1 H), 6.96 - 7.02 (m, 1 H), 6.49 (d, J = 7.6 Hz, 1 H), 5.13 (s, 1 H), 5.06 - 5.24 (m, 1 H), 4.44 - 4.53 (m, 2 H), 3.87 (s, 3 H), 3.04 - 3.15 (m, 2 H), 2.34 (m, 1 H), 2.07 - 2.27 (m, 1 H), 1.98 - 2.07 (m, 1 H), 1.52 -1.79 (m, 5 H), 0.94 (d, J = 6.3 Hz, 3 H), 0.89 (d, J = 6.3 Hz, 3 H); MS (ESI+) for CaiHael UO m/z 577.2 (M+H)+.
Example 4
(Described as Example 41 in WO20Q5/113580): (3S)-3-(f/V-r(4-methoxy-1H-indol-2- yl)carbonyl1-L-leucyl)amino)-2-oxo-4-r(3S)-2-oxopyrrolidin-3-yl1butyl 4-methylbenzoate
Following the procedure described for the preparation of (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate but substituting 4-methylbenzoic acid and making non-critical variations provided a crude product. This material was purified by Biotage MPLC (25M, 2.5-4.5% methanol/dichloromethane) to afford 92 mg (44%) of the title compound. 1H NMR (400 MHz, DMSO-de) d 11.59 (d, J= 1.8 Hz, 1 H), 8.63 (d, J= 8.1 Hz, 1 H), 8.46 (d, J= 7.6 Hz, 1 H), 7.87 (d, J= 8.1 Hz, 2 H), 7.65 (s, 1 H), 7.37 (d, J= 1.8 Hz, 1 H), 7.34 (d, J = 8.3 Hz, 2 H), 7.08 (t, J = 8.0 Hz, 1 H), 6.97 - 7.01 (m, 1 H), 6.50 (d, J = 7.8 Hz, 1 H),
5.09 (s, 1 H), 5.03 - 5.20 (m, 1 H), 4.43 - 4.52 (m, 2 H), 3.87 (s, 3 H), 3.04 - 3.17 (m, 2 H), 2.38 (s, 3 H), 2.28 - 2.34 (m, 1 H), 2.06 - 2.14 (m, 1 H), 1.96 - 2.06 (m, 1 H), 1.51 - 1.78 (m, 5 H), 0.94 (d, J = 6.3 Hz, 3 H), 0.89 (d, J = 6.3 Hz, 3 H); MS (ESI+) C32H38N4O7 m/z 591.2 (M+H)+.
Example 5
(Described as Example 42 in WO20Q5/113580): (3S)-3-(f/V-r(4-methoxy-1H-indol-2- yl)carbonyl1-L-leucyl)amino)-2-oxo-4-r(3S)-2-oxopyrrolidin-3-yl1butyl 4-fluorobenzoate
Following the procedure described for the preparation of (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate but substituting 4-fluorobenzoic acid and making non-critical variations provided a crude product. This material was purified by Biotage MPLC (25M, 2.5-4.5% methanol/dichloromethane) to afford 136 mg (65%) of the title compound. 1H NMR (400 MHz, DMSO-de) d 11.58 (d, J= 2.0 Hz, 1 H), 8.63 (d, J= 7.8 Hz, 1 H), 8.46 (d, J= 7.6 Hz, 1 H), 8.04 (dd, J = 8.6, 5.6 Hz, 2 H), 7.65 (s, 1 H), 7.35 - 7.41 (m, 3 H), 7.08 (t, J = 8.0 Hz, 1 H), 6.99 (d, J = 8.1 Hz, 1 H), 6.50 (d, J = 7.6 Hz, 1 H), 5.12 (d, J = 1.3 Hz, 1 H), 5.06 - 5.23 (m, 1 H), 4.44 - 4.52 (m, 2 H), 3.87 (s, 3 H), 3.04 - 3.17 (m, 2 H), 2.28 - 2.38 (m, 1 H), 2.07 - 2.26 (m, 1 H), 1.98 - 2.06 (m, 1 H), 1.52 - 1.79 (m, 5 H), 0.94 (d, J = 6.3 Hz, 3 H), 0.89 (d, J= 6.3 Hz, 3 H); MS (ESI+) for C31H35FN4O7 m/z 595.2 (M+H)+.
Example 6
(Described as Example 43 in WO20Q5/1135801: (3S1-3-(f/V-r(4-methoxy-1H-indol-2- yl)carbonyl1-L-leucyl)amino)-2-oxo-4-r(3S)-2-oxopyrrolidin-3-yl1butyl 4-cvanobenzoate
Following the procedure described for the preparation of (3S)-3-({/V-[(4-methoxy-1H- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate but substituting 4-cyanobenzoic acid and making non-critical variations provided a crude product. This material was purified by Biotage MPLC (25M, 2.5-4.5%
methanol/dichloromethane) to afford 159 mg (75%) of the title compound. 1H NMR (400 MHz, DMSO-de) d 11.58 (d, J= 2.0 Hz, 1 H), 8.64 (d, J= 8.1 Hz, 1 H), 8.46 (d, J= 7.6 Hz, 1 H), 8.09 - 8.14 (m, 2 H), 7.99 - 8.05 (m, 2 H), 7.66 (s, 1 H), 7.37 (d, J = 1.5 Hz, 1 H), 7.08 (t, J= 8.0 Hz, 1 H), 6.99 (d, J = 8.3 Hz, 1 H), 6.50 (d, J= 7.6 Hz, 1 H), 5.17 (d, J = 2.8 Hz, 1 H), 5.11 - 5.27 (m, 1 H), 4.44 - 4.53 (m, 2 H), 3.87 (s, 3 H), 3.04 - 3.17 (m, 2 H), 2.28 - 2.38 (m, 1 H), 2.07 - 2.26 (m, 1 H), 1.97 - 2.06 (m, 1 H), 1.51 - 1.78 (m, 5 H), 0.94 (d, J = 6.3 Hz, 3 H), 0.89 (d, J = 6.3 Hz, 3 H); MS (ESI+) for C32H35N5O7 m/z 602.2 (M+H)+. Example 7
(Described as Example 44 in WO20Q5/113580): (3S)-3-(f/V-r(4-methoxy-1AY-indol-2- yl)carbonyl1-L-leucyl)amino)-2-oxo-4-r(3S)-2-oxopyrrolidin-3-yl1butyl 4-methoxybenzoate
Following the procedure described for the preparation of (3S)-3-({/V-[(4-methoxy-1 AY- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate but substituting 4-methoxybenzoic acid and making non-critical variations provided a crude product. This material was purified by Biotage MPLC (25M, 2.5-4.5% methanol/dichloromethane) to afford 145 mg (68%) of the title compound. 1H NMR (400 MHz, DMSO-de) d 11.59 (d, J= 1.8 Hz, 1 H), 8.62 (d, J= 7.8 Hz, 1 H), 8.46 (d, J= 7.6 Hz, 1 H), 7.93 (d, J = 9.1 Hz, 2 H), 7.65 (s, 1 H), 7.37 (d, J= 2.0 Hz, 1 H), 7.04 - 7.11
(m, 2 H), 7.00 (dd, J = 8.6, 3.0 Hz, 2 H), 6.50 (d, J= 7.6 Hz, t H), 5.07 (s, 1 H), 5.01 - 5.18 (m, 1 H), 4.44 - 4.51 (m, 2 H), 3.87 (s, 3 H), 3.83 (s, 3 H), 3.04 - 3.17 (m, 2 H), 2.28 - 2.38 (m, 1 H), 2.07 - 2.25 (m, 1 H),1.97 - 2.06 (m, 1 H),1.50 -1.79 (m, 5 H), 0.94 (d,
J = 6.3 Hz, 3 H), 0.89 (d, J = 6.3 Hz, 3 H); MS (ESI+) for C32H38N4O8 m/z 607.2 (M+H)+.
Example 8
(Described as Example 45 in WO20Q5/113580): (3S)-3-(f/V-r(4-methoxy-1AY-indol-2- yl)carbonyl1-L-leucyl)amino)-2-oxo-4-r(3S)-2-oxopyrrolidin-3-yl1butyl 4-chlorobenzoate
Following the procedure described for the preparation of (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate but substituting 4-chlorobenzoic acid and making non-critical variations provided a crude product. This material was purified by Biotage MPLC (25M, 2.5-4.5% methanol/dichloromethane) to afford 172 mg (80%) of the title compound. 1H NMR (400 MHz, DMSO-de) d 11.58 (d, J= 1.8 Hz, 1 H), 8.63 (d, J= 7.8 Hz, 1 H), 8.46 (d, J= 7.6 Hz, 1 H), 7.98 (d, J = 8.6 Hz, 2 H), 7.65 (s, 1 H), 7.62 (d, J= 8.6 Hz, 2 H), 7.37 (d, J = 1.8 Hz, 1 H), 7.08 (t, J = 8.0 Hz, 1 H), 6.99 (d, J = 8.3 Hz, 1 H), 6.50 (d, J= 7.6 Hz, 1 H), 5.13 (d, J = 1.5 Hz, 1 H), 5.07 - 5.23 (m, 1 H), 4.44 - 4.52 (m, 2 H),
3.87 (s, 3 H), 3.04 - 3.14 (m, 2 H), 2.28 - 2.38 (m, 1 H), 2.06 - 2.26 (m, 1 H), 1.97 - 2.06 (m, 1 H), 1.51 - 1.78 (m, 5 H), 0.94 (d, J = 6.3 Hz, 3 H), 0.89. (d, J = 6.3 Hz, 3 H); MS (ESI+) for C31H35CIN4O7 m/z 611.1 (M+H)+ Example 9
(Described as Example 46 in WO20Q5/1135801: (3S1-3-(f/V-r(4-methoxy-1H-indol-2- yl)carbonyll-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yllbutyl 2,6- dichlorobenzoate
Following the procedure described for the preparation of (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate but substituting 2,6-dichlorobenzoic acid and making non-critical variations provided a crude product. This material was purified by LC (20 g 230 - 400 S1O2, 3% methanol/chloroform) to afford 114 mg (65%) of the title compound as a white solid. 1H NMR (DMSO-de) d 11.57 (d, J = 2 Hz, 1 H), 8.62 (d, J = 8 Hz, 1 H), 8.46 (d, J = 4 Hz, 1
H), 7.65 - 7.53 (m, 4 H), 7.36 (s, 1 H), 7.08 (t, J = 8 Hz, 1 H), 6.99 (d, J = 8 Hz, 1 H),
6.49 (d, J = 8 Hz, 1 H), 5.19 (d, J = 20 Hz, 1 H), 5.15 (d, J = 20 Hz, 1 H), 4.51 (m, 2 H), 3.87 (s, 3 H), 3.11 (m, 2 H), 2.30 (m, 1 H), 2.06 (m, 2 H), 1.76 - 1.51 (m, 5 H), 0.94 (d, J = 8 Hz, 3 H), 0.89 (d, J= 8 Hz, 3 H); MS (ESI+) for C31 H34CI2N4O7 m/z 645.1 (M+H)+; Anal. Calcd for C31 H34CI2N4O7 · 0.2 H2O: C, 57.36; H, 5.34; N, 8.63. Found: C, 57.23; H, 5.55; N, 8.46. HRMS (ESI+) Calcd for C31 H34CI2N4O7+H I 645.1877, found 645.1871.
Example 10
(Described as Example 47 in WO20Q5/1135801: (3S1-3-(f/V-r(4-methoxy-1H-indol-2- yl)carbonyl1-L-leucyl)amino)-2-oxo-4-r(3S)-2-oxopyrrolidin-3-yl1butyl 2,6- dimethylbenzoate
Following the procedure described for the preparation of (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate but substituting 2,6-dimethylbenzoic acid and making non-critical variations provided a crude brown foam. This material was purified by Biotage MPLC (25M, 3-4% methanol/dichloromethane) to afford 177 mg (73%) of the title compound as an off-white glass. 1H NMR (DMSO-de) d 11.58 (d, J = 2 Hz, 1 H), 8.63 (d, J = 8 Hz, 1 H), 8.46 (d, J = 8 Hz, 1 H), 7.65 (s, 1 H), 7.36 (s, 1 H), 7.25 (t, J= 8 Hz, 1 H), 7.08 (m, 3 H), 7.00 (d, J = 8 Hz, 1 H), 6.49 (d, J= 8 Hz, 1 H), 5.11 (s, 2 H), 4.51 (m, 2 H), 3.87 (s, 3 H), 3.10 (m,
2 H), 2.32 - 2.21 (m, 7 H), 2.07 (m, 2 H), 1.78 - 1.53 (m, 5 H), 0.94 (d, J = 8 Hz, 3 H), 0.89 (d, J = 8 Hz, 3 H); MS (ESI+) for C33H40N4O7 m/z 605.2 (M+H)+; Anal. Calcd for C33H40N4O7 · 0.3 H2O · 0.2 CHC : C, 62.90; H, 6.49; N, 8.84. Found: C, 62.95; H,
6.42; N, 8.72. HRMS (ESI+) Calcd for C33H40N4O7+H I 605.2970, found 605.2985.
Example 11
(Described as Example 48 in WO20Q5/1135801: (3S1-3-(f/V-r(4-methoxy-1H-lndol-2- yl)carbonyl1-L-leucyl)amino)-2-oxo-4-r(3S)-2-oxopyrrolidin-3-yl1butyl 2,6- difluorobenzoate
Following the procedure described for the preparation of (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate but substituting 2,6-difluorolbenzoic acid and making non-critical variations provided a crude brown oily solid. This material was triturated with chloroform/ethyl acetate to afford 180 mg (75%) of the title compound as white solid. 1H NMR (DMSO-cfg) d 11.65 (d, J = 2 Hz, 1 H), 8.68 (d, J = 8 Hz, 1 H), 8.54 (d, J = 8 Hz, 1 H), 7.73 - 7.65 (m, 2 H), 7.36 (s, 1 H), 7.27 (t, J = 8 Hz, 1 H), 7.08 (t, J = 8 Hz, 1 H), 6.99 (d, J = 8 Hz, 1 H), 6.49 (d, J = 8 Hz,
1 H), 5.19 (d, J= 16 Hz, 1H), 5.14 (d, J= 16 Hz, 1 H), 4.48 (m, 2 H), 3.87 (s, 3 H), 3.11 (m, 2 H), 2.32 (m, 1 H), 2.11 - 1.91 (m, 2 H), 1.81-1.56 (m, 5 H), 0.94 (d, J= 4 Hz, 3 H),
0.89 (d, J = 4 Hz, 3 H); MS (ESI+) for C31H34F2N4O7 m/z 613.2 (M+H)+; HRMS (ESI+) Calcd for C31H34F2N4O7+HI 613.2469, found 613.2476.
Example 12 (Described as Example 49 in WO20Q5/1135801: (3S1-3-(f/V-r(4-methoxy-1H-indol-2- yl)carbonyll-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yllbutyl 2,6- dimethoxybenzoate
Following the procedure described for the preparation of (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate but substituting 2,6-dimethoxybenzoic acid and making non-critical variations provided a crude brown foam. This material was purified by Biotage MPLC (25M, 3-4% methanol/dichloromethane) to afford 169 mg (66%) of the title compound as an off-white solid. 1H NMR (DMSO-de) d 11.58 (d, J= 2 Hz, 1 H), 8.55 (d, J= 8 Hz, 1 H), 8.45 (d, J = 8 Hz, 1 H), 7.64 (s, 1 H), 7.40 - 7.35 (m, 2 H), 7.08 (t, J = 8 Hz, 1 H), 7.00 (d, J = 8 Hz, 1
H), 6.71 (d, J = 8 Hz, 1 H), 6.50 (d, J= 8 Hz, 1 H), 5.01 (d, J = 16 Hz, 1 H), 4.95 (d, J = 16 Hz, 1 H), 4.53 - 4.48 (m, 2 H), 3.87 (s, 3 H), 3.75 (s, 6 H), 3.08 (m, 2 H), 2.31 (m, 1 H), 2.11 - 1.90 (m, 2 H), 1.75 - 1.55 (m, 5 H), 0.94 (d, J = 8 Hz, 3 H), 0.89 (d, J = 8 Hz, 3 H); MS (ESI+) for C33H40N4O9 m/z 637.2 (M+H)+; Anal. Calcd for C33H40N4O9 · 0.25 H2O • 0.25 CHC : C, 59.51; H, 6.12; N, 8.35. Found: C, 59.49; H, 6.08; N, 8.42.
Example 13
(Described as Example 50 in WO20Q5/113580V (3S1-3-(f/V-r(4-methoxy-1H-indol-2- vDcarbonyl1-L-leucyl}amino)-2-oxo-4-r(3S)-2-oxopyrrolidin-3-yl1butyl 4-chlcrc-2- hydroxybenzoate
Following the procedure described for the preparation of (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate but substituting 4-chlorosalicylic acid and making non-critical variations provided a crude brown syrup. This material was purified by Biotage MPLC (25M, 2-3% methanol/dichloromethane) to afford 64 mg (25%) of the title compound as a tan solid. 1H NMR (DMSO-de) d 11.58 (s, 1 H), 10.50 (bs, 1 H), 8.65 (d, J = 8 Hz, 1 H), 8.46 (d, J = 8 Hz, 1 H), 7.81 (d, J= 8 Hz, 1 H), 7.63 (m, 1 H), 7.37 (s, 1 H), 7.08 (m, 2 H), 7.00 (m, 2 H), 6.50 (d, J= 8 Hz, 1 H), 5.16 (d, J= 16 Hz, 2 H), 5.11 (d, J= 16 Hz, 2 H), 4.49 (m, 2 H), 3.87 (s, 3 H), 3.13 (m, 2 H), 2.32 (m, 1 H), 2.11 - 1.98 (m, 2 H), 1.76 - 1.55 (m, 5
H), 0.94 (d, J = 6 Hz, 3 H), 0.89 (d, J = 6 Hz, 3 H); MS (ESI-) for CsiHssCIISUOs m/z 625.1 (M-H)-; Anal Calcd for CsiHssCIISUOs · 0.1 H2O · 0.14 CHCIs: C, 57.93; H, 5.52; N, 8.68. Found: C, 58.04; H, 5.78; N, 8.74; HRMS (ESI+) Calcd for CsiHssCIISUOs+HI 627.2216, found 627.2219.
Example 14
(Described as Example 51 in W02005/113580): (3S)-3- (4-methoxy-1H-indol-2-
yl)carbonyl1-L-leucyl)amino)-2-oxo-4-r(3S)-2-oxopyrrolidin-3-yl1butyl 4-cvano-2- fluorobenzoate
Following the procedure described for the preparation of (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate but substituting 4-cyano-2-fluorobenzoic acid and making non-critical variations provided a crude oily brown solid. This material was purified by Biotage MPLC (25M, 2.5-3.5% methanol/dichloromethane) to afford 119 mg (48%) of the title compound as an off-white powder. 1H NMR (DMSO-de) d 11.58 (d, J= 2 Hz, 1 H), 8.63 (d, J = 8 Hz, 1 H), 8.46 (d,
J = 8 Hz, 1 H), 8.06 (m, 2 H), 7.83 (d, J = 8 Hz, 1 H), 7.65 (s, 1 H), 7.36 (d, J = 2 Hz, 1 H), 7.08 (t, J= 8 Hz, 1 H), 6.99 (d, J = 8 Hz, 1 H), 6.50 (d, J = 8 Hz, 1 H), 5.16 (d, J = 16 Hz, 1 H), 5.11 (d, J= 16 Hz, 1 H), 4.49 (m, 2 H), 3.87 (s, 3 H), 3.11(m, 2 H), 2.32 (m, 1 H), 2.10 - 1.98 (m, 2 H), 1.77-1.53 (m, 5 H), 0.94 (d, J= 6 Hz, 3 H), 0.89 (d, J= 6 Hz, 3 H); MS (ESI+) for C32H34FN5O7 m/z 620.1 (M+H)+; Anal Calcd for C32H34FN5O7 · 0.3 H2O: C, 61.49; H, 5.58; N, 11.20. Found: C, 61.47; H, 5.61; N, 10.98; HRMS (ESI+) Calcd for C32H34FN5O7+HI 620.2515, found 620.2532.
Example 15
(Described as Example 52 in WO20Q5/113580): (3S)-3-(f/V-r(4-methoxy-1H-indol-2- yl)carbonyl1-L-leucyl)amino)-2-oxo-4-r(3S)-2-oxopyrrolidin-3-yl1butyl 2-cyanobenzoate
Following the procedure described for the preparation of (3S)-3-({/\/-[(4-methoxy-1/-/- indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2-oxopyrrolidin-3-yl]butyl acetate but substituting 2-cyanobenzoic acid and making non-critical variations provided a crude brown oily solid. This material was triturated with chloroform/ethyl acetate to afford 91 mg (38%) of the title compound as white solid. 1H NMR (DMSO-cfg) d 11.58 (s, 1 H), 8.65 (d, J = 8 Hz, 1 H), 8.46 (d, J = 8 Hz, 1 H), 8.17 (m, 1 H), 8.04 (m, 1 H), 7.88 (m, 1
H), 7.65 (s, 1 H), 7.37 (s, 1 H), 7.08 (t, J = 8 Hz, 1 H), 6.99 (d, J = 8 Hz, 1 H), 6.49 (d, J = 8 Hz, 1 H), 5.19 (m, 2 H), 4.50 (m, 2 H), 3.87 (s, 3 H), 3.11 (m, 2 H), 2.32 (m, 1 H), 2.07 - 1.97 (m, 2 H), 1.76 - 1.56 (m, 5 H), 0.94 (d, J = 6 Hz, 3 H), 0.89 (d, J = 6 Hz, 3 H); MS (ESI+) for C32H35N5O7 m/z 602.2 (M+H)+; Anal Calcd for C32H35N5O7 · 0.4 H2O: C, 63.12, H, 5.93; N, 11.50. Found: C, 63.16; H, 5.96; N, 11.43; HRMS (ESI+) Calcd for C32H35N5O7+H I 602.2609, found 602.2610.
Docking Experiments Methods:
Homology Modeling. The sequence of 3C-like proteinase in SARS and COVID-19 can be found in references from the RCSB (e.g., 3IWM)1 and the NCBI (e.g., Reference Sequence: YP_009725301.1NCBI)2.
SARS 3C Protease Sequence (PDB 3IWM):
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDL
LIRKSNHSFLVQAGNVQLRVI
GHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHT
IKGSFLNGSCGSVGFNIDYDCV
SFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVING
DRWFLNRFTTTLNDFNLVA
MKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTP
FDVVRQCSGVTFQ
New Wuhan Coronavirus SARS-CoV-2 Sequence (same section):
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDL
LIRKSNHNFLVQAGNVQLRVI
GHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFT
IKGSFLNGSCGSVGFNIDYDCV
SFCYM H H M ELPTGVH AGTDLEG N FYG PFVDRQTAQAAGTDTTITVN VLAWLYAAVI N GDRWFLNRFTTTLNDFNLVA
MKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTP
FDVVRQCSGVTFQ
A homology model was built from a crystal structure of SARS 3C-like protease in Pfizer’s database using Schrodinger’s PRIME3. Minimization of the homology model in complex with ligands was used to remove clashes with ligands containing benzothiazole ketones or a benzyl side chains after examining the protein conformations of other SARS 3C-like crystal structures with these ligand moieties. Relaxation of residues in the 185-190 loop, His41 and Met49 to led to three differently minimized versions of the homology model. The catalytic Cys was mutated to Gly (C145G) to facilitate AGDOCK core docking and subsequent scoring without a clash with the catalytic Cys.
Docking: Compounds are docked into the homology models using core docking4 with AGDOCK5. The docking is performed without forming the protein-ligand covalent bond. Instead, a common core that included the lactam side chain and reactive ketone was identified in the ligands and held fixed in the crystal structure orientation as a mimic of covalent docking (See Figure 2). The affinity measure for AGDOCK core docking is HT Score6.
Method References:
1. http : //www. res b . o rg/str uctu re/3 i WM
2. https://wvvw.ncbi.nlm.nih.Qov/protein/YP 009725301.1
3. Schrodinger Release 2019-1: Prime, Schrodinger, LLC, New York, NY, 2019
4. Daniel K. Gehlhaar, Gennady M. Verkhivker, Paul A. Rejto, Christopher J. Sherman, David R. Fogel, Lawrence J. Fogel, Stephan T. Freer, Molecular recognition of the inhibitor AG-1343 by HIV-1 protease: conformationally flexible docking by evolutionary programming, Chemistry & Biology, Volume 2, Issue 5, 1995, Pages 317-324.
5. Daniel K. Gehlhaar, Djamal Bouzida, and Paul A. Rejto, Reduced Dimensionality in Ligand — Protein Structure Prediction: Covalent Inhibitors of Serine Proteases and Design of Site-Directed Combinatorial Libraries Rational Drug Design. July 7, 1999, 292-311.
6. Tami J. Marrone, Brock A. Luty, Peter W. Rose, Discovering high-affinity ligands from the computationally predicted structures and affinities of small molecules bound to a target: A virtual screening approach. Perspectives in Drug Discovery and Design 20, 209-230 (2000).
Results:
Homology model: The sequence homology between SARS-CoV and SARS-CoV-2 is 96.1%. There are 12 of 306 residues that are different (T35V, A46S, S65N, L86V, R88K, S94A, H134F, K180N, L202V, A267S, T285A & I286L highlighted in cyan in Figure A) which translates to 96.1 % identity.
The ligand associated with the crystal structure used to build the homology model is Compound B, N-((1S)-1-{[((1S)-3-hydroxy-2-oxo-1-{[(3S)-2-oxopyrrolidin-3- yl]methyl}propyl)amino]carbonyl}-3-methylbutyl)-4-methoxy-1H-indole-2-carboxamide. The amino acid residue nearest to Compound B, N-((1S)-1-{[((1S)-3-hydroxy-2-oxo-1- {[(3S)-2-oxopyrrolidin-3-yl]methyl}propyl)amino]carbonyl}-3-methylbutyl)-4-methoxy-1H- indole-2-carboxamide, that differed between SARS 3C-like protease and SARS-CoV-2 3C-like protease model is A46S, and the minimum distance from Caipha to ligand is 8.3 A. Other residues are between 11 A and 38 A from the nearest atom in Compound B.
Table 1. Approximate distances from Caipha atoms in SARS-CoV-2 to Compound B, N- ((1S)-1-{[((1S)-3-hydroxy-2-oxo-1-{[(3S)-2-oxopyrrolidin-3-yl]methyl}propyl)amino] carbonyl}-3-methylbutyl)-4-methoxy-1H-indole-2-carboxamide
Figure 1 depicts the residue differences between SARS-CoV and SARS-CoV-2. Residue changes are highlighted in cyan in this ribbon depiction of SARS-CoV-2
homology model. The Compound B, N-((1S)-1-{[((1S)-3-hydroxy-2-oxo-1-{[(3S)-2- oxopyrrolidin-3-yl]methyl}propyl)amino]carbonyl}-3-methylbutyl)-4-methoxy-1H-indole-2- carboxamide, location is shown in magenta. The approximate distance between the C- alpha of a SARS-CoV-2 amino acid residue and the closest atom in the Compound B, N-((1S)-1-{[((1S)-3-hydroxy-2-oxo-1-{[(3S)-2-oxopyrrolidin-3-yl]methyl}propyl)amino] carbonyl}-3-methylbutyl)-4-methoxy-1H-indole-2-carboxamide, is shown in Table 1, above.
Docking Results:
The approximately 96% homology of SARS-CoV-2 3CL to SARS-CoV 3CL and the similarity between ligands allows a comparison of the RMSD between the peptide backbone of xtal ligand in SARS-CoV (see Figure 2) and the docked ligand in the SARS-CoV-2 3CL model. The core-docked ligand RMSD to the peptide backbone did not differ by more than 0.32A (average 0.28A). See Figure 2 for an example. In the case of Compound B, N-((1S)-1-{[((1S)-3-hydroxy-2-oxo-1-{[(3S)-2-oxopyrrolidin-3- yl]methyl}propyl)amino]carbonyl}-3-methylbutyl)-4-methoxy-1H-indole-2-carboxamide; the RMSD for the whole molecule was 0.37 A.
Figure 2. Binding site of homology model of SARS-CoV-2 3CL with a core-docked ligand (Compound B, N-((1S)-1-{[((1S)-3-hydroxy-2-oxo-1-{[(3S)-2-oxopyrrolidin-3- yl]methyl}propyl)amino]carbonyl}-3-methylbutyl)-4-methoxy-1H-indole-2-carboxamide) present (purple carbons, red oxygen, blue nitrogen). Part of the crystal structure of Compound B, N-((1S)-1-{[((1S)-3-hydroxy-2-oxo-1-{[(3S)-2-oxopyrrolidin-3-yl]methyl} propyl)amino]carbonyl}-3-methylbutyl)-4-methoxy-1H-indole-2-carboxamide; (peptide backbone, lactam side chain and attacked ketone) was used to measure the RMSD of the different ligands to that backbone (grey carbons, thick stick). The core used for core docking is shown as 11 heavy atoms in ball representation (light blue carbons) and in the inset chemical structure. Distances shown in Angstroms.
The docking result(s) in Table 2 below indicate that the compound(s) have predicted affinities (AGbind, kcal/mol) that are generally commensurate with target recognition and binding. The effective potency can differ from the DQ binding terms depending on several factors such as cell uptake, efflux, cofactor competition or substrate competition.
Table 2:
The compounds described above are analyzed by a FRET biochemical assay and by in vitro virological assays using cell culture techniques.
Protection from SARS Infection: Neutral Red Endpoint
The ability of compounds to protect cells against infection by the SARS coronavirus is measured by a cell viability assay similar to that described in Borenfreund, E., and Puerner, J. 1985. Toxicity determined in vitro by morphological alterations and neutral red absorption Toxicology Letters. 24:119-124, utilizing neutral red staining as an endpoint. Briefly, medium containing appropriate concentrations of compound or medium only is added to Vero cells. Cells are infected with SARS-associated virus or mock-infected with medium only. One to seven days later, the medium is removed and medium containing neutral red is added to the test plates. Following incubation at 37°C for two hours, cells are washed twice with PBS and a 50% EtOH, 1 % acetic acid solution is added. The cells are shaken for 1 to 2 minutes and incubated at 37°C for 5 to 10 minutes. The amount of neutral red is quantified spectrophotometrically at 540nm. Data is expressed as the percent of neutral red in wells of compound-treated cells compared to neutral red in wells of uninfected, compound-free cells. The fifty percent effective concentration (EC50) is calculated as the concentration of compound that increases the percent of neutral red production in infected, compound-treated cells to 50% of that produced by uninfected, compound-free cells. The 50% cytotoxicity concentration (CC50) is calculated as the concentration of compound that decreases the percentage of neutral red produced in uninfected, compound-treated cells to 50% of that produced in uninfected, compound-free cells. The therapeutic index is calculated by dividing the cytotoxicity (CC50) by the antiviral activity (EC50).
Protection from SARS-CoV-2 Infection: Glo endpoint
The ability of compounds to protect cells against infection by the SARS-CoV-2 coronavirus can also be measured by a cell viability assay utilizing luciferase to measure intracellular ATP as an endpoint. Briefly, medium containing appropriate concentrations of compound or medium only is added to Vero cells. Cells are infected with SARS-CoV-2 virus or mock-infected with medium only. One to seven days later, the medium is removed and the amount of intracellular ATP is measured as per Promega Technical Bulletin No. 288: CellTiter-Glo® Luminescent Cell Viability Assay (Promega, Madison, Wl). The CellTiter-Glo® reagent is added to the test plates and following incubation at 37°C for 1.25 hours, the amount of signal is quantified using a luminometer at 490nm. Data is expressed as the percent of luminescent signal from wells of compound-treated cells compared to the luminescent signal from wells of uninfected, compound-free cells. The fifty percent effective concentration (EC50) is calculated as the concentration of compound that increases the percent of the luminescent signal from infected, compound-treated cells to 50% of the luminescent signal from uninfected, compound-free cells. The 50% cytotoxicity concentration (CC50) is calculated as the concentration of compound that decreases the percentage of the luminescent signal from uninfected, compound-treated cells to 50% of the luminescent signal from uninfected, compound-free cells. The therapeutic index is calculated by dividing the cytotoxicity (CC50) by the antiviral activity (EC50).
Cytotoxicity
The ability of compounds to cause cytotoxicity in cells is measured by a cell viability assay similar to that described in Weislow, O.S., Kiser, R., Fine, D.L., Bader, J., Shoemaker, R.H., and Boyd, M. R.1989. New Soluble-Formazan Assay for HIV-1 Cytopathic Effects: Application to High-Flux Screening of Synthetic and Natural Products for AIDS-Antiviral Activity. Journal of the National Cancer Institute 81(08): 577- 586, utilizing formazan as an endpoint. Briefly, Vero cells are resuspended in medium containing appropriate concentrations of compound or medium only. One to seven days later, XTT and PMS are added to the test plates and following incubation at 37°C for two hours the amount of formazan produced is quantified spectrophotometrically at 540nm. Data is expressed as the percent of formazan produced in compound-treated cells compared to formazan produced in wells of compound-free cells. The 50%
cytotoxicity concentration (CC50) is calculated as the concentration of compound that decreases the percentage of formazan produced in uninfected, compound-treated cells to 50% of that produced in uninfected, compound-free cells.
Protection from SARS-CoV-2 Coronavirus Infection
The ability of compounds to protect cells against infection by SARS-CoV-2 is measured by a cell viability assay similar to that described in Weislow, O.S., Kiser, R., Fine, D.L., Bader, J., Shoemaker, R.H., and Boyd, M.R.1989. New Soluble-Formazan Assay for HIV-1 Cytopathic Effects: Application to High-Flux Screening of Synthetic and Natural Products for AIDS-Antiviral Activity. Journal of the National Cancer Institute 81(08): 577-586, utilizing formazan as an endpoint. Briefly, medium containing appropriate concentrations of compound or medium only is added to MRC-5 cells. Cells are infected with human coronavirus SARS-CoV-2 or mock-infected with medium only. One to seven days later, XTI and PMS are added to the test plates and following incubation at 37°C for two hours the amount of formazan produced is quantified spectrophotometrically at 540nm. Data is expressed as the percent of formazan in wells of compound-treated cells compared to formazan in wells of uninfected, compound-free cells. The fifty percent effective concentration (EC50) is calculated as the concentration of compound that increases the percent of formazan production in infected, compound- treated cells to 50% of that produced by uninfected, compound-free cells. The 50% cytotoxicity concentration (CC50) is calculated as the concentration of compound that decreases the percentage of formazan produced in uninfected, compound-treated cells to 50% of that produced in uninfected, compound-free cells. The therapeutic index is calculated by dividing the cytotoxicity (CC50) by the antiviral activity (EC50).
SARS-CoV-2 Coronavirus 3C Protease FRET Assay and Analysis
The proteolytic activity of the main protease, 3CLpro, of SARS-CoV-2 was monitored using a continuous fluorescence resonance energy transfer (FRET) assay. The SARS- CoV-2 3CLpro assay measures the activity of full-length SARS-CoV-2 3CL protease to cleave a synthetic fluorogenic substrate peptide with the following sequence: Dabcyl- KTSAVLQ-SGFRKME-Edans modelled on a consensus peptide (V. Grum-Tokars et al. Evaluating the 3C-like protease activity of SARS-coronavirus: recommendations for standardized assays for drug discovery. Virus Research 133 (2008) 63-73). The
fluorescence of the cleaved Edans peptide (excitation 340 nm / emission 490 nm) is measured using a fluorescence intensity protocol on a Flexstation reader (Molecular Devices). The fluorescent signal is reduced in the present of PF-835231, a potent inhibitor of SARS-CoV-2 3CLpro. The assay reaction buffer contained 20 mM Tris-HCI (pH 7.3), 100 nM NaCI, 1 mM EDTA and 25 mM peptide substrate. Enzyme reactions were initiated with the addition of 15 nM SARS-CoV-2 3CL protease and allowed to proceed for 60 minutes at 23 °C. Percent inhibition or activity was calculated based on control wells containing no compound (0% inhibition/100% activity) and a control compound (100% inhibition/0% activity). ICso values were generated using a four- parameter fit model using ABASE software (I DBS). Ki values were fit to the Morrison equation with the enzyme concentration parameter fixed to 15 nM, the Km parameter fixed to 14 pM and the substrate concentration parameter fixed to 25 pM using ABASE software (I DBS).
Proteolytic activity of SARS-CoV-2 Coronavirus 3CL protease is measured using a continuous fluorescence resonance energy transfer assay. The SARS-CoV-2 3CLpro FRET assay measures the protease catalyzed cleavage of TAMRA- SITSAVLQSGFRKMK-(DABCYL)-OH to TAMRA - SITSAVLQ and SGFRKMK(DABCYL)-OH. The fluorescence of the cleaved TAMRA (ex. 558 nm / em. 581 nm) peptide was measured using a TECAN SAFI RE fluorescence plate reader over the course of 10 min. Typical reaction solutions contained 20 mM HEPES (pH 7.0), 1 mM EDTA, 4.0 pM FRET substrate, 4% DMSO and 0.005% Tween-20. Assays were initiated with the addition of 25 nM SARS 3CLpro (nucleotide sequence 9985-10902 of the Urbani strain of SARS coronavirus complete genome sequence (NCBI accession number AY278741)). Percent inhibition was determined in duplicate at 0.001 mM level of inhibitor. Data was analyzed with the non-linear regression analysis program Kalidagraph using the equation:
FU = offset+ (limit)(1- e (kobsH) where offset equals the fluorescence signal of the un-cleaved peptide substrate, and limit equals the fluorescence of fully cleaved peptide substrate. The kobs is the first order rate constant for this reaction, and in the absence of any inhibitor represents the utilization of substrate. In an enzyme start reaction which contains an irreversible inhibitor, and where the calculated limit is less than 20% of the theoretical maximum limit, the calculated kobs represents the rate of inactivation of coronavirus 3C protease. The slope (kobs/ 1) of a plot of kobs vs. [I] is a measure of the avidity of the inhibitor for
an enzyme. For very fast irreversible inhibitors, kobs/l is calculated from observations at only one or two [I] rather than as a slope.
All patents and publications described hereinabove are hereby incorporated by reference in their entirety. While the invention has been described in terms of various preferred embodiments and specific examples, the invention should be understood as not being limited by the foregoing detailed description, but as being defined by the appended claims and their equivalents.
Claims
1. A method of treating COVID-19 in a patient, the method comprising administering to a patient in need thereof a therapeutically effective amount of a compound selected from the group consisting of:
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl acetate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl pivalate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl benzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methylbenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-fluorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-cyanobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methoxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-chlorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dichlorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dimethylbenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-lndol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-difluorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dimethoxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-chloro-2-hydroxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-cyano-2-fluorobenzoate; and
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2-cyanobenzoate;
or a pharmaceutically acceptable salt thereof
2. The method of claim 1 wherein the compound or pharmaceutically acceptable salt thereof is administered orally, by inhalation or intranasally.
3. The method of claim 2 wherein the compound or pharmaceutically acceptable salt thereof is administered orally.
4. The method of claim 2 wherein the compound or pharmaceutically acceptable salt thereof is administered by inhalation or intranasally.
5. The method of claim 1 wherein the compound or pharmaceutically acceptable salt thereof is administered sublingually.
6. The method of any one of claims 1 to 5 wherein the compound or pharmaceutically acceptable salt thereof is administered one to four times over a 24- hour period.
7. The method of any one of claims 1 to 6 further comprising the administration of one or more additional therapeutic agents.
8. The method of claim 7 wherein the additional therapeutic agent is selected from the group consisting of remdesivir and dexamethasone.
9. A method of inhibiting or preventing SARS-CoV-2 viral replication comprising contacting a SARS-CoV-2 coronavirus protease with a therapeutically effective amount of a compound selected from the group consisting of:
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl acetate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl pivalate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl benzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methylbenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-fluorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-cyanobenzoate;
(3S)-3-({/V-[(4-methoxy-1H-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methoxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-chlorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dichlorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dimethylbenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-lndol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-difluorobenzoate;
(3S)-3-({/V-[(4-methoxy-1H-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dimethoxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-chloro-2-hydroxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-cyano-2-fluorobenzoate; and
(3S)-3-({/V-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2-cyanobenzoate; or a pharmaceutically acceptable salt thereof
10. A method of inhibiting or preventing SARS-CoV-2 viral replication comprising contacting the SARS-CoV-2 coronavirus 3CL protease with a therapeutically effective amount of a compound selected from the group consisting of:
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl acetate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl pivalate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl benzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methylbenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-fluorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-cyanobenzoate;
(3S)-3-({/V-[(4-methoxy-1H-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methoxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-chlorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dichlorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dimethylbenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-lndol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-difluorobenzoate;
(3S)-3-({/V-[(4-methoxy-1H-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dimethoxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-chloro-2-hydroxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-cyano-2-fluorobenzoate; and
(3S)-3-({/V-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2-cyanobenzoate; or a pharmaceutically acceptable salt thereof
11. A method of treating COVID-19 in a patient, the method comprising administering to a patient in need thereof a pharmaceutical composition, the pharmaceutical composition comprising a therapeutically effective amount of a compound selected from the group consisting of:
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl acetate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl pivalate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl benzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methylbenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-fluorobenzoate;
(3S)-3-({/V-[(4-methoxy-1H-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-cyanobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methoxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-chlorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dichlorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dimethylbenzoate;
(3S)-3-({/V-[(4-methoxy-1H-lndol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-difluorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dimethoxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-chloro-2-hydroxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-cyano-2-fluorobenzoate; and
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2-cyanobenzoate; or a pharmaceutically acceptable salt thereof.
12. The method of claim 11 wherein the pharmaceutical composition further comprises an additional therapeutic agent.
13. The method of claim 12 wherein the additional therapeutic agent is selected from the group consisting of remdesivir and dexamethasone.
14. The method of any one of claims 11 to 13 wherein the pharmaceutical composition is administered orally.
15. The method of any one of claims 11 to 13 wherein the pharmaceutical composition is administered by inhalation or intranasally.
16. The method of claim 7 or 12 wherein the one or more additional therapeutic agent is selected from the group consisting of remdesivir, galidesivir, favilavir/avifavir, mulnupiravir (MK-4482/EIDD 2801), AT-527, AT-301 , BLD-2660, favipiravir, camostat, SLV213 emtrictabine/tenofivir, clevudine, dalcetrapib, boceprevir, ABX464, dexamethasone, hydrocortisone, convalescent plasma, gelsolin (Rhu-p65N), monoclonal antibodies, regdanvimab (Regkirova), ravulizumab (Ultomiris), VIR-7831/VIR-7832, BRI 1-196/BRI I- 198, COVI-AMG/COVI DROPS (STI- 2020), bamlanivimab (LY-CoV555), mavrilimab, leronlimab (PRO140), AZD7442, lenzilumab, infliximab, adalimumab, JS 016, STI-1499 (COVIGUARD), lanadelumab (Takhzyro), canakinumab (Haris), gimsilumab, otilimab, casirivimab/imdevimab (REGN-Cov2), MK-7110 (CD24Fc/SACCOVID), heparin, apixaban, tocilizumab (Actemra), sarilumab (Kevzara), apilimod dimesylate, DNL758, PB1046, dapaglifozin, abivertinib, ATR-002, bemcentinib, acalabrutinib, baricitinib, losmapimod, famotidine, niclosamide and diminazene.
17. The method of claim 16 wherein the one or more additional agent is selected from the group consisting of remdesivir, dexamethasone, malnupiravir, bamlanivimab and baricitinib.
18. A compound selected from the group consisting of: (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl acetate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl pivalate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl benzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methylbenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-fluorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-cyanobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methoxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-chlorobenzoate;
(3S)-3-({/V-[(4-methoxy-1H-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dichlorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dimethylbenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-lndol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-difluorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dimethoxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-chloro-2-hydroxybenzoate;
(3S)-3-({/V-[(4-methoxy-1H-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-cyano-2-fluorobenzoate; and
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2-cyanobenzoate; or a pharmaceutically acceptable salt thereof, for use in the treatment of COVID-19 in a patient.
19. The compound for use according to claim 18 wherein the compound or pharmaceutically acceptable salt thereof is administered orally, by inhalation or intranasally.
20. The compound for use according to claim 19 wherein the compound or pharmaceutically acceptable salt thereof is administered orally.
21. The compound for use according to claim 19 wherein the compound or pharmaceutically acceptable salt thereof is administered by inhalation or intranasally.
22. The compound for use according to claim 18 wherein the compound or pharmaceutically acceptable salt thereof is administered sublingually.
23. The compound for use according to any one of claims 18 to 22 wherein the compound or pharmaceutically acceptable salt thereof is administered one to four times over a 24-hour period.
24. The compound for use according to any one of claims 18 to 23 wherein the compound or pharmaceutically acceptable salt thereof is administered with one or more additional therapeutic agent.
25. The compound for use according to claim 24 wherein the one or more additional therapeutic agent is selected from the group consisting of remdesivir and dexamethasone.
26. The compound for use according to claim 24 wherein the one or more additional therapeutic agent is selected from the group consisting of remdesivir, galidesivir, favilavir/avifavir, mulnupiravir (MK-4482/EIDD 2801), AT-527, AT-301, BLD-2660, favipiravir, camostat, SLV213 emtrictabine/tenofivir, clevudine, dalcetrapib, boceprevir, ABX464, dexamethasone, hydrocortisone, convalescent plasma, gelsolin (Rhu-p65N), monoclonal antibodies, regdanvimab (Regkirova), ravulizumab (Ultomiris), VIR-7831/VIR-7832, BRI 1-196/BRI I- 198, COVI-AMG/COVI DROPS (STI- 2020), bamlanivimab (LY-CoV555), mavrilimab, leronlimab (PRO140), AZD7442, lenzilumab, infliximab, adalimumab, JS 016, STI-1499 (COVIGUARD), lanadelumab (Takhzyro), canakinumab (llaris), gimsilumab, otilimab, casirivimab/imdevimab (REGN-Cov2), MK-7110 (CD24Fc/SACCOVID), heparin, apixaban, tocilizumab (Actemra), sarilumab (Kevzara), apilimod dimesylate, DNL758, PB1046, dapaglifozin, abivertinib, ATR-002, bemcentinib, acalabrutinib, baricitinib, losmapimod, famotidine, niclosamide and diminazene.
27. The compound for use according to claim 26 wherein the one or more additional agent is selected from the group consisting of remdesivir, dexamethasone, malnupiravir, bamlanivimab and baricitinib.
28. A compound selected from the group consisting of: (3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl acetate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl pivalate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl benzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methylbenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-fluorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-cyanobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-methoxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-chlorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dichlorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dimethylbenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-lndol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-difluorobenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2,6-dimethoxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-chloro-2-hydroxybenzoate;
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 4-cyano-2-fluorobenzoate; and
(3S)-3-({/\/-[(4-methoxy-1/-/-indol-2-yl)carbonyl]-L-leucyl}amino)-2-oxo-4-[(3S)-2- oxopyrrolidin-3-yl]butyl 2-cyanobenzoate; or a pharmaceutically acceptable salt thereof, for use in inhibiting or preventing SARS-CoV-2 viral replication.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/906,109 US20230105838A1 (en) | 2020-04-05 | 2021-04-01 | Method of Treating COVID-19 |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202063005376P | 2020-04-05 | 2020-04-05 | |
US63/005,376 | 2020-04-05 | ||
US202163155530P | 2021-03-02 | 2021-03-02 | |
US63/155,530 | 2021-03-02 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2021205296A1 true WO2021205296A1 (en) | 2021-10-14 |
Family
ID=75439160
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/IB2021/052738 WO2021205296A1 (en) | 2020-04-05 | 2021-04-01 | Method of treating covid-19 |
Country Status (2)
Country | Link |
---|---|
US (1) | US20230105838A1 (en) |
WO (1) | WO2021205296A1 (en) |
Cited By (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11319325B1 (en) | 2021-05-11 | 2022-05-03 | Enanta Pharmaceuticals, Inc. | Macrocyclic spiropyrrolidine derived antiviral agents |
US11325916B1 (en) | 2021-07-29 | 2022-05-10 | Enanta Pharmaceuticals, Inc. | Spiropyrrolidine derived antiviral agents |
US11339170B1 (en) | 2021-07-23 | 2022-05-24 | Enanta Pharmaceuticals, Inc. | Spiropyrrolidine derived antiviral agents |
US11352363B1 (en) | 2020-11-23 | 2022-06-07 | Enanta Pharmaceuticals, Inc. | Spiropyrrolidine derived antiviral agents |
US11358953B2 (en) | 2020-07-20 | 2022-06-14 | Enanta Pharmaceuticals, Inc. | Functionalized peptides as antiviral agents |
US11384090B2 (en) | 2020-11-23 | 2022-07-12 | Enanta Pharmaceuticals, Inc. | Spiropyrrolidine derived antiviral agents |
CN114957053A (en) * | 2022-05-20 | 2022-08-30 | 中国医学科学院医药生物技术研究所 | Oxoethylene compound or pharmaceutically acceptable salt thereof, preparation method and application thereof, pharmaceutical composition and application thereof |
WO2022256434A1 (en) * | 2021-06-02 | 2022-12-08 | ACEA Therapeutics, Inc. | Protease inhibitors as antivirals |
WO2022266363A1 (en) * | 2021-06-16 | 2022-12-22 | The Scripps Research Institute | Protease inhibitors for the treatment of coronavirus infections |
US11858945B2 (en) | 2021-11-12 | 2024-01-02 | Enanta Pharmaceuticals, Inc. | Alkyne-containing antiviral agents |
US11912714B2 (en) | 2021-11-12 | 2024-02-27 | Enanta Pharmaceuticals, Inc. | Spiropyrrolidine derived antiviral agents |
US11919910B2 (en) | 2021-11-12 | 2024-03-05 | Enanta Pharmaceuticals, Inc. | Spiropyrrolidine derived antiviral agents |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005113580A1 (en) | 2004-05-21 | 2005-12-01 | Pfizer Inc. | Anticoronviral compounds and compositions, their pharmaceutical uses and materials for their synthesis |
US9884876B2 (en) | 2014-05-09 | 2018-02-06 | Kineta, Inc. | Anti-viral compounds, pharmaceutical compositions, and methods of use thereof |
-
2021
- 2021-04-01 WO PCT/IB2021/052738 patent/WO2021205296A1/en active Application Filing
- 2021-04-01 US US17/906,109 patent/US20230105838A1/en active Pending
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005113580A1 (en) | 2004-05-21 | 2005-12-01 | Pfizer Inc. | Anticoronviral compounds and compositions, their pharmaceutical uses and materials for their synthesis |
US9884876B2 (en) | 2014-05-09 | 2018-02-06 | Kineta, Inc. | Anti-viral compounds, pharmaceutical compositions, and methods of use thereof |
Non-Patent Citations (24)
Title |
---|
"NCBI", Database accession no. YP_009725301.1 |
ADVANCED DRUG DELIVERY REVIEWS, vol. 19, no. 115, 1996 |
BORENFREUND, E.PUERNER, J.: "Toxicity determined in vitro by morphological alterations and neutral red absorption", TOXICOLOGY LETTERS, vol. 24, 1985, pages 119 - 124, XP025521855, DOI: 10.1016/0378-4274(85)90046-3 |
DANIEL K. GEHLHAARDJAMAL BOUZIDAPAUL A. REJTO, REDUCED DIMENSIONALITY IN LIGAND—PROTEIN STRUCTURE PREDICTION: COVALENT INHIBITORS OF SERINE PROTEASES AND DESIGN OF SITE-DIRECTED COMBINATORIAL LIBRARIES RATIONAL DRUG DESIGN, 7 July 1999 (1999-07-07), pages 292 - 311 |
DANIEL K. GEHLHAARGENNADY M. VERKHIVKERPAUL A. REJTOCHRISTOPHER J. SHERMANDAVID R. FOGELLAWRENCE J. FOGELSTEPHAN T. FREER: "Molecular recognition of the inhibitor AG-1343 by HIV-1 protease: conformationally flexible docking by evolutionary programming", CHEMISTRY & BIOLOGY, vol. 2, 1995, pages 317 - 324, XP008010769, DOI: 10.1016/1074-5521(95)90050-0 |
FEHR, A.R.PERLMAN, S., CORONAVIRUSES: AN OVERVIEW OF THEIR REPLICATION AND PATHOGENESIS METHODS MOL BIOL, vol. 1282, 2015, pages 1 - 23 |
HOFFMAN ROBERT L. ET AL: "Discovery of Ketone-Based Covalent Inhibitors of Coronavirus 3CL Proteases for the Potential Therapeutic Treatment of COVID-19", JOURNAL OF MEDICINAL CHEMISTRY, vol. 63, no. 21, 15 October 2020 (2020-10-15), US, pages 12725 - 12747, XP055803394, ISSN: 0022-2623, DOI: 10.1021/acs.jmedchem.0c01063 * |
J. MED. CHEM., vol. 29, no. 10, 1996 |
JOURNAL OF GENERAL VIROLOGY, vol. 83, 2002, pages 595 - 599 |
LU, J.CUI, J. ET AL., ON THE ORIGIN AND CONTINUING EVOLUTION OF SARS-COV-2, Retrieved from the Internet <URL:http://doi.org/10.1093/nsr/nwaa036> |
LU, R. ET AL., THE LANCET, 29 January 2020 (2020-01-29), Retrieved from the Internet <URL:http://doi.org/10.1016/S0140-6736(20)> |
NASOFF ET AL., PNAS, vol. 88, 1991, pages 5462 - 5466 |
NATIONAL HEALTH COMMISSION OF THE PEOPLE'S REPUBLIC OF CHINA, DIAGNOSIS AND TREATMENT OF PNEUMONIA CAUSED BY 2019-NCOV, 6 February 2020 (2020-02-06), Retrieved from the Internet <URL:http://www.nhc.gov.cn/jkj/s3577/202002/573340613ab243b3a7f61df260551dd4/files/c791e5a7ea5149f680fdcb34dac0f54e.pdf> |
SCHODINGER: "Schrodinger Release 2019-1: Prime", 2019, LLC |
STOERMER MARTIN: "Homology Models of Wuhan Coronavirus 3CLpro Protease", 5 February 2020 (2020-02-05), pages 1 - 11, XP055814654, Retrieved from the Internet <URL:https://chemrxiv.org/articles/preprint/Homology_Models_of_Wuhan_Coronavirus_3CLpro_Protease/11637294/1> [retrieved on 20210616], DOI: 10.26434/chemrxiv.11637294.v1 * |
TAMI J. MARRONEBROCK A. LUTYPETER W. ROSE: "Discovering high-affinity ligands from the computationally predicted structures and affinities of small molecules bound to a target: A virtual screening approach", PERSPECTIVES IN DRUG DISCOVERY AND DESIGN, vol. 20, 2000, pages 209 - 230 |
V. GRUM-TOKARS ET AL.: "Evaluating the 3C-like protease activity of SARS-coronavirus: recommendations for standardized assays for drug discovery", VIRUS RESEARCH, vol. 133, 2008, pages 63 - 73, XP022520313, DOI: 10.1016/j.virusres.2007.02.015 |
WEISLOW, O.S.KISER, R.FINE, D.L.BADER, J.SHOEMAKER, R.H.BOYD, M. R.: "New Soluble-Formazan Assay for HIV-1 Cytopathic Effects: Application to High-Flux Screening of Synthetic and Natural Products for AIDS-Antiviral Activity", JOURNAL OF THE NATIONAL CANCER INSTITUTE, vol. 81, no. 08, 1989, pages 577 - 586, XP000197128, DOI: 10.1093/jnci/81.8.577 |
WU, C. ET AL., ISCIENCE, vol. 23, 23 October 2020 (2020-10-23), pages 101642 |
XU, J.ZHAO, S.TENG, T.ABDALLA, A.E.ZHU, W.XIE, L.WANG, Y.GUO, X.: "Systematic Comparison of Two Animal-to-Human Transmitted Human Coronaviruses: SARS-CoV-2and SARS-CoV", VIRUSES, vol. 12, no. 244, 2020 |
YU ET AL.: "Viral Hepatitis and Liver Disease", 1994, SPRINGER-VERLAG, pages: 574 - 577 |
YUSHUN WAN, Y.SHANG, J.GRAHAM, R.2, BARIC, R.S.LI, F.: "Receptor recognition by novel coronavirus from Wuhan: An analysis based on decade-long structural studies of SARS", J. VIROL., 2020 |
ZHANG, L.LIN, D.SUN, X.ROX, K.HILGENFELD, R.: "X-ray Structure of Main Protease of the Novel Coronavirus SARS-CoV-2 Enables Design of a-Ketoamide Inhibitors", BIORXIV, Retrieved from the Internet <URL:https://doi.org/10.1101/2020.02.17.952879> |
ZIEBUHR, J.SNIJDER, E.J.GORBALEYA, A.E.: "Virus-encoded proteinases and proteolytic processing in Nidovirales", J. GEN. VIROL., vol. 81, 2000, pages 853 - 879 |
Cited By (14)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11358953B2 (en) | 2020-07-20 | 2022-06-14 | Enanta Pharmaceuticals, Inc. | Functionalized peptides as antiviral agents |
US11384090B2 (en) | 2020-11-23 | 2022-07-12 | Enanta Pharmaceuticals, Inc. | Spiropyrrolidine derived antiviral agents |
US11352363B1 (en) | 2020-11-23 | 2022-06-07 | Enanta Pharmaceuticals, Inc. | Spiropyrrolidine derived antiviral agents |
US11319325B1 (en) | 2021-05-11 | 2022-05-03 | Enanta Pharmaceuticals, Inc. | Macrocyclic spiropyrrolidine derived antiviral agents |
US11753373B2 (en) | 2021-06-02 | 2023-09-12 | ACEA Therapeutics, Inc. | Protease inhibitors as antivirals |
WO2022256434A1 (en) * | 2021-06-02 | 2022-12-08 | ACEA Therapeutics, Inc. | Protease inhibitors as antivirals |
WO2022266363A1 (en) * | 2021-06-16 | 2022-12-22 | The Scripps Research Institute | Protease inhibitors for the treatment of coronavirus infections |
US11339170B1 (en) | 2021-07-23 | 2022-05-24 | Enanta Pharmaceuticals, Inc. | Spiropyrrolidine derived antiviral agents |
US11325916B1 (en) | 2021-07-29 | 2022-05-10 | Enanta Pharmaceuticals, Inc. | Spiropyrrolidine derived antiviral agents |
US11858945B2 (en) | 2021-11-12 | 2024-01-02 | Enanta Pharmaceuticals, Inc. | Alkyne-containing antiviral agents |
US11912714B2 (en) | 2021-11-12 | 2024-02-27 | Enanta Pharmaceuticals, Inc. | Spiropyrrolidine derived antiviral agents |
US11919910B2 (en) | 2021-11-12 | 2024-03-05 | Enanta Pharmaceuticals, Inc. | Spiropyrrolidine derived antiviral agents |
CN114957053A (en) * | 2022-05-20 | 2022-08-30 | 中国医学科学院医药生物技术研究所 | Oxoethylene compound or pharmaceutically acceptable salt thereof, preparation method and application thereof, pharmaceutical composition and application thereof |
CN114957053B (en) * | 2022-05-20 | 2023-12-22 | 中国医学科学院医药生物技术研究所 | Oxoethylene compound or pharmaceutically acceptable salt thereof, preparation method and application thereof, pharmaceutical composition and application thereof |
Also Published As
Publication number | Publication date |
---|---|
US20230105838A1 (en) | 2023-04-06 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20230105838A1 (en) | Method of Treating COVID-19 | |
Uzunova et al. | Insights into antiviral mechanisms of remdesivir, lopinavir/ritonavir and chloroquine/hydroxychloroquine affecting the new SARS-CoV-2 | |
AU2021253796B2 (en) | Compounds and methods for the treatment of COVID-19 | |
TW202214604A (en) | Nitrile-containing antiviral compounds | |
US20230157998A1 (en) | Methods of Inhibiting SARS-CoV-2 Replication and Treating Corona Virus Disease 2019 | |
WO2022013684A1 (en) | Antiviral heteroaryl ketone derivatives | |
US20240083885A1 (en) | Compositions and methods for inhibiting m pro protease activity and for preventing and treating sars-cov-2 infection | |
US20060014821A1 (en) | Inhibitors of SARS 3C like protease | |
Zhao et al. | Mechanism of action of small-molecule agents in ongoing clinical trials for SARS-CoV-2: a review | |
US8859290B2 (en) | Inhibitors of influenza endonuclease activity and tools for their discovery | |
US20230120707A1 (en) | Compounds and Method of Treating COVID-19 | |
Cooper et al. | Diastereomeric resolution yields highly potent inhibitor of SARS-CoV-2 main protease | |
Zhang et al. | Discovery of quinazolin-4-one-based non-covalent inhibitors targeting the severe acute respiratory syndrome coronavirus 2 main protease (SARS-CoV-2 Mpro) | |
Stefanelli et al. | Broad-spectrum coronavirus 3C-like protease peptidomimetic inhibitors effectively block SARS-CoV-2 replication in cells: Design, synthesis, biological evaluation, and X-ray structure determination | |
WO2021234127A1 (en) | NUCLEOSIDE ANALOGUE TO INHIBIT THE MAIN PROTEASE OF SARS-CoV-2 VIRUS | |
WO2024037520A1 (en) | Amide compound, and preparation method therefor, pharmaceutical composition and use thereof | |
Raj et al. | Current understanding on molecular drug targets and emerging treatment strategy for novel coronavirus-19 | |
WO2021164689A1 (en) | Application of nelfinavir in preparation of drug for preventing and treating novel coronavirus pneumonia | |
Mao et al. | Olgotrelvir, a dual inhibitor of SARS-CoV-2 Mpro and cathepsin L, as a standalone antiviral oral intervention candidate for COVID-19 | |
TW202206080A (en) | Compounds and methods for prevention and treatment of coronavirus infections | |
US9206412B2 (en) | Thioxothiazolidine inhibitors | |
Xie et al. | Structure-based design of pan-coronavirus inhibitors targeting host cathepsin L and calpain-1 | |
US20230241067A1 (en) | Targeting papain-like protease for broad-spectrum coronaviruses inhibition | |
US20230241101A1 (en) | Therapeutic composition and method for treating coronavirus infection | |
EP4173621A1 (en) | Pharmaceutical composition, its use as a drug and new compounds, especially for treating sars-cov-2 infection |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21717554 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 21717554 Country of ref document: EP Kind code of ref document: A1 |