WO2021138600A1 - Nanoparticle systems to stimulate and maintain immune system responsiveness at treatment sites - Google Patents
Nanoparticle systems to stimulate and maintain immune system responsiveness at treatment sites Download PDFInfo
- Publication number
- WO2021138600A1 WO2021138600A1 PCT/US2020/067729 US2020067729W WO2021138600A1 WO 2021138600 A1 WO2021138600 A1 WO 2021138600A1 US 2020067729 W US2020067729 W US 2020067729W WO 2021138600 A1 WO2021138600 A1 WO 2021138600A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cell
- nanoparticle
- nanoparticles
- binding domain
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/88—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation using microencapsulation, e.g. using amphiphile liposome vesicle
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/15—Natural-killer [NK] cells; Natural-killer T [NKT] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/17—Monocytes; Macrophages
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/549—Sugars, nucleosides, nucleotides or nucleic acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/645—Polycationic or polyanionic oligopeptides, polypeptides or polyamino acids, e.g. polylysine, polyarginine, polyglutamic acid or peptide TAT
- A61K47/6455—Polycationic oligopeptides, polypeptides or polyamino acids, e.g. for complexing nucleic acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/69—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit
- A61K47/6921—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere
- A61K47/6927—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere the form being a solid microparticle having no hollow or gas-filled cores
- A61K47/6929—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere the form being a solid microparticle having no hollow or gas-filled cores the form being a nanoparticle, e.g. an immuno-nanoparticle
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/69—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit
- A61K47/6921—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere
- A61K47/6927—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere the form being a solid microparticle having no hollow or gas-filled cores
- A61K47/6929—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere the form being a solid microparticle having no hollow or gas-filled cores the form being a nanoparticle, e.g. an immuno-nanoparticle
- A61K47/6931—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere the form being a solid microparticle having no hollow or gas-filled cores the form being a nanoparticle, e.g. an immuno-nanoparticle the material constituting the nanoparticle being a polymer
- A61K47/6935—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere the form being a solid microparticle having no hollow or gas-filled cores the form being a nanoparticle, e.g. an immuno-nanoparticle the material constituting the nanoparticle being a polymer the polymer being obtained otherwise than by reactions involving carbon to carbon unsaturated bonds, e.g. polyesters, polyamides or polyglycerol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
- A61K9/19—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles lyophilised, i.e. freeze-dried, solutions or dispersions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2121/00—Preparations for use in therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/30—Special therapeutic applications
- C12N2320/32—Special delivery means, e.g. tissue-specific
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
Definitions
- the disclosure provides nanoparticle systems that genetically modify monocytes/macrophages in vivo to (1) recruit additional immune cells to a treatment site; (2) remain activated at the treatment site providing an on-going stimulatory signal to other immune cells; and (3) secrete multi-specific immune-cell engaging molecules that bind antigens on targeted cells at the treatment site and also bind and activate the recruited immune cells to destroy the bound cell.
- the systems can also inhibit the activity of transforming growth factor beta (TQRb).
- Macrophages are key immune effector cells that infiltrate cancerous tissue in high numbers. Within the tumor microenvironment, however, macrophages undergo a switch from an activated tumoricidal state to an immunosuppressive phenotype that actually facilitates tumor growth and metastasis. Pollard, Nat Rev Cancer 4, 71-78 (2004); Mantovani, et al. , Nat Rev Clin Oncol (2017).
- CARs are proteins including several distinct subcomponents that allow the genetically modified T cells to recognize and kill cancer cells.
- the subcomponents include at least an extracellular component and an intracellular component.
- the extracellular component includes a binding domain that specifically binds a marker that is preferentially present on the surface of cells of interest. When the binding domain binds such markers, the intracellular component signals the T cell to destroy the bound cell.
- CARs additionally include a transmembrane domain that can link the extracellular component to the intracellular component, and other subcomponents that can increase the CAR’s function.
- a transmembrane domain that can link the extracellular component to the intracellular component
- other subcomponents that can increase the CAR’s function.
- linker sequences such as a spacer region
- CAR-T CAR-expressing T cells
- Bispecific T-cell engaging antibodies bind both a cancer antigen on cancer cells and a T cell activating epitope, with the goal of bringing T cells to cancer cells to destroy the cancer cells. See, for example, US 2008/0145362.
- Most current bispecific T-cell engaging antibody therapeutics include paired monospecific, antibody-derived binding domains.
- TGF-b transforming growth factor b family of protein factors are found at high levels in solid tumors and contribute to immune dysfunction in the tumor microenvironment.
- the current disclosure provides systems and methods to reverse the immunosuppressive, tumor supporting state of tumor-associated macrophages (TAMs) and turn these TAMs into highly activated, tumor cell-killing macrophages.
- TAMs tumor-associated macrophages
- the systems and methods disclosed herein do not simply aim to kill TAMs, but instead redirect their activity from tumor-promoting to tumor- destroying.
- the systems and methods are used as a therapeutic to induce the killing of cancer cells and/or to reduce or prevent the growth or development of new cancer cells. Data disclosed herein shows that these systems and methods are able to completely eradicate and suppress ovarian cancer, a notoriously difficult cancer type to control.
- the current disclosure provides for genetically engineering the activated TAM to express multi-specific immune-cell engaging molecules.
- the activated TAM then provide three critical aspects to the success of the cancer therapies described herein. They (1) recruit immune cells to the tumor site; (2) remain activated at the tumor site providing an on-going stimulatory signal to other immune cells; and (3) secrete multi-specific immune-cell engaging molecules that bind cancer antigens at the tumor site and also bind and activate the recruited immune cells to destroy the bound cancer cell.
- the approach described to kill cancer cells can also be applied to other cell types of interest, such as diseased cells, autoreactive cells, infected cells, and microbial cells, to name a few.
- Particular embodiments alter or maintain the activation states of macrophages in vivo by utilizing a nanoparticle system to deliver nucleotides encoding activation regulators, such as transcription factors.
- Particularly useful nanoparticles have a positive core and a neutral or negatively-charged surface and deliver nucleotides encoding (i) a transcription factor that creates and/or maintains the activation status of a macrophage; (ii) a kinase; and/or (iii) a multi-specific immune-cell engaging molecule.
- the systems will include nanoparticles that deliver nucleotides encoding each of these components.
- a nanoparticle size of ⁇ 130 nm ensures tumor infiltration.
- the nanoparticles can optionally include a TAM targeting ligand to direct more selective uptake of the nanoparticles by TAMs.
- TAMs express CD206, a cellular surface receptor that can be targeted by including mannose on the surface of the nanoparticles.
- Particular embodiments include a nanoparticle that is ⁇ 130 nm in diameter, has a positively-charged polymer core, and a neutral or negatively-charged coating.
- Nucleotides encoding interferon-regulatory factor 5 (IRF5); the kinase, IKKb; a multi-specific antibody; and optionally a TQRb inhibitor are encapsulated within the positively-charged polymer core.
- IRF5 interferon-regulatory factor 5
- IKKb the kinase
- a multi-specific antibody optionally a TQRb inhibitor
- TQRb inhibitor are encapsulated within the positively-charged polymer core.
- a bi-specific antibody binds a cancer antigen selected from EpCam or Tyrosinase related protein 1 (TYRP1/gp75) and an immune cell activating epitope selected from CD3, CD28, or 4-1 BB.
- Systems disclosed herein can additionally include a transforming growth factor beta (TGF ) inhibitor.
- TGF transforming growth factor beta
- FIGs. 1A-1D Scheme to genetically transform tumor-associated macrophages (TAMs) into tumoricidal cells using targeted mRNA nanoparticles.
- TAMs tumor-associated macrophages
- FIG. 1A An injectable nanocarrier was developed to deliver in vitro transcribed mRNA encoding M1-polarizing transcription factors as a new method to rationally reprogram TAMs for therapeutic purposes without causing systemic toxicity. Illustrated is the first planned clinical application, designed to treat ovarian cancer patients with repeated intraperitoneal infusions of mRNA nanoparticles.
- FIG. 1B Scheme to genetically reprogram intracranial TAMs into tumoricidal macrophages using targeted mRNA nanoparticles.
- TAMs tumor-associated macrophages
- An injectable nanocarrier co-delivering in vitro transcribed mRNA encoding M1-polarizing transcription factors and antibodies that redirect T cells toward tumor antigen provides a new method to rationally reprogram TAMs and activate the host adaptive immune response for therapeutic purposes without causing systemic toxicity.
- FIG. 1 D Exemplary formats of bi-specific binding molecules in Fc and non-Fc formats.
- FIGs. 2A-2K Nanoparticles carrying mRNA encoding IRF5 and IKKb can imprint a pro- inflammatory M1-like phenotype.
- FIG. 2A Design of macrophage-targeted polymeric NPs formulated with mRNAs encoding key regulators of macrophage polarization.
- the nanoparticles consist of a PbAE-mRNA polyplex core coated with a layer of PGA-Di-mannose, which targets the nanoparticles to mannose receptors (CD206) expressed by M2-like macrophages.
- CD206 mannose receptors
- FIG. 2K synthetic mRNA encapsulated in the NP, which is engineered to encode the reprogramming transcription factors.
- FIG. 2B Transmission electron microscopy of a population of NPs (scale bar 200 nm) and a single NP (inset, scale bar 50 nm).
- FIG. 2C Size distributions of NPs, measured using a NanoSight NS300 instrument.
- FIG. 2D NPs demonstrated high transfection (46%) of bone marrow-derived macrophages (BMDMs) after 1 h exposure.
- FIG. 2E Gene-transfer efficiencies into bone marrow derived macrophages (BMDM) measured by flow cytometry 24 hours after nanoparticle transfection.
- FIG. 2F Relative viability of NP transfected and untransfected macrophages (assessed by staining with Annexin V and PI). N.s.; non significant.
- FIG. 2H Timelines depicting NP transfection protocols and culture conditions for the BMDMs used in FIGs. 2I-2K.
- FIG. 3 In vitro screening of the effect of different members of the interferon-regulatory factor (IRF) family (delivered in combination with or without their activating kinase) on the phenotype of mouse macrophages.
- BMDMs from C57BL/6 mice were incubated in M-CSF conditioning media and transfected with mRNA-PBAE NPs carrying synthetic mRNA encoding (1) control GFP, (2) murine IRF5, (3) murine IRF5 and the IKKb kinase, which phosphorylates IRF5, (4) murine IRF8 and the IKKb kinase, (5) murine IRF8 K310R, which is a mutant of IRF8, with a Lys-310 to Arg (K310R) conversion ( White etal., J Biol Chem.
- This fusion protein includes the DNA binding domain (DBD) and constitutively active domain (CAD) of IRF-7 and the nuclear export signal (NES) and IRF association domain of IRF3 ( Lin et ai, Molecular and Cellular Biology. 18.5, 1998).
- DBD DNA binding domain
- CAD constitutively active domain
- NES nuclear export signal
- IRF association domain of IRF3 Lin et ai, Molecular and Cellular Biology. 18.5, 1998.
- FIGs. 4A-4J Repeated intraperitoneal injections of mRNA nanocarriers delivering IRF5 and IKKb genes into macrophages more than doubles mean survival of mice with disseminated ovarian cancer.
- FIG. 4A Time lines and dosing regimens. Arrows indicate time of I.P. injection.
- FIG. 4B Sequential bioluminescence imaging of tumor growth in control and treated mice.
- FIG. 4C Kaplan-Meier survival curves for treated versus control mice. Statistical analysis was performed using the log-rank test.
- FIG. 4D Flow cytometric quantitation of in vivo transfection rates in different immune cell subpopulations 48 hours after a single i.p.
- D-mannose- coated NPs carrying GFP mRNA as a control macrophages (CD45+, CD11b+, MHCII+, CD11c- , Ly6C-/low, Ly6G-), monocytes (CD45+, CD11b+, MHCII+, CD11c-, Ly6C+, Ly6G-), neutrophils (CD45+, CD11b+, MHCII+, CD11c-, Ly6G+), CD4+ T cells (CD45+, JCR-b chain+, CD4+, CD8- ), CD8+ T cells (CD45+, TCR-b chain+, CD4-, CD8+), and natural killer cells (CD45+, TCR-b chain-, CD49b+) were measured.
- macrophages CD45+, CD11b+, MHCII+, CD11c- , Ly6C-/low, Ly6G-
- monocytes CD45+, CD11b+, MHCII+, CD
- FIG. 4E Flow cytometric analysis of macrophage phenotypes in the peritoneum of mice with disseminated ID8 ovarian cancer. Animals were either treated with 4 doses of IRF5/IKi ⁇ NPs or PBS.
- FIG. 4F Box plots summarizing relative percent (left panel) and absolute numbers (right panel) of Ly6C-, F4/80+, and CD206+ (M2-like) macrophages.
- FIG. 4G Corresponding numbers for Ly6C-, F4/80+, and CD206- (M 1-like) macrophages.
- FIG. 4H Representative hematoxylin and eosin-stained sections of ovarian tumor-infiltrated mesenteries isolated from PBS controls (top panel) or IRF5/IKi ⁇ NP-treated animals (bottom panel; scale bar 100 pm). 10-fold magnifications of representative malignant lesions are shown on the right (scale bar 50 pm).
- FIG. 4I Luminex assay measuring cytokines produced by isolated peritoneal macrophages from each treatment group. CD11b+, F4/80+ peritoneal macrophages were isolated by fluorescence activated cell sorting, and cultured ex vivo. After 24 hours, cell culture supernatants were collected.
- FIGs. 5A-5F Macrophage-programming mRNA nanocarriers are highly biocompatible and safe for repeated dosing.
- FIG. 5A In vivo biodistribution of macrophage-targeted IRF5/IKi ⁇ NPs following i.p. administration. NP-delivered (codon optimized) mRNA was detected by qPCR 24 hours after a single injection of nanoparticles containing 50 pg mRNA.
- FIG. 5B Schematic representation of the experimental timeline. *Twenty-four hours after the last dose, mice were euthanized by CO2 inhalation. Blood was collected through retro-orbital bleeding into heparin coated tubes for serum chemistry and complete blood count.
- FIG. 5C Representative hematoxylin and eosin-stained sections of various organs isolated from controls or NP-treated animals. Scale bar, 100 pm. Lesions found in the NP-treated animals are shown and described here based on analysis by a Comparative Pathologist. The relevant findings for each numbered image is: [1] Discrete foci of cellular infiltrates largely composed of mononuclear cells admixed with a few granulocytes; Mild extramedullary hematopoiesis.
- hepatocytes are mild to moderately swollen.
- Within the mesentery there are moderate, multifocal infiltrates of macrophages, lymphocytes, plasma cells and granulocytes.
- FIG. 5D Serum chemistry and blood counts.
- FIGs. 5E, 5F Luminex assay measurements of serum IL-6 (FIG. 5E) and TNF-a (FIG. 5F) cytokines 4 or 8 days after a single i.p. injection of IRFS/IKKb NPs.
- FIGs 6A-6I Intravenously infused IRFS/IKKb nanoparticles can control tumor metastases in the lung.
- FIG. 6A In vivo biodistribution of macrophage-targeted IRF5/IKi ⁇ NPs following i.v. administration. Codon-optimized mRNA was measured by qPCR 24 hours after a single i.v. injection of nanoparticles containing 50 pg mRNA.
- FIGs. 6B-6H C57BL/6 albino mice were injected via tail vein with 1 c 10 6 B16F10 firefly luciferase-expressing melanoma cells to establish lung metastases.
- FIG. 6B Time lines and dosing regimens.
- FIG. 6C Confocal microscopy of healthy lungs (left panel) and B16F10 tumor- infiltrated lungs (right panel). Infiltrating macrophage populations fluoresce in green.
- FIG. 6D Sequential bioluminescence tumor imaging.
- FIG. 6E Kaplan-Meier survival curves for each treatment group ms indicates median survival. Statistical analysis was performed using the log- rank test, and P ⁇ 0.05 was considered significant.
- FIG. 6F Representative photographs (top row) and micrographs of lungs containing B16F10 melanoma metastases representing each group following 2 weeks of treatment.
- FIG. 6G Counts of lung tumor foci.
- FIG. 6H Phenotypic characterization of monocyte/macrophage populations in bronchoalveolar lavage from each treatment group.
- FIG. 6I Summary of the relative percentages of suppressive and activated macrophages.
- FIGs. 7A-7F Macrophage reprogramming improves the outcome of radiotherapy in glioma.
- FIG. 7A T2 MRI scan, and histological staining following initiation of a RO ⁇ Rb ⁇ nbh glioma in RCAS-PDGF-B/Nestin-Tv-a; lnk4a/Arf-/- Pten-/- transgenic mice on post-induction day 21.
- FIG. 7B Confocal microscopy of CD68+ TAMs infiltrating the glioma margin. Scale bar 300 pm.
- FIG. 7A T2 MRI scan, and histological staining following initiation of a RO ⁇ Rb ⁇ nbh glioma in RCAS-PDGF-B/Nestin-Tv-a; lnk4a/Arf-/- Pten-/- transgenic mice on post-induction day 21.
- FIG. 7B Confocal microscopy of CD68+
- FIG. 7C Flow cytometry analysis of macrophage (F4/80+, CD11b+) populations in healthy brain tissue versus glioma.
- FIGs. 7D-7E Kaplan-Meier survival curves of mice with established gliomas receiving IRF5/IKI ⁇ treatments as a monotherapy (FIG. 7D) or combined with brain tumor radiotherapy (FIG. 7E). Time lines and dosing regimens are shown on top. Ms, median survival. Statistical analysis was performed using the log-rank test, and P ⁇ 0.05 was considered statistically significant.
- FIG. 7F Sequential bioluminescence imaging of tumor progression.
- FIGs. 8A-8E IVT mRNA-carrying nanoparticles encoding human IRF5/IKI ⁇ efficiently reprogram human macrophages.
- FIG. 8A Time line and culture conditions to differentiate the human THP-1 monocytic cell line into suppressive M2-like macrophages.
- FIG. 8B Bioluminescent imaging of M2-differentiated THP1-Lucia cells cultured in 24 wells and transfected with indicated concentrations of NPs carrying human IRF5/ IKKb mRNA versus control GFP mRNA. Levels of IRF-induced Lucia luciferase were determined 24 hours after transfection using Quanti-Luc.
- FIG. 8C Summary of bioluminescent counts.
- FIGs. 8D-8E Differences in I L-1 b cytokine secretion (FIG. 8D) and surface expression (FIG. 8E) of the M1-macrophage marker CD80.
- FIG. 9. List of antibodies used in myeloid and lymphoid immunophenotyping panels described in Example 1.
- FIGs. 10A, 10B T cells contribute to anti-tumor effects achieved with macrophage programming nanoparticles.
- FIG. 11 Exemplary sequences supporting the disclosure.
- FIG. 12 Protein/encoding sequence pairings with associated notes.
- Macrophages are key immune effector cells that infiltrate cancerous tissue in high numbers. However, within an immunosuppressive tumor milieu, they undergo a switch from an activated tumoricidal state to an immunosuppressive phenotype, which facilitates tumor growth and metastasis. These tumor-associated immunosuppressed macrophages (TAMs) are associated with poor prognosis ( Komohara Y et a/. (2014) Cancer science 105(1): 1-8). They induce angiogenesis, lymphogenesis, and stroma remodeling.
- TAMs tumor-associated immunosuppressed macrophages
- TAMs can also interact with other immune cells and suppress innate and adaptive antitumor immune responses.
- T cells contribute to the anti-tumor effects achieved with macrophage-programming nanoparticles.
- a multifocal dense cluster of host T cells surrounding the neoplasms was found in all IRF5/IKK b nanoparticle-treated animals, indicating that genetic programming of immune-stimulatory macrophages can restore lymphocyte migration and infiltration into solid tumors (NPs increased T cell infiltration into tumors by an average 10.6- fold (CD8) and 3.5-fold (CD4); see FIGS. 10A, 10B).
- the current disclosure provides for use of nanoparticles that deliver nucleotides encoding macrophage programming transcription factors and T-cell redirecting macromolecules (such as bi-specific antibodies) to further activate innate and adaptive immune cells (illustrated in FIG. 1C).
- bi-specific molecule technologies One key advantage over existing bi-specific molecule technologies is that these molecules are directly secreted by TAMs and therefore reach the highest concentration within the tumor lesion (minimizing systemic exposure). Given the fast clearance rate of bi-specific antibodies (e.g., 2 hours in human serum), conventional bi-specific antibody therapy needs to be administered via continuous intravenous infusion and is associated with dose-limiting toxicities. This approach has shown little clinical success for the treatment of solid tumors, which are protected from T-cell attacks with myeloid-derived suppressor cells.
- physicians can genetically modify monocytes/macrophages in vivo to (1) recruit additional immune cells to the tumor site; (2) remain activated at the tumor site providing an on-going stimulatory signal to other immune cells; and (3) secrete multi-specific immune-cell engaging molecules that bind cancer antigens at the tumor site and also bind and activate the recruited immune cells to destroy the bound cancer cell.
- this therapy works from within the tumor, which is in contrast to existing combination treatments that can disrupt immune homeostasis.
- Particular embodiments utilize nanoparticles to provide cells with nucleotides encoding genes encoding activation regulators such as transcription factors (e.g., Interferon Regulatory Factors (IRFs)) and/or kinases (e.g., IKKb).
- activation regulators such as transcription factors (e.g., Interferon Regulatory Factors (IRFs)) and/or kinases (e.g., IKKb).
- IRFs Interferon Regulatory Factors
- IKKb Interferon Regulatory Factors
- Macrophage polarization is a highly dynamic process through which the physiological activity of macrophages changes. As indicated, in most tumors, TAMs exhibit an immunosuppressed phenotype which can be an “M2” phenotype. By contrast, activated macrophages can exhibit an “M1” phenotype which results in tumor cell killing.
- Particular embodiments disclosed herein reverse the polarization of tumor-promoting TAMs into tumor killing macrophages.
- Particular embodiments disclosed herein genetically modify monocytes to maintain an activated status upon later differentiation to macrophages so that the macrophages do not become immune-suppressed at a tumor site. These effects ameliorate the immunosuppressive milieu within the tumors by inducing inflammatory cytokines, activating other immune cells, and phagocytosing tumor cells.
- Macrophage activation refers to the process of altering the phenotype or function of a macrophage from (i) an inactivated state to an activated state; (ii) a non-activated state to an activated state; (iii) an activated state to a more activated state; or (iv) an inactivated state to a non-activated state.
- An inactivated state means an immunosuppressed phenotype that facilitates tumor growth and metastasis.
- a non-activated state means that the macrophage neither facilitates tumor growth or metastasis nor promotes the killing of tumor cells.
- Activated means that the macrophage exhibits tumoricidal activity.
- the activated state results in an M1 phenotype as described more fully below.
- the inactivated state results in an M2 phenotype, also as described more fully below.
- one benefit of the disclosed systems and methods is that patients can be spared from systemic toxicities because inflammation induced by treatment remains localized at the treatment site.
- locally infused nanoparticles target TAMs in the tumor milieu, deliver nucleotides that selectively reprogram signaling pathways that control macrophage polarization, and are completely degradable locally by physiological pathways (Sahin etai, Nat Rev Drug Discov 13, 759-780 (2014)).
- Nanoparticles described herein can also be administered intravenously where they can be taken up by monocytes within the blood stream.
- nucleotide delivery systems based on viruses or conventional nanocarriers such as liposomes were limited by their restricted diffusion within tumor tissue. Jain & Stylianopoulos, Nat Rev Clin Oncol 7, 653-664 (2010).
- particular embodiments utilize nanoparticles (also referred to herein as NPs) with enhanced diffusivity so that the NPs deliver nucleotides to a large population of TAMs within a tumor.
- NPs also referred to herein as NPs
- NPs nanoparticles
- Particular embodiments utilize NPs ⁇ 130 nm in size that carry a neutral surface charge.
- Particular embodiments can further optionally include a targeting ligand attached to the surface of the NP.
- a targeting ligand attached to the surface of the NP.
- macrophage mannose receptor 1 also known as CD206
- CD206 is a type I transmembrane protein that is expressed by macrophages.
- CD206 also shows high expression levels in TAMs.
- di-mannose can be attached to the NP surface to enable more selective targeting to the mannose receptor (CD206) expressed on the TAM cell surface.
- TAM cell surface receptors that can be targeted include early growth response protein 2 (Egr2), CD163, CD23, interleukin (IL)27RA, CLEC4A, CD1a, CD1b, CD11b, CD14, CD16, CD31 , CD93, CD115, CD192, CD226, IL13-Ra1, IL-4r, IL-1 R type II, decoy IL-1 R type II, IL-1 Or, macrophage scavenging receptors A and B, Ym-1 , Ym-2, Low density receptor-related protein 1 (LRP1), IL-6r, CXCR1/2, CX3CR1, CXCR3, CXCR4, and PD-L1.
- Egr2 early growth response protein 2
- CD163, CD23 interleukin (IL)27RA
- CLEC4A interleukin
- CD1a CD1b
- CD11b CD11b
- CD14 CD16
- CD31 CD93
- CD115 CD192
- systems and methods disclosed herein include administering nanoparticles to a subject in need thereof.
- the nanoparticles are directed to monocytes in the bloodstream and/or macrophages present in tumors in the subject and are designed to be internalized by the monocytes/macrophages. Once internalized, the nanoparticles further deliver one or more nucleotides having sequences that encode IRF5 and IKKb. The one or more nucleotides modify the monocytes/macrophages to express IRF5 and IKKb. Without being bound by theory, the IKKb kinase activates the IRF5 transcription factor by phosphorylation.
- IRF5 Activated IRF5 then causes expression of type I interferon (IFN) genes, inflammatory cytokines, including tumor necrosis factor (TNF), IL-6, IL-12 and IL-23, and tumor suppressors.
- IFN type I interferon
- TNF tumor necrosis factor
- IL-6 tumor necrosis factor
- IL-12 tumor necrosis factor
- IL-23 tumor suppressors.
- M2 macrophages that have internalized one or more nucleotides encoding IRF5 and IKKb
- the expression of the aforementioned genes through IRF5 action leads to a phenotypic or functional switch of the macrophages from an M2 phenotype to an M1 phenotype, which enables the macrophages to kill or otherwise trigger the destruction of tumor cells, thereby treating cancer.
- the nanoparticles are internalized in the monocytes/macrophages by phagocytosis.
- the nanoparticles are internalized in the monocytes/macrophages by ligand-mediated endocytosis (e.g., CD-206-mediated endocytosis).
- delivery of the nanoparticles including the IRF5 and IKKb genes into macrophages can include, e.g., (1) binding to the macrophages, (2) internalization of the nanoparticles by the macrophages, (3) escape from endocytic vesicles into the cytoplasm after internalization, (4) release of the one or more nucleotides, which (5) can be transported into the nucleus of the macrophages and (6) transcribed to deliver genes for expressing IRF5 and IKKb.
- nanoparticles within systems disclosed herein additionally genetically modify monocytes/macrophages to produce and secrete bi-specific immune-cell activating molecules.
- This approach is depicted in FIG. 1C wherein a nanoparticle having nucleotides encoding transcription factors and a bi-specific antibody are encapsulated within a positively-charged core.
- nanoparticles are taken up by monocytes within the bloodstream. These monocytes then leave the bloodstream and arrive at a tumor site. Based on nanoparticle uptake, the cells express transcription factors that enter the nucleus and allow creation or maintenance of an activated macrophage state. The activated macrophage state attracts immune cells to the tumor site where it also secretes bi-specific antibodies.
- the bi-specific antibodies bind cancer antigens at the tumor site as well as activating epitopes on the recruited immune cells.
- TGF-b The transforming growth factor b family of protein factors participates in a wide array of regulatory pathways in a wide array of different cell and tissue types, and at different stages of normal and pathological processes.
- TGF-b is a pleiotropic cytokine found at high levels in solid tumors.
- T ⁇ Rb induces regulatory T cells (Tregs) and inhibits CD8+ and TH1 cells in the tumor microenvironment, driving immune dysfunction. See, e.g., Ravi et al., Nature Communications 9, 741 (2016). Accordingly, particular embodiments disclosed herein reduce or neutralize TGF- b in the tumor microenvironment.
- nanoparticles described herein can deliver nucleotides encoding a T ⁇ Rb inhibitor, such as a T ⁇ Rb antibody.
- T ⁇ Rb inhibitor such as a T ⁇ Rb antibody.
- Aspects of the current disclosure are now described with additional detail and options as follows: (1) Macrophages and Macrophage Phenotypes; (2) Cellular Pathways to Affect Macrophage Polarization; (3) Targeted Antigens and Associated Binding Domains; (4) Immune Cell Activating Epitopes and Associated Binding Domains; (5) Bi-Specific Molecule Formats; (6) TQRb Inhibitors; (7) Nucleotides; (8) Nanoparticles; (9) Compositions for Administration; (10) Methods of Use; (11) Exemplary Embodiments; (12) Experimental Examples; and (13) Closing Paragraphs. These headings do not limit the interpretation of the disclosure and are provided for organizational purposes only.
- Macrophages and Macrophage Phenotypes refers to a white blood cell of the immune system differentiated from bone marrow derived monocytes. Macrophages are characterized by their phagocytic activity and their antigen presentation capacity. Macrophages are key players in both the innate and adaptive immune responses. Phenotypically macrophages express the surface marker F4/80 (Ly71) and may also express other surface markers such as CDIIb (Mad), CDIIc, CD14, CD40 or CD68.
- Macrophages play an important role in both innate and adaptive immunity by activating T lymphocytes.
- macrophages are one of the major populations of infiltrating leukocytes associated with solid tumors (Gordon S & Taylor PR (2005) Nature Reviews Immunology 5(12): 953-964). They can be recruited to the tumor site from surrounding tissues or by the tumor itself through the secretion of chemotactic molecules.
- Macrophages participate in immune responses to tumors in a polarized manner depending on their phenotype. “Phenotype” is used herein to refer to the physical attributes or biochemical characteristics of a cell as a result of the interaction of its genotype and the environment and can include functions of a cell.
- Macrophages that activate Th1 T lymphocytes provide an inflammatory response and are often denoted as having an M1-polarized or “classically activated” phenotype.
- Macrophages in an activated state i.e. M1 macrophages or macrophages having an M1 phenotype
- killer macrophages inhibit cell proliferation, cause tissue damage, mediate resistance to pathogens, and possess strong tumoricidal activity.
- These macrophages can increase expression of mediators that are responsible for antigen presentation and costimulation; promoting infiltration of neutrophils to a tumor area leading to neutrophil-targeted tumor regression.
- An M1 phenotype can also be evidenced by increased antigen presentation as compared to a relevant control condition.
- an M1 phenotype can be evidenced by M1 macrophage production of reactive oxygen species (ROS) and nitric oxide (NO). NO has anti-proliferative effects integral for protection against pathogens and aberrant cells like tumor cells.
- an M1 phenotype can be evidenced by a pro-inflammatory state that induces Th1 immunity through the production of cytokines such as IL-12.
- macrophages in an activated state are classically activated macrophages that can phagocytose pathogens.
- an M1 phenotype can also be evidenced by surface markers expressed by the macrophages; factors, proteins, or compounds produced by the macrophages upon polarization; or genes induced by the macrophages upon polarization.
- M1 polarization can lead to a phenotype evidenced by expression of CD80, CD86, iNOS, suppressor of cytokine signaling 3 (SOCS3), TNFa, IL-1, IL-6, IL-12, IL-23, Type I IFN, CXCL1 , CXCL2, CXCL3, CXCL5, CXCL8, CXCL9, and CXCL10.
- an M1 phenotype includes an increase in expression of CD80.
- an M1 phenotype includes CD206-, MHCII+, CD11C-, and CD11b+.
- macrophages that activate Th2 T lymphocytes provide an anti inflammatory response and are often denoted as having an “M2” phenotype.
- Macrophages that are in an inactivated state i.e. M2 macrophages or macrophages having an M2 phenotype
- repair macrophages are involved in metazoan parasites containment, cell proliferation, tissue repair, tumor progression, anti-inflammation pathways, and immunosuppression.
- An M2 phenotype can reduce antigen presentation and decrease phagocytosis as compared to a relevant control condition.
- An M2 phenotype can also be evidenced by, for example, expression of one or more of arginase 1 (Arg1 (arginase activity is associated with pro-proliferative effects and tissue repair responses)), IL-10, TGF-b , PPAry, KLF4, CD206 (MRC1), Dectin-1 (a signaling non-TLR pattern-recognition receptor), DC-SIGN (C- type lectin), scavenger receptor A, scavenger receptor B-1 , CD163 (high affinity scavenger receptor for the hemoglobin-haptoglobin complex), chemokine receptors CCR2, CXCR1, and CXCR2, YM1 (chitinase 3-like 3), and Fizzl ; and secretion of the chemokines CCL17, CCL22 and CCL24.
- an M2 phenotype includes CD206+
- Table 1 provides particular combinations of criteria that can be used to distinguish an M1 phenotype from M2 phenotypes (including sub-phenotypes designated as M2a, M2b, M2c and M2d).
- Assays to assess macrophage phenotype can take advantage of the different molecular signatures particular to the M1 or M2 phenotype.
- a commonly accepted marker profile for M1 macrophages is CD80+, whereas M2-macrophages can be characterized as CD163+.
- flow cytometry can be performed to assess for these markers.
- Driving macrophages towards a M1 type and away from a M2 type can also be assessed by measuring an increase of the I L-12/IL-10 ratio or the CD163-/CD163+ macrophage ratio.
- M1 versus M2 morphology can be assessed by light microscopy.
- phagocytosis assays may be used in conjunction with other assays to assess whether a macrophage is M1 type or M2 phenotype.
- Phagocytosis assays of different macrophage populations may be performed by incubating an entity to be phagocytosed with macrophages at a concentration that is consistent with their normalized total surface area per cell.
- the entity to be phagocytosed may be added to macrophage cultures.
- the entity to be phagocytosed may be, for example, labeled with a fluorescent label.
- Phagocytosis index may be determined by the median total fluorescence intensity measured per macrophage. Quantification of phagocytosis may be by, for example, flow cytometry.
- an M1 phenotype includes reduced expression of signature M2 macrophage genes including SerpinB2 (inhibitor of urokinase-type plasminogen activator), CCL2 (C-C motif chemokine ligand 2), CCL11 (C-C motif chemokine ligand 11), and Retnla (resistin like alpha; Fizzl).
- an M1 phenotype includes increased expression of M1 differentiation genes including CCL5 (C-C motif chemokine ligand 5).
- Gene expression (e.g., M1 expression of CD80, CD86 and/or other genes noted above) can be measured by assays well known to a skilled artisan. Methods to measure gene expression include NanoString nCounter® expression assays (NanoString Technologies, Inc., Seattle, WA), Northern blots, dot blots, microarrays, serial analysis of gene expression (SAGE), RNA-seq, and quantitative RT-PCR.
- Methods to measure gene expression products include ELISA (enzyme linked immunosorbent assay), western blot, FACS, radioimmunological assay (RIA), sandwich assay, fluorescent in situ hybridization (FISH), immunohistological staining, Immunoelectrophoresis, immunoprecipitation, and immunofluorescence using detection reagents such as an antibody or protein binding agents.
- ELISA enzyme linked immunosorbent assay
- RIA radioimmunological assay
- sandwich assay sandwich assay
- fluorescent in situ hybridization (FISH) fluorescent in situ hybridization
- Immunoelectrophoresis Immunoelectrophoresis
- immunoprecipitation immunofluorescence using detection reagents such as an antibody or protein binding agents.
- Embodiments disclosed herein can be used to genetically modify phagocytic cells, such as polymorphonuclear neutrophils, monocytes, monocyte-derived macrophages, tissue-resident macrophages, epithelial cells, fibroblasts, and dendritic cells.
- Phagocytic cells can be professional or non-professional.
- Professional phagocytes include polymorphonuclear neutrophils, monocytes, monocyte-derived macrophages, and tissue-resident macrophages.
- the primary function of a professional phagocytic cell is phagocytosis.
- Non professional phagocytes include all other cell types that can perform phagocytosis, but it is not considered the primary function of the cell.
- non-professional phagocytes include epithelial cells, fibroblasts, and dendritic cells.
- non-professional phagocytes include epithelial cells, fibroblasts, and dendritic cells.
- TLR Toll-like receptor
- LPS lipopolysaccharide
- GM-CSF macrophage colony-stimulating factor
- M2 polarized macrophages can be divided into subsets, depending on the stimuli that initiates the polarization: the M2a subtype is elicited by IL-4, IL-13 or fungal and helminth infections; M2b is elicited by IL-1 receptor ligands, immune complexes and LPS; M2c is elicited by IL-10, TGF-b and glucocorticoids; and M2d is elicited by IL-6 and adenosine.
- M2 macrophage polarization may also be triggered by IL-21 , GM-CSF, complement components, and apoptotic cells. Macrophage polarization is also modulated by local microenvironmental conditions such as hypoxia.
- Transcription factors that are involved in both M1 and M2 polarization include IRFs, signal transducers and activators of transcription (STAT), SOCS3 proteins, and nuclear factor kappa-light-chain- enhancer of activated B cells (NFKB).
- Mitogen-activated protein kinases (MAPK) also play a role in directing macrophage function towards either the M1 or M2 phenotype.
- Some intracellular molecules implicated in the induction of an M1 phenotype include the G-protein coupled receptor, P2Y(2)R, which plays a role in inducing NO via NOS2 (Eun SY et al. (2014) Int Immunopharmacol 18: 270-276); SOCS3, which activates NFKB/PI-3 kinase pathways to produce NO (Arnold CE et al. (2014) Immunology 141 : 96-110); and growth and differentiation factor Activin A, which promotes M1 markers and down-regulates IL-10 (Sierra-Filardi E et al. (2011) Blood 117: 5092-5101).
- P2Y(2)R G-protein coupled receptor
- IRFs intracellular molecules involved in induction of the M1 phenotype
- IRFs are a group of transcription factors with diverse roles, including virus-mediated activation of IFN, and modulation of cell growth, differentiation, apoptosis, and immune system activity.
- Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats.
- IRF5 is a transcription factor that possesses a helix-turn-helix DNA-binding motif and mediates virus- and IFN-induced signaling pathways. It acts as a molecular switch that controls whether macrophages will promote or inhibit inflammation. IRF5 activates type I IFN genes, inflammatory cytokines, including TNF, IL-6, IL-12 and IL-23, and tumor suppressors as well as Th1 and Th17 responses. It is encoded by the human IRF5 gene located at chromosome 7q32 (OMIM ID 607218). It is appreciated that several isoforms/transcriptional variants of IRF5 exist.
- isoforms of human IRF5 include isoform 1 (UniProt Accession Q 13568-1 , SEQ ID NO: 1), isoform 2 (UniProt Accession Q13568-2, SEQ ID NO: 2), isoform 3 (UniProt Accession Q13568-3, SEQ ID NO: 3), isoform 4 (UniProt Accession Q13568-4, SEQ ID NO: 4), isoform 5 (UniProt Accession Q13568-5, SEQ ID NO: 5) and isoform 6 (UniProt Accession Q13568-6, SEQ ID NO: 6).
- isoforms of human IRF5 include isoform 1 encoded by a nucleotide sequence shown in SEQ ID NO: 23, isoform 2 encoded by a nucleotide sequence shown in SEQ ID NO: 24, isoform 3 encoded by a nucleotide sequence shown in SEQ ID NO: 25, isoform 4 encoded by a nucleotide sequence shown in SEQ ID NO: 26, isoform 5 encoded by a nucleotide sequence shown in SEQ ID NO: 27 and isoform 6 encoded by a nucleotide sequence shown in SEQ ID NO: 28.
- murine IRF5 includes an amino acid sequence shown in SEQ ID NO: 7.
- murine IRF5 is encoded by a nucleotide sequence shown in SEQ ID NO: 29. M1 macrophages have been shown to upregulate IRF5.
- IRF1 and IRF8 also play critical roles in the development and function of myeloid cells, including activation of macrophages by proinflammatory signals such as IFN-g. Dror N et al. (2007) Mol Immunol. 44(4):338-346.
- human IRF1 includes an amino acid sequence shown in SEQ ID NO: 8.
- human IRF1 is encoded by a nucleotide sequence shown in SEQ ID NO: 30.
- murine IRF1 includes an amino acid sequence shown in SEQ ID NO: 12.
- murine IRF1 is encoded by a nucleotide sequence shown in SEQ ID NO: 34.
- human IRF8 includes an amino acid sequence shown in SEQ ID NO: 11. In particular embodiments, human IRF8 is encoded by a nucleotide sequence shown in SEQ ID NO: 33. In particular embodiments, murine IRF8 includes an amino acid sequence shown in SEQ ID NO: 16. In particular embodiments, murine IRF8 is encoded by a nucleotide sequence shown in SEQ ID NO: 38.
- IRF3 is a homolog of IRF1 and IRF2. It contains several functional domains including a NES, a DBD, a C-terminal IRF association domain and several regulatory phosphorylation sites. IRF3 is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREB Binding Protein, a transcriptional coactivator. This complex translocates to the nucleus and activates the transcription of IFN-a and -b, as well as other interferon-induced genes.
- isoforms of human IRF3 include isoform 1 (UniProt Accession Q14653-1), isoform 2 (UniProt Accession Q14653-2), isoform 3 (UniProt Accession Q14653-3), isoform 4 (UniProt Accession Q14653-4), and isoform 5 (UniProt Accession Q14653-5).
- human IRF3 isoform 1 includes an amino acid sequence shown in SEQ ID NO: 9.
- human IRF3 isoform 1 is encoded by a nucleotide sequence shown in SEQ ID NO: 31.
- murine IRF3 includes an amino acid sequence shown in SEQ ID NO: 13.
- murine IRF3 is encoded by a nucleotide sequence shown in SEQ ID NO: 35.
- IRF7 has been shown to play a role in the transcriptional activation of type I IFN genes.
- isoforms of human IRF7 include isoform A (UniProt Accession Q92985- 1), isoform B (UniProt Accession Q92985-2), isoform C (UniProt Accession Q92985-3), and isoform D (UniProt Accession Q92985-4).
- human IRF7 isoform A includes an amino acid sequence shown in SEQ ID NO: 10.
- human IRF7 isoform A is encoded by a nucleotide sequence shown in SEQ ID NO: 32.
- murine IRF7 includes an amino acid sequence shown in SEQ ID NO: 14.
- murine IRF7 is encoded by a nucleotide sequence shown in SEQ ID NO: 36.
- IRF mutants that contribute to IRF activation may also be used.
- phosphomimetic mutants of human variant 3/variant 4 of IRF5 that substitute amino acid residues S425, S427, S430, S436 with residues mimicking phosphorylation, such as aspartic acid residues (Chen W et al. (2008) Nat Struct Mol Biol.
- a fusion protein of murine IRF7/IRF3 includes Asp (D) mutations at four serine and one threonine residues in the IRF3 association domains (SEQ ID NO: 15), conferring constitutive activation and translocation of the fusion protein (Lin R et al. (1998) supra; Lin et al. (2000) Molecular and Cellular Biology 20: 6342-6353).
- a fusion protein of murine IRF7/IRF3 including D mutations at four serine and one threonine residues in the IRF3 association domains is encoded by a nucleotide sequence shown in SEQ ID NO: 37.
- a murine IRF8 mutant includes substitution of Lysine (K) at amino acid residue 310 with Arginine (R) (SEQ ID NO: 17).
- a murine IRF8 mutant including a substitution of K at amino acid residue 310 with R is encoded by a nucleotide sequence shown in SEQ ID NO: 39.
- Sentrin-specific protease 1 (SENP1) targets SUMO 2/3.
- IRF8 The activity of SENP1 “deSUMOylates” IRF8 (and other proteins) and causes IRF8 to go from a repressor of M1 macrophage differentiation to an activator (directly and through transactivation activities). Preventing SUMO binding to IRF8 by mutation of the K310 residue increases IRF8 specific gene transcription 2-5 fold (see Chang T-H et al. (2012) supra).
- engineered IRF transcription factors include IRFs that lack a functioning autoinhibitory domain and are therefore insensitive to feedback inactivation (Thompson et al. (2016) Front Immunol 9: 2622).
- a human IRF5 with 2-3-fold increase in activity can be obtained by deleting aa 489-539 of the human IRF5 protein (Barnes et al. (2002) Mol Cell Biol 22: 5721-5740).
- an autoinhibitory domain of IRF4 a transcription factor that promotes an M2 phenotype, can be deleted or mutated to generate a more active IRF4 in the context of treating an autoimmune disease.
- an autoinhibitory domain of an IRF is found at the carboxy terminus of the IRF protein.
- engineered IRF transcription factors include IRFs that lack one or more functioning nuclear export signals (NES) to entrap IRFs in the nucleus and therefore enhance transcription.
- NES nuclear export signals
- engineered IRF transcription factors include fusions of one or more IRFs, fusions of fragments of one or more IRFs, and fusions of mutated IRFs.
- NFKB is also a key transcription factor related to macrophage M1 activation.
- NFKB regulates the expression of a large number of inflammatory genes including TNFa, IL1B, cyclooxygenase 2 (COX-2), IL-6, and IL12p40.
- NFKB activity is modulated via the activation of the inhibitor of kappa B kinase (IKK) trimeric complex (two kinases, IKKa, IKKb, and a regulatory protein, IKKy).
- IKK inhibitor of kappa B kinase
- NFKB p65/p50 heterodimer This results in the proteosomal degradation of I-KB and the release of NFKB p65/p50 heterodimer from the NFKB/I-KB complex.
- the NFKB p65/p50 heterodimer is then translocated to the nucleus and binds to the promoters of inflammatory genes.
- IKKb is an activating kinase for NFKB as well as other transcription factors such as IRF5.
- IKKb similarly phosphorylates several other signaling pathway components including FOX03, NCOA3, BCL10, IRS1 , NEMO/I KBKG, NFKB subunits RELA and NFKB1 , as well as the IKK- related kinases TBK1 and IKBKE.
- isoforms of human IKKb include isoform 1 (UniProt Accession 014920-1 , SEQ ID NO: 18), isoform 2 (UniProt Accession 014920- 2 SEQ ID NO: 19), isoform 3 (UniProt Accession 014920-3 SEQ ID NO: 20), and isoform 4 (UniProt Accession 014920-4 SEQ ID NO: 21).
- isoforms of human IKKb include isoform 1 encoded by a nucleotide sequence shown in SEQ ID NO: 40, isoform 2 encoded by a nucleotide sequence shown in SEQ ID NO: 41 , isoform 3 encoded by a nucleotide sequence shown in SEQ ID NO: 42, and isoform 4 encoded by a nucleotide sequence shown in SEQ ID NO: 43.
- murine IKKb includes an amino acid sequence shown in SEQ ID NO: 22.
- murine IKKb is encoded by a nucleotide sequence shown in SEQ ID NO: 44.
- hypoxia also influences macrophage polarization through hypoxia inducible factors HIF-1a and HIF-2a.
- HIF-1a regulates NOS2 expression and supports emergence of an M1 phenotype while HIF-2a regulates Arg1 expression and supports emergence of an M2 phenotype (Takeda N et al. (2010) Genes Dev 24: 491-501).
- IRF interferon regulatory factor
- SOCS3 suppressor of cytokine signaling 3
- Btk Bruton’s tyrosine kinase
- co-expression strategies include: co-expression of
- IRF5 and IKKb co-expression of IRF5 and TANK-binding kinase-1 (TBK-1), TNF receptor-associated factor 6 (TRAF6) adaptor, receptor interacting protein 2 (RIP2) kinase, and/or NFKB kinase-e (IKKe) (Chang Foreman H-C et al. (2012) PLoS One 7(3): e33098); co-expression of IRF5 and protein kinase DNA-PK (Ryzhakov G et al.
- antigens refer to proteins expressed by cell types of interest.
- Cells of interest or cell types of interest include any pre-defined cell type that is capable of recognition and destruction by the immune system.
- cell types of interest in the present invention are cell types that have an adverse, harmful or otherwise undesirable effect (or are pre-disposed to having such an effect) on the health, viability, or well-being of a subject.
- Cells of interest can include, for example, (i) eukaryotic cells that are either cancerous or infected with a pathogen such as a virus, and (ii) prokaryotic cells, such as certain bacteria, fungi or yeast.
- Cells of interest also include autoreactive cells that may be harmful and/or cause autoimmunity.
- Such autoreactive cells of interest include, for example, autoreactive immune cells, autoreactive lymphocytes autoreactive T cells, autoreactive B cells.
- autoreactive cells of interest may also be self-reactive cells programmed during development to control the immune response, such as regulatory T-cells.
- autoreactive cells contribute to autoimmune conditions in subjects, for example, by recognizing and binding inappropriate self-antigens.
- a cell type that may be harmful when over-represented in a localized or circulating cell population may be a cell type or interest according to the invention.
- an inflammatory reaction may produce an over representation of immune cells, in which case, cells of interest may include, for example, neutrophils or mast cells. Further, in some instances, cells of interest may be cells previously administered as part of a treatment, for example, genetically-modified cells (e.g., chimeric antigen receptor (CAR) expressing cells).
- CAR chimeric antigen receptor
- antigens are preferentially expressed by the cells of interest. “Preferentially expressed” means that an antigen is found at higher levels on the cells of interest as compared to other cell types. In some instances, an antigen is only expressed by the cells of interest. In other instances, the antigen is expressed on the cells of interest at least 25%, 35%, 45%, 55%, 65%, 75%, 85%, 95%, 96%, 97%, 98%, 99%, or 100% more than on other cell types. [0072] The following provides examples of cancer cell antigens associated with different cancer types:
- Exemplary binding domains for cancer cell antigens include can be generated de novo or derived from known antibodies or binding domains specific for a selected cancer antigen.
- Epithelial cell adhesion molecule (EpCam; also referred to as EGP-40, Trop-1 , 17-1 A, KSA, KS1/4, AUA1, GA733-2, and CD326) is overexpressed in certain cancers, including ovarian cancer. It is a 40kd surface glycoprotein having an extracellular domain with two EGF-like repeats.
- Antibodies targeting EpCam are commercially available (Richter et al. , Am. J. Obstet. Gynecol. 2010, 203(6): 582.e1-582e7).
- Exemplary antibodies that bind EpCam include MT201 (adecatumumab) and Edrecolomab.
- Tyrosine related protein 1 or gp75 glycoprotein is a melanosomal protein that is involved in malignant melanocyte and melanoma progression (Ghanem et al., Mol. Oncol. 2011 April; 5(2): 150-155).
- Exemplary antibodies that bind TYRP1/gp75 include TA99 (Saenger, et al., Cancer Research, 68(23): 9884-9891, 2008), 20D7 (Patel, et al., IOS Press, 16(3-4): 127- 1036, 2007), and flanvotumab (IMC-20D7S) (Khalil, et al., Clinical Cancer Research, 22(21): 5204-5210, 2016.
- an antibody that binds TYRP1/gp75 is described in US7951370.
- the antibody that binds TYRP1/gp75 includes a CDRL1 sequence including RASQSVSSYLA (SEQ ID NO: 84), a CDRL2 sequence including DASNRAT (SEQ ID NO: 85), a CDRL3 sequence including QQRSNWLMYT (SEQ ID NO: 253), a CDRH1 sequence including GYTFTSYAMN (SEQ ID NO: 254), a CDRH2 sequence including WINTNTGNPTYAQGFTG (SEQ ID NO: 255), and a CDRH3 sequence including RYSSSWYLDY (SEQ ID NO: 256).
- the antibody that binds TYRP1/gp75 includes a CDRL1 sequence including a CDRL1 sequence including RASGNIYNYLA (SEQ ID NO: 257), a CDRL2 sequence including DAKTLAD (SEQ ID NO: 258), a CDRL3 sequence including QHFWSLPFT (SEQ ID NO: 259), a CDRH1 sequence including GFNIKDYFLH (SEQ ID NO: 260), a CDRH2 sequence including WINPDNGNTVYDPKFQG (SEQ ID NO: 261), and a CDRH3 sequence including DYTYEKAALDY (SEQ ID NO: 262).
- TYRP1/gp75-binding antibodies include a variable light chain including the sequence:
- Exemplary antibodies with binding domains that bind mesothelin include anetumab, ravtansine, Amatuximab, and HN1.
- the HN1 antibody includes a CDRL1 sequence including RASEGIYHWLA (SEQ ID NO: 55), a CDRL2 sequence including KASSLAS (SEQ ID NO: 58), a CDRL3 sequence including QQYSNYPLT (SEQ ID NO: 61), a CDRH1 sequence including TYYMQ (SEQ ID NO: 64), a CDRH2 sequence including VINPSGVTSYAQKFQG (SEQ ID NO: 71), and a CDRH3 sequence including WALWGDFGMDV (SEQ ID NO: 73).
- US8206710 describes mesothelin-binding antibodies including: a variable light chain including the sequence
- GNVFSCSVMHEALHNHYTQKSLSLSPGK* (SEQ ID NO: 112); as well as an antibody having a variable light chain including the sequence
- MUC16 binding domains can be derived from antibodies Oregovomab, ovarex, and abagovomab.
- US 7723485 describes a MUC16 binding antibody including a variable light chain including sequence
- WO2016149368 describes a MUC16 binding antibody including a variable light chain including a CDRL1 sequence including SEDIYSG (SEQ ID NO: 117), a CDRL2 sequence including GAS, a CDRL3 sequence including GYSYSSTL (SEQ ID NO: 118), a CDRH1 sequence including TLGMGVG (SEQ ID NO: 119), a CDRH2 sequence including HIWWDDDKYYNPALKS (SEQ ID NO: 120), and a CDRH3 sequence including IGTAQATDALDY (SEQ ID NO: 121).
- a folate receptor binding antibody includes farletuzumab. In particular embodiments, farletuzumab is described in US9133275.
- farletuzumab includes a variable light chain including a CDRL1 sequence including KASQSVSFAGTSLMH (SEQ ID NO: 122), a CDRL2 sequence including RASNLEA (SEQ ID NO: 123), and a CDRL3 sequence including QQSREYPYT (SEQ ID NO: 124), and a variable heavy chain including a CDRH1 sequence including GYFMN (SEQ ID NO: 125), a CDRH2 sequence including RIHPYDGDTFYNQKFQG (SEQ ID NO: 126), and a CDRH3 sequence including YDGSRAMDY (SEQ ID NO: 127). Additional FOLR binding antibodies are described in US10101343B2, US8388972, and US8709432.
- An exemplary EGFR antibody includes cetuximab.
- cetuximab is described in US US7598350.
- cetuximab includes a variable light chain including a CDRL1 sequence including RASQSVSSYLA (SEQ ID NO: 84), a CDRL2 sequence including DASNRAT (SEQ ID NO: 85), a CDRL3 sequence including HQYGSTPLT (SEQ ID NO: 130), a CDRH1 sequence including SGDYYWS (SEQ ID NO: 131), a CDRH2 sequence including YIYYSGSTDYNPSLKS (SEQ ID NO: 132), and a CDRH3 sequence including VSIFGVGTFDY (SEQ ID NO: 133).
- EGFR binding domains are described in US7247301 , US7723484, US7132511 , and US5844093.
- US7723484 particularly describes an EGFR binding antibody that includes a variable light chain including sequence
- CD19 binding domains are found within antibody FMC63, SJ25C1 and HD37. (SJ25C1: Bejcek et al. Cancer Res 2005, PMID 7538901 ; HD37: Pezutto et al. Jl 1987, PMID 2437199).
- FMC63 CDRs include a CDRL1 sequence including RASQDISKYLN (SEQ ID NO: 136), a CDRL2 sequence including SRLHSGV (SEQ ID NO: 137), a CDRL3 sequence including GNTLPYTFG (SEQ ID NO: 138), a CDRH1 sequence including DYGVS (SEQ ID NO: 139), a CDRH2 sequence including VTWGSETTYYNSALKS (SEQ ID NO: 140), and a CDRH3 sequence including YAMDYWG (SEQ ID NO: 141).
- a number of antibodies specific for RORI are also known to those of skill in the art and can be readily characterized for sequence, epitope binding, and affinity. See, for example, W02008076868, WO/2008103849, W0201008069, W02010124188, WO2011079902,
- WO2011054007 WO2011159847, W02012076066, WO2012076727, WO 2012045085, and WO2012097313.
- the R11 antibody includes a CDRL1 sequence including QASQSIDSNLA (SEQ ID NO: 142), a CDRL2 sequence including RASNLAS (SEQ ID NO: 143), a CDRL3 sequence including LGGVGNVSYRTS (SEQ ID NO: 144), a CDRH1 sequence including DYPIS (SEQ ID NO: 145), a CDRH2 sequence including FI NSGGSTWYASWVKG (SEQ ID NO: 146), and a CDRH3 sequence including GYSTYYCDFNI (SEQ ID NO: 147).
- the R12 antibody includes a CDRL1 sequence including TLSSAHKTDTID (SEQ ID NO: 148), a CDRL2 sequence including GSYTKRP (SEQ ID NO: 149), a CDRL3 sequence including GADYIGGYV (SEQ ID NO: 150), a CDRH1 sequence including AYYMS (SEQ ID NO: 151), a CDRH2 sequence including TIYPSSGKTYYATWVNG (SEQ ID NO: 152), and a CDRH3 sequence including DSYADDGALFNI (SEQ ID NO: 153).
- the 2A2 antibody includes a CDRL1 sequence including KASQNVDAAVA (SEQ ID NO: 154), a CDRL2 sequence including SASNRYT (SEQ ID NO: 155), a CDRL3 sequence including QQYDIYPYT (SEQ ID NO: 156), a CDRH1 sequence including DYEMH (SEQ ID NO: 157), a CDRH2 sequence including AIDPETGGTAYNQKFKG (SEQ ID NO: 158), and a CDRH3 sequence including YYDYDSFTY (SEQ ID NO: 159).
- the Y31 antibody includes a CDRL1 sequence including QASQSIGSYLA (SEQ ID NO: 160), a CDRL2 sequence including YASNLAS (SEQ ID NO: 161), a CDRL3 sequence including LGSLSNSDNV (SEQ ID NO: 162), a CDRH1 sequence including SHWMS (SEQ ID NO: 163), a CDRH2 sequence including I IAASGSTYYAN WAKG (SEQ ID NO: 164), and a CDRH3 sequence including DYGDYRLVTFNI (SEQ ID NO: 165).
- a Her2 binding domain can be derived from the 4D5 antibody.
- the 4D5 antibody includes a CDRL1 sequence including RASQDVNTAVAW (SEQ ID NO: 166), a CDRL2 sequence including YSASFLES (SEQ ID NO: 167), a CDRL3 sequence including QQHYTTPT (SEQ ID NO: 168), a CDRH1 sequence including SGFNTKDTYIHW (SEQ ID NO: 169), a CDRH2 sequence including RIYPTNGYTRYADSVKGR (SEQ ID NO: 170), and a CDRH3 sequence including WGGDGFYAMDV (SEQ ID NO: 171).
- binding domains derived from the 3G10 antibody include a CDRL1 sequence including RASQSVSSYL (SEQ ID NO: 172), a CDRL2 sequence including DASNRAT (SEQ ID NO: 85), a CDRL3 sequence including QQRSNWPRT (SEQ ID NO: 173), a CDRH1 sequence including DYGFS (SEQ ID NO: 174), a CDRH2 sequence including WITAYNGNTNYAQKLQG (SEQ ID NO: 175), and a CDRH3 sequence including DYFYGMDY (SEQ ID NO: 176).
- PD-L1 binding domains can also include a CDRL1 sequence including RASQDVSTAVA (SEQ ID NO: 177), a CDRL2 sequence including S AS FLYS (SEQ ID NO: 178), a CDRL3 sequence including QQYLYHPAT (SEQ ID NO: 179), a CDRH1 sequence including SGFTFSDSWIH (SEQ ID NO: 180), a CDRH2 sequence including WISPYGGSTYYADSVKG (SEQ ID NO: 181), and a CDRH3 sequence including RHWPGGFDY (SEQ ID NO: 182) or (ii) a CDRL1 sequence including TGTSSDVGGYNYVS (SEQ ID NO: 183), a CDRL2 sequence including DVSNRPS (SEQ ID NO: 184), a CDRL3 sequence including SSYTSSSTRV (SEQ ID NO: 185), a CDRH1 sequence including SGFTFSSYIMM (SEQ ID NO: 186), a CDRH
- Additional antibodies with PD-L1 binding domains include Atezolizumab, Avelumab, and Durva!umab
- antigens are expressed by virally-infected cells.
- viruses include adenoviruses, arenaviruses, bunyaviruses, coronavirusess, flavirviruses, hantaviruses, hepadnaviruses, herpesviruses, papilomaviruses, paramyxoviruses, parvoviruses, picornaviruses, poxviruses, orthomyxoviruses, retroviruses, reoviruses, rhabdoviruses, rotaviruses, spongiform viruses or togaviruses.
- viral antigens include peptides expressed by CMV, cold viruses, Epstein-Barr, flu viruses, hepatitis A, B, and C viruses, herpes simplex, HIV, influenza, Japanese encephalitis, measles, polio, rabies, respiratory syncytial, rubella, smallpox, varicella zoster or West Nile virus.
- coronaviral antigens include the spike (S) protein
- cytomegaloviral antigens include envelope glycoprotein B and CMV pp65
- Epstein-Barr antigens include EBV EBNAI, EBV P18, and EBV P23
- hepatitis antigens include the S, M, and L proteins of hepatitis B virus, the pre-S antigen of hepatitis B virus, HBCAG DELTA, HBV HBE, hepatitis C viral RNA, HCV NS3 and HCV NS4
- herpes simplex viral antigens include immediate early proteins and glycoprotein D
- HIV antigens include gene products of the gag, pol, and env genes such as HIV gp32, HIV gp41, HIV gp120, HIV gp160, HIV P17/24, HIV P24, HIV P55 GAG, HIV P66 POL, HIV TAT, HIV GP36, the Nef protein and reverse transcriptase
- influenza antigens include the
- antigens are expressed by cells associated with bacterial infections.
- bacteria include anthrax; gram-negative bacilli, chlamydia, diptheria, haemophilus influenza, Helicobacter pylori, malaria, Mycobacterium tuberculosis, pertussis toxin, pneumococcus, rickettsiae, staphylococcus, streptococcus and tetanus.
- anthrax antigens include anthrax protective antigen; gram-negative bacilli antigens include lipopolysaccharides; haemophilus influenza antigens include capsular polysaccharides; diptheria antigens include diptheria toxin; Mycobacterium tuberculosis antigens include mycolic acid, heat shock protein 65 (HSP65), the 30 kDa major secreted protein and antigen 85A; pertussis toxin antigens include hemagglutinin, pertactin, FIM2, FIM3 and adenylate cyclase; pneumococcal antigens include pneumolysin and pneumococcal capsular polysaccharides; rickettsiae antigens include rompA; streptococcal antigens include M proteins; and tetanus antigens include tetanus toxin.
- HSP65 heat shock protein 65
- lymphocytes are modified to target multi-drug resistant “superbugs”.
- superbugs include Enterococcus faecium, Clostridium difficile, Acinetobacter baumannii, Pseudomonas aeruginosa, and Enterobacteriaceae (including Escherichia coli, Klebsiella pneumoniae, Enterobacter spp.).
- antigens are expressed by cells associated with fungal infections.
- fungi include Candida, coccidiodes, cryptococcus, histoplasma, leishmania, plasmodium, protozoa, parasites, schistosomae, tinea, toxoplasma, and trypanosoma cruzi.
- coccidiodes antigens include spherule antigens; cryptococcal antigens include capsular polysaccharides; histoplasma antigens include heat shock protein 60 (HSP60); leishmania antigens include gp63 and lipophosphoglycan; plasmodium falciparum antigens include merozoite surface antigens, sporozoite surface antigens, circumsporozoite antigens, gametocyte/gamete surface antigens, protozoal and other parasitic antigens including the blood-stage antigen pf 155/RESA; schistosomae antigens include glutathione-S-transferase and paramyosin; tinea fungal antigens include trichophytin; toxoplasma antigens include SAG-1 and p30; and trypanosoma cruzi antigens include the 75-77 kDa antigen and the 56 kD
- antigens are expressed by cells associated with autoimmune or allergic conditions.
- autoimmune conditions include acute necrotizing hemorrhagic encephalopathy, allergic asthma, alopecia areata, anemia, aphthous ulcer, arthritis (including rheumatoid arthritis, juvenile rheumatoid arthritis, osteoarthritis, psoriatic arthritis), asthma, autoimmune thyroiditis, celiac disease, conjunctivitis, Crohn's disease, cutaneous lupus erythematosus, dermatitis (including atopic dermatitis and eczematous dermatitis), diabetes, diabetes mellitus, erythema nodosum leprosum, keratoconjunctivitis, multiple sclerosis, myasthenia gravis, psoriasis, scleroderma, Sjogren's syndrome, including keratoconjunctivitis sicca secondary to Sjogren'
- autoimmune antigens include glutamic acid decarboxylase 65 (GAD 65), native DNA, myelin basic protein, myelin proteolipid protein, acetylcholine receptor components, thyroglobulin, and the thyroid stimulating hormone (TSH) receptor.
- GID 65 glutamic acid decarboxylase 65
- native DNA myelin basic protein
- myelin proteolipid protein acetylcholine receptor components
- thyroglobulin thyroglobulin
- TSH thyroid stimulating hormone
- allergic antigens include pollen antigens such as Japanese cedar pollen antigens, ragweed pollen antigens, rye grass pollen antigens, animal derived antigens (such as dust mite antigens and feline antigens), histocompatibility antigens, and penicillin and other therapeutic drugs.
- Binding domains for antigens expressed by cells of interest can also be derived from T cell receptors (TCR).
- TCR T cell receptors
- Useful TCR can also be identified by isolating T cells that bind a particular antigen and sequencing the TCR chains.
- antigen-specific T cells may be induced by in vitro cultivation of isolated human T cells in the presence of an antigen/MHC complex.
- TCR genes encoding TCR that bind the antigen/MHC complex can be readily cloned by, for example, the 5' RACE procedure using primers corresponding to the sequences specific to the TCR a-chain gene and the TCR b-chain gene.
- TCR chains following sequencing (i.e., to perform paired chain analysis).
- Various methods can be utilized to pair isolated a and b chains.
- post-sequencing pairing may be unnecessary or relatively simple, for example in embodiments in which the a and b chain pairing information is not lost in the procedure, such as if one were to sequence from single cells.
- Chain pairing may also be performed using multiwell sequencing. Assays such as PairSEQ® (Adaptive Biotechnologies Corp., Seattle, WA) have also been developed.
- TCR TCR
- WO2018/129270 WO2017/112944
- WO2011/039507 US 8,008,438
- US2016/0083449 US2015/0246959
- Stromnes et al. (2015) Cancer cell 28(5): 638- 652
- Kobayashi et al. (2013) Nature Medicine 19: 1542-1546
- Varela-Rohena et al. (2008) Nature Medicine. 14(12): 1390-1395
- Immune cells that can be targeted for localized activation include, for example, T cells and natural killer (NK) cells.
- T-cell activation can be mediated by two distinct signals: those that initiate antigen- dependent primary activation and provide a T-cell receptor like signal (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic signaling sequences).
- primary cytoplasmic signaling sequences those that initiate antigen- dependent primary activation and provide a T-cell receptor like signal
- secondary cytoplasmic signaling sequences those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal.
- secondary cytoplasmic signaling sequences secondary cytoplasmic signaling sequences
- T cell activating epitopes are on T cell markers including CD2, CD3, CD7, CD27, CD28, CD30, CD40, CD83, 4-1 BB (CD 137), 0X40, lymphocyte function-associated antigen-1 (LFA-1), LIGHT, NKG2C, and B7-H3.
- T cell suppressive receptors that can be blocked include PD-1, LAG3, TIM-3, BTLA, CTLA-4, and CD200.
- Antibodies with PD- 1 binding domains include Pembrolizumab and Nivo!umab while a CTLA-4 blocking antibody includes !pilimumab.
- CD3 is a primary signal transduction element of T cell receptors and is expressed on all mature T cells. Binding domains for CD3 can be derived from, for example, OKT3, 20G6-F3, 4B4- D7, 4E7-C9, and 18F5-H10.
- OKT3 is described in U.S. Patent No. 5,929,212.
- the OKT3 antibody includes a CDRL1 sequence including SASSSVSYMN (SEQ ID NO: 189), a CDRL2 sequence including RWIYDTSKLAS (SEQ ID NO: 190), a CDRL3 sequence including QQWSSNPFT (SEQ ID NO: 191), a CDRH1 sequence including KASGYTFTRYTMH (SEQ ID NO: 192), a CDRH2 sequence including INPSRGYTNYNQKFKD (SEQ ID NO: 193), and a CDRH3 sequence including YYDDHYCLDY (SEQ ID NO: 194).
- the following sequence is an scFv derived from OKT3 which retains the capacity to bind CD3: QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGY TNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSS SGGGGSGGGGSGGGGSQIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKR WIYDTSKLASGVPAHFRGSGSGTSYSLTISGMEAEDAATYYCQQWSSNPFTFGSGTKLEINR (SEQ ID NO: 195). It may also be used as a CD3 binding domain.
- the 20G6-F3 antibody includes a CDRL1 sequence including QSLVHNNGNTY (SEQ ID NO: 196), a CDRL2 sequence including KVS, a CDRL3 sequence including GQGTQYPFT (SEQ ID NO: 197), a CDRH1 sequence including GFTFTKAW (SEQ ID NO: 198), a CDRH2 sequence including IKDKSNSYAT (SEQ ID NO: 199), and a CDRH3 sequence including RGVYYALSPFDY (SEQ ID NO: 200).
- the 4B4-D7 antibody includes a CDRL1 sequence including QSLVHDNGNTY (SEQ ID NO: 201), a CDRL2 sequence including KVS, a CDRL3 sequence including GQGTQYPFT (SEQ ID NO: 197), a CDRH1 sequence including GFTFSNAW (SEQ ID NO: 202), a CDRH2 sequence including IKARSNNYAT (SEQ ID NO: 203), and a CDRH3 sequence including RGTYYASKPFDY (SEQ ID NO: 204).
- the 4E7-C9 antibody includes a CDRL1 sequence including QSLEHNNGNTY (SEQ ID NO: 205), a CDRL2 sequence including KVS, a CDRL3 sequence including GQGTQYPFT (SEQ ID NO: 197), a CDRH1 sequence including GFTFSNAW (SEQ ID NO: 202), a CDRH2 sequence including IKDKSNNYAT (SEQ ID NO: 206), and a CDRH3 sequence including RYVHYGIGYAMDA (SEQ ID NO: 207).
- the 18F5-H10 antibody includes a CDRL1 sequence including QSLVHTNGNTY (SEQ ID NO: 208), a CDRL2 sequence including KVS, a CDRL3 sequence including GQGTHYPFT (SEQ ID NO: 209), a CDRH1 sequence including GFTFTNAW (SEQ ID NO: 210), a CDRH2 sequence including KDKSNNYAT (SEQ ID NO: 211), and a CDRH3 sequence including RYVHYRFAYALDA (SEQ ID NO: 212).
- anti-CD3 antibodies binding domains, and CDRs
- TR66 may also be used.
- CD28 is a surface glycoprotein present on 80% of peripheral T cells in humans and is present on both resting and activated T cells. CD28 binds to B7-1 (CD80) and B7-2 (CD86) and is the most potent of the known co-stimulatory molecules (June et al. , Immunol. Today 15:321 (1994); Linsley et al., Ann. Rev. Immunol. 11:191 (1993)).
- a CD28 binding domain can be derived from CD80, CD86, or the antibodies TGN1412, 9D7, 9.3, KOLT-2, 15E8, 248.23.2, and EX5.3D10.
- a binding domain derived from TGN1412 includes a CDRL1 sequence including HASQNIYVWLN (SEQ ID NO: 213), a CDRL2 sequence including KASNLHT (SEQ ID NO: 214), a CDRL3 sequence including QQGQTYPYT (SEQ ID NO: 215), a CDRH1 sequence including SYYIH (SEQ ID NO: 216), a CDRH2 sequence including CIYPGNVNTNYNEKFKD (SEQ ID NO: 217), and a CDRH3 sequence including SHYGLDWNFDV (SEQ ID NO: 218).
- a CD80/CD86 binding domain is derived from one or more monoclonal antibodies described in U.S. Patent No. 7,531 ,175.
- the CD80/CD86 binding domain includes a CDRL1 sequence including SVSSSISSSNLH (SEQ ID NO: 219), a CDRL2 sequence including GTSNLAS (SEQ ID NO: 220), a CDRL3 sequence including QQWSSYPLT (SEQ ID NO: 221), a CDRH1 sequence including DYYMH (SEQ ID NO: 222), a CDRH2 sequence including WIDPENGNTLYDPKFQG (SEQ ID NO: 223), and a CDRH3 sequence including EGLFFAY (SEQ ID NO: 224).
- Activated T-cells express 4-1BB (CD137).
- 4-1 BB also called CD137 or TNFSF9 (UniProt ID No. Q07011) is a T-cell co-stimulatory receptor.
- [0127J 4-1BB binding domains can be derived from a monoclonal antibody described in U.S. Patent Number 9,382,328B2
- the 4-1 BB binding domain includes a CDRL1 sequence including RASQSVS (SEQ ID NO: 225), a CDRL2 sequence including AS N RAT (SEQ ID NO: 226), a CDRL3 sequence including QRSNWPPALT (SEQ ID NO: 227), a CDRH1 sequence including YYWS (SEQ ID NO: 228), a CDRH2 sequence including INH, and a CDRH3 sequence including YGPGNYDWYFDL (SEQ ID NO: 229).
- the 4-1 BB binding domain includes a CDRL1 sequence including SGDNIGDQYAH (SEQ ID NO: 230), a CDRL2 sequence including QDKNRPS (SEQ ID NO: 231), a CDRL3 sequence including ATYTGFGSLAV (SEQ ID NO: 232), a CDRH1 sequence including GYSFSTYWIS (SEQ ID NO: 233), a CDRH2 sequence including KIYPGDSYTNYSPS (SEQ ID NO: 234), and a CDRH3 sequence including GYGIFDY (SEQ ID NO: 235).
- Cytotoxic T-cells destroy tumor cells. These cells are also known as CD8+ T-cells because they express the CD8 glycoprotein at their surface. These cells recognize their targets by binding to antigen associated with MHC class I, which is present on the surface of nearly every cell of the body.
- a CD8 binding domain can be derived from the OKT8 antibody.
- the OKT8 antibody includes a CDRL1 sequence including RTSRSISQYLA (SEQ ID NO: 236), a CDRL2 sequence including SGSTLQS (SEQ ID NO: 237), a CDRL3 sequence including QQHNENPLT (SEQ ID NO: 238), a CDRH1 sequence including GFNIKD (SEQ ID NO: 239), a CDRH2 sequence including RIDPANDNT (SEQ ID NO: 240), and a CDRH3 sequence including GYGYYVFDH (SEQ ID NO: 241).
- immune cells can be activated by suppressing the activity of inhibitory epitopes such as PD-1 , LAG 3, TIM-3, BTLA, CTLA-4, VISTA and/or CD200.
- inhibitory epitopes such as PD-1 , LAG 3, TIM-3, BTLA, CTLA-4, VISTA and/or CD200.
- PD-1 also called CD279 (UniProt ID No. Q15116) is an inhibitory cell surface receptor involved in regulating the T-cell immune response.
- the PD-1 binding domain includes a CDRL1 sequence including RASQSVSTSGYSYMH (SEQ ID NO: 242), a CDRL2 sequence including FGSNLES (SEQ ID NO: 243), a CDRL3 sequence including QHSWEIPYT (SEQ ID NO: 244), a CDRH1 sequence including SSWIH (SEQ ID NO: 245), a CDRH2 sequence including
- YIYPSTGFTEYNQKFKD (SEQ ID NO: 246), and a CDRH3 sequence including
- a PD-1 binding domain can be derived from a monoclonal antibody described in U.S. Patent Application 20090217401 A1.
- the PD-1 binding domain includes a CDRL1 sequence including RASQSVSSYLA (SEQ ID NO: 84), a CDRL2 sequence including DASNRAT (SEQ ID NO: 85), a CDRL3 sequence including QQSSNWPRT (SEQ ID NO: 248), a CDRH1 sequence including NSGMH (SEQ ID NO: 249), a CDRH2 sequence including VLWYDGSKRYYADSVKG (SEQ ID NO: 250), and a CDRH3 sequence including NDDY (SEQ ID NO: 251).
- LAG 3 also called CD223 (UniProt ID No. P18627) binds to HLA class-ll antigens and is involved in activation of lymphocytes.
- a LAG3 binding domain can be derived from a monoclonal antibody described in WO/2014/008218.
- TIM-3 also known as HAVcr-2 or TIMD-3 (UniProt ID No. Q9TDQ0) is a cell surface receptor that plays an inhibitory role in innate and adaptive immune responses.
- a TIM-3 binding domain can be derived from a monoclonal antibody described in U.S. Patent Publication 2015/0218274.
- BTLA also known as CD272 (UniProt ID No. Q7Z6A9), is an inhibitory receptor that inhibits the immune response of lymphocytes.
- a BTLA binding domain e.g., scFv
- scFv can be derived from one or more monoclonal antibodies described in U.S. Patent Publication 2012/0288500.
- CTLA-4 also known as CD152 (UniProt ID No. P16410), is an inhibitory receptor that is a major negative regulator of the T-cell response.
- a CTLA-4 binding domain can be derived from a monoclonal antibody described in U.S. Patent No. 6,984,720.
- CD200 also known as ox-2 membrane glycoprotein, UniProt ID No. P41217) is a protein that can deliver inhibitory signals to immune cells.
- a CD200 binding domain can be derived from one or more monoclonal antibodies described in U.S. Patent Publication 2013/0189258.
- natural killer cells also known as NK cells, K cells, and killer cells
- NK cells can induce apoptosis or cell lysis by releasing granules that disrupt cellular membranes and can secrete cytokines to recruit other immune cells.
- Examples of activating proteins expressed on the surface of NK cells include NKG2D, CD8, CD16, KIR2DL4, KIR2DS1, KIR2DS2, KIR3DS1 , NKG2C, NKG2E, NKG2D, and several members of the natural cytotoxicity receptor (NCR) family.
- Examples of NCRs that activate NK cells upon ligand binding include NKp30, NKp44, NKp46, NKp80, and DNAM-1.
- Examples of commercially available antibodies that bind to an NK cell receptor and induce and/or enhance activation of NK cells include: 5C6 and 1 D11 , which bind and activate NKG2D (available from BioLegend ® San Diego, CA); mAb 33, which binds and activates KIR2DL4 (available from BioLegend ® ); P44-8, which binds and activates NKp44 (available from BioLegend ® ); SK1, which binds and activates CD8; and 3G8 which binds and activates CD16. Additional NK cell activating antibodies are described in WO/2005/0003172 and US Patent No. 9,415,104.
- Naturally occurring antibody structural units include a tetramer.
- Each tetramer includes two pairs of polypeptide chains, each pair having one light chain and one heavy chain.
- the amino-terminal portion of each chain includes a variable region that is responsible for antigen recognition and epitope binding.
- the variable regions exhibit the same general structure of relatively conserved framework regions (FR) joined by three hyper variable regions, also called complementarity determining regions (CDRs).
- FR relatively conserved framework regions
- CDRs complementarity determining regions
- both light and heavy chain variable regions include the domains FR1 , CDR1 , FR2, CDR2, FR3, CDR3 and FR4.
- the assignment of amino acids to each domain is typically in accordance with the definitions of Kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991)), or Chothia & Lesk, J. Mol. Biol., 196:901-917 (1987); Chothia et al., Nature, 342:878-883 (1989).
- Multi-Specific Molecule Formats As indicated, multi-specific immune-cell engaging molecules bind both an antigen at a treatment site (e.g., a cancer antigen at a tumor site) and an immune cell activating epitope, with the goal of bringing immune cells to cells of interest to destroy them. Bi-specific antibodies bind on antigen on a cell of interest and one immune cell activating epitopes.
- Trispecific antibodies can bind two antigens on a cell of interest and one immune cell activating epitope or one antigen on a cell of interest and two immune cell activating epitopes (e.g., a primary activation signal (e.g., CD3) and a costimulatory activation signal (e.g., CD28 or 4-1 BB).
- Quadspecific antibodies can bind four distinct binding partners, divided in multiple combinations between antigens on cells of interest and immune cell activating epitopes.
- the immune cells are T cells or natural killer (NK) cells.
- bispecific antibody formats are described in, e.g., W02009/080251, W02009/080252, W02009/080253, W02009/080254, WO2010/112193, WO2010/115589, W02010/136172, WO2010/145792, and WO2010/145793.
- W02009/080251, W02009/080252, W02009/080253, W02009/080254 WO2010/112193, WO2010/115589, W02010/136172, WO2010/145792, and WO2010/145793.
- binding domains can be derived from multiple sources such as antibodies, TCR, fibronectin, affibodies, natural ligands (e.g., CD80 and CD86 for CD28), etc.
- binding domains can be derived from whole antibodies or binding fragments of an antibody, e.g., Fv, Fab, Fab', F(ab')2, Fc, and single chain Fv fragments (scFvs) or any biologically effective fragments of an immunoglobulin that bind specifically to a cancer antigen or immune cell activating epitope (e.g., T cell receptor).
- Antibodies or antigen binding fragments include all or a portion of polyclonal antibodies, monoclonal antibodies, human antibodies, humanized antibodies, synthetic antibodies, chimeric antibodies, bispecific antibodies, mini bodies, and linear antibodies.
- Multi-specifics including binding domains from human origin or humanized antibodies have lowered immunogenicity in humans and have a lower number of non-immunogenic epitopes compared to non-human antibodies.
- Binding domains will generally be selected to have reduced antigenicity in human subjects. Binding domains can particularly include any peptide that specifically binds a selected cancer antigen or immune cell activating epitope. Sources of binding domains include antibody variable regions from various species (which can be in the form of antibodies, sFvs, scFvs, Fabs, scFv-based grababody, or soluble VH domain or domain antibodies).
- these antibodies can form antigen-binding regions using only a heavy chain variable region, i.e., these functional antibodies are homodimers of heavy chains only (referred to as "heavy chain antibodies”) (Jespers et ai, Nat. Biotechnol. 22:1161, 2004; Cortez-Retamozo et ai, Cancer Res. 64:2853, 2004; Baral et ai, Nature Med. 72:580, 2006; and Barthelemy etai, J. Biol. Chem. 283:3639, 2008).
- Phage display libraries of partially or fully synthetic antibodies are available and can be screened for an antibody or fragment thereof that can bind a selected epitope. For example, binding domains may be identified by screening a Fab phage library for Fab fragments that specifically bind to a target of interest (see Hoet et ai, Nat. Biotechnol. 23:344, 2005). Phage display libraries of human antibodies are also available. Additionally, traditional strategies for hybridoma development using a target of interest as an immunogen in convenient systems (e.g., mice, HuMAb mouse®, TC mouseTM, KM-mouse ® , llamas, chicken, rats, hamsters, rabbits, etc.) can be used to develop binding domains.
- binding domains specifically bind to selected epitopes expressed by targeted cancer cells and/or T cells and do not cross react with nonspecific components or unrelated targets.
- the amino acid sequence or polynucleotide sequence coding for the CDR within a binding domain can be isolated and/or determined.
- An alternative source of binding domains includes sequences that encode random peptide libraries or sequences that encode an engineered diversity of amino acids in loop regions of alternative non-antibody scaffolds, such as scTCR (see, e.g., Lake et ai., Int. Immunol.11:745, 1999; Maynard et ai, J. Immunol. Methods 306:51, 2005; U.S. Patent No. 8,361,794), mAb 2 or FcabTM (see, e.g., PCT Patent Application Publication Nos.
- scTCR see, e.g., Lake et ai., Int. Immunol.11:745, 1999; Maynard et ai, J. Immunol. Methods 306:51, 2005; U.S. Patent No. 8,361,794
- mAb 2 or FcabTM see, e.g., PCT Patent Application Publication Nos.
- an antibody fragment is used as one or more binding domains in a multi-specific.
- An "antibody fragment” denotes a portion of a complete or full-length antibody that retains the ability to bind to an epitope. Examples of antibody fragments include Fv, scFv, Fab, Fab', Fab'-SH, F(ab')2; diabodies; and linear antibodies.
- a single chain variable fragment is a fusion protein of the variable regions of the heavy and light chains of immunoglobulins connected with a short linker peptide.
- Fv fragments include the VL and VH domains of a single arm of an antibody.
- VL and VH are coded by separate genes, they can be joined, using, for example, recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (single chain Fv (scFv)).
- scFv single chain Fv
- a Fab fragment is a monovalent antibody fragment including VL, VH, CL and CH1 domains.
- a F(ab')2 fragment is a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region.
- Diabodies include two epitope-binding sites that may be bivalent. See, for example, EP 0404097; W01993/01161; and Holliger, et al., Proc. Natl. Acad. Sci. USA 90 (1993) 6444-6448. Dual affinity retargeting antibodies (DARTTM; based on the diabody format but featuring a C-terminal disulfide bridge for additional stabilization (Moore et al., Blood 117, 4542-51 (2011))) can also be used. Antibody fragments can also include isolated CDRs.
- multi-specific antibodies can also include a natural receptor or ligand for an epitope as a binding domain.
- a target for binding includes PD-L1
- the binding domains can include PD-1 (including, e.g., a PD-1/antiCD3 fusion).
- PD-1 including, e.g., a PD-1/antiCD3 fusion.
- a receptor fusion for binding is Enbrel® (Amgen).
- Natural receptors or ligands can also be modified to enhance binding.
- betalacept is a modified version of abatacept.
- the multi-specific can include a natural receptor or ligand that induces phagocytosis.
- Calreticulin (UniProt ID No. P27797) is a protein that is localized to the endoplasmic reticulum of healthy cells, but in dying cells it translocates to the cell surface and induces phagocytosis by immune cells such as macrophages.
- the binding domains can include calreticulin or a portion of calreticulin that is capable of inducing phagocytosis.
- the multi-specific can include a single chain antibody attached to the C-terminus of a light chain (see, e.g., Oncoimmunology. 2017; 6(3): e1267891).
- This format can be useful because the presence of the Fc region can help preserve the protein half-life.
- the presence of the Fc region can also be useful because Fc interacts with several receptors and can contribute to the immune response.
- Antibody-scFv fusions can also be useful because the antibody portion binds to its epitope in a dimeric fashion, which enhances avidity and the scFv portion binds its epitope in a monomeric fashion, which can be useful, for example, for binding T- cell epitopes and only allowing multimerization in the presence of a target (e.g., cancer cell). These embodiments can be “tri-specific”. [0155] As indicated, binding domains of a multi-specifics may be joined through a linker.
- a linker is an amino acid sequence which can provide flexibility and room for conformational movement between the binding domains of a multi-specific. Any appropriate linker may be used. Examples of linkers can be found in Chen et al.
- Linkers can be flexible, rigid, or semi-rigid, depending on the desired functional domain presentation to a target.
- Commonly used flexible linkers include Gly-Ser linkers such as GGSGGGSGGSG (SEQ ID NO: 252), GGSGGGSGSG (SEQ ID NO: 63) and GGSGGGSG (SEQ ID NO: 65). Additional examples include: GGGGSGGGGS (SEQ ID NO: 90); GGGSGGGS (SEQ ID NO: 128); and GGSGGS (SEQ ID NO: 129).
- Linkers that include one or more antibody hinge regions and/or immunoglobulin heavy chain constant regions, such as CH3 alone or a CH2CH3 sequence can also be used.
- flexible linkers may be incapable of maintaining a distance or positioning of binding domains needed for a particular use.
- rigid or semi-rigid linkers may be useful.
- rigid or semi-rigid linkers include proline-rich linkers.
- a proline-rich linker is a peptide sequence having more proline residues than would be expected based on chance alone.
- a proline-rich linker is one having at least 30%, at least 35%, at least 36%, at least 39%, at least 40%, at least 48%, at least 50%, or at least 51% proline residues.
- proline-rich linkers include fragments of proline-rich salivary proteins (PRPs).
- bi-specific antibodies include Catumaxomab (EpCAM/CD3; in a Triomab format and evaluated in clinical trial NCT00189345); MT110 (EpCAM/CD3; in a BiTE (Amgen) format and evaluated in clinical trial NCT00635596); Ertumaxomab (HER2/CD3; in a Triomab format and evaluated in clinical trial NCT00452140); MDX-447 (EGFR/CD64; in a 2(Fab’) format and evaluated in clinical trial NCT00005813); MM-141 (HER3/IGF-IR; in a scFv-lgG format and evaluated in clinical trial NCT01733004); AMG211 (CEA/CD3; in a BiTE format and evaluated in clinical trial NCT02760199); R06958688 (CEA/CD3; in a BiTE format and evaluated in clinical trial NCT02760199); R06958688 (CEA/CD3; in a BiTE format and evaluated in
- AMG701 BCMA-targeting
- Solitomab EpCam/CD3 targeting
- EpCam binding bi-specific molecules see Brischwein et al., Mol. Immunol. 2006; 43: 1129-1143 and Schlereth et al. , Cancer Research, 2005; 65: 2882-2889.
- Additional particular examples of bi-specific antibodies are described in WO2014/167022; US2016/0208001 ; US 2014/0302037 and US 2014/0308285.
- One last example includes Blinatumomab. See Ellerman, Methods, 154 (2019) 102-117 for additional information regarding bispecific-T cell engagers.
- TQRb Inhibitors Three highly homologous isoforms of TQRb exist in humans: TQRb1 , TQRb2 and TQRb3. Numerous inhibitory TQRb peptides and antibodies are available. In particular embodiments, monocytes/macrophages can be reprogrammed to express an inhibitory TQRb peptide or antibody.
- TQRb inhibitors examples include Trabedersen (AP12009; an antisense oligo evaluated in clinical trials NCT00431561 , NCT00844064, and NCT00761280); Disitertide (a peptide evaluated in clinical trials NCT00574613 and NCT00781053); Lerdelimumab (a humanized antibody); Metelimumab (a humanized antibody evaluated in clinical trial NCT00043706); Fresolimumab (a humanized antibody evaluated in clinical trials NCT00464321 , NCT01284322, and NCT01291784); LY2382770 (a humanized antibody evaluated in clinical trial NCT01113801); SIX-100 (an antibody evaluated in clinical trial NCT01371305); Avotermin (a recombinant protein evaluated in clinical trials NCT004322111 and NCT00656227); and IMC-TR1 (a humanized antibody evaluated in clinical trial NCT01646203).
- Trabedersen a peptide evaluated
- FIG. 2B of Ravi et al. provides the amino acid sequences of the heavy chain and light chain of a-CTLA4-TGFpRI! including the ligand binding sequence of the TGFpRII extracellular domain.
- T ⁇ Rb inhibitors examples include tranilast, pirfenidone, Lefty-1 (11051 Accession Nos: NM_010094 (mouse), and NM_020997 (human)), SB-431542, SB-202190, and SB-505124 (Lindemann et al., Mol. Cancer, 2003, 2: 20; GlaxoSmithKline), NPC30345, SD093, SD908, SD208 (Scios), SM16 (Biogen pou), LY2109761 , LY364947, LY580276.
- LY2157299 (Lilly Research Laboratories), A-83-01 (WO 2009/146408), ALK5 inhibitor II (2-[3-[6- methylpyridin-2-yl]-1H-pyrazol-4 yl]-1 ,5-naphthyridine), TGFbRI kinase inhibitor VIII (6-[2-tert- butyl-5-[6-methyl-pyridin-2-yl]-1H-imidazol-4-yl]-quinoxaline) and derivatives thereof. [0161] (7) Nucleotides.
- nucleotides encoding genes that regulate activation states and genes that result in expression of multi-specific molecules and optionally a TQRb inhibitor are delivered to immune cells, such as monocytes and/or macrophages.
- Gene refers to a nucleotide sequence that encodes an encoded molecule. This definition includes various sequence polymorphisms, mutations, and/or sequence variants wherein such alterations do not affect the function of the encoded molecule.
- the term “gene” may include not only coding sequences but also regulatory regions such as promoters, enhancers, and termination regions. The term further can include all introns and other DNA sequences spliced from the mRNA transcript, along with variants resulting from alternative splice sites.
- Nucleotide sequences encoding the encoded molecule can be RNA that directs the expression of the encoded molecule. These nucleotide sequences include RNA sequences that are translated, in particular embodiments, into protein. In particular embodiments, one of ordinary skill in the art can appreciate that DNA sequences including thymine (T) bases can be equivalent to mRNA sequences having the same sequence except that T bases are replaced by uracil (U) bases.
- the nucleotide sequences include both the full-length nucleotide sequences as well as non-full-length sequences derived from the full-length protein. The sequences can also include degenerate codons of the native sequence or sequences that may be introduced to provide codon preference in a specific immune cell.
- Encoding refers to a property of sequences of nucleotides, such as a plasmid, a gene, cDNA, mRNA, to serve as templates for synthesis of an activation regulator, multi-specific antibody, and/or a T ⁇ Rb inhibitor.
- the nucleotides include synthetic mRNA.
- synthetic mRNA is engineered for increased intracellular stability using 5'-capping.
- Multiple distinct 5'-cap structures can be used to generate the 5'-cap of a synthetic mRNA molecule.
- the Anti-Reverse Cap Analog (ARCA) cap contains a 5'-5'-triphosphate guanine-guanine linkage where one guanine contains an N7 methyl group as well as a 3'-0- methyl group.
- Synthetic mRNA molecules may also be capped post-transcriptionally using enzymes responsible for generating 5'-cap structures.
- recombinant Vaccinia Virus Capping Enzyme and recombinant 2'-0-methyltransferase enzyme can create a canonical 5'-5'- triphosphate linkage between the 5'-most nucleotide of an mRNA and a guanine nucleotide where the guanine contains an N7 methylation and the ultimate 5'-nucleotide contains a 2'-0-methyl generating the Cap1 structure. This results in a cap with higher translational-competency and cellular stability and reduced activation of cellular pro-inflammatory cytokines.
- other modifications of synthetic mRNA to reduce immunogenicity, promote mRNA stability, and/or promote translation of mRNA can include 5’- and 3’- terminal untranslated regions (UTRs), a Kozak translation initiation sequence in the 5’ UTR, modified ribonucleosides, and/or a polyA tail.
- modified ribonucleosides can include pseudouridine (Y), 5-methylcytidine (5mC), N6-methyladenosine (m6A), 2-thiouridine (2sU), 5-methoxyuridine (5moll), and N-1-methylpseudouridine (GTI1Y).
- UTRs can include alpha- and/or beta-globin UTRs.
- Particular embodiments of producing synthetic mRNA include generating a DNA template containing the coding DNA sequence of the desired protein with a 5’ T100-250 overhang by PCR amplification from a corresponding DNA plasmid.
- the DNA template can then be used to produce the mRNA by an in vitro transcription reaction.
- a 5’ cap structure e.g., ARCA
- modified ribonucleosides e.g., ARCA
- a 3’ poly(A) tail can be incorporated.
- in vitro transcription systems are commercially available including from, e.g., MEGAscriptT7 transcription kit (ThermoFisher Scientific, Waltham, MA), RiboprobeTM System T7 (Promega, Madison, Wl), AmpliScribeTM T7 high yield transcription kit (Epicentre, Madison, Wl), and HiScribeTM T7 in vitro transcription kit (New England Biolabs, Ipswich, MA).
- synthetic mRNA can be synthesized by companies that synthesize nucleotides (e.g., TriLink Biotechnologies, San Diego, CA).
- Synthetic mRNA or other nucleotides may be made cyclic. Such nucleotides may be cyclized, or concatemerized, to generate a translation competent molecule to assist interactions between poly-A binding proteins and 5'-end binding proteins.
- the mechanism of cyclization or concatemerization may occur through at least 3 different routes: 1) chemical, 2) enzymatic, or 3) ribozyme catalyzed.
- the newly formed 5'-/3'-linkage may be intramolecular or intermolecular.
- the 5'-end and the 3'-end of the nucleotide may contain chemically reactive groups that, when close together, form a new covalent linkage between the 5'-end and the 3'-end of the molecule.
- the 5'-end may contain an NHS-ester reactive group and the 3'-end may contain a 3'-amino-terminated nucleotide such that in an organic solvent the 3'-amino- terminated nucleotide on the 3'-end of a nucleotide molecule will undergo a nucleophilic attack on the 5'-NHS-ester moiety forming a new 5'-/3'-amide bond.
- T4 RNA ligase may be used to enzymatically link a 5'-phosphorylated nucleotide molecule to the 3'-hydroxyl group of a nucleotide forming a new phosphorodiester linkage.
- 1 pg of a nucleotide molecule can be incubated at 37°C for 1 hour with 1-10 units of T4 RNA ligase (New England Biolabs, Ipswich, MA) according to the manufacturer's protocol.
- the ligation reaction may occur in the presence of a split oligonucleotide capable of base-pairing with both the 5'- and 3'-region in juxtaposition to assist the enzymatic ligation reaction.
- either the 5'- or 3'-end of a cDNA template encodes a ligase ribozyme sequence such that during in vitro transcription, the resultant nucleotide molecule can contain an active ribozyme sequence capable of ligating the 5'-end of a nucleotide molecule to the 3'-end of a nucleotide molecule.
- the ligase ribozyme may be derived from the Group I Intron, Hepatitis Delta Virus, Hairpin ribozyme or may be selected by SELEX (systematic evolution of ligands by exponential enrichment). The ribozyme ligase reaction may take 1 to 24 hours at temperatures between 0 and 37°C.
- nucleotides include a plasmid, a cDNA, or an mRNA that can include, e.g., a sequence (e.g., a gene) for expressing an encoded molecule.
- Suitable plasmids include standard plasmid vectors and minicircle plasmids that can be used to transfer a gene to a monocyte/macrophage.
- the nucleotides e.g., minicircle plasmids
- the nucleotides can include promoters, such as general promoters, tissue-specific promoters, cell- specific promoters, and/or promoters specific for the cytoplasm.
- promoters and plasmids e.g., minicircle plasmids
- plasmids are generally well known in the art and can be prepared using conventional techniques.
- Particular embodiments include use of double-stranded DNA (integrating and/or non-integrating), conventional plasmids, minicircles, and/or closed-ended linear ceDNA (see Li et al., PLoS One, Aug. 1, 2013 doi.org/10.1371/journal.pone. 0069879).
- the ceDNA is a non-viral, AAV-derived vector DNA with covalently closed ends (Li et al., PLoS One, 2013, doi.org/10.1371/journal.pone. 0069879).
- a nucleotide encoding a macrophage activation regulator is used in combination with one or more additional nucleotides encoding other activation regulators (e.g., combinations of IRFs, multi-specific antibodies and/or T ⁇ Rb inhibitors).
- a nucleotide encoding an IRF is used in combination with one or more additional nucleotides encoding other IRFs and with a nucleotide encoding a IKKb.
- a nucleotide encoding an IRF is used in combination with a nucleotide encoding a IKKb, multi-specific antibodies and/or TQRb inhibitors at a ratio of 0.5:1, 1 :1, 2:1, 3:1 , 4:1 , or 5:1.
- a nucleotide encoding an IRF is used in combination with a nucleotide encoding a IKKb at a ratio of 3:1.
- Gene editing systems modify or affect particular sequences of a cell’s endogenous genome.
- Gene editing systems are useful for targeted genome editing, for example gene disruption, gene editing by homologous recombination, and gene therapy to insert therapeutic genes at the appropriate chromosomal target sites with a human genome.
- TALENs transcription activator-like effector nucleases
- TALE transcription activator-like effector
- TALENs are used to edit genes and genomes by inducing double strand breaks (DSBs) in the DNA, which induce repair mechanisms in cells.
- DSBs double strand breaks
- two TALENs must bind and flank each side of the target DNA site for the DNA cleavage domain to dimerize and induce a DSB.
- the DSB is repaired in the cell by non-homologous end-joining (NHEJ) or by homologous recombination (HR) with an exogenous double-stranded donor DNA fragment.
- NHEJ non-homologous end-joining
- HR homologous recombination
- TALENs have been engineered to bind a target sequence of, for example, an endogenous genome, and cut DNA at the location of the target sequence.
- the TALEs of TALENs are DNA binding proteins secreted by Xanthomonas bacteria.
- the DNA binding domain of TALEs include a highly conserved 33 or 34 amino acid repeat, with divergent residues at the 12th and 13th positions of each repeat. These two positions, referred to as the Repeat Variable Diresidue (RVD), show a strong correlation with specific nucleotide recognition. Accordingly, targeting specificity can be improved by changing the amino acids in the RVD and incorporating nonconventional RVD amino acids.
- RVD Repeat Variable Diresidue
- Examples of DNA cleavage domains that can be used in TALEN fusions are wild-type and variant Fokl endonucleases.
- the Fokl domain functions as a dimer requiring two constructs with unique DNA binding domains for sites on the target sequence.
- the Fokl cleavage domain cleaves within a five or six base pair spacer sequence separating the two inverted half-sites.
- Particular embodiments utilize MegaTALs as gene editing systems. MegaTALs have a single chain rare-cleaving nuclease structure in which a TALE is fused with the DNA cleavage domain of a meganuclease. Meganucleases, also known as homing endonucleases, are single peptide chains that have both DNA recognition and nuclease function in the same domain. In contrast to the TALEN, the megaTAL only requires the delivery of a single peptide chain for functional activity. [0177] Particular embodiments utilize zinc finger nucleases (ZFNs) as gene editing systems. ZFNs are a class of site-specific nucleases engineered to bind and cleave DNA at specific positions.
- ZFNs zinc finger nucleases
- ZFNs are used to introduce DSBs at a specific site in a DNA sequence which enables the ZFNs to target unique sequences within a genome in a variety of different cells. Moreover, subsequent to double-stranded breakage, homologous recombination or non-homologous end joining takes place to repair the DSB, thus enabling genome editing.
- ZFNs are synthesized by fusing a zinc finger DNA-binding domain to a DNA cleavage domain.
- the DNA-binding domain includes three to six zinc finger proteins which are transcription factors.
- the DNA cleavage domain includes the catalytic domain of, for example, Fokl endonuclease.
- Guide RNA can be used, for example, with gene-editing systems such as CRISPR-Cas systems.
- CRISPR-Cas systems include CRISPR repeats and a set of CRISPR-associated genes (Cas).
- any system capable of resulting in functional expression of delivered nucleotides can be used within the current disclosure.
- delivery utilizing viral vectors is excluded.
- Nanoparticles used within the systems and methods disclosed herein can function to condense and protect nucleotides from enzymatic degradation.
- Particularly useful materials to use within nanoparticles for this purpose include positively charged lipids and/or polymers, including poly ⁇ -amino ester) (PbAE).
- Examples of positively charged polymers that can be used within nanoparticles of the current disclosure include polyamines; polyorganic amines (e.g., polyethyleneimine (PEI), polyethyleneimine celluloses); poly(amidoamines) (PAMAM); polyamino acids (e.g., polylysine (PLL), polyarginine); polysaccharides (e.g, cellulose, dextran, DEAE dextran, starch); spermine, spermidine, poly(vinylbenzyl trialkyl ammonium), poly(4-vinyl-N-alkyl-pyridiumiun), poly(acryloyl- trialkyl ammonium), and Tat proteins.
- polyamines e.g., polyethyleneimine (PEI), polyethyleneimine celluloses); poly(amidoamines) (PAMAM); polyamino acids (e.g., polylysine (PLL), polyarginine); polysaccharides (e.g, cellulose,
- Examples of positively charged lipids include esters of phosphatidic acid with an aminoalcohol, such as an ester of dipalmitoyl phosphatidic acid or distearoyl phosphatidic acid with hydroxyethylenediamine. More particular examples of positively charged lipids include 3b- [N--(N',N'-dimethylaminoethyl)carbamoyl) cholesterol (DC-chol); N,N'-dimethyl-N,N'-dioctacyl ammonium bromide (DDAB); N,N'-dimethyl-N,N'-dioctacyl ammonium chloride (DDAC); 1,2- dioleoyloxypropyl-3-dimethyl-hydroxyethyl ammonium chloride (DORI); 1 ,2-dioleoyloxy-3- [trimethylammonio]-propane (DOTAP); N-(1-(2,3-dioleyloxy)propyl)-N
- Blends of lipids and polymers in any concentration and in any ratio can also be used. Blending different polymer types in different ratios using various grades can result in characteristics that borrow from each of the contributing polymers. Various terminal group chemistries can also be adopted.
- Particular embodiments disclosed herein can also utilize porous nanoparticles constructed from any material capable of forming a porous network.
- Exemplary materials include metals, transition metals and metalloids.
- Exemplary metals, transition metals and metalloids include lithium, magnesium, zinc, aluminum and silica.
- the porous nanoparticles include silica.
- the exceptionally high surface area of mesoporous silica (exceeding 1,000 m2/g) enables nucleotide loading at levels exceeding conventional DNA carriers such as liposomes.
- Particles can be formed in a variety of different shapes, including spheroidal, cuboidal, pyramidal, oblong, cylindrical, toroidal, and the like.
- the nucleotides can be included in the pores of the nanoparticles in a variety of ways.
- the nucleotides can be encapsulated in the porous nanoparticles.
- the nucleotides can be associated (e.g., covalently and/or non-covalently) with the surface or close underlying vicinity of the surface of the porous nanoparticles.
- the nucleotides can be incorporated in the porous nanoparticles e.g., integrated in the material of the porous nanoparticles.
- the nucleotides can be incorporated into a polymer matrix of polymer nanoparticles.
- the nanoparticles disclosed herein include a coating.
- a coating can serve to shield the encapsulated nucleotides and/or reduce or prevent off-target binding. Off- target binding is reduced or prevented by reducing the surface charge of the nanoparticles to neutral or negative.
- coatings can include neutral or negatively charged polymer- and/or liposome-based coatings.
- the coating is a dense surface coating of hydrophilic and/or neutrally charged hydrophilic polymer sufficient to prevent the encapsulated nucleotides from being exposed to the environment before release into an immune cell.
- the coating covers at least 80% or at least 90% of the surface of the nanoparticle.
- the coating includes polyglutamic acid (PGA).
- PGA can serve as a linker to attach a targeting ligand to a nanoparticle.
- PGA can serve as a linker to attach di-mannose to a nanoparticle.
- the coating includes hyaluronic acid.
- neutrally charged polymers include polyethylene glycol (PEG); polypropylene glycol); and polyalkylene oxide copolymers, (PLURONIC®, BASF Corp., Mount Olive, NJ).
- Neutrally charged polymers also include zwitterionic polymers.
- Zwitterionic refers to the property of overall charge neutrality while having both a positive and a negative electrical charge. Zwitterionic polymers can behave like regions of cell membranes that resist cell and protein adhesion.
- Zwitterionic polymers include zwitterionic constitutional units including pendant groups (i.e., groups pendant from the polymer backbone) with zwitterionic groups.
- exemplary zwitterionic pendant groups include carboxybetaine groups (e.g., -Ra-N+(Rb)(Rc)-Rd-CC>2-, where Ra is a linker group that covalently couples the polymer backbone to the cationic nitrogen center of the carboxybetaine groups, Rb and Rc are nitrogen substituents, and Rd is a linker group that covalently couples the cationic nitrogen center to the carboxy group of the carboxybetaine group).
- Examples of negatively charged polymers include alginic acids; carboxylic acid polysaccharides; carboxymethyl cellulose; carboxymethyl cellulose-cysteine; carrageenan (e.g., GELCARIN® 209, GELCARIN® 379, FMC Corporation, Philadelphia, PA); chondroitin sulfate; glycosaminoglycans; mucopolysaccharides; negatively charged polysaccharides (e.g., dextran sulfate); poly(acrylic acid); poly(D-aspartic acid); poly(L-aspartic acid); poly(L-aspartic acid) sodium salt; poly(D-glutamic acid); poly(L-glutamic acid); poly(L-glutamic acid) sodium salt; poly(methacrylic acid); sodium alginate (e.g., PROTANAL® LF 120M, PROTANAL® LF 200M, PROTANAL® LF 200D, FMC Biopolymer Corp., Dr
- polymers disclosed herein can include "star shaped polymers," which refer to branched polymers in which two or more polymer branches extend from a core.
- the core is a group of atoms having two or more functional groups from which the branches can be extended by polymerization.
- nanoparticles of the present disclosure include star shaped polymers.
- nanoparticles of the present disclosure include star shaped polymers and a coating.
- nanoparticles of the present disclosure include star shaped polymers and a coating including PGA.
- nanoparticles of the present disclosure include star shaped polymers and a coating including hyaluronic acid.
- the branches are zwitterionic or negatively-charged polymeric branches.
- the branch precursors can be converted to zwitterionic or negatively- charged polymers via hydrolysis, ultraviolet irradiation, or heat.
- the polymers also may be obtained by any polymerization method effective for polymerization of unsaturated monomers, including atom transfer radical polymerization (ATRP), reversible addition-fragmentation chain transfer polymerization (RAFT), photo-polymerization, ring-opening polymerization (ROP), condensation, Michael addition, branch generation/propagation reaction, or other reactions.
- ARP atom transfer radical polymerization
- RAFT reversible addition-fragmentation chain transfer polymerization
- ROP ring-opening polymerization
- condensation Michael addition, branch generation/propagation reaction, or other reactions.
- Liposomes are microscopic vesicles including at least one concentric lipid bilayer.
- Vesicle forming lipids are selected to achieve a specified degree of fluidity or rigidity of the final complex.
- liposomes provide a lipid composition that surrounds an aqueous core.
- the structure of a liposome can be used to encapsulate a nanoparticle within its core (i.e., a liposomal nanoparticle).
- nanoparticles of the present disclosure are utilized as nanoparticles within liposomal nanoparticles.
- Lipid nanoparticles (LNPs) are liposome-like structures that lack the continuous lipid bilayer characteristic of liposomes.
- Solid lipid nanoparticles are LNPs that are solid at room and body temperatures.
- PC phosphatidylcholine
- PE phosphatidylethanolamine
- PI phosphatidylinositol
- SM sphingomyelin
- DOPE dioleoylphosphatidylethanolamine
- lipids capable of producing a stable liposome are phospholipids, such as hydrogenated soy phosphatidylcholine (HSPC), lecithin, phosphatidylethanolamine, lysolecithin, lysophosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, sphingomyelin, cephalin, cardiolipin, phosphatidic acid, cerebro sides, distearoylphosphatidylethanolamine (DSPE), dioleoylphosphatidylcholine (DOPC), dipalmitoylphosphatidylcholine (DPPC), palmitoyloleoylphosphatidylcholine (POPC), palmitoyloleoylphosphatidylethanolamine (POPE) and dioleoylphosphatidylethanolamine 4-(N- maleimido-methyl)cyclohexane-1
- HSPC hydrogenated soy phosphati
- Additional non-phosphorous containing lipids that can become incorporated into liposomes include stearylamine, dodecylamine, hexadecylamine, isopropyl myristate, triethanolamine-lauryl sulfate, alkyl-aryl sulfate, acetyl palmitate, glycerol ricinoleate, hexadecyl stereate, amphoteric acrylic polymers, polyethyloxylated fatty acid amides, DDAB, dioctadecyl dimethyl ammonium chloride (DODAC), 1,2-dimyristoyl-3-trimethylammonium propane (DMTAP), DOTAP, DOTMA, DC-Chol, phosphatidic acid (PA), dipalmitoylphosphatidylglycerol (DPPG), dioleoylphosphatidylglycerol, DOPG, and dicetylphosphate.
- DODAC dioc
- lipids used to create liposomes disclosed herein include cholesterol, hydrogenated soy phosphatidylcholine (HSPC) and, the derivatized vesicle-forming lipid PEG-DSPE.
- HSPC hydrogenated soy phosphatidylcholine
- PEG-DSPE the derivatized vesicle-forming lipid PEG-DSPE.
- the size of particles can vary over a wide range and can be measured in different ways.
- the particles are nanoparticles of ⁇ 130 nm in size.
- NPs of the present disclosure can also have a minimum dimension of equal to or less than 500 nm, less than 150 nm, less than 140 nm, less than 120 nm, less than 110 nm, less than 100 nm, less than 90 nm, less than 80 nm, less than 70 nm, less than 60 nm, less than 50 nm, less than 40 nm, less than 30 nm, less than 20 nm, or less than 10 nm.
- the nanoparticles are NPs 90 to 130 nm in size.
- the NPs can have a minimum dimension ranging between 5 nm and 500 nm, between 10 nm and 100 nm, between 20 nm and 90 nm, between 30 nm and 80 nm, between 40 nm and 70 nm, and between 40 nm and 60 nm.
- the dimension is the diameter of NPs or coated NPs.
- a population of nanoparticles of the present disclosure can have a mean minimum dimension of equal to or less than 500 nm, less than 100 nm, less than 90 nm, less than 80 nm, less than 70 nm, less than 60 nm, less than 50 nm, less than 40 nm, less than 30 nm, less than 20 nm, or less than 10 nm.
- a population of NPs in a composition of the present disclosure can have a mean diameter ranging between 5 nm and 500 nm, between 10 nm and 100 nm, between 20 nm and 90 nm, between 30 nm and 80 nm, between 40 nm and 70 nm, and between 40 nm and 60 nm, between 70 nm and 130 nm or between 75 nm and 125 nm.
- Dimensions of the nanoparticles can be determined using, e.g., conventional techniques, such as dynamic light scattering and/or electron microscopy. While not preferred, in particular embodiments, microparticles could also be used.
- PbAE polymers are mixed with nucleotides (e.g., in vitro transcribed mRNA) in a ratio of 20:1 , 30:1 , 40:1 , 50:1, 60:1, 70:1 , 80:1 , 90:1 , 100:1, or more to generate PbAE-nucleotide polyplexes.
- PbAE polymers are mixed with nucleotides (e.g., in vitro transcribed mRNA) in a ratio of 60:1 to generate PbAE-nucleotide polyplexes.
- the PbAE-nucleotide polyplexes can be combined with PGA/Di-mannose to form the final NPs.
- positively-charged polymer cores are PbAE formed by combining 1,4-butanediol diacrylate with 4-amino-1 -butanol in a 1:1 molar ratio of diacrylate to amine monomers.
- the polymer can be a piperazine-capped 447 polymer.
- a-D-mannopyranosyl-(1 2)-a-D-mannopyranose can be modified into glycosylamine before being conjugated to PGA.
- Codon-optimized mRNAs can be capped with the Anti-Reverse Cap Analog 3'-0-Me- m7G(5')ppp(5')G (ARCA), and fully substituted with the modified ribonucleotides pseudouridine (Y) and 5-methylcytidine (m5C).
- ARCA Anti-Reverse Cap Analog 3'-0-Me- m7G(5')ppp(5')G
- Y pseudouridine
- m5C 5-methylcytidine
- PbAE-447 polymers can be added to the mRNA at a ratio of 60:1 (w:w) and vortexed immediately for 15 s at a medium speed. Then the mixture can be incubated at RT for 5 min to allow the formation of PbAE-mRNA polyplexes.
- 100 pg/mL PGA/Di-mannose in NaOAc buffer can be added to the polyplexes solution, vortexed for 15 s at medium speed, and incubated for 5 min at room temperature. In this process, PGA/Di-mannose coats the surfaces of PbAE-mRNA polyplexes to form the final NPs.
- D- sucrose 60 mg/ml_
- the nanoparticles can be snap-frozen in dry ice, then lyophilized.
- Dried NPs can be stored at -20 °C or -80 °C until use.
- lyophilized NPs can be re-suspended in water at a 1:20 (w:v) ratio.
- the NP have a size of 99.8 ⁇ SE/24.5, a polydispersity of 0.183, and an almost neutral surface charge (3.40 ⁇ SE/2.15 mV z-potential).
- These physiochemical properties of NPs can be characterized using a Zumblels instrument (Brookhaven Instrument Corporation) at 25 °C.
- NPs nanoparticles
- 10 mM PBS buffer pH 8.4
- the hydrodynamic radius and polydispersity of NPs were measured every 10 min for 5 h, and their sizes and particle concentrations were derived from Particle Tracking Analysis using a Nanosite 300 instrument (Malvern).
- Freshly made NPs 25 pL containing 0.83 pg of mRNA
- glow discharge-treated 200 mesh carbon/Formvar-coated copper grids After 30 s, the grids were treated sequentially with 50% Karnovsky’s fixative, 0.1 M cacodylate buffer, dH20, then 1% (w/v) uranyl acetate.
- Samples were imaged with a JEOL JEM-1400 transmission electron microscope operating at 120 kV (JEOL USA).
- nanoparticles can optionally include binding domain targeting ligands that bind cellular markers present on the surface of monocytes and/or macrophages.
- M2 Binding Domains Egr2 is expressed by M2 macrophages.
- Commercially available antibodies for Egr2 can be obtained from Thermo Fisher, Waltham, MA; Abeam, Cambridge, MA; Millipore Sigma, Burlington, MA; Miltenyi Biotec, Bergisch Gladbach, Germany; LifeSpan Biosciences, Inc., Seattle, WA; and Novus Biologicals, Littleton, CO. Generation of anti-Egr2 antibodies are discussed, for example, in Murakami K et al.
- Anti-Egr2 antibodies include: rabbit monoclonal anti-Egr2 antibody clone EPR4004; mouse monoclonal anti-Egr2 antibody clone 1G5; mouse monoclonal anti-Egr2 antibody clone OTI1B12; rabbit polyclonal anti-Egr2 antibody recognizing AA residues 200-300 of human Egr2; rabbit polyclonal anti-Egr2 antibody recognizing AA residues 340-420 of human Egr2; and rabbit polyclonal anti-Egr2 antibody recognizing AA residues 370-420 of human Egr2. Binding domains can be derived from these antibodies and other antibodies disclosed herein.
- the targeting ligand can be a nanobody including a binding domain including a CDR1 sequence including SGNIFSINAIG (SEQ ID NO: 45), a CDR2 sequence including TITLSGSTN (SEQ ID NO: 46), a CDR3 sequence including NTYSDSDVYGY (SEQ ID NO: 47). These reflect CDR sequences that bind CD206.
- the targeting ligand can be a nanobody including a CDR1 sequence including PGFKLDYYAIA (SEQ ID NO: 48), a CDR2 sequence including SINSSGGST (SEQ ID NO: 49), and a CDR3 sequence including LRRYYGLNLDPGSYDY (SEQ ID NO: 50). These reflect CDR sequences that bind CD206.
- the targeting ligand includes a human or humanized binding domain (e.g., nanobody) including a CDR1 sequence including GFPFNIYPMS (SEQ ID NO: 51), a CDR2 sequence including YISHGGTTT (SEQ ID NO: 52), and a CDRH3 sequence including GYARLMTDSELV (SEQ ID NO: 53). These reflect CDR sequences that bind CD206.
- a human or humanized binding domain e.g., nanobody
- CDR1 sequence including GFPFNIYPMS SEQ ID NO: 51
- CDR2 sequence including YISHGGTTT
- GYARLMTDSELV SEQ ID NO: 53
- an anti-CD206 antibody includes a rat monoclonal anti-mouse CD206 monoclonal antibody clone C068C2 (Cat # 141732, Biolegend, San Diego, CA).
- the targeting ligand includes a binding domain including a CDRL1 sequence including ASQSVSHDV (SEQ ID NO: 54), a CDRL2 sequence including YTS, a CDRL3 sequence including QDYSSPRT (SEQ ID NO: 56), a CDRH1 sequence including GYSITSDY (SEQ ID NO: 57), a CDRH2 sequence including YSG, and a CDRH3 sequence including CVSGTYYFDYWG (SEQ ID NO: 59).
- CDRL1 sequence including ASQSVSHDV SEQ ID NO: 54
- CDRL2 sequence including YTS a CDRL3 sequence including QDYSSPRT
- CDRH1 sequence including GYSITSDY SEQ ID NO: 57
- CDRH2 sequence including YSG a CDRH3 sequence including CVSGTYYFDYWG (SEQ ID NO: 59).
- the targeting ligand includes a binding domain including a CDRL1 sequence including ASQSVSSDV (SEQ ID NO: 60), a CDRL2 sequence including YAS, a CDRL3 sequence including QDYTSPRT (SEQ ID NO: 62), a CDRH1 sequence including GYSITSDY (SEQ ID NO: 57), a CDRH2 sequence including YSG, and a CDRH3 sequence including CVSGTYYFDYWG (SEQ ID NO: 59).
- CDRL1 sequence including ASQSVSSDV SEQ ID NO: 60
- CDRL2 sequence including YAS a CDRL3 sequence including QDYTSPRT
- CDRH1 sequence including GYSITSDY SEQ ID NO: 57
- CDRH2 sequence including YSG a CDRH3 sequence including CVSGTYYFDYWG (SEQ ID NO: 59).
- CD163 A number of additional antibodies or binding domains specific for CD163 are known to those of skill in the art and can be readily characterized for sequence, epitope binding, and affinity. See, for example, WO 2011/039510, WO 2002/032941, WO 2002/076501 , and US 2005/0214871.
- Commercially available antibodies for CD163 can be obtained from Thermo Fisher, Waltham, MA; Enzo Life Sciences, Inc., Farmingdale, NY; BioLegend, San Diego, CA; R & D Systems, Minneapolis, MN; LifeSpan Biosciences, Inc., Seattle, WA; and RDI Research Diagnostics, Flanders, NJ.
- anti-CD163 antibodies can include: mouse monoclonal anti-CD163 antibody clone 3D4; mouse monoclonal anti-CD163 antibody clone Ber- Mac3; mouse monoclonal anti-CD163 antibody clone EDHu-1; and mouse monoclonal anti- CD163 antibody clone GHI/61.
- the targeting ligand includes a binding domain including a CDRL1 sequence including RSSKSLLYKDGKTYLN (SEQ ID NO: 66), a CDRL2 sequence including LMSTRAS (SEQ ID NO: 67), a CDRL3 sequence including QQLVEYPFT (SEQ ID NO: 68), a CDRH1 sequence including GYWMS (SEQ ID NO: 69), a CDRH2 sequence including EIRLKSDNYATHYAESVKG (SEQ ID NO: 70), and a CDRH3 sequence including FID.
- CDRL1 sequence including RSSKSLLYKDGKTYLN
- CDRL2 sequence including LMSTRAS SEQ ID NO: 67
- CDRL3 sequence including QQLVEYPFT SEQ ID NO: 68
- CDRH1 sequence including GYWMS SEQ ID NO: 69
- CDRH2 sequence including EIRLKSDNYATHYAESVKG SEQ ID NO: 70
- FID FID
- a number of antibodies or binding domains specific for CD23 are known to those of skill in the art and can be readily characterized for sequence, epitope binding, and affinity. See, for example, US 7,008,623, US 6,011,138 A (antibodies including 5E8, 6G5, 2C8, B3B1 and 3G12), US 2009/0252725, Rector et al. (1985) J. Immunol. 55: 481-488; Flores-Rumeo et al. (1993) Science 241: 1038-1046; Sherr et al. (1989) J. Immunol. 142: 481-489; and Pene et al., (1988) PNAS 85: 6820-6824.
- CD23 Commercially available antibodies for CD23 can be obtained from Thermo Fisher, Waltham, MA; Abeam, Cambridge, MA; Bioss Antibodies, Inc., Woburn, MA; Bio-Rad, Hercules, CA; LifeSpan Biosciences, Inc., Seattle, WA; and Boster Biological Technology, Pleasanton, CA.
- anti-CD23 antibodies can include: mouse monoclonal anti-CD23 antibody clone Tu 1 ; rabbit monoclonal anti-CD23 antibody clone SP23; rabbit monoclonal anti-CD23 antibody clone EPR3617; mouse monoclonal anti-CD23 antibody clone 5B5; mouse monoclonal anti-CD23 antibody clone 1B12; mouse monoclonal anti-CD23 antibody clone M-L23.4; and mouse monoclonal anti-CD23 antibody clone 3A2.
- the targeting ligand includes a binding domain including a CDRL1 sequence including SSNIGDNY (SEQ ID NO: 72), a CDRL2 sequence including RDS, a CDRL3 sequence including QSYDSSLSGS (SEQ ID NO: 74), a CDRH1 sequence including GFTFDDYG (SEQ ID NO: 75), a CDRH2 sequence including ISWNGGKT (SEQ ID NO: 76), and a CDRH3 sequence including ARGSLFHDSSGFYFGH (SEQ ID NO: 77). These reflect CDR sequences of the Ab79 antibody that bind CD38.
- the targeting ligand includes a binding domain including a CDRL1 sequence including NSNIGSNT (SEQ ID NO: 78), a CDRL2 sequence including SDS, a CDRL3 sequence including QSYDSSLSGSR (SEQ ID NO: 80), a CDRH1 sequence including GFTFNNYG (SEQ ID NO: 81), a CDRH2 sequence including ISYDGSDK (SEQ ID NO: 82), and a CDRH3 sequence including ARVYYYGFSGPSMDV (SEQ ID NO: 83).
- CDRL1 sequence including NSNIGSNT SEQ ID NO: 78
- CDRL2 sequence including SDS includes SDS
- CDRL3 sequence including QSYDSSLSGSR SEQ ID NO: 80
- CDRH1 sequence including GFTFNNYG SEQ ID NO: 81
- a CDRH2 sequence including ISYDGSDK SEQ ID NO: 82
- a CDRH3 sequence including ARVYYYGFSGPSMDV SEQ ID NO:
- the targeting ligand includes a binding domain including a CDRL1 sequence including RASQSVSSYLA (SEQ ID NO: 84), a CDRL2 sequence including DASNRAT (SEQ ID NO: 85), a CDRL3 sequence including QQRSNWPPTF (SEQ ID NO: 86), a CDRH1 sequence including SFAMS (SEQ ID NO: 87), a CDRH2 sequence including AISGSGGGTYYADSVKG (SEQ ID NO: 88), and a CDRH3 sequence including DKILWFGEPVFDY (SEQ ID NO: 89).
- CDRL1 sequence including RASQSVSSYLA SEQ ID NO: 84
- CDRL2 sequence including DASNRAT SEQ ID NO: 85
- a CDRL3 sequence including QQRSNWPPTF SEQ ID NO: 86
- CDRH1 sequence including SFAMS SEQ ID NO: 87
- CDRH2 sequence including AISGSGGGTYYADSVKG SEQ ID NO: 88
- CD38 A number of antibodies specific for CD38 are known to those of skill in the art and can be readily characterized for sequence, epitope binding, and affinity. See, for example, WO 2005/103083, WO 2006/125640, WO 2007/042309, WO 2008/047242, WO 2012/092612, WO 2006/099875, WO 2011/154453, WO 2015/130728, US 7,829,693, and US 2016/0200828.
- Commercially available antibodies for CD38 can be obtained from Thermo Fisher, Waltham, MA; Abeam, Cambridge, MA; and Millipore Sigma, Burlington, MA.
- anti- CD23 antibodies can include: rabbit monoclonal anti-CD38 antibody clone GAD-3; mouse monoclonal anti-CD38 antibody clone HIT2; mouse monoclonal anti-CD38 antibody clone AT1; mouse monoclonal anti-CD38 antibody clone AT13/5; rat monoclonal anti-CD38 antibody clone NIMR-5; and rat monoclonal lgG2a, k anti-CD38 antibody clone 90/CD38 (Cat # BD Biosciences, San Jose, CA).
- G-protein coupled receptor 18 is targeted on M1 macrophages.
- Commercially available antibodies for Gpr18 can be obtained from Assay Biotechnology Company Inc., Sunnyvale, CA; Thermo Fisher, Waltham, MA; Abeam, Cambridge, MA; GeneTex, Inc., Irvine, CA; and Novus Biologicals, Littleton, CO.
- anti-Gpr18 antibodies include: rabbit polyclonal anti-Gpr18 antibody recognizing a portion of amino acids 1-50 of human Gpr18; rabbit polyclonal anti-Gpr18 antibody recognizing a region including amino acids 160-240 of human Gpr18; rabbit polyclonal anti-Gpr18 antibody recognizing a region including amino acids 100-180 of human Gpr18; rabbit monoclonal anti-Gpr18 antibody clone EPR12359; and rabbit polyclonal anti-Gpr18 antibody recognizing a region including amino acids 140-190 of human Gpr18.
- formyl peptide receptor 2 (Fpr2) is targeted on M1 macrophages.
- Commercially available antibodies for Fpr2 can be obtained from Atlas Antibodies, Bromma, Sweden; Biorbyt, LLC, San Francisco, CA; Cloud-Clone Corp., Katy, TX; US Biological Life Sciences, Salem, MA; and Novus Biologicals, Littleton, CO.
- anti- fpr2 antibodies include: mouse monoclonal anti-fpr2 antibody clone GM1 D6; mouse monoclonal anti-fpr2 antibody clone 304405; recombinant anti-fpr2 antibody clone REA663; and rabbit polyclonal anti-fpr2 antibody recognizing a region including amino acids 300-350 of fpr2.
- the targeting ligand includes a binding domain including a CDRL1 sequence including RASQSVSSYLA (SEQ ID NO: 84), a CDRL2 sequence including DASSRAT (SEQ ID NO: 91), a CDRL3 sequence including QLRSNWPPYT (SEQ ID NO: 92), a CDRH1 sequence including GYGMH (SEQ ID NO: 93), a CDRH2 sequence including VI WYDGSN KYYADSVKG (SEQ ID NO: 94), and a CDRH3 sequence including DTGDRFFDY (SEQ ID NO: 95).
- CDRL1 sequence including RASQSVSSYLA SEQ ID NO: 84
- CDRL2 sequence including DASSRAT SEQ ID NO: 91
- CDRL3 sequence including QLRSNWPPYT SEQ ID NO: 92
- CDRH1 sequence including GYGMH SEQ ID NO: 93
- CDRH2 sequence including VI WYDGSN KYYADSVKG SEQ ID NO: 94
- compositions for Administration The nanoparticles disclosed herein can be provided as part of compositions formulated for administration to subjects.
- Compositions include a nanoparticle disclosed herein and a pharmaceutically acceptable carrier.
- Exemplary generally used pharmaceutically acceptable carriers include any and all bulking agents or fillers, solvents or co-solvents, dispersion media, coatings, surfactants, antioxidants (e.g., ascorbic acid, methionine, vitamin E), preservatives, isotonic agents, absorption delaying agents, salts, stabilizers, buffering agents, chelating agents (e.g., EDTA), gels, binders, disintegration agents, and/or lubricants.
- bulking agents or fillers include any and all bulking agents or fillers, solvents or co-solvents, dispersion media, coatings, surfactants, antioxidants (e.g., ascorbic acid, methionine, vitamin E), preservatives, isotonic agents, absorption delaying agents, salts, stabilizers, buffering agents, chelating agents (e.g., EDTA), gels, binders, disintegration agents, and/or lubricants.
- antioxidants e.g
- Exemplary buffering agents include citrate buffers, succinate buffers, tartrate buffers, fumarate buffers, gluconate buffers, oxalate buffers, lactate buffers, acetate buffers, phosphate buffers, histidine buffers and/or trimethylamine salts.
- Exemplary preservatives include phenol, benzyl alcohol, meta-cresol, methyl paraben, propyl paraben, octadecyldimethylbenzyl ammonium chloride, benzalkonium halides, hexamethonium chloride, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol and 3-pentanol.
- Exemplary isotonic agents include polyhydric sugar alcohols including trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol or mannitol.
- Exemplary stabilizers include organic sugars, polyhydric sugar alcohols, polyethylene glycol, sulfur-containing reducing agents, amino acids, low molecular weight polypeptides, proteins, immunoglobulins, hydrophilic polymers or polysaccharides.
- compositions are formulated for intraperitoneal, intravenous, or intracranial injection.
- the compositions disclosed herein can further be formulated for intraarterial, intranodal, intralymphatic, intratumoral, intramuscular, oral, and/or subcutaneous administration and more particularly by intraarterial, intranodal, intralymphatic, intratumoral, intramuscular, and/or subcutaneous injection.
- the compositions disclosed herein can be formulated for administration by infusion, perfusion, or ingestion.
- compositions can be formulated as aqueous solutions, such as in buffers including Hanks' solution, Ringer's solution, or physiological saline.
- aqueous solutions can contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- the formulation can be in lyophilized and/or powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- compositions can also be formulated as depot preparations.
- Depot preparations can be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as sparingly soluble salts.
- compositions can be formulated as sustained-release systems utilizing semipermeable matrices of solid polymers containing nanoparticles.
- sustained-release materials have been established and are well known by those of ordinary skill in the art. Sustained-release systems may, depending on their chemical nature, release nanoparticles following administration for a few weeks up to over 100 days.
- compositions can be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions and the like.
- compositions can also include nucleotides carrying one or more anticancer genes selected from p53, RB, BRCA1, E1A, bcl-2, MDR-1, p21, p16, bax, bcl-xs, E2F, IGF-I VEGF, angiostatin, oncostatin, endostatin, GM-CSF, IL-12, IL-2, IL- 4, IL-7, IFN-Y, TNFa and/or HSV-tk.
- anticancer genes selected from p53, RB, BRCA1, E1A, bcl-2, MDR-1, p21, p16, bax, bcl-xs, E2F, IGF-I VEGF, angiostatin, oncostatin, endostatin, GM-CSF, IL-12, IL-2, IL- 4, IL-7, IFN-Y, TNFa and/or HSV-tk.
- composition formulation disclosed herein can advantageously include any other pharmaceutically acceptable carriers which include those that do not produce significantly adverse, allergic or other untoward reactions that outweigh the benefit of administration, whether for research, prophylactic and/or therapeutic treatments.
- exemplary pharmaceutically acceptable carriers and formulations are disclosed in Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990.
- formulations can be prepared to meet sterility, pyrogenicity, general safety and purity standards as required by United States FDA Office of Biological Standards and/or other relevant foreign regulatory agencies.
- the nanoparticles are provided as part of a composition that can include, for example, at least 0.1% w/v or w/w nanoparticles; at least 1% w/v or w/w nanoparticles; at least 10% w/v or w/w nanoparticles; at least 20% w/v or w/w nanoparticles; at least 30% w/v or w/w nanoparticles; at least 40% w/v or w/w nanoparticles; at least 50% w/v or w/w nanoparticles; at least 60% w/v or w/w nanoparticles; at least 70% w/v or w/w nanoparticles; at least 80% w/v or w/w nanoparticles; at least 90% w/v or w/w nanoparticles; at least 95% w/v or w/w nanoparticles; or at least 99% w/v or w/w nanoparticles
- Methods disclosed herein include altering the activation state of macrophages from an inactivated state to an activated state by introducing into macrophages nanoparticles including nucleotides encoding one or more IRFs and IKKb.
- the altering results in reducing the percentage of macrophages in an inactivated state (e.g., M2 macrophages) in a population of macrophages treated with nanoparticles including nucleotides encoding one or more IRFs and IKKb by 5-fold, 10-fold, 15-fold, 20-fold, or more compared to the percentage of macrophages in an inactivated state that have not been treated with the nanoparticles including nucleotides encoding one or more IRFs and IKKb.
- an inactivated state e.g., M2 macrophages
- the altering results in reducing the number of macrophages in an inactivated state (e.g., M2 macrophages) in a population of macrophages treated with the nanoparticles including nucleotides encoding one or more IRFs and IKKb by 5-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50- fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold, or more compared to the number of macrophages in an inactivated state that have not been treated with the nanoparticles including nucleotides encoding one or more IRFs and IKKb.
- an inactivated state e.g., M2 macrophages
- altering the activation state of macrophages from an inactivated state to an activated state by introducing into macrophages nanoparticles including nucleotides encoding one or more IRFs and IKKb results in: restoring lymphocyte migration and infiltration into treatment sites, such as solid tumors or sites of infection or inflammation; increasing release of pro-inflammatory (anti-tumor) cytokines including I L- 1 b , IL-12, IFNy, and/or TNFa by 1.5-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 15-fold, 20-fold, or more; reducing release of cytokines associated with M2 macrophage phenotype including IL- 6 by 1.5-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 15-fold
- altering the activation state of macrophages from an inactivated state to an activated state includes introducing into macrophages nanoparticles including nucleotides encoding IRF5 and IRF8.
- altering the activation of macrophages from an inactivated state to an activated state includes introducing into macrophages nanoparticles including nucleotides encoding mutant IRFs that are constitutively active or more active than their wild type counterpart IRFs.
- Methods disclosed herein additionally result in secretion of multi-specific molecules (e.g., bi-specific molecules) from genetically modified monocytes/macrophages as well optionally TQRb inhibitors.
- multi-specific molecules e.g., bi-specific molecules
- Methods disclosed herein include treating subjects (humans, veterinary animals, livestock and research animals) with compositions disclosed herein. Treating subjects includes delivering a therapeutically effective amount. Therapeutically effective amounts can provide effective amounts, prophylactic treatments and/or therapeutic treatments.
- an "effective amount” is the amount of a compound necessary to result in a desired physiological change in a subject. Effective amounts are often administered for research purposes. Effective amounts disclosed herein immunomodulate cells in a subject.
- the cells to be immunomodulated are immunosuppressed cells.
- the cells to be immunomodulated are macrophages.
- immunomodulation of macrophages includes switching immunosuppressed macrophages into activated macrophages.
- immunomodulation of macrophages includes switching M2 macrophages to M1 macrophages.
- cells to be immunomodulated include immunosuppressed cells including MDSC, Treg, DCreg, neutrophils, Th17, Breg, and/or MSC.
- immunomodulation of immunosuppressed cells includes phenotypic and/or functional switch of the immunosuppressed cells from being protumor to being antitumor.
- a prophylactic treatment includes a treatment administered to a subject who does not display signs or symptoms of a disease or condition or displays only early signs or symptoms of the disease or condition such that treatment is administered for the purpose of diminishing, preventing, or decreasing the risk of developing the disease or condition further.
- a prophylactic treatment functions as a preventative treatment against a disease or disorder.
- a prophylactic treatment includes administration of the compositions disclosed herein to a subject who had cancer but is in remission such that treatment is administered for the purpose of reducing or delaying the occurrence of relapse.
- a "therapeutic treatment” includes a treatment administered to a subject who displays symptoms or signs of a disease or condition and is administered to the subject for the purpose of diminishing or eliminating those signs or symptoms of the disease or condition.
- a therapeutic treatment includes administration of the compositions disclosed herein to a subject who has cancer to diminish or eliminate tumors and/or metastasis.
- therapeutically effective amounts provide an anti-cancer effect in a subject.
- Cancer medical term: malignant neoplasm
- Metastasis refers to the spread of cancer cells from their original site of proliferation to another part of the body.
- the formation of metastasis is a very complex process and depends on detachment of malignant cells from the primary tumor, invasion of the extracellular matrix, penetration of the endothelial basement membranes to enter the body cavity and vessels, and then, after being transported by the blood, infiltration of target organs.
- a new tumor i.e. a secondary tumor or metastatic tumor
- Tumor metastasis often occurs even after the removal of the primary tumor because tumor cells or components may remain and develop metastatic potential.
- therapeutically effective amounts provide an anti-tumor effect in a subject.
- a “tumor” is a swelling or lesion formed by an abnormal growth of cells (called neoplastic cells or tumor cells).
- a “tumor cell” is an abnormal cell that divides by a rapid, uncontrolled cellular proliferation and continues to divide after the stimuli that initiated the new division cease. Tumors show partial or complete lack of structural organization and functional coordination with the normal tissue, and usually form a distinct mass of tissue, which may be either benign, pre-malignant or malignant.
- An anti-tumor effect refers to a biological effect, which can be manifested by a decrease in the number of tumor cells, a decrease in the number of metastases, a decrease in tumor volume, an increase life expectancy, induced apoptosis of cancer cells, induced cancer cell death, induced chemo- or radiosensitivity in cancer cells, inhibited angiogenesis near cancer cells, inhibited cancer cell proliferation, inhibited tumor growth, prevented metastasis, prolonged life for a subject, reduced cancer-associated pain, reduced number of metastases, and/or reduced relapse or re-occurrence of the cancer following treatment.
- compositions disclosed herein can be used to treat a variety of cancers, can prevent or significantly delay metastasis, and/or can prevent or significantly delay relapse.
- overall survival of a subject with cancer treated with a nanoparticle composition disclosed herein is improved by 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2-fold, 2.1- fold, 2.2-fold, 2.3-fold, 2.4-fold, 2.5-fold, or more as compared to a control subject with the same cancer not treated with the nanoparticle composition.
- the number of metastases in a subject with cancer treated with a nanoparticle composition disclosed herein is decreased by 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more as compared to a control subject with the same cancer not treated with the nanoparticle composition.
- a therapeutic treatment includes administration of the compositions disclosed herein in combination with another therapy to a subject who has cancer to diminish or eliminate tumors.
- the therapy to use in combination with the compositions disclosed herein include cancer vaccines, CAR immunotherapy (e.g., CAR-T immunotherapy), chemotherapy, radiotherapy, hormone therapy, signal transduction inhibitors, gene expression modulators, apoptosis inducers, angiogenesis inhibitors, and monoclonal antibodies that deliver toxic molecules.
- administration of a nanoparticle composition disclosed herein in combination with radiotherapy to a subject who has cancer improves overall survival by 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2-fold, 2.1-fold, 2.2-fold, 2.3-fold, 2.4-fold, 2.5-fold, or more as compared to a control subject with the same cancer not administered the nanoparticle composition in combination with radiotherapy.
- Cancers that can be treated with systems and methods disclosed herein include ovarian cancer, breast cancer, brain cancer, melanomas, lung metastases, seminomas, teratomas, neuroblastomas, gliomas, rectal cancer, endometrial cancer, kidney cancer, adrenal cancer, thyroid cancer, skin cancer, cervical cancer, intestinal cancer, liver cancer, colon cancer, stomach cancer, head and neck cancer, gastrointestinal cancer, lymph node cancer, esophagus cancer, colorectal cancer, pancreatic cancer, ear, nose and throat (ENT) cancer, prostate cancer, cancer of the uterus, lung cancer, and metastases thereof.
- ovarian cancer breast cancer, brain cancer, melanomas, lung metastases, seminomas, teratomas, neuroblastomas, gliomas, rectal cancer, endometrial cancer, kidney cancer, adrenal cancer, thyroid cancer, skin cancer, cervical cancer, intestinal cancer, liver cancer, colon cancer, stomach cancer, head and neck cancer, gastrointestinal cancer, lymph node cancer, eso
- therapeutically effective amounts provide anti-pathogen effects.
- Anti-pathogen effects can include anti-infection effects.
- Anti-infection effects can include a decrease in the occurrence of infections, a decrease in the severity of infections, a decrease in the duration of infections, a decrease in the number of infected cells, a decrease in volume of infected tissue, an increase in life expectancy, induced sensitivity of infected cells to immune clearance, reduced infection-associated pain, and/or reduction or elimination of a symptom associated with the treated infection.
- therapeutically effective amounts provide anti-inflammatory effects.
- Anti-inflammatory effects can include reduced inflammation-associated pain, heat, redness, swelling and/or loss of function.
- therapeutically effective amounts provide anti-Crohn’s disease effects or anti-ulcerative colitis effects.
- Anti-Crohn’s disease effects or anti-ulcerative colitis effects can include reduced diarrhea, reduced rectal bleeding, reduced unexplained weight loss, reduced fever, reduced abdominal pain and cramping, reduced fatigue and feelings of low energy, and/or restored appetite.
- therapeutically effective amounts provide anti-arthritis effects.
- Anti-arthritis effects can include reduced pain, stiffness, swelling, redness in the joints and/or a restored range of motion.
- Types of arthritis include rheumatoid arthritis (RA), ankylosing spondylitis, and psoriatic arthritis.
- therapeutically effective amounts provide anti-plaque psoriasis effects.
- Anti-plaque psoriasis effects can include reduced red patches, scaling spots, itching, burning, soreness, nail bed abnormalities and/or swollen or stiff joints.
- therapeutically effective amounts can be initially estimated based on results from in vitro assays and/or animal model studies.
- a dose can be formulated in animal models to achieve a circulating concentration range that includes an IC50 as determined in cell culture against a particular target. Such information can be used to more accurately determine useful doses in subjects of interest.
- the actual dose amount administered to a particular subject can be determined by a physician, veterinarian or researcher taking into account parameters such as physical and physiological factors including target, body weight, severity of condition, type of disease, previous or concurrent therapeutic interventions, idiopathy of the subject and route of administration.
- Useful doses often range from 0.1 to 5 pg/kg or from 0.5 to 1 pg /kg.
- a dose can include 1 pg /kg, 5 pg /kg, 10 pg /kg, 15 pg /kg, 20 pg /kg, 25 pg /kg, 30 pg /kg, 35 pg/kg, 40 pg/kg, 45 pg/kg, 50 pg/kg, 55 pg/kg, 60 pg/kg, 65 pg/kg, 70 pg/kg, 75 pg/kg, 80 pg/kg, 85 pg/kg, 90 pg/kg, 95 pg/kg, 100 pg/kg, 150 pg/kg, 200 pg/kg, 250 pg/kg, 350 pg/kg, 400 pg/kg, 450 pg/kg, 500 pg/kg, 550 pg/kg, 600 pg/kg, 650 pg/kg, 700 pg/kg, 750 pg/kg, 800 p
- a dose can include 1 mg/kg, 5 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 35 mg/kg, 40 mg/kg, 45 mg/kg, 50 mg/kg, 55 mg/kg, 60 mg/kg, 65 mg/kg, 70 mg/kg, 75 mg/kg, 80 mg/kg, 85 mg/kg, 90 mg/kg, 95 mg/kg, 100 mg/kg, 150 mg/kg, 200 mg/kg, 250 mg/kg, 350 mg/kg, 400 mg/kg, 450 mg/kg, 500 mg/kg, 550 mg/kg, 600 mg/kg, 650 mg/kg, 700 mg/kg, 750 mg/kg, 800 mg/kg, 850 mg/kg, 900 mg/kg, 950 mg/kg, 1000 mg/kg or more.
- Therapeutically effective amounts can be achieved by administering single or multiple doses during the course of a treatment regimen (e.g., daily, every other day, every 3 days, every 4 days, every 5 days, every 6 days, weekly, every 2 weeks, every 3 weeks, monthly, every 2 months, every 3 months, every 4 months, every 5 months, every 6 months, every 7 months, every 8 months, every 9 months, every 10 months, every 11 months or yearly.
- therapeutically effective amounts can be achieved by administering repeated doses during the course of a treatment regimen.
- the nanoparticle compositions described herein can be administered by injection, inhalation, infusion, perfusion, lavage or ingestion.
- Routes of administration can include intravenous, intradermal, intraarterial, intraparenteral, intranasal, intranodal, intralymphatic, intraperitoneal, intracranial, intralesional, intraprostatic, intravaginal, intrarectal, topical, intrathecal, intratumoral, intramuscular, intravesicular, oral, subcutaneous, and/or sublingual administration and more particularly by intravenous, intratumoral, intraperitoneal, and/or intracranial injection.
- Local administration includes administration of a therapeutically effective amount of a composition disclosed herein to a particular region, organ, or cavity of the body.
- intraperitoneal injection can be used to deliver a therapeutic to treat ovarian cancer or intracranial injection can be used to deliver a therapeutic to treat a glioma.
- Administration of a therapeutic at a tumor site can include ligand mediated targeting of a therapeutic (e.g., nanoparticle compositions) to tumor cells and/or tumor supporting cells and not to healthy tissue using targeting ligands as described above.
- Administration of a therapeutic at a tumor site can include passive targeting of a therapeutic (e.g., nanoparticle compositions) to tumor cells and/or tumor supporting cells and not to healthy tissue.
- Particular embodiments of passive targeting can include enhanced permeability and retention (EPR) phenomenon based on size range of nanoparticles and the leaky vasculature and impaired lymphatic drainage of tumor tissues.
- EPR enhanced permeability and retention
- Systemic administration is body-wide, and is typically achieved by intravenous injection of a composition or therapeutic into the circulation.
- Systemic administration of a therapeutic can be useful for less localized forms of cancer, such as cancers that have metastasized.
- a nanoparticle including: a targeting ligand that binds to a professional phagocyte; and a nucleic acid that encodes a protein molecule having at least a first binding domain and a second binding domain, wherein the first binding domain is specific to a cell surface protein expressed by an immune cell, and wherein the second binding domain is specific to a cell surface protein expressed by a cell of interest.
- nanoparticle of embodiment 1, wherein the cell of interest is a cancer cell, an infected cell, an autoreactive cell, or a prokaryotic cell.
- RNA ribonucleic acid
- RNA includes messenger RNA (mRNA).
- mRNA messenger RNA
- lymphocyte is selected from the group including a T-cell, a B-cell, a natural killer (NK) cell, and a tumor-infiltrating lymphocyte (TIL) cell.
- the first binding domain is specific to a cell surface protein of a T-cell selected from the group including a CD8+ T cell, CD4+ T cell, a gamma delta T cell, and an NK T-cell.
- IRFs interferon regulatory factors
- nanoparticle of any of embodiments 1-15 further including a tumor cell proliferation inhibitor or a nucleic acid encoding a tumor cell proliferation inhibitor.
- nucleic acid encodes an antibody, or an antigen-binding fragment of an antibody.
- a composition including: a first plurality of nanoparticles, wherein each of the first plurality of nanoparticles includes: a targeting ligand that binds to a professional phagocyte; and a nucleic acid encoding a protein molecule having a first binding domain specific to a cell surface protein expressed by an immune cell, and a second binding domain is specific to a cell surface protein expressed by a cell of interest.
- composition of embodiment 20, wherein the cell of interest is a cancer cell, an infected cell, an autoreactive cell, or a prokaryotic cell.
- composition of any of embodiments 20-23, wherein the nucleic acid includes RNA includes RNA.
- composition of embodiment 24, wherein the RNA includes mRNA is provided.
- composition of embodiment 25, wherein the mRNA includes synthetic RNA or IVT RNA.
- composition of embodiment 27, wherein the lymphocyte is selected from the group including a T-cell, a B-cell, an NK cell, and a TIL cell.
- composition of any of embodiments 20-31 wherein the protein molecule is an EpCAM- CD3 bi-specific T-cell engager.
- the second binding domain is specific to an antigen expressed by the cell of interest.
- composition of any of embodiments 20-33, further including a pharmaceutically acceptable carrier is provided.
- composition of any of embodiments 20-34, wherein at least a subset of the first plurality of nanoparticles further includes one or more of (a) a nucleic acid encoding one or more interferon regulatory factors (IRFs), and (b) a nucleic acid encoding IKKb.
- IRFs interferon regulatory factors
- composition of any of embodiments 20-35, wherein the first plurality of nanoparticles include a liposome, a liposomal nanoparticle, a lipid nanoparticle, or a solid lipid nanoparticle.
- composition of any of embodiments 20-36 further including: a second plurality of nanoparticles, wherein at least a subset of the second plurality of nanoparticles include one or more of (a) a nucleic acid encoding one or more interferon regulatory factors (IRFs), and (b) a nucleic acid encoding IKKb.
- IRFs interferon regulatory factors
- composition of any of embodiments 20-37, further including a tumor cell proliferation inhibitor is provided.
- composition of any of embodiments 37-40, wherein the second plurality of nanoparticles include a liposome, a liposomal nanoparticle, a lipid nanoparticle, or a solid lipid nanoparticle.
- composition of any of embodiments 20-41 further including a third plurality of nanoparticles, wherein at least a subset of the third plurality of nanoparticles include a nucleic acid encoding an antigen-binding fragment of an antibody of a tumor cell proliferation inhibitor.
- composition of any of embodiments 38-42, wherein the tumor cell proliferation inhibitor is a CD40-CD40L inhibitor or a TQRb inhibitor.
- composition of embodiment 42 or 43 including the first plurality of nanoparticles and the third plurality of nanoparticles in the absence of the second plurality of nanoparticles.
- composition of any of embodiments 42-44, wherein the third plurality of nanoparticles include a liposome, a liposomal nanoparticle, a lipid nanoparticle, or a solid lipid nanoparticle.
- a composition for treating a condition in a human subject including: a first plurality of nanoparticles, wherein each of the plurality of nanoparticles includes (i) a targeting ligand that binds to a monocyte, macrophage, or both; and (ii) an mRNA encoding a protein molecule having at least a first binding domain specific to a cell surface protein expressed by a lymphocyte, and a second binding domain specific to a cell surface protein expressed by a cell of interest; wherein the first plurality of nanoparticles stimulates or enhances an immune response in the human subject, thereby treating the condition.
- composition of embodiment 46, wherein the cell of interest is a cancer cell, an infected cell, an autoreactive cell, or a prokaryotic cell.
- composition of embodiment 50, wherein the lymphocyte is selected from the group including a T-cell, a B-cell, an NK cell and a TIL cell.
- composition of any of embodiments 46-56, further including a pharmaceutically acceptable carrier is provided.
- IRFs interferon regulatory factors
- composition of any of embodiments 46-58, wherein the first plurality of nanoparticles include a liposome, a liposomal nanoparticle, a lipid nanoparticle, or a solid lipid nanoparticle.
- composition of any of embodiments 46-59 further including: a second plurality of nanoparticles, wherein each of the second plurality of nanoparticles includes a targeting ligand that binds to a monocyte, a macrophage, or both, and one or more of (a) an mRNA encoding one or more interferon regulatory factors (IRFs), (b) an mRNA encoding IKKb, and (c) an mRNA encoding a tumor cell proliferation inhibitor.
- IRFs interferon regulatory factors
- composition of embodiment 60, wherein the second plurality of nanoparticles include an mRNA encoding an antigen-binding fragment of an antibody of a tumor cell proliferation inhibitor.
- composition of embodiments 60 or 61 , wherein the tumor cell proliferation inhibitor is a CD40-CD40L inhibitor or a TQRb inhibitor.
- composition of any of embodiments 60-62, wherein the second plurality of nanoparticles include a liposome, a liposomal nanoparticle, a lipid nanoparticle, or a solid lipid nanoparticle.
- a method for treating a condition in a human subject including: administering to the human subject a composition including a first plurality of nanoparticles, wherein each of the first plurality of nanoparticles includes:
- a targeting ligand that binds to a monocyte, a macrophage, or both; and (ii) an mRNA encoding a protein molecule having at least a first binding domain specific to a cell surface protein expressed by a lymphocyte, and a second binding domain specific to a cell surface protein expressed by a cell of interest; wherein the plurality of nanoparticles stimulates or enhances an immune response in the human subject, thereby treating the condition.
- the cell of interest is a cancer cell, an infected cell, an autoreactive cell, or a prokaryotic cell.
- lymphocyte is selected from the group including a T-cell, a B-cell, an NK cell, and a TIL cell.
- composition further including a pharmaceutically acceptable carrier.
- composition of any of embodiments 64-75, wherein the first plurality of nanoparticles include a liposome, a liposomal nanoparticle, a lipid nanoparticle, or a solid lipid nanoparticle.
- any of embodiments 64-76 further including: administering to the human subject a composition including a second plurality of nanoparticles, wherein each of the second plurality of nanoparticles includes a targeting ligand that binds to a monocyte, a macrophage, or both, and one or more of (a) an mRNA encoding one or more interferon regulatory factors (IRFs), and (b) an mRNA encoding IKKb.
- IRFs interferon regulatory factors
- composition of embodiment 77 or 78, wherein the second plurality of nanoparticles include a liposome, a liposomal nanoparticle, a lipid nanoparticle, or a solid lipid nanoparticle.
- compositions including a third plurality of nanoparticles wherein each of the third plurality of nanoparticles includes a targeting ligand that binds to a monocyte, a macrophage, or both, and an mRNA encoding a tumor cell proliferation inhibitor.
- an mRNA encoding a tumor cell proliferation inhibitor encodes an antigen-binding fragment of an antibody of a tumor cell proliferation inhibitor.
- tumor cell proliferation inhibitor is a CD40-CD40L inhibitor or a TGF inhibitor.
- composition of any of embodiments 80-82, wherein the third plurality of nanoparticles include a liposome, a liposomal nanoparticle, a lipid nanoparticle, or a solid lipid nanoparticle.
- a modified professional phagocyte including: a nanoparticle loaded with a nucleic acid encoding a protein molecule having at least a first binding domain specific to a cell surface protein expressed by an immune cell and a second binding domain specific for a cell surface protein expressed by a cell of interest, wherein the nanoparticle is adhered to the surface of the phagocyte or has been internalized by the phagocyte.
- the modified professional phagocyte of embodiment 89 wherein the cell of interest is a cancer cell, an infected cell, an autoreactive cell, or a prokaryotic cell.
- modified professional phagocyte of any of embodiments 89-91 where the phagocyte is a tumor-associated macrophage.
- RNA ribonucleic acid
- RNA messenger RNA
- modified professional phagocyte of embodiment 94 wherein the mRNA includes synthetic RNA or in vitro transcribed RNA (IVT RNA).
- the modified professional phagocyte of embodiment 96 wherein the lymphocyte is selected from the group including a T-cell, a B-cell, an NK cell, and a TIL cell.
- IRFs interferon regulatory factors
- the modified professional phagocyte of any of embodiments 89-103 further including: a second nanoparticle loaded with one or more of (a) a nucleic acid encoding one or more interferon regulatory factors (IRFs), (b) a nucleic acid encoding IKKb, and (c) a nucleic acid encoding a tumor cell proliferation inhibitor, wherein the second nanoparticle is adhered to the surface of the phagocyte or has been internalized by the phagocyte.
- IRFs interferon regulatory factors
- the modified professional phagocyte of any of embodiments 89-107 further including at least one of a second nanoparticle loaded with one or more of (a) a nucleic acid encoding one or more interferon regulatory factors (IRFs), (b) a nucleic acid encoding IKKb, or (c) a nucleic acid encoding a tumor cell proliferation inhibitor; and a third nanoparticle loaded with a nucleic acid encoding a tumor cell proliferation inhibitor, wherein each of the second and third nanoparticles is adhered to the surface of the phagocyte or has been internalized by the phagocyte.
- IRFs interferon regulatory factors
- IKKb interferon regulatory factors
- a third nanoparticle loaded with a nucleic acid encoding a tumor cell proliferation inhibitor wherein each of the second and third nanoparticles is adhered to the surface of the phagocyte or has been internalized by the phagocyte.
- a nanoparticle including a positively-charged polymer core and a neutral or negatively- charged coating around the polymer core wherein the positively-charged polymer core encapsulates nucleotides encoding at least one binding domain that binds an immune cell activating epitope and/or at least one binding domain that binds an antigen on a cell of interest.
- nanoparticle of embodiment 110 wherein the nanoparticles are ⁇ 130 nm.
- the nanoparticle of embodiments 110 or 111, wherein the positively charged polymer includes poly ⁇ -amino ester, poly(L-lysine), poly(ethylene imine) (PEI), poly-(amidoamine) dendrimers (PAMAMs), poly(amine-co-esters), poly(dimethylaminoethyl methacrylate) (PDMAEMA), chitosan, poly-(L-lactide-co-L-lysine), poly[a-(4-aminobutyl)-L-glycolic acid] (PAGA), or poly(4-hydroxy-L-proline ester) (PHP).
- the positively charged polymer includes poly ⁇ -amino ester, poly(L-lysine), poly(ethylene imine) (PEI), poly-(amidoamine) dendrimers (PAMAMs), poly(amine-co-esters), poly(dimethylaminoethyl methacrylate) (PDMAEMA), chitosan,
- nanoparticle of any of embodiments 110-113, wherein the neutral or negatively- charged coating includes polyglutamic acid (PGA), poly(acrylic acid), alginic acid, or cholesteryl hemisuccinate/1,2-dioleoyl-sn-glycero-3-phosphoethanolamine.
- PGA polyglutamic acid
- poly(acrylic acid) poly(acrylic acid)
- alginic acid or cholesteryl hemisuccinate/1,2-dioleoyl-sn-glycero-3-phosphoethanolamine.
- nanoparticle of any of embodiments 110-114, wherein the neutral or negatively- charged coating includes polyglutamic acid (PGA).
- PGA polyglutamic acid
- nanoparticle of any of embodiments 110-115, wherein the neutral or negatively- charged coating includes a zwitterionic polymer.
- nanoparticle of any of embodiments 110-116, wherein the neutral or negatively- charged coating includes a liposome.
- DOTAP 1,2-dioleoyl-3- trimethylammonium-propane
- DOTMA 1,2-di-0-octadecenyl-3-trimethylammonium propane
- DC-Chol 1,2-di-0-octadecenyl-3-trimethylammonium propane
- DOGS dioctadecyl- amidoglycylspermine
- DOPE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine
- DOPC 1,2-dioleoyl-sn-glycero-3-phosphocholine
- RNA ribonucleic acid
- RNA includes synthetic RNA.
- RNA includes in vitro transcribed mRNA.
- nanoparticle of any of embodiments 110-122, wherein the nucleotides are in the form of a plasmid, a minicircle plasmid, or a closed-ended linear ceDNA.
- the antigen on the cell of interest is a cancer antigen expressed by an ovarian cancer cell, a melanoma cell, a glioblastoma cell, a multiple myeloma cell, a melanoma cell, a prostate cancer cell, a breast cancer cell, a stem cell cancer cell, a mesothelioma cell, a renal cell carcinoma cell, a pancreatic cancer cell, a lung cancer cell, a cholangiocarcinoma cell, a bladder cancer cell, a neuroblastoma cell, a colorectal cancer cell, or a merkel cell carcinoma cell.
- the cancer antigen includes 13- cell maturation antigen (BCMA), carboxy-anhydrase-IX (CAIX), CD19, CD24, CD56, CD133, CEA, disialoganglioside, EpCam, EGFR, EGFR variant III (EGFRvlll), ERBB2, folate receptor (FOLR), GD2, glypican-2, HER2, Lewis Y, L1-CAM, mesothelin, MUC16, PD-L1 , PSMA, Prostate Stem Cell antigen (PSCA), ROR1 , TYRP1/gp75, SV40 T, or WT-1.
- BCMA 13- cell maturation antigen
- CAIX carboxy-anhydrase-IX
- CD19 CD24
- CD56 CD133
- CEA disialoganglioside
- EpCam EpCam
- EGFR EGFR variant III
- ERBB2 folate receptor
- GD2 glypican-2
- nanoparticle of any of embodiments 110-125, wherein the binding domain that binds the cancer antigen includes the complementarity determining regions (CDRs) of antibody adecatumumab, anetumab, ravtansine, amatuximab, HN1 , oregovomab, ovarex, abagovomab, edrecolomab, farletuzumab.
- CDRs complementarity determining regions
- TCR T cell receptor
- nanoparticle of any of embodiments 110-126, wherein the binding domains that binds a cancer antigen is a protein molecule.
- nanoparticle of embodiment 127 wherein nucleotides within the nanoparticle encode different protein molecules including binding domains that bind different cancer antigens.
- nanoparticle of embodiment 129 wherein the cancer type is ovarian cancer, melanoma, or glioblastoma.
- the different cancer antigens include at least two cancer antigens selected from EpCam, L1-CAM, MUC16, folate receptor (FOLR), Lewis Y, ROR1, mesothelin, WT-1, PD-L1, EGFR, and CD56; at least two cancer antigens selected from Tyrosinase related protein 1 (TYRP1/gp75); GD2, PD-L1, and EGFR; or two cancer antigens selected from EGFR variant III (EGFRvlll) and IL13Ra2.
- the different cancer antigens include at least two cancer antigens selected from EpCam, L1-CAM, MUC16, folate receptor (FOLR), Lewis Y, ROR1, mesothelin, WT-1, PD-L1, EGFR, and CD56; at least two cancer antigens selected from Tyrosinase related protein 1 (TYRP1/gp75); GD2, PD-L1, and EGFR; or two cancer antigens selected from EGFR variant III
- nanoparticle of any of embodiments 110-134, wherein the immune cell activating epitope is expressed by a T cell is expressed by a T cell.
- the nanoparticle of embodiment 135, wherein the immune cell activating epitope expressed by the T cell includes CD2, CD3, CD7, CD8, CD27, CD28, CD30, CD40, CD83, 4- 1BB, 0X40, lymphocyte function-associated antigen-1 (LFA-1), LIGHT, NKG2C, or B7-H3.
- the immune cell activating epitope expressed by the T cell includes CD2, CD3, CD7, CD8, CD27, CD28, CD30, CD40, CD83, 4- 1BB, 0X40, lymphocyte function-associated antigen-1 (LFA-1), LIGHT, NKG2C, or B7-H3.
- nanoparticle of embodiment 135, wherein the immune cell activating epitope expressed by the T cell includes CD3, CD28, or 4-1BB.
- nanoparticle of any of embodiments 110-137, wherein the binding domains that bind an immune cell activating epitope include a protein molecule.
- nanoparticle of embodiment 138 wherein nucleotides within the nanoparticle encode different protein molecules including binding domains that bind different immune cell activating epitopes.
- nanoparticle of embodiment 139, wherein the different immune cell activating epitopes include CD3 and CD28 or CD3 and 4-1 BB.
- nanoparticle of any of embodiments 110-140, wherein at least one binding domain includes the CDRs of antibody OKT3, 20G6-F3, 4B4-D7, 4E7-C9, 18F5-H10, TGN1412, 9D7, 9.3, KOLT-2, 15E8, 248.23.2, EX5.3D10, OKT8 or the SK1.
- the nanoparticle of embodiment 142, wherein the immune cell activating epitope expressed by the NK cell includes NKG2D, CD8, CD16, KIR2DL4, KIR2DS1 , KIR2DS2, KIR3DS1 , NKG2C, NKG2E, NKG2D, NKp30, NKp44, NKp46, NKp80, or DNAM-1.
- nanoparticle of any of embodiments 110-143, wherein at least one binding domain includes the CDRs of antibody 5C6, 1 D11 , mAb 33, P44-8, SK1 , or 3G8.
- nanoparticle of embodiment 149, wherein the protein molecule includes catumaxomab, MT110, ertumaxomab, MDX-447, MM-141, AMG211, R06958688, R06895882, TF2, BAY2010112, AMG701, solitomab, or blinatumomab.
- IRFs interferon regulatory factors
- nanoparticle of embodiment 163, wherein the IRF7/IRF3 fusion protein includes a sequence as set forth in SEQ ID NO: 15.
- nanoparticle of embodiment 166, wherein the IKKb is selected from a sequence having >90%, >95%, or >98% identity to a sequence as set forth in a sequence selected from SEQ ID NOs: 18-22.
- TQRb transforming growth factor beta
- TQRb inhibitor includes the CDRs of an antibody that suppresses the activity of TQRb.
- TQRb inhibitor includes an antibody that suppresses the activity of TQRb.
- GILZ glucocorticoid-induced leucine zipper
- an anticancer gene selected from p53, RB, BRCA1, E1A, bcl-2, MDR-1, p21, p16, bax, bcl-xs, E2F, IGF-I VEGF, angiostatin, oncostatin, endostatin, GM-CSF, IL-12, IL-2, IL-4, IL-7, IFN-g, TNFa and/or
- a system including: nanoparticles wherein at least a subset of the nanoparticles include nucleotides encoding one or more interferon regulatory factors (IRFs) and wherein at least a subset of the nanoparticles include nucleotides encoding a protein molecule having at least two binding domains wherein one binding domain binds an antigen expressed by a cell of interest at a treatment site and wherein one binding domain binds an immune cell activating epitope.
- IRFs interferon regulatory factors
- nanoparticles include a positively-charged core and a neutrally or negatively-charged coating on the outer surface of the core.
- the positively-charged core includes a positively- charged lipid and/or a positively-charged polymer.
- the positively charged polymer includes poly ⁇ -amino ester, poly(L-lysine), poly(ethylene imine) (PEI), poly-(amidoamine) dendrimers (PAMAMs), poly(amine-co-esters), poly(dimethylaminoethyl methacrylate) (PDMAEMA), chitosan, poly-(L-lactide-co-L-lysine), poly[a-(4-aminobutyl)-L-glycolic acid] (PAGA), or poly(4- hydroxy-L-proline ester) (PHP).
- the positively charged polymer includes poly ⁇ -amino ester, poly(L-lysine), poly(ethylene imine) (PEI), poly-(amidoamine) dendrimers (PAMAMs), poly(amine-co-esters), poly(dimethylaminoethyl methacrylate) (PDMAEMA), chitosan, poly-(L-lactide-co-L-
- neutral or negatively-charged coating includes polyglutamic acid (PGA), poly(acrylic acid), alginic acid, or cholesteryl hemisuccinate/1,2-dioleoyl-sn-glycero-3-phosphoethanolamine.
- the liposome includes 1,2-dioleoyl-3- trimethylammonium-propane (DOTAP), 1,2-di-0-octadecenyl-3-trimethylammonium propane (DOTMA), 3B-[N-(N',N'-dimethylaminoethane)-carbamoyl]cholesterol (DC-Chol), dioctadecyl- amidoglycylspermine (DOGS), cholesterol, 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), or 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC).
- DOTAP 1,2-dioleoyl-3- trimethylammonium-propane
- DOTMA 1,2-di-0-octadecenyl-3-trimethylammonium propane
- DC-Chol 3B-[N-(N',N'-dimethylaminoethan
- RNA ribonucleic acid
- RNA includes synthetic RNA.
- RNA includes in vitro transcribed mRNA.
- nucleotides include integrating or non-integrating double-stranded DNA.
- nucleotides are in the form of a plasmid, a minicircle plasmid, or a closed-ended linear ceDNA.
- IRFs are selected from IRF1 , IRF3, IRF5, IRF7, IRF8, and/or a fusion of IRF7 and IRF3.
- IRF5 includes a sequence as set forth in SEQ ID NO: 1 or SEQ ID NO: 3 with one or more mutations selected from S156D, S158D and T160D.
- I RF5 includes a sequence as set forth in SEQ ID NO: 2 with one or more mutations selected from T10D, S158D, S309D, S317D, S451 D, and S462D.
- IRF5 includes a sequence as set forth in SEQ ID NO: 4 with one or more mutations selected from S425D, S427D, S430D, and S436D.
- IRF1 including a sequence as set forth in SEQ ID NOs: 8 or 12.
- IRF8 including a sequence as set forth in SEQ ID NOs: 11,16, or 17.
- the one or more IRFs include an IRF7/IRF3 fusion protein including an N-terminal IRF7 DNA binding domain, a constitutively active domain, and a C-terminal IRF3 nuclear export signal.
- IRF7/IRF3 fusion protein includes a sequence as set forth in SEQ ID NO: 15.
- nucleotides include a sequence as set forth in a sequence selected from SEQ ID NOs: 23-44.
- cancer antigen includes B-cell maturation antigen (BCMA), carboxy-anhydrase-IX (CAIX), CD19, CD24, CD56, CD133, CEA, disialoganglioside, EpCam, EGFR, EGFR variant III (EGFRvlll), ERBB2, folate receptor (FOLR), GD2, glypican-2, HER2, Lewis Y, L1-CAM, mesothelin, MUC16, PD-L1, PSMA, Prostate Stem Cell antigen (PSCA), ROR1 , TYRP1/gp75, SV40 T, or WT-1.
- BCMA B-cell maturation antigen
- CAIX carboxy-anhydrase-IX
- CD19 CD24
- CD56 CD133
- CEA disialoganglioside
- EpCam EpCam
- EGFR EGFR variant III
- ERBB2 folate receptor
- GD2 glypican-2
- binding domain of the protein molecule includes the complementarity determining regions (CDRs) of antibody adecatumumab, anetumab, ravtansine, amatuximab, HN1 , oregovomab, ovarex, abagovomab, edrecolomab, farletuzumab. flanvotumab, TA99, 20D7, Cetuximab, FMC63, SJ25C1, HD37, R11 , R12, 2A2, Y31, 4D5, 3G10 atezolizumab, avelumab, or durvalumab or a TCR.
- CDRs complementarity determining regions
- FLR Lewis Y
- ROR1 mesothelin
- WT-1 WT-1
- PD-L1 EGFR
- CD56 CD56
- EGFRvlll EGFR variant III
- IL13Ra2 IL13Ra2.
- the viral antigen is expressed by adenoviruses, arenaviruses, bunyaviruses, coronavirusess, flavirviruses, hantaviruses, hepadnaviruses, herpesviruses, papilomaviruses, paramyxoviruses, parvoviruses, picornaviruses, poxviruses, orthomyxoviruses, retroviruses, reoviruses, rhabdoviruses, rotaviruses, spongiform viruses or togaviruses; the bacterial antigen is expressed by anthrax; gram-negative bacilli, chlamydia, diptheria, haemophilus influenza, Helicobacter pylori, malaria, Mycobacterium tuberculosis, pertussis toxin, pneumococcus, rickettsiae, staphylococcus
- the system of embodiment 232, wherein the immune cell activating epitope expressed by the T cell includes CD2, CD3, CD7, CD8, CD27, CD28, CD30, CD40, CD83, 4-1 BB, 0X40, lymphocyte function-associated antigen-1 (LFA-1), LIGHT, NKG2C, or B7-H3.
- the immune cell activating epitope expressed by the T cell includes CD2, CD3, CD7, CD8, CD27, CD28, CD30, CD40, CD83, 4-1 BB, 0X40, lymphocyte function-associated antigen-1 (LFA-1), LIGHT, NKG2C, or B7-H3.
- the system of embodiment 233, wherein the immune cell activating epitope expressed by the T cell includes CD3, CD28, or 4-1 BB.
- the system of embodiment 238, wherein the immune cell activating epitope expressed by the NK cell includes NKG2D, CD8, CD16, KIR2DL4, KIR2DS1, KIR2DS2, KIR3DS1, NKG2C, NKG2E, NKG2D, NKp30, NKp44, NKp46, NKp80, or DNAM-1.
- the protein molecule includes at least one binding domain binds CEA and at least one binding domain binds CD3, CD28, or 4- 1BB; at least one binding domain binds EGFR and at least one binding domain binds CD3, CD28, or 4-1 BB; at least one binding domain binds EpCam and at least one binding domain binds CD3, CD28, or 4-1 BB; at least one binding domain binds HER2 and at least one binding domain binds CD3, CD28, or 4-1 BB; at least one binding domain binds PD-L1 and at least one binding domain binds CD3, CD28, or 4-1 BB; at least one binding domain binds PSMA and at least one binding domain binds CD3, CD28, or 4-1 BB; or at least one binding domain binds [TYRP1/gp75] and at least one binding domain binds CD3, CD28, or 4-1 BB.
- nucleotides encoding at least two binding domains are encapsulated within the same nanoparticle core as the nucleotides encoding one or more IRFs and/or IKKb.
- nucleotides encoding at least two binding domains are encapsulated within different nanoparticles than those encapsulating nucleotides encoding one or more IRFs and/or IKKb.
- T ⁇ Rb transforming growth factor beta
- T ⁇ Rb inhibitor includes nucleotides encoding the T ⁇ Rb inhibitor.
- T ⁇ Rb inhibitor includes the CDRs of an antibody that suppresses the activity of T ⁇ Rb.
- T ⁇ Rb inhibitor includes an antibody that suppresses the activity of T ⁇ Rb.
- the antibody includes trabedersen, disitertide, metelimumab, fresolimumab, LY2382770, SIX-100, avotermin, and/or IMC-TR1.
- nanoparticles further include nucleotides encoding glucocorticoid-induced leucine zipper (GILZ).
- GILZ glucocorticoid-induced leucine zipper
- nanoparticles further include nucleotides including an anticancer gene selected from p53, RB, BRCA1, E1A, bcl-2, MDR-1, p21, p16, bax, bcl-xs, E2F, IGF-I VEGF, angiostatin, oncostatin, endostatin, GM-CSF, IL-12, IL- 2, IL-4, IL-7, IFN-Y, TNFa and/or HSV-tk.
- an anticancer gene selected from p53, RB, BRCA1, E1A, bcl-2, MDR-1, p21, p16, bax, bcl-xs, E2F, IGF-I VEGF, angiostatin, oncostatin, endostatin, GM-CSF, IL-12, IL- 2, IL-4, IL-7, IFN-Y, TNFa and/or HSV-tk.
- a method of modulating the macrophage activation state at a treatment site within a subject, recruiting immune cells to the treatment site, and activating the recruited immune cells including: administering the system of any of embodiments 182-257 to the subject, thereby modulating the macrophage activation state at the treatment site within the subject, recruiting immune cells to the treatment site, and activating the recruited immune cells.
- TAM tumor-associated macrophages
- Example 1 Materials and Methods. PbAE synthesis. The methods used to synthesize the polymer were described previously (Mangraviti A et al. (2015) ACS Nano 9: 1236-1249). 1,4-butanediol diacrylate was combined with 4-amino-1 -butanol in a 1:1 molar ratio of diacrylate to amine monomers. Acrylate-terminated poly(4-amino-1-butanol-co- 1,4-butanediol diacrylate) was formed by heating the mixture to 90 °C with stirring for 24 hours. 2.3 g of this polymer was dissolved in 2 ml_ tetrahydrofuran (THF).
- THF 2 ml_ tetrahydrofuran
- PGA conjugation to Di-mannose a-D-mannopyranosyl-(1 2)-a-D-mannopyranose (Di mannose, Omicron Biochemicals Inc.) was modified into glycosylamine before being conjugated to polyglutamic acid (PGA).
- PGA polyglutamic acid
- the Di-mannose 157 mg was dissolved in 10.5 mL of saturated aqueous ammonium carbonate, then stirred at RT for 24 hours. On the second day, more solid ammonium carbonate was added until the Di-mannose precipitated from the reaction solution. The mixture was stirred until completion, as measured by TLC, followed by lyophilization to remove the excess ammonium carbonate. Complete removal of volatile salt was accomplished by re-dissolving the solid in methanol.
- Poly ⁇ -amino esters)- 447 (PbAE-447) polymer in DMSO was diluted from 100 pg/pL to 6 pg/pL, also in NaOAc buffer.
- PbAE-447 polymers were added to the mRNA at a ratio of 60:1 (w:w) and vortexed immediately for 15 seconds at a medium speed, then the mixture was incubated at RT for 5 min to allow the formation of PbAE-mRNA polyplexes.
- 100 pg/mL PGA/Di-mannose in NaOAc buffer was added to the polyplexes solution, vortexed for 15 seconds at medium speed, and incubated for 5 min at room temperature. In this process, PGA/Di-mannose coated the surfaces of PbAE-mRNA polyplexes to form the final NPs.
- D-sucrose 60 mg/ml_ was added to the NP solutions as a cryoprotectant.
- the nanoparticles were snap-frozen in dry ice, then lyophilized.
- the dried NPs were stored at -20°C or -80 °C until use.
- lyophilized NPs were re-suspended in water at a 1 :20 (w:v) ratio.
- NPs The hydrodynamic radius and polydispersity of NPs were measured every 10 minutes for 5 hours, and their sizes and particle concentrations were derived from Particle Tracking Analysis using a Nanosite 300 instrument (Malvern). To characterize the NPs using transmission electron microscopy, previously described protocols were followed (Smith TT et al. (2017) Nat Nanotechnol 12: 813-820). Freshly made NPs (25 pl_ containing 0.83 pg of mRNA) were deposited on glow discharge-treated 200 mesh carbon/Formvar-coated copper grids. After 30 seconds, the grids were treated sequentially with 50% Karnovsky’s fixative, 0.1 M cacodylate buffer, dH20, then 1% (w/v) uranyl acetate. Samples were imaged with a JEOL JEM- 1400 transmission electron microscope operating at 120 kV (JEOL USA).
- BMDMs Bone marrow derived macrophages
- Other cell lines To prepare BMDMs, bone marrow progenitor cells were harvested from mouse femurs following established protocols (Zhang X et al. (2008) Curr Protoc Immunol Chapter 14: Unit 14 11).
- BMDMs were used between 7-21 days ex vivo.
- the murine ovarian cancer cell line ID8 a gift from Dr. Katherine Roby (University of Kansas Medical Center, Kansas City, KS), was cultured in DMEM supplemented with 10% FBS, 100 U/mL penicillin, 5 pg/mL insulin, 5 pg/mL transferrin, and 5 ng/mL sodium selenite (all Sigma-Aldrich).
- ID8 tumor cells were transfected with the pUNOI plasmid (Invivogen) encoding murine VEGF along with the blasticidin- resistance gene. To obtain stable transfectants, tumor cells were cultured in complete medium containing 10 pg/mL blasticidin (Invivogen) for 3 weeks.
- pUNOI plasmid Invivogen
- blasticidin- resistance gene To obtain stable transfectants, tumor cells were cultured in complete medium containing 10 pg/mL blasticidin (Invivogen) for 3 weeks.
- the B16F10 melanoma cell line (American Type Culture Collection) was cultured in complete RPMI 1640 medium with 10% FBS, 100 U/mL penicillin, 2 mM/L-glutamine, 1.5 g/L sodium bicarbonate, 4.5 g/L glucose, 10 mM HEPES, 1.0 mM sodium pyruvate, and 0.05 mM 2-mercaptoethanol.
- ID8-VEGF and B16F10 cell lines were retrovirally transduced with firefly luciferase.
- the DF-1 cell line carrying RA ⁇ e-R ⁇ Rb or RCAS-cre retrovirus was cultured in complete medium supplemented with 10% FBS and 100 U/mL penicillin under 5% C02 at 39 °C.
- BMDMs BMDMs were reseeded on 24-well plates in macrophage complete medium at a concentration of 250,000/well. Before transfection, the complete medium was replaced with 300 pL unsupplemented DMEM. To transfect these cells, NPs containing 2 pg mRNA were added into the base medium and co cultured with the BMDMs at 37 °C. After 1 hour, medium containing NPs was removed, and the cells were cultured an additional 24 hours before evaluation of transfection efficiency and cell viability.
- BMDMs were reseeded on 24-well plates in conditioned medium 24 hours prior to transfection, allowing transformation of the cells into their phenotypes. M2-like macrophages were then exposed to either IRFS/IKKb NPs carrying 25% eGFP mRNA as a reporter, or eGFP NPs (control) containing 2 pg mRNA, following the transfection protocol described above.
- RNA isolation and preparation To harvest RNAs, BMDMs were lysed in Trizol reagent (Ambion), and total RNAs were extracted and purified using RNeasy® Plus Universal Mini-Kits (QIAGEN) following the manufacturer’s instructions.
- RNA was quantified using a NanoDrop Microvolume Spectrophotometer (Thermo Fisher) and then subjected to quality control performed by the FHCRC Genomics Shared Resource with an Agilent 4200 TapeStation analyzer (Agilent).
- Cytokine analysis Cytokine levels were evaluated using a Luminex 200 system (Luminex) at the FHCRC Immune Monitoring Shared Resource center.
- Luminex Luminex 200 system
- cell culture supernatant was collected for the measurement of IL-6, I L- 12 p70 , INFy, and TNFa concentrations.
- plasma concentration of GM-CSF, INFy, I L-12p70, IL-2, IL-6, and TNFa were measured.
- qRT-PCR analysis Gene expression levels were determined by qRT-PCR. To measure selected macrophage signature genes (SerpinB2, Retnla, Ccl5, Cell 1 , codon-optimized IRF5, endogenous IRF5, and housekeeping GAPD genes), total RNA was isolated with RNeasy mini columns (Qiagen) according to the manufacturer’s instructions. cDNA was synthesized using a qScript cDNA Synthesis Kit (Quanta).
- qRT-PCR was performed in triplicate via PerfeCTa qPCR SuperMix Low ROX (Quanta) using gene-specific probes from the Roche’s Universal Probe Library (UPL) and PCR primers optimized by ProbeFinder (Roche): SerpinB2, UPL -049, F-ACTGGGGCAGTTATGACAGG (SEQ ID NO: 96), R-G AT GATCGGCC ACAAACT G (SEQ ID NO: 97); Retnla, UPL-078, F-TT GTTCCCTT CT CAT CT GC AT (SEQ ID NO: 98), R- CCTT G ACCTT ATT CTCCACGA (SEQ ID NO: 99); Ccl5, UPL-105, F- CCTACTCCCACTCGGTCCT (SEQ ID NO: 100), R-CT G ATTT CTTG G GTTT G CTGT (SEQ ID NO: 101); Cell 1, UPL-018, F-AGAGCTCCACAGCGCTTC (SEQ ID NO: 102), R- CAGCACC
- mice and in vivo tumor models were obtained from Jackson Laboratory; the others were bred and housed in the FHCRC animal facility. All of the mice were used in the context of a protocol approved by the center’s Institutional Animal Care and Use Committee.
- VEGFP vascular epithelial growth factor
- ID8 cells were injected intraperitoneally (i.p.) into 4- to 6-week-old female albino B6 (C57BL/6J-Tyr ⁇ c-2J>) mice and allowed to establish for 2 weeks. For survival studies, the animals were treated i.p.
- IRF5 NPs/eGFP NPs carrying 50 pg mRNA (two doses per week for 9 weeks, or until health conditions reached euthanizing requirements).
- Peritoneal lavage was performed to collect the peritoneal cells.
- mice received treatment with IRF5/IK ⁇ NPs carrying 50 pg mRNA for 3 weeks with 2 doses per week; the second received oral gavage of 15 mg/kg RI3Kg inhibitor IPI-594 (MedKoo Biosciences Inc) formulated in vehicle (5% 1-methyl- 2-pyrrolidinone in polyethylene glycol 400) daily for 3 weeks; the third group received i.p. injection of 30 g/kg CSF1 R inhibitor Pexidartinib (PLX3397, MedKoo Biosciences Inc) formulated in the same vehicle daily for 3 weeks.
- RI3Kg inhibitor IPI-594 MedKoo Biosciences Inc
- vehicle 5% 1-methyl- 2-pyrrolidinone in polyethylene glycol 400
- mice To model metastatic lung cancer, 2.5x104 16F10 cells transduced with F-luc and suspended in 200 pl_ RPMI medium were injected into 4- to 6-week-old female albino B6 (C57BL/6J-Tyr ⁇ c- 2J>) mice (Jackson Laboratories) and allowed to establish for 1 week. For survival studies, mice were treated retro-orbital ly with (or without) IRFS/IKKb or eGFP NPs carrying 30 pg mRNA suspended in PBS. Mice were treated with 3 doses/wk for 3 weeks or until health conditions reached euthanizing requirements. For mechanism studies, the mice received the same treatments for 2 weeks. Bronchoalveolar lavage was performed to collect alveolar cells for analysis.
- mice bearing glioma were generated following published protocols (Uhrbom L et al. (2004) Nat Med 10: 1257-1260).
- Avian DF-1 cells producing RCAS -R ⁇ QRb and RCAS-cre retroviruses were injected intracranially into both brain hemispheres (coordinates: 1 mm caudal from bregma, 2 mm lateral, depth of 2 mm from the dural surface) of Nestin-tv-a//n/c4a-a/f-/-; Pten-/- mice (C57BL/6) between 4-6 weeks of age. Tumors were allowed to establish for 2 weeks.
- mice received 10Gy radiation to one hemisphere, while the unirradiated hemisphere was shielded with lead.
- mice received retro-orbital injections of IRFS/IKKb NPs carrying 30 pg mRNA (3 doses/wk for 3 weeks) or were assigned to the PBS control group.
- mice in 7-8 groups received an i.p. or retro-orbital dose of NPs carrying 50 pg mRNA. Twenty-four hours after injection, whole blood was collected, and mice were euthanized with C02 to retrieve organs (liver, spleen, lung, kidney, heart, intestine, pancreases, and diaphragm). All tissues were stabilized with RNAIater, then frozen on dry ice. The codon- optimized IRF5 mRNA levels in each organ were measured using RT-qPCR.
- mice To measure potential in vivo toxicities of repeatedly infusing macrophage-targeting NPs, we injected mice (5/group) intravenously with 6 sequential doses of IRF5/IKI ⁇ or eGFP NPs carrying 50 pg mRNA over the course of 3 weeks. Controls received no treatment. Twenty-four hours after the final infusion, mice were anesthetized and blood was collected by retro-orbital bleed to determine the complete blood counts. Blood was also collected for serum chemistry and cytokine profile analyses (performed by Phoenix Central Laboratories, Mukilteo, WA).
- Cytokine assays Cytokine levels were evaluated using a Luminex 200 system (Luminex) at the FHCRC Immune Monitoring Shared Resources. For ex vivo studies, cell culture supernatant was collected for the measurement of I L-6, IL12p70, INFy, and TNFa concentrations. For in vivo studies, we measured plasma concentrations of GM-CSF, INFy, I L-12p70, IL-2, I L-6, and TNFa.
- Di-mannose moieties were engineered onto their surfaces using polyglutamic acid (PGA) as a linker (FIG. 2A).
- PGA polyglutamic acid
- the NPs were manufactured utilizing a simple two-step, charge driven self-assembly process. First, the synthetic mRNA was complexed with a positively charged PBAE polymer, which condenses the mRNA into nano-sized complexes. This step was followed by the addition of PGA functionalized with Di-mannose, which shields the positive charge of the PBAE-mRNA nanoparticles and confers macrophage-targeting.
- the resulting mRNA nanocarriers had a size of 99.8 ⁇ 24.5 nm, a polydispersity of 0.183, and a neutral surface charge (3.40 ⁇ 2.15 mV z-potential, FIG. 2B-2C).
- the transfection efficiency was first tested in murine bone marrow-derived macrophages (BMDMs) using NPs formulated with green fluorescent protein-encoding mRNA (GFP-NPs). Briefly, 50,000 BMDMs were exposed to NPs containing 1 pg mRNA for 1 hour, followed by flow cytometry measurements of GFP expression the next day.
- BMDMs murine bone marrow-derived macrophages
- GFP-NPs green fluorescent protein-encoding mRNA
- the first encodes IRF5 a key member of the IRF family that favors the polarization of macrophages toward the M1 phenotype
- the second encodes IKKb a kinase that phosphorylates and activates IRF5.
- BMDMs were first cultured in the presence of interleukin-4 (IL-4) to induce a suppressive M2 phenotype (FIG. 2H).
- IL-4 interleukin-4
- gene expression profiles were analyzed and compared with inflammatory macrophages, which were generated separately by exposing BMDMs to the TLR4 agonist Monophosphoryl Lipid A.
- macrophages transfected with IRF5/IKI ⁇ mRNA NPs display gene expression profiles similar to inflammatory macrophages (FIG. 21).
- Signature M2 macrophage genes such as Serpinb2 and Ccl2 (Jablonski K et al. (2015) Plos One 10: e0145342; Varga T et al. (2016) J Immunol 196: 4771-4782), were strongly downregulated while key M1 differentiation genes, such as Ccl5 (Sica A etal. (2012) J Clin Invest 122: 787-795), were upregulated (FIG. 2J, 2K).
- Example 2 Therapeutic effects of NP-delivered pro-M1 genes for disseminated ovarian cancer.
- a model that recapitulates late-stage, unresectable ovarian tumors in C57BL/6 mice was used; these animals are injected with ID8 ovarian cancer cells which were tagged with luciferase to enable serial bioluminescent imaging of tumor growth (Liao JB etal. (2015) J Immunother Cancer 3: 16; Stephan SB et al. (2015) Nat Biotechnol 33: 97-101).
- the tumors were allowed to establish for two weeks. By this stage, the mice have developed nodules throughout the peritoneal wall and in the intestinal mesentery.
- the animals were divided into 3 groups that received PBS (control), GFPNPs (sham), or IRF5/IKI ⁇ NP treatment at an i.p. dose of 100 pg mRNA/mouse/week for 9 weeks (FIG. 4A). It was observed that in the IRF5/IKI ⁇ NP treated group, the disease regressed and was eventually cleared in 40% of animals (overall 142 d median survival versus 60 d in controls; FIG. 4B-4C). To understand the underlying mechanisms of IRF5/ IKKb NP-mediated anti-tumor effects, how exclusively mannose receptor-targeting confined NP interaction to phagocytes was first examined.
- Flow cytometry of peritoneal lavage fluid collected 24 h after the first dose of NPs targeted with Di-mannose revealed preferential gene transfer into macrophages and monocytes (average 37.1% and 15.3%, respectively, FIG. 4D), while transfection into off- target cells was low or undetectable.
- IRF5/IKI ⁇ NPs reduced the population of immune-suppressive macrophages (Ly6C-, F4/80+, CD206+) to an average 2.6% ⁇ 2.1% versus 43% ⁇ 15.6% in controls (FIG. 4E-4F).
- the fraction of M 1 -like macrophages increased from 0.5% ⁇ 0.2% to 10.2% ⁇ 4.1% (FIG. 4E, 4G).
- IRF5 gene therapy also affected the population of other immune cells. In particular, inflammatory monocytes (CD11b+, Ly6C+, Ly6G-) were more abundant (73.4% ⁇ 3.6% compared to 4.5% ⁇ 1.9% in untreated mice).
- Peritoneal macrophages were isolated by fluorescence-activated cell sorting to analyze their cytokine secretion, and detected a robust increase in the release of pro-inflammatory (anti tumor) cytokines IL-12 (3.4-fold higher), IFN-g (8.4-fold higher), and TNF-a (1.5-fold higher), whereas the levels of IL-6, a regulatory cytokine associated with differentiation toward alternatively activated (M2-like) macrophages, were reduced by 97-fold; FIG. 4I). Genome expression profiling confirmed differentiation toward an M 1 - 1 i ke macrophage phenotype in IRF5/IKI ⁇ nanoparticle-treated mice. Gene expression levels of macrophages cultured ex vivo in MPLA or IL-4 were included to provide reference values for classic M 1 -like or M2-like macrophages, respectively (FIG. 4J).
- mice were injected with a total of 8 doses of IRF5/IKI ⁇ NPs (two 50 pg mRNA doses/week for 4 weeks, FIG. 5B). They were euthanized 24 h after the final dose, body weight was recorded, blood was collected by retroorbital bleed for serum chemistry, and a complete gross necropsy was performed. There was no difference in body weights between groups.
- the following tissues were evaluated by a board- certified staff pathologist: liver, spleen, mesentery, pancreas, stomach, kidney, heart, and lungs.
- IRF5/IKI ⁇ NPs injection of IRF5/IKI ⁇ NPs, moderate and transient increase was measured in serum levels of interleukin-6 (IL-6) to an average of 26.8 pg/mL (FIG. 5E), and tumor necrosis factor-a (TNF-a) to an average 94.7 pg/mL (FIG. 5F). Based on previous reports, these levels are 500-fold lower than those associated with pathological findings and thus can be considered safe Tarrant J.M. (2010) Toxicol Sci 117: 4-16; Copeland S et al. (2005) Clin Diagn Lab Immunol 12: 60-67).
- IL-6 interleukin-6
- TNF-a tumor necrosis factor-a
- nanoparticles containing IRF5/ IKKb mRNA were administered into mice with disseminated pulmonary melanoma metastases (FIG. 6B).
- FIG. 6B Recent work describes the foundational role of monocytes and macrophages in establishing metastases caused by this disease (Butler KL et al. (2017) Sci Rep 7: 45593; Nielsen SR et al. (2017) Mediators Inflamm 2017: 9624760), and it was confirmed by confocal microscopy that tumor engraftment was coordinate with phagocyte accumulation in the lungs (FIG.6C).
- mice with detectable cancers were sorted into groups that had matching levels. Groups were then randomly assigned to treatment conditions, receiving no therapy (PBS), or intravenous injections of GFP- or IRF5/ IKKb-encapsulating nanoparticles. Only IRF/IKKb nanoparticle therapy substantially reduced tumor burdens in the lungs; in fact, they improved overall survival by a mean 1.3-fold (FIG. 6D-6E).
- the total number of metastases in the lungs of IRF5/IKK NP-treated animals was 8.7-fold reduced (average 40 ⁇ 16 metastases) compared to PBS controls (average 419 ⁇ 139 metastases; FIG. 6F-6G).
- Flow cytometry of bronchoalveolar lavage fluid cells revealed a strong shift from immune-suppressive (CD206+, MHCII-, CD11c+, CDUblow) macrophages toward activated (CD206-, MHCII+, CD11c-, CD11b+) phagocytes (FIG. 6H-6I).
- the RCAS- PDGF-B/Nestin-Tv-a; Ink4a/Arf-/-; Pten-/- transgenic mouse model of R ⁇ QRb ⁇ nbh glioma (PDG mice (Hambardzumyan D etal. (2009) Transl Oncol 2: 89-95; Quail DF etal. (2016) Science 352: aad3018)) was used. Brain tissue was stereotactically injected with a mixture of DF-1 cells transfected with either ROAb-R ⁇ OBb or RCAS-cre retrovirus (1 :1 mixture, 2 pl_).
- FIG. 7C Flow cytometry revealed that the F4/80+, CD11 b+ macrophage population accounted for 32.8% of total cells in the tumor, which is 9-fold higher than seen in age-matched healthy control mice (3.7%) (FIG. 7C).
- the PDG mice in the experiments express the firefly luciferase gene linked to a key cancer gene promoter. Bioluminescence from this reporter has been demonstrated to be positively correlated with tumor grade (Uhrbom L et al. (2004) Nat Med 10: 1257-1260), so it was used to monitor tumor development every four days after the onset of treatment.
- IRF/IKKb NPs as a monotherapy was first tested: PDG mice received intravenous infusions of 9 doses of NPs loaded with IRF5/IKi ⁇ mRNA, or PBS in the control group (3 doses/week for 3 weeks). IRF/IKKb NP treatments only modestly suppressed tumor progression (producing on average only a 5-day survival advantage compared to untreated controls; FIG. 7D). However, combining radiotherapy as the standard-of-care with IRF5/IKi ⁇ NP injections substantially reduced tumor growth and more than doubled the survival of treated mice compared to the PBS control group (52 d versus 25 days, respectively; FIG.7E-7F).
- NPs delivering IVT mRNA encoding human IRF5 and IKKb were fabricated.
- the human monocytic cell line THP-1 was used as a well- established M1 and M2 macrophage polarization model to test these nanocarriers (Li C et at. (2016) Sci Rep 6: 21044; Surdziel E etal. (2017) Plos One 12: e0183679).
- M2-type macrophages were generated by treating THP-1 cells with PMA and polarizing them with IL-4 and IL-13 (FIG. 8A).
- THP1-LuciaTM ISG cells were transfected with nanoparticles loaded with hulRF5/IKI ⁇ or GFP control mRNAs.
- THP1-LuciaTM ISG cells secrete the fluorescent Lucia reporter under the control of an IRF- inducible promoter.
- This composite promoter includes five IFN-stimulated response elements (ISRE) fused to an ISG54 minimal promoter, which is unresponsive to activators of the NF-KB or AP-1 pathways.
- ISRE IFN-stimulated response elements
- hulRF5 NPs strongly upregulated luciferase expression in M2-polarized THP-1 cells, indicating that the mRNA constructs are functional in human cells (FIG. 8B-8C).
- IRF5 pathway activation can reprogram M2-polarized THP-1 cells toward an M 1 -like phenotype.
- secretion of the pro- inflammatory cytokine I L-1 b following NP transfection was measured.
- Production of IL-1 b was significantly increased in THP-1 cells transfected with hulRF5 NPs versus untransfected controls (mean 21-fold; P ⁇ 0.0001, FIG. 8D), which correlated with a robust upregulation (10.9-fold increased MFI, P ⁇ 0.0001) of the M1 macrophage cell surface marker CD80 (FIG. 8E).
- Example 3 Nanoparticles delivering IRF5/IKKb and EpCAM-CD3 bi-specific antibody mRNA will be administered in a preclinical mouse model of disseminated stage 4 ovarian cancer and a 4T1 breast cancer lung metastasis model. Underlying mechanisms (changes in the composition of the tumor microenvironment) and bi-specific antibody serum levels (versus concentrations of bi-specific antibody directly at the tumor site) will be assessed. A side-by-side comparison of in situ-generated versus intravenously administered bi-specific antibody proteins will also be performed.
- amino acid changes in the protein variants disclosed herein are conservative amino acid changes, i.e. , substitutions of similarly charged or uncharged amino acids.
- a conservative amino acid change involves substitution of one of a family of amino acids which are related in their side chains.
- Naturally occurring amino acids are generally divided into conservative substitution families as follows: Group 1: Alanine (Ala), Glycine (Gly), Serine (Ser), and Threonine (Thr); Group 2: (acidic): Aspartic acid (Asp), and Glutamic acid (Glu); Group 3: (acidic; also classified as polar, negatively charged residues and their amides): Asparagine (Asn), Glutamine (Gin), Asp, and Glu; Group 4: Gin and Asn; Group 5: (basic; also classified as polar, positively charged residues): Arginine (Arg), Lysine (Lys), and Histidine (His); Group 6 (large aliphatic, nonpolar residues): Isoleucine (lie), Leucine (Leu), Methionine (Met), Valine (Val) and Cysteine (Cys); Group 7 (uncharged polar): Tyrosine (Tyr), Gly, Asn, Gin, Cys, Ser, and Thr; Group 8
- the hydropathic index of amino acids may be considered.
- the importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte and Doolittle, 1982, J. Mol. Biol. 157(1), 105-32). Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics (Kyte and Doolittle, 1982).
- amino acid substitutions may be based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
- variants of gene sequences can include codon optimized variants, sequence polymorphisms, splice variants, and/or mutations that do not affect the function of an encoded product to a statistically-significant degree.
- Variants of the protein, nucleotide, and gene sequences disclosed herein also include sequences with at least 70% sequence identity, 80% sequence identity, 85% sequence, 90% sequence identity, 95% sequence identity, 96% sequence identity, 97% sequence identity, 98% sequence identity, or 99% sequence identity to the protein, nucleotide, or gene sequences disclosed herein.
- % sequence identity refers to a relationship between two or more sequences, as determined by comparing the sequences.
- identity also means the degree of sequence relatedness between protein, nucleotide, or gene sequences as determined by the match between strings of such sequences.
- Identity (often referred to as “similarity") can be readily calculated by known methods, including those described in: Computational Molecular Biology (Lesk, A. M., ed.) Oxford University Press, NY (1988); Biocomputing: Informatics and Genome Projects (Smith, D. W., ed.) Academic Press, NY (1994); Computer Analysis of Sequence Data, Part I (Griffin, A. M., and Griffin, H.
- Variants also include nucleotide molecules that hybridizes under stringent hybridization conditions to a sequence disclosed herein and provide the same function as the reference sequence.
- Exemplary stringent hybridization conditions include an overnight incubation at 42 °C in a solution including 50% formamide, 5XSSC (750 mM NaCI, 75 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5XDenhardt's solution, 10% dextran sulfate, and 20 pg/ml denatured, sheared salmon sperm DNA, followed by washing the filters in 0.1XSSC at 50 °C.
- 5XSSC 750 mM NaCI, 75 mM trisodium citrate
- 50 mM sodium phosphate pH 7.6
- 5XDenhardt's solution 10% dextran sulfate
- 20 pg/ml denatured, sheared salmon sperm DNA followed by washing the filters in 0.1XSSC at 50 °
- Changes in the stringency of hybridization and signal detection are primarily accomplished through the manipulation of formamide concentration (lower percentages of formamide result in lowered stringency); salt conditions, or temperature.
- washes performed following stringent hybridization can be done at higher salt concentrations (e.g. 5XSSC).
- Variations in the above conditions may be accomplished through the inclusion and/or substitution of alternate blocking reagents used to suppress background in hybridization experiments.
- Typical blocking reagents include Denhardt's reagent, BLOTTO, heparin, denatured salmon sperm DNA, and commercially available proprietary formulations.
- the inclusion of specific blocking reagents may require modification of the hybridization conditions described above, due to problems with compatibility.
- binds refers to an association of a binding domain (of, for example, a CAR binding domain or a nanoparticle selected cell targeting ligand) to its cognate binding molecule with an affinity or Ka (i.e. , an equilibrium association constant of a particular binding interaction with units of 1/M) equal to or greater than 10 5 M 1 , while not significantly associating with any other molecules or components in a relevant environment sample.
- affinity or Ka i.e. , an equilibrium association constant of a particular binding interaction with units of 1/M
- high affinity binding domains refer to those binding domains with a Ka of at least 107 M-1, at least 108 M-1, at least 109 M-1, at least 1010 M-1 , at least 1011 M-1, at least 1012 M-1 , or at least 1013 M-1.
- low affinity binding domains refer to those binding domains with a Ka of up to 107 M-1, up to 106 M-1 , up to 105 M-1.
- affinity may be defined as an equilibrium dissociation constant (Kd) of a particular binding interaction with units of M (e.g., 10-5 M to 10-13 M).
- a binding domain may have "enhanced affinity," which refers to a selected or engineered binding domains with stronger binding to a cognate binding molecule than a wild type (or parent) binding domain.
- enhanced affinity may be due to a Ka (equilibrium association constant) for the cognate binding molecule that is higher than the reference binding domain or due to a Kd (dissociation constant) for the cognate binding molecule that is less than that of the reference binding domain, or due to an off-rate (Koff) for the cognate binding molecule that is less than that of the reference binding domain.
- assays are known for detecting binding domains that specifically bind a particular cognate binding molecule as well as determining binding affinities, such as Western blot, ELISA, and BIACORE® analysis (see also, e.g., Scatchard, et al., 1949, Ann. N.Y. Acad. Sci. 51:660; and US 5,283,173, US 5,468,614, or the equivalent).
- each embodiment disclosed herein can comprise, consist essentially of or consist of its particular stated element, step, ingredient or component.
- the terms “include” or “including” should be interpreted to recite: “comprise, consist of, or consist essentially of.”
- the transition term “comprise” or “comprises” means has, but is not limited to, and allows for the inclusion of unspecified elements, steps, ingredients, or components, even in major amounts.
- the transitional phrase “consisting of” excludes any element, step, ingredient or component not specified.
- the transition phrase “consisting essentially of” limits the scope of the embodiment to the specified elements, steps, ingredients or components and to those that do not materially affect the embodiment. A material effect would cause a statistically significant reduction in the ability to obtain a claimed effect according to a relevant experimental method described in the current disclosure.
- the term “about” has the meaning reasonably ascribed to it by a person skilled in the art when used in conjunction with a stated numerical value or range, i.e. denoting somewhat more or somewhat less than the stated value or range, to within a range of ⁇ 20% of the stated value; ⁇ 19% of the stated value; ⁇ 18% of the stated value; ⁇ 17% of the stated value; ⁇ 16% of the stated value; ⁇ 15% of the stated value; ⁇ 14% of the stated value; ⁇ 13% of the stated value; ⁇ 12% of the stated value; ⁇ 11% of the stated value; ⁇ 10% of the stated value; ⁇ 9% of the stated value; ⁇ 8% of the stated value; ⁇ 7% of the stated value; ⁇ 6% of the stated value; ⁇ 5% of the stated value; ⁇ 4% of the stated value; ⁇ 3% of the stated value; ⁇ 2% of the stated value; or ⁇ 1% of the stated value.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Genetics & Genomics (AREA)
- Pharmacology & Pharmacy (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Nanotechnology (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Dermatology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| MX2022008183A MX2022008183A (es) | 2019-12-31 | 2020-12-31 | Sistemas de nanoparticulas para estimular y mantener la capacidad de respuesta del sistema inmunitario en sitios de tratamiento. |
| US17/758,296 US20230331804A1 (en) | 2019-12-31 | 2020-12-31 | Nanoparticle systems to stimulate and maintain immune system responsiveness at treatment sites |
| KR1020227026301A KR20220130712A (ko) | 2019-12-31 | 2020-12-31 | 치료 부위에서 면역계 반응을 자극하고 유지하기 위한 나노입자 시스템 |
| JP2022565737A JP2023508616A (ja) | 2019-12-31 | 2020-12-31 | 治療部位での免疫系応答性を刺激し維持するためのナノ粒子システム |
| CA3162629A CA3162629A1 (en) | 2019-12-31 | 2020-12-31 | Nanoparticle systems to stimulate and maintain immune system responsiveness at treatment sites |
| BR112022013068A BR112022013068A2 (pt) | 2019-12-31 | 2020-12-31 | Sistemas de nanopartícula para estimular e manter a capacidade de resposta do sistema imune nos sítios de tratamento |
| AU2020417305A AU2020417305A1 (en) | 2019-12-31 | 2020-12-31 | Nanoparticle systems to stimulate and maintain immune system responsiveness at treatment sites |
| EP20911288.7A EP4085137A4 (en) | 2019-12-31 | 2020-12-31 | Nanoparticle systems to stimulate and maintain immune system responsiveness at treatment sites |
| IL294441A IL294441A (en) | 2019-12-31 | 2020-12-31 | Nanoparticle systems to stimulate and maintain immune system responsiveness at treatment sites |
| CN202080091519.9A CN115135764A (zh) | 2019-12-31 | 2020-12-31 | 用于刺激和维持治疗部位处的免疫系统应答性的纳米颗粒系统 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962956033P | 2019-12-31 | 2019-12-31 | |
| US62/956,033 | 2019-12-31 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021138600A1 true WO2021138600A1 (en) | 2021-07-08 |
Family
ID=76685916
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/067729 Ceased WO2021138600A1 (en) | 2019-12-31 | 2020-12-31 | Nanoparticle systems to stimulate and maintain immune system responsiveness at treatment sites |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US20230331804A1 (https=) |
| EP (1) | EP4085137A4 (https=) |
| JP (1) | JP2023508616A (https=) |
| KR (1) | KR20220130712A (https=) |
| CN (1) | CN115135764A (https=) |
| AU (1) | AU2020417305A1 (https=) |
| BR (1) | BR112022013068A2 (https=) |
| CA (1) | CA3162629A1 (https=) |
| IL (1) | IL294441A (https=) |
| MX (1) | MX2022008183A (https=) |
| WO (1) | WO2021138600A1 (https=) |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11434291B2 (en) | 2019-05-14 | 2022-09-06 | Provention Bio, Inc. | Methods and compositions for preventing type 1 diabetes |
| WO2023081644A1 (en) * | 2021-11-02 | 2023-05-11 | Engage Biologics Inc. | Materials and methods for treatment with mrna encoding multispecific binding molecules |
| CN116874600A (zh) * | 2023-07-13 | 2023-10-13 | 浙江大学 | 来自纳米抗体可靶向cd163受体的短肽的制备方法及其应用 |
| US11865190B2 (en) | 2018-10-09 | 2024-01-09 | The University Of British Columbia | Compositions and systems comprising transfection-competent vesicles free of organic-solvents and detergents and methods related thereto |
| WO2024026029A3 (en) * | 2022-07-27 | 2024-04-04 | Trustees Of Tufts College | Lipid nanoparticles for immunotherapy |
| US12006366B2 (en) | 2020-06-11 | 2024-06-11 | Provention Bio, Inc. | Methods and compositions for preventing type 1 diabetes |
| WO2025026553A1 (en) * | 2023-08-02 | 2025-02-06 | BioNTech SE | Agents and methods for targeted delivery to cells |
| JP2025531169A (ja) * | 2022-09-16 | 2025-09-19 | 四川大学華西医院 | NKG2D-NKp46細胞アダプター分子及びその用途 |
| US12565529B2 (en) | 2021-05-24 | 2026-03-03 | Provention Bio, Inc. | Methods for treating type 1 diabetes |
| US12576131B2 (en) | 2018-01-18 | 2026-03-17 | Fred Hutchinson Cancer Center | Altering inflammatory states of immune cells in vivo by modulating cellular activation states |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025128615A1 (en) * | 2023-12-12 | 2025-06-19 | Seagen Inc. | Multispecific egfr antibodies and use in the treatment of cancer |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20170151339A1 (en) * | 2014-06-30 | 2017-06-01 | Tarveda Therapeutics, Inc. | Targeted conjugates and particles and formulations thereof |
| US20180258411A1 (en) * | 2015-09-25 | 2018-09-13 | Tarveda Therapeutics, Inc. | Compositions and methods for genome editing |
| WO2019143948A1 (en) * | 2018-01-18 | 2019-07-25 | Fred Hutchinson Cancer Research Center | Altering inflammatory states of immune cells in vivo by modulating cellular activation states |
| WO2019197600A1 (en) * | 2018-04-13 | 2019-10-17 | F. Hoffmann-La Roche Ag | Her2-targeting antigen binding molecules comprising 4-1bbl |
| WO2019213308A1 (en) * | 2018-05-01 | 2019-11-07 | Fred Hutchinson Cancer Research Center | Nanoparticles for gene expression and uses thereof |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2294579C (en) * | 1997-06-23 | 2007-10-09 | Sequus Pharmaceuticals, Inc. | Liposome-entrapped polynucleotide composition and method |
| WO1999064074A1 (en) * | 1998-06-11 | 1999-12-16 | The Trustees Of The University Of Pennsylvania | Methods and compositions for delivering proteins to macrophage cells and cells of macrophage derived lineage |
| CN119564879A (zh) * | 2015-08-18 | 2025-03-07 | 乐天医药生技股份有限公司 | 用于光免疫疗法的组合物、联用及相关方法 |
| AU2016308286B2 (en) * | 2015-08-18 | 2022-04-07 | Rakuten Medical, Inc. | Phthalocyanine dye conjugates and their storage |
| AU2017313806B2 (en) * | 2016-08-17 | 2023-07-20 | Orbis Health Solutions Llc | Tumor-targeting bead vectors and methods of using the same |
-
2020
- 2020-12-31 CN CN202080091519.9A patent/CN115135764A/zh active Pending
- 2020-12-31 KR KR1020227026301A patent/KR20220130712A/ko active Pending
- 2020-12-31 BR BR112022013068A patent/BR112022013068A2/pt unknown
- 2020-12-31 CA CA3162629A patent/CA3162629A1/en active Pending
- 2020-12-31 WO PCT/US2020/067729 patent/WO2021138600A1/en not_active Ceased
- 2020-12-31 JP JP2022565737A patent/JP2023508616A/ja active Pending
- 2020-12-31 IL IL294441A patent/IL294441A/en unknown
- 2020-12-31 MX MX2022008183A patent/MX2022008183A/es unknown
- 2020-12-31 AU AU2020417305A patent/AU2020417305A1/en active Pending
- 2020-12-31 EP EP20911288.7A patent/EP4085137A4/en active Pending
- 2020-12-31 US US17/758,296 patent/US20230331804A1/en active Pending
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20170151339A1 (en) * | 2014-06-30 | 2017-06-01 | Tarveda Therapeutics, Inc. | Targeted conjugates and particles and formulations thereof |
| US20180258411A1 (en) * | 2015-09-25 | 2018-09-13 | Tarveda Therapeutics, Inc. | Compositions and methods for genome editing |
| WO2019143948A1 (en) * | 2018-01-18 | 2019-07-25 | Fred Hutchinson Cancer Research Center | Altering inflammatory states of immune cells in vivo by modulating cellular activation states |
| WO2019197600A1 (en) * | 2018-04-13 | 2019-10-17 | F. Hoffmann-La Roche Ag | Her2-targeting antigen binding molecules comprising 4-1bbl |
| WO2019213308A1 (en) * | 2018-05-01 | 2019-11-07 | Fred Hutchinson Cancer Research Center | Nanoparticles for gene expression and uses thereof |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4085137A4 * |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12576131B2 (en) | 2018-01-18 | 2026-03-17 | Fred Hutchinson Cancer Center | Altering inflammatory states of immune cells in vivo by modulating cellular activation states |
| US11865190B2 (en) | 2018-10-09 | 2024-01-09 | The University Of British Columbia | Compositions and systems comprising transfection-competent vesicles free of organic-solvents and detergents and methods related thereto |
| US11980673B2 (en) | 2018-10-09 | 2024-05-14 | The University Of British Columbia | Compositions and systems comprising transfection-competent vesicles free of organic-solvents and detergents and methods related thereto |
| US11434291B2 (en) | 2019-05-14 | 2022-09-06 | Provention Bio, Inc. | Methods and compositions for preventing type 1 diabetes |
| US12006366B2 (en) | 2020-06-11 | 2024-06-11 | Provention Bio, Inc. | Methods and compositions for preventing type 1 diabetes |
| US12565529B2 (en) | 2021-05-24 | 2026-03-03 | Provention Bio, Inc. | Methods for treating type 1 diabetes |
| WO2023081644A1 (en) * | 2021-11-02 | 2023-05-11 | Engage Biologics Inc. | Materials and methods for treatment with mrna encoding multispecific binding molecules |
| WO2024026029A3 (en) * | 2022-07-27 | 2024-04-04 | Trustees Of Tufts College | Lipid nanoparticles for immunotherapy |
| JP2025531169A (ja) * | 2022-09-16 | 2025-09-19 | 四川大学華西医院 | NKG2D-NKp46細胞アダプター分子及びその用途 |
| CN116874600A (zh) * | 2023-07-13 | 2023-10-13 | 浙江大学 | 来自纳米抗体可靶向cd163受体的短肽的制备方法及其应用 |
| WO2025026553A1 (en) * | 2023-08-02 | 2025-02-06 | BioNTech SE | Agents and methods for targeted delivery to cells |
| WO2025027145A1 (en) * | 2023-08-02 | 2025-02-06 | BioNTech SE | Agents and methods for targeted delivery to cells |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2023508616A (ja) | 2023-03-02 |
| IL294441A (en) | 2022-09-01 |
| MX2022008183A (es) | 2022-09-29 |
| EP4085137A4 (en) | 2024-06-12 |
| CN115135764A (zh) | 2022-09-30 |
| AU2020417305A1 (en) | 2022-07-21 |
| US20230331804A1 (en) | 2023-10-19 |
| EP4085137A1 (en) | 2022-11-09 |
| KR20220130712A (ko) | 2022-09-27 |
| CA3162629A1 (en) | 2021-07-08 |
| BR112022013068A2 (pt) | 2022-09-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230331804A1 (en) | Nanoparticle systems to stimulate and maintain immune system responsiveness at treatment sites | |
| KR102806143B1 (ko) | 유전자 발현을 위한 나노입자 및 이의 용도 | |
| AU2020394441B2 (en) | CD19 and CD22 chimeric antigen receptors and uses thereof | |
| AU2019284911B2 (en) | BCMA chimeric antigen receptors and uses thereof | |
| US12576131B2 (en) | Altering inflammatory states of immune cells in vivo by modulating cellular activation states | |
| CN105392888A (zh) | 使用人源化抗cd19嵌合抗原受体治疗癌症 | |
| RU2847583C1 (ru) | Системы наночастиц для стимуляции и поддержания реактивности иммунной системы в зонах лечения | |
| TW202307210A (zh) | Cd19和cd22嵌合抗原受體及其用途 | |
| WO2025096673A1 (en) | Compositions comprising cells targeting cancer and methods of using the same |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20911288 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3162629 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022565737 Country of ref document: JP Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022013068 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202217041175 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 2020417305 Country of ref document: AU Date of ref document: 20201231 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020911288 Country of ref document: EP Effective date: 20220801 |
|
| ENP | Entry into the national phase |
Ref document number: 112022013068 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220629 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 2022120799 Country of ref document: RU |
|
| WWD | Wipo information: divisional of initial pct application |
Ref document number: 828445 Country of ref document: NZ |