WO2021058830A1 - Vector - Google Patents
Vector Download PDFInfo
- Publication number
- WO2021058830A1 WO2021058830A1 PCT/EP2020/077144 EP2020077144W WO2021058830A1 WO 2021058830 A1 WO2021058830 A1 WO 2021058830A1 EP 2020077144 W EP2020077144 W EP 2020077144W WO 2021058830 A1 WO2021058830 A1 WO 2021058830A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- sequence
- pgrn
- aav
- seq
- aav vector
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
- A01K67/0275—Genetically modified vertebrates, e.g. transgenic
- A01K67/0276—Knock-out vertebrates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0008—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
- A61K48/0058—Nucleic acids adapted for tissue specific expression, e.g. having tissue specific promoters as part of a contruct
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0075—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the delivery route, e.g. oral, subcutaneous
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
- A61P25/16—Anti-Parkinson drugs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/07—Animals genetically altered by homologous recombination
- A01K2217/075—Animals genetically altered by homologous recombination inducing loss of function, i.e. knock out
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2227/00—Animals characterised by species
- A01K2227/10—Mammal
- A01K2227/105—Murine
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/03—Animal model, e.g. for test or diseases
- A01K2267/0306—Animal model for genetic diseases
- A01K2267/0318—Animal model for neurodegenerative disease, e.g. non- Alzheimer's
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/22—Vectors comprising a coding region that has been codon optimised for expression in a respective host
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/008—Vector systems having a special element relevant for transcription cell type or tissue specific enhancer/promoter combination
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/42—Vector systems having a special element relevant for transcription being an intron or intervening sequence for splicing and/or stability of RNA
Definitions
- the present invention relates to the field of recombinant viral vectors.
- the invention relates to recombinant viral vectors which are suitable for the delivery of therapeutic genes in vivo.
- Frontotemporal dementia is the second most common form of dementia in people who present with symptoms ⁇ 65 years of age. It is characterised by changes in behaviour, personality and language and is very distressing to the patient, their family and friends. Approximately 30% of patients with FTD have a family history of dementia and, of these -20% carry loss of function (LoF) mutations in GRN gene encoding the protein progranulin. Children homozygous for GRN mutations develop the lysosomal storage disorder neuronal ceroid lipofuscinosis (NCL11) characterized by neurodegeneration and blindness (Rohrer JD et al ., (2015b) Lancet Neurol. 14:253-262).
- NCL11 neuronal ceroid lipofuscinosis
- Progranulin is a secreted glycoprotein that has important trophic effects on neurons, inhibits inflammation and plays a key role in autophagy (Chitramuthu BP et al., (2017) Brain. 140021:3081-3104). Progranulin is produced by microglia and neurons but is taken up by all cell types. Once it binds to its receptor sortilin on the cell membrane, it is imported by endosomes and delivered to lysosomes where it is degraded into multiple granulins (Holler CJ et al., (2017) eNeuro. 18:4).
- One of these granulins acts as a chaperone for the protease cathepsin D to promote lysosomal acidification and effective proteolysis. Lysosomal defects inhibit autophagy and TDP-43 accumulates in nuclear and cytoplasmic inclusions.
- GRN-V mice show a subtle behavioural phenotype (reduced social dominance) and, despite developing lipofuscinosis, reactive gliosis and abnormal lysosomes, they do not develop TDP- 43 proteinopathy or neuronal loss (Arrant AW et al ., (2016) J. Neurosci. 38(9): 2341-2358).
- Selective knockout of GRN from neurons (Petkau TL et al, (2017) Neurobiol Dis. 106: 14-22) or partial knockout from microglia (Petkau TL etal., (2017) J. Neuroinflammation. 14(1):225) in mice reduced PGRN levels by -50% but does not result in a phenotype or detectable pathology. This indicates that both cell types can secrete sufficient progranulin to deliver tissue-wide cross-correction.
- SMA Spinal Muscular Atrophy
- AAV-GRN therapy may be a successful therapy for ALS and for FTD due to TDP-43 accumulation that is not associated with GRN mutations. Clearance of amyloid b deposition in the brain has also been enhanced by the administration of lenti-virus delivering GRN to transgenic mouse models of Alzheimer’s (Minami SS et al. , (2014) Nat. Med. 20(10): 1157-64), and progranulin gene delivery has been shown to be neuroprotective in the MTPT toxin model of Parkinson’s (Van Kampen JM etal., (2014) PLoS One. 9(5):e97032). Because GRN is able to enhance autophagy and reduce inflammation, AAV-GRN may also provide therapeutic benefit for many other neurodegenerative disorders in which misfolded proteins accumulate.
- a number of research groups are already investigating a variety of approaches to find suitable treatments for FTD-GRN patients, including delivery of progranulin using AAV vectors.
- Passage Bio has received significant funding to develop AAV-delivered therapeutics to treat rare monogenic CNS diseases, including FTD (https://www.passagebio.com/investors- and-media/news-and-events/press-releases/press-release-details/2019/Passage-Bio-Launches- with-1155-Million-Series-A-to-Develop-AAV-Delivered-Therapeutics-to-Treat-Rare- Monogenic-CNS-Diseases/default.aspx).
- WO 2017/151884 also describes the use of a vector comprising a nucleic acid encoding progranulin in which the vector transduces cells that contact the cerebrospinal fluid (CSF) to express the progranulin.
- the vector includes the AAV capsid protein and the progranulin nucleic acid is inserted between a pair of AAV inverted terminal repeats.
- the present invention provides an adeno-associated virus (AAV) vector comprising a nucleic acid comprising a human growth hormone intron 3 (hGHi3) sequence operably coupled to a polynucleotide sequence encoding a polypeptide of interest.
- AAV adeno-associated virus
- the present invention provides an adeno-associated virus (AAV) vector comprising a synapsin promoter sequence operably coupled to a polynucleotide sequence encoding a polypeptide of interest.
- AAV adeno-associated virus
- the polypeptide of interest is progranulin.
- the present invention provides an adeno-associated virus (AAV) vector comprising a progranulin 3’ untranslated region (UTR) sequence operably coupled to a polynucleotide sequence encoding a polypeptide of interest.
- AAV adeno-associated virus
- UTR untranslated region
- the polypeptide of interest is progranulin.
- the present invention provides an adeno-associated virus (AAV) vector comprising a polynucleotide sequence encoding progranulin, wherein the polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:4.
- AAV adeno-associated virus
- the hGHi3 sequence may comprise the sequence of SEQ ID NO:7 or a variant, fragment or homolog thereof.
- suitable variants may comprise a sequence having at least 85%, 90%, 95% or 99% sequence identity to SEQ ID NO:7, e.g. over at least 30, 50, 70, 80, 90 residues of, or over the full length of SEQ ID NO:7.
- the polynucleotide sequence encodes a heterologous polypeptide or transgenic protein, e.g. a non-AAV protein.
- the polynucleotide sequence may encode a mammalian polypeptide, e.g. a human polypeptide or protein.
- the polynucleotide sequence may comprise the complete coding sequence for the polypeptide of interest or part of the coding sequence therefor.
- the coding sequence may be derived from GRN and code for progranulin (PGRN), e.g. human progranulin. It is preferred if the polynucleotide sequence comprises the complete coding sequence for PGRN.
- the polynucleotide sequence preferably encodes an amino acid sequence as defined in SEQ ID NO: 16, or a fragment, homolog or variant thereof.
- the encoded amino acid sequence may have at least 85%, 90%, 95% or 99% sequence identity to SEQ ID NO: 16, e.g. over at least 50, 100, 200, 300, 500 residues of, or over the full length of SEQ ID NO: 16.
- the polynucleotide sequence may comprise the wild-type coding sequence for human progranulin (SEQ ID NO: 1), or a variant, fragment or homolog thereof.
- the polynucleotide sequence may be codon-optimised, for example, optimised for expression in humans.
- the codon-optimised sequence has a codon adaptation index (CAI) for humans of at least 0.8, more preferably at least 0.9. Most preferably the codon-optimised sequence has a CAI for both humans and mouse of at least 0.9.
- the codon-optimised sequence has a GC content of 30 to 70%, most preferably 60 to 65%.
- the codon-optimised sequence has at least 50%, 60%, 70%, 75%, or most preferably at least 80% sequence similarity or sequence identity to the wild-type progranulin sequence.
- Codon-optimisation may introduce new or different regulatory elements that enhance protein production. Such regulatory elements may additionally restrict expression to particular tissues and/or organs, such as the brain.
- the codon-optimised sequence may comprise the sequence of SEQ ID NO:2, SEQ ID NO:3 or SEQ ID NO:4, or a variant, fragment or homolog thereof.
- the codon-optimised sequence may comprise the sequence of SEQ ID NO:4, or a variant, fragment or homolog thereof, i.e. based on candidate III (PGRN-GS) described in the examples herein.
- Suitable variants may comprise a sequence having at least 85%, 90%, 95% or 99% sequence identity to SEQ ID NO:l, SEQ ID NO:2, SEQ ID NO:3 or SEQ ID NO:4, e g. over at least 100, 200, 300, 500, 1000 or 1500 residues of, or over the full length of SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3 or SEQ ID NO:4.
- polynucleotide sequence may comprise a sequence having at least 85%, 90%, 95% or 99% sequence identity to SEQ ID NO:4, e.g. over at least 100, 200, 300, 500, 1000 or 1500 residues of, or over the full length of SEQ ID NO:4.
- suitable fragments may comprise at least 20, 30, 50, 100, 200, 300, 500, 1000 or 1500 residues of any one of the polynucleotide or amino acid sequences described herein, e.g. at least 20, 30, 50, 100, 200, 300, 500, 1000 or 1500 residues of SEQ ID NO:l, SEQ ID NO:2, SEQ ID NO:3 SEQ ID NO:4, SEQ ID NO:7, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16 or SEQ ID NO: 17.
- the AAV vector may further comprise an exonic splicing element (ESE).
- ESE exonic splicing element
- the ESE may be upstream of the polynucleotide coding sequence, for example, in a 5’ flanking sequence. It will be appreciated that the ESE may be part of or inserted into a flanking sequence.
- a 5’ flanking sequence may be a guide sequence, such as a 5’ flanking sequence derived from a wild-type polynucleotide sequence.
- the 5’ flanking sequence may be a 5’ guide sequence derived from the wild-type GRN gene.
- the wild type GRN 5’ guide sequence comprises about 300 to 500 base pairs, e.g. 350 to 450 or about 392 base pairs.
- the AAV vector may further comprise a 3’ untranslated region (UTR) from progranulin.
- the 3’ UTR of PGRN may function as an exonic enhancing element to enhance and potentially regulate PGRN expression.
- the 3’ UTR of PGRN may, for example, be located in the cassette or vector downstream of the polynucleotide coding sequence, i.e. in the 3 ’ region.
- the cassette or vector comprises the 3 ’ UTR of human PGRN, or a variant, fragment or homolog thereof.
- the cassette or vector may comprise the sequence of SEQ ID NO: 14, or a sequence having at least 85%, 90%, 95% or 99% sequence identity to SEQ ID NO: 14, e.g. over at least 100, 200, 250 residues of, or over the full length of SEQ ID NO: 14.
- the polynucleotide sequence may include a signalling sequence (i.e. a sequence encoding a signalling peptide) derived from human growth hormone (hGH).
- the hGH signalling sequence may comprise the sequence of SEQ ID NO:9 or a variant or homolog thereof.
- the signalling sequence may replace a signalling sequence present in the sequence encoding the polypeptide of interest. In a particular example, the hGH signalling sequence replaces residues 1 to 51 of GRN.
- the AAV vector may further comprise a sequence that imparts tissue or cell-type specificity to the protein expression.
- a neuron-specific promoter such as a promoter derived from synapsin, may be included in the expression cassette.
- the promoter may, for example, comprise the sequence of SEQ ID NO: 15, or a variant, fragment or homolog thereof.
- the cassette or vector may comprise the sequence of SEQ ID NO: 15, or a sequence having at least 85%, 90%, 95% or 99% sequence identity to SEQ ID NO: 15, e.g. over at least 50, 100, 200, 300 or 400 residues of, or over the full length of SEQ ID NO: 15.
- the present invention provides an AAV vector comprising a human synapsin promoter, hGHi3 and a progranulin 3’ UTR operably coupled to a polynucleotide sequence encoding a polypeptide of interest.
- the polynucleotide sequence may be codon-optimised, for example, optimised for expression in humans. Even more preferably the polypeptide of interest is progranulin.
- the AAV vector may, for example, comprise the sequence of SEQ ID NO: 17, or a variant, fragment or homolog thereof.
- the AAV vector may comprise the sequence of SEQ ID NO: 17, or a sequence having at least 85%, 90%, 95%, or 99% sequence identity to SEQ ID NO: 17, e.g. over at least 100, 200, 300, 500, 1000, 1500, 2000, 2500, or 3000 residues of, or over the full length of SEQ ID NO: 17.
- sequence may additionally or alternatively limit expression of the polypeptide of interest to either dividing or non-dividing cells, such as non-dividing neurons. In this way, any carcinogenic risk may be reduced.
- the present invention provides an AAV vector cassette to deliver the GRN gene for the efficient expression and secretion of progranulin to supplement PGRN levels in the brains of subjects with ALS, FTD and NCL11 and related neurodegenerative disorders.
- Such subjects may have levels of progranulin below a normal physiological level, have GRN mutations or are either partially or wholly deficient in this protein.
- serotype AAV9 is a preferred example.
- the present invention resides in i) a pharmaceutical composition or medicament comprising an AAV vector as described herein and ii) one or more pharmaceutically or physiologically acceptable carriers, excipients and/or diluents.
- the pharmaceutical composition or medicament may be formulated for administration or delivery directly or indirectly to the brain or a specific area of the brain, such as the frontal, temporal and/or parietal lobes.
- the pharmaceutical composition or medicament as described herein may be for use in the treatment of disease, preferably a neurological disease or disorder.
- the disease to be treated is a neurodegenerative disease.
- the neurological disorder comprises frontotemporal dementia (FTD), neuronal ceroid lipofuscinosis (CLN11), amyotrophic lateral sclerosis (ALS), Huntington’s disease, Parkinson’s disease or Alzheimer’s disease.
- FTD frontotemporal dementia
- CLN11 neuronal ceroid lipofuscinosis
- ALS amyotrophic lateral sclerosis
- Huntington’s disease Parkinson’s disease or Alzheimer’s disease.
- the pharmaceutical composition or medicament may be used to treat any patient suffering from the disease, or a sub-group of patients thereof.
- the pharmaceutical composition or medicament as described herein is used to treat (i) subjects who are heterozygous, homozygous or compound heterozygous for GRN mutations, (ii) subjects suffering from sporadic neurological disease and/or (iii) subjects having PGRN levels below a physiologically normal level.
- sporadic disease it is typically meant subjects who are not known to have another family member affected or do not have a loss of function GRN mutation linked to the disease.
- use of the pharmaceutical composition or medicament as described herein may be for the manufacture of a medicament for the treatment of a neurological disorder, e.g. for treating frontotemporal dementia (FTD-GRN) patients who are heterozygous for a GRN mutation or for treating neuronal ceroid lipofuscinosis (NCL11) patients who are homozygous or compound heterozygous for GRN mutations.
- the medicament may also be used for other neurological disorders in people who do not have PGRN levels below a physiologically normal level e.g. frontotemporal dementia (FTD) patients who do not have GRN mutation, amyotrophic lateral sclerosis (ALS), Huntington’s disease, Parkinson’s disease or Alzheimer’s disease, and subjects suffering from other sporadic neurological diseases.
- the pharmaceutical composition or medicament of the present invention may also be used in a method of treatment in which a therapeutically effective amount of a pharmaceutically or physiologically acceptable composition comprising an AAV vector as described herein may be administered to a subject in need thereof for the treatment of a neurological disorder, e.g. frontotemporal dementia (FTD), neuronal ceroid lipofuscinosis (NCL11), amyotrophic lateral sclerosis (ALS), Huntington’s disease, Parkinson’s disease or Alzheimer’s disease, for example in subjects suffering from sporadic neurological disease and/or subjects having PGRN levels below a physiologically normal level.
- a neurological disorder e.g. frontotemporal dementia (FTD), neuronal ceroid lipofuscinosis (NCL11), amyotrophic lateral sclerosis (ALS), Huntington’s disease, Parkinson’s disease or Alzheimer’s disease, for example in subjects suffering from sporadic neurological disease and/or subjects having PGRN levels below a physiologically normal level.
- FDD fronto
- the pharmaceutical composition or medicament of the invention may be administered as a gene therapy to FTD and ALS patients who have recently become symptomatic, thereby arresting the degenerative process.
- Such treatment may even rescue neurons that are dysfunctional but still alive.
- Even a modest improvement in dementia symptoms and prevention of progression would dramatically reduce the care burden on their family and the community.
- the composition or medicament may be administered prophylactically to prevent or limit the onset of disease, particularly to subjects at greatest risk.
- a nucleic acid as described above, e.g. a nucleic acid (e.g. polynucleotide) comprising (i) a human growth hormone intron 3 (hGHi3) sequence (ii) a synapsin promoter sequence and/or (iii) a progranulin 3’ untranslated region (UTR) sequence, operably coupled to a heterologous polynucleotide sequence encoding a polypeptide of interest (e.g. polypeptide other than human growth hormone).
- the polypeptide of interest comprises progranulin.
- the coding sequence for the polypeptide may be codon-optimized, e.g. as described herein.
- the present invention provides a nucleic acid sequence comprising a sequence having at least 85%, 90%, 95% or 99% sequence identity to SEQ ID NO:4, e.g. over at least 100, 200, 300, 500, 1000 or 1500 residues of, or over the full length of SEQ ID NO:4.
- the nucleic acid sequence may further comprise one or more regulatory elements (such as promoter) or other elements as described above with reference to the AAV vector comprising such a nucleic acid.
- the nucleic acid comprises a neuron-specific promoter (e.g. a synapsin promoter).
- the nucleic acid may e.g. comprise an expression cassette suitable for use in an AAV vector, and thus may e.g. comprise one or more AAV inverted terminal repeats.
- Figure 1 Screening of secreted PGRN expression for codon-optimised candidates.
- Figure la Twelve codon-optimised PGRN sequences were synthesized under the CMV promoter.
- HEK- 293 cells were used for transfection (250 ng/2E+10 cells). 48 hours later the medium was collected and western blot analysis performed.
- Figure lb The intensity of the PGRN expression was measured by ImageJ for each candidate.
- Figure lc CAI score before and after the double codon optimisation (human and other species).
- Figure 2a Schematic diagram of candidates I, II, III of the codon optimised hPGRN by different algorithms.
- Figure 2b BamHl and BstBl were used to cut the 5’ sequence of Wild-type human PGRN. The digested DNA fragments were replaced with codon optimised PGRN candidates to generate a fusion plasmid.
- Figure 3 Quantitation of secreted PGRN from codon optimised constructs in cell culture medium.
- Figure 3a PGRN codon optimised and fusion constructs were transfected into HEK- 293 cells. After 48 hours the cell culture medium was sampled and levels of PGRN were assayed by western blot.
- Figure 3b Levels of secreted PGRN were measured by ImageJ for each candidate and the value was normalised initially to the number of cells (protein GAPDH) and subsequently to cassette copy number (qPCR of CMV/GAPDH). The results of three biological replicates and four independent experiments were plotted in the scatterplot and subjected to one-way ANOVA statistical analysis (* ⁇ 0.05).
- Figure 4 Quantitation of expressed PGRN from codon optimised constructs in cell culture lysates.
- Figure 4a PGRN codon optimised and fusion constructs were transfected into HEK- 293 cells. After 48 hours the cell cultures were lysed and levels of PGRN were assayed by western blot.
- Figure 4b Levels of expressed PGRN were measured by ImageJ for each candidate and the value was normalised initially to the number of cells (protein GAPDH) and subsequently to cassette copy number (qPCR of CMV/GAPDH). The results of three biological replicates and four independent experiments were plotted in the scatterplot and subjected to one-way ANOVA statistical analysis (* ⁇ 0.05).
- Figure 5 Testing intron-mediated enhancement of human growth hormone on PGRN protein expression.
- Figure 5a Schematic diagram of the human growth hormone intronic sequence located in the genomic sequence.
- Figure 5b The hGH introns 1, 2 or 3 were cloned into the 5’ UTR of human PGRN-wt.
- Figure 5c The human PGRN signalling sequence (18 amino acid peptide) was replaced with human growth hormone signalling sequence to test whether it could enhance the secretion of PGRN.
- Figure 6 Secretion of PGRN was enhanced by hGH intron 3 and signalling sequence of hGH.
- Figure 6a PGRN intronic and signalling peptide sequences were transfected into HEK-293 cells. After 48 hours the cell culture medium was sampled and levels of PGRN were assayed by western blot.
- Figure 6b Levels of secreted PGRN were measured by ImageJ for each candidate and the value was normalised initially to the number of cells (protein GAPDH) and subsequently to cassette copy number (qPCR of CMV/GAPDH). The results of three biological replicates and four independent experiments were plotted in the scatterplot and subjected to one-way ANOVA statistical analysis (* ⁇ 0.05, *** ⁇ 0.0005).
- Figure 7 PGRN expression was enhanced by hGH intron3 but not by hGH signalling in cell lysates.
- Figure 7a PGRN intronic and signalling peptide sequences were transfected into HEK- 293 cells. After 48 hours the cell cultures were lysed and levels of PGRN were assayed by western blot.
- Figure 7b Levels of expressed PGRN were measured by ImageJ for each candidate and the value was normalised initially to the number of cells (protein GAPDH) and subsequently to cassette copy number (qPCR of CMV/GAPDH). The results of three biological replicates and four independent experiments were plotted in the scatterplot and subjected to one-way ANOVA statistical analysis (*** ⁇ 0.0001).
- Figure 8. hGHi3 did not enhance the GRN expression from codon optimised PGRN-GS.
- Figure 8a The hGH intron 3 inserted PGRN-GS was transfected to HEK-293 cells. 48 hours later the medium was collected and used for western blot for GRN expression.
- Figure 8b The expression levels were quantified using image-J and image studio and the values were normalized initially to the number of cells (protein GAPDH) and subsequently to cassette copy number (qPCR of CMV/GAPDH).
- Figure 8c ESE element of PGRN wild type sequences and codon optimised PGRN-GW were analysed by ESE finder 2.0. SR protein binding score was plotted as a bar graph. Each colour represents different type of SR splicing proteins.
- Figure 9 hGHi3-PGRN-fusion construct enhanced the GRN expression in primary neuron.
- Figure 9a Schematic diagram of hGHi3 cloning for hGHi3-PGRN-Fusion constructs.
- Figure 9b AAV harbouring hGHi3-PGRN-GA were produced and transduced to 7 days old rat primary cortical neurons. After five days of incubation, medium was collected for western blot analysis of PGRN expression levels.
- Figure 9c Levels of expressed PGRN were measured by ImageJ for each candidate and the value was normalised initially to the number of cells (protein GAPDH) and subsequently to cassette copy number (qPCR of CMV/GAPDH). The results of three biological replicates and four independent experiments were plotted in the scatterplot and subjected to one-way ANOVA statistical analysis.
- FIG 10. Synapsin promoter increased PGRN secretion by rat cortical neurons.
- Figure 10a Wild type PGRN was cloned under CMV and synapsin promoters in an AAV shuttle vector. The plasmids were transfected to rat cortical neuron at day 7 for five days then the medium was sampled and processed for western blot analysis.
- Figure 10b The intensity of the PGRN expression was measured by imageJ.
- Figure 11 AAV9 carrying Syn-PGRNwt enhanced the PGRN expression in cultured rat neurons.
- Figure 11a Virus particles were produced using a neuron specific AAV9 capsid. Then AAV particles were transduced to rat primary cortical neuron at day 7 with 1E+6 virus particles for 5 days. The medium was used for western blot.
- Figure l ib PGRN protein levels were measured by ELISA assay (0.001).
- FIG. 12 Biodistribution of the AAV9-PGRN transduction in mouse organs.
- Figure 12a AAV9-CMV-PGRN-WT and AAV9-Syn-PGRN-WT were administered by bilateral ICV injection (1E+12 GC/Kg).
- Figure 12b qPCR for human PGRN was performed on genomic DNA to determine tissue biodistribution.
- FIG. 13 AAV9 carrying Syn-PGRNwt enhanced the PGRN expression in mouse cortex.
- AAV9 vectors carrying CMV-PGRN-WT and Syn-PGRN-WT were delivered by bilateral ICV injection (1E+12 GC/Kg).
- Figure 13a A commercial ELISA kit (Adipogen) was used for the quantitative analysis of PGRN expression levels in the serum, CSF and cortex.
- Figure 14 Example of a PGRN vector suitable for use in gene therapy.
- Figure 14a Schematic diagram of a CMV promoter driven PGRN codon optimised construct composed of hGH3 intron 3 in the 5’UTR.
- Figure 14b Schematic diagram of a Synapsin promoter driven PGRN codon optimised construct composed of hGH3 intron 3 in the 5’UTR.
- FIG. 15 ICV delivery of AAV9-Syn-PGRNwt showing wide distribution of PGRN in mouse brain a) The 4 weeks old mouse brain slice were used for IHC to detect the human GRN expression. The images were taken by Nikon AIR confocal. To reconstitute the whole brain image, the scanned images were stitched by 20% overlapping in automatic setting in NIC software. Human GRN (green), NeuN (red) b) Un-injected brain slices were subjected to IHC, which show no GRN detection c) Cortex, d) hippocampus, e) Thalamus.
- AAV9 carrying Syn-PGRNwt enhanced the PGRN expression in mouse hippocampus.
- AAV9 vectors carrying CMV-PGRN-WT and Syn-PGRN-WT were delivered by bilateral ICV injection (2.5E+10).
- a) Commercial ELISA kit (Adipogen) was use for the quantitative analysis of PGRN expression levels in the serum, CSF and cortex
- PGRN Western blot for AAV9-Syn-EGFP and AAV9-Syn-PGRNwt.
- the PGRN is detected around 68 kDa only from AAV9-Syn-PGRNwt injected hippocampal lysate d) PGRN western blot for A AV9-CMV -EGFP and AAV9-CMV-PGRNwt
- FIG. 17 Schematic diagram of Syn-hGHi3-PGRN-GS-UTR a). Schematic diagram of the Syn promoter driven PGRN codon optimised construct, which is composed of hGH3 intron3 and 3’UTR. b). DNA sequence for human PGRN-UTR.
- Figure 18. AAV9 carrying Syn-PGRN-GS, Syn-hGHi3-PGRN-GS and Syn-hGHi3-PGRN- GS-UTR enhanced the PGRN expression in mouse cortex.
- AAV9 vectors carrying Syn-PGRN- GS, Syn-hGHi3-PGRN-GS and Syn-hGHi3-PGRN-GS-UTR were delivered by bilateral IT injection.
- FIG. 19 Immunohistochemisty of AAV9-PGRN-GS and AAV9-hGHi3-PGRN-GS-UTR.
- the mice were harvested at 4 weeks after the IT injection. Free frozen tissues were sectioned at the thickness 30 uM and immunostained with human specific Goat-anti GRN antibodies (Green) for overnight.
- DAPI is used as counter staining (Blue) a, a’) AAV-EGFP, b, b’) AAV9-PGRN-GS, and c, c’) AAV9-PGRN-GS-UTR.
- FIG. 20 High power and 3d rendered images of PGRN in mouse brain.
- the distribution of human PGRN was studied in the mouse cortex by immunofluorescence to determine whether PGRN is being secreted and taken up by other cells
- Many cortical neurons stained red with NeuN
- were positive for human PGRN green
- Some NeuN negative cells indicating PGRN secreted by neurons is taken up by glia
- Some microglia labelled with IBA1 red in b
- showed GRN positive foci green
- 3D rendered images indicating that they were able to take up PGRN secreted by neurons.
- FIG. 21 Plasmid map for AAV PGRN vector. Human growth hormone intron is inserted between synapsin promoter and hPGRN. The natural sequence of hPGRN UTR was added in at the 3 ’ end of hPGRN. The ITR to ITR were cloned in newly synthesized Kanamycin resistant backbone plasmid. A) linear form. B) circular plasmid form.
- AAV2 ITR adeno-associated virus type 2 inverted terminal repeat
- hSyn promoter human synapsin promoter
- hGHi3 human growth hormone intron 2
- PGRN-GS GenScript ® codon-optimised human progranulin
- hPGRN-3’UTR human progranulin 3’ untranslated region
- bGH poly(A) signal bovine growth hormone polyadenylation signal
- fl ori FI replication origin
- KanR kanamycin resistance gene.
- SEQ ID NO: 1 Human PGRN wild-type (PGRN-WT) DNA coding sequence
- SEQ ID NO: 5 human growth hormone intron 1 sequence
- SEQ ID NO: 6 human growth hormone intron 2 sequence
- SEQ ID NO: 7 human growth hormone intron 3 sequence
- SEQ ID NO: 8 human growth hormone intron 4 sequence
- SEQ ID NO:9 generic DNA signalling sequence of human growth hormone
- SEQ ID NO: 10 translated amino acid sequence for the generic signalling sequence of human growth hormone
- the present invention relates to an adeno-associated virus (AAV) vector comprising (i) a human growth hormone intron 3 (hGHi3) sequence (ii) a synapsin promoter sequence and/or (iii) a progranulin 3’ untranslated region (UTR) sequence, operably coupled to a polynucleotide sequence encoding a polypeptide of interest.
- AAV adeno-associated virus
- the invention encompasses a specific embodiment in which the AAV vector cassette contains a codon-optimised PGRN gene that significantly increases the production and secretion of the progranulin protein.
- PGRN secretion may be further increased by placing the sequence under the 5’ regulatory control of hGH intron 3.
- the 3’ UTR from PGRN may also be included in the cassette in order to further enhance and regulate PGRN expression.
- hGHi3 is an intronic splicing element (ISE).
- ISE intronic splicing element
- the term “one or more”, such as one or more members of a group of members, is clear per se, by means of further exemplification, the term encompasses inter alia a reference to any one of said members, or to any two or more of said members, such as, e.g., any >3, >4, >5, >6 or >7 etc. of said members, and up to all said members.
- nucleic acid or “polynucleotide” refers to a (e.g. polymeric) form of nucleotides of any length, including deoxyribonucleotides or ribonucleotides, or analogs thereof.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs, and may be interrupted by non-nucleotide components. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer.
- polynucleotide refers interchangeably to double- and single- stranded molecules. Unless otherwise specified or required, any embodiment of the invention described herein that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double- stranded form.
- polypeptide refers to polymers of amino acids of any length.
- the terms also encompass an amino acid polymer that has been modified; for example, disulphide bond formation, glycosylation, lipidation, phosphorylation, or conjugation with a labelling component.
- Polypeptides such as anti- angiogenic polypeptides, neuroprotective polypeptides, and the like, when discussed in the context of delivering a gene product to a mammalian subject, and compositions therefor, refer to the respective intact polypeptide, or any fragment or genetically engineered derivative thereof, which retains the desired biochemical function of the intact protein.
- references to nucleic acids encoding anti -angiogenic polypeptides, nucleic acids encoding neuroprotective polypeptides, and other such nucleic acids for use in delivery of a gene product to a mammalian subject include polynucleotides encoding the intact polypeptide or any fragment or genetically engineered derivative possessing the desired biochemical function.
- a polynucleotide or polypeptide has a certain percent "sequence identity" to another polynucleotide or polypeptide, meaning that, when aligned, that percentage of bases or amino acids are the same when comparing the two sequences.
- Sequence similarity can be determined in a number of different manners.
- sequences can be aligned using the methods and computer programs, including BLAST, available over the world wide web at ncbi.nlm.nih.gov/BLAST/.
- FASTA is Another alignment algorithm
- GCG Genetics Computing Group
- Other techniques for alignment are described in Methods in Enzymology, vol. 266: Computer Methods for Macromolecular Sequence Analysis (1996), ed. Doolittle, Academic Press, Inc., a division of Harcourt Brace & Co., San Diego, California, USA.
- alignment programs that permit gaps in the sequence.
- the Smith- Waterman is one type of algorithm that permits gaps in sequence alignments. See Meth. Mol. Biol. 70: 173-187 (1997). Also, the GAP program using the Needleman and Wunsch alignment method can be utilized to align sequences. See J. Mol. Biol. 48: 443- 453 (1970)
- the program has default parameters determined by the sequences inputted to be compared.
- the sequence identity is determined using the default parameters determined by the program. This program is available also from Genetics Computing Group (GCG) package, from Madison, Wisconsin, USA.
- GCG Genetics Computing Group
- FastDB is described in Current Methods in Sequence Comparison and Analysis, Macromolecule Sequencing and Synthesis, Selected Methods and Applications, pp. 127-149, 1988, Alan R. Liss, Inc. Percent sequence identity is calculated by FastDB based upon the following parameters:
- AAV adeno-associated virus
- AAV adeno-associated virus
- rAAV refers to recombinant adeno-associated virus, also referred to as a recombinant AAV vector (or "rAAV vector”).
- AAV includes, for example, AAV type 1 (AAV-1), AAV type 2 (AAV-2), AAV type 3 (AAV-3), AAV type 4 (AAV-4), AAV type 5 (AAV-5), AAV type 6 (AAV-6), AAV type 7 (AAV-7), AAV type 8 (AAV-8), AAV type 9 (AAV-9), AAV type 10 (AAV- 10, including AAVrhlO), AAV type 12 (AAV-12), avian AAV, bovine AAV, canine AAV, equine AAV, primate AAV, non-primate AAV, and ovine AAV.
- Primarymate AAV refers to AAV that infect primates
- non-primate AAV refers to AAV that infect non-primate mammals
- bovine AAV refers to AAV that infect bovine mammals, and so on.
- the AAV vectors described herein are typically recombinant AAV vectors (rAAV).
- An "rAAV vector” as used herein refers to an AAV vector comprising a polynucleotide sequence not of AAV origin (i.e., a polynucleotide heterologous to AAV), typically a sequence of interest for the genetic transformation of a cell.
- the heterologous polynucleotide may be flanked by at least one, and sometimes by two, AAV inverted terminal repeat sequences (ITRs).
- ITRs are derived from AAV serotype 2, i.e. the rAAV vector comprises AAV2 ITRs.
- the vector comprises one or both of the following AAV2 ITR sequences, or homologs or variants thereof: SEQ ID NO: 19:
- AAV ITR sequences are discussed in e.g. Wilmott et al. (2019), Human Gene Therapy MethodsVol. 30, No. 6:206-213 and are available from publicly-accessible databases.
- rAAV vector encompasses both rAAV vector particles and rAAV vector plasmids.
- An rAAV vector may either be single-stranded (ssAAV) or self-complementary (scAAV).
- ssAAV single-stranded
- scAAV self-complementary
- a suitable cloning vector comprising further sequence elements that may used in the vectors of the present invention is disclosed is RS540-AAV-ErbB-RASERlC-OFPBidBH3, disclosed in GenBank accession no. MK801287.1.
- An "AAV virus” or “AAV viral particle” or “rAAV vector particle” refers to a viral particle composed of at least one AAV capsid protein (typically by all of the capsid proteins of a wild- type AAV) and an encapsidated polynucleotide rAAV vector. If the particle comprises a heterologous polynucleotide (i.e. a polynucleotide other than a wild- type AAV genome such as a transgene to be delivered to a mammalian cell), it is typically referred to as an "rAAV vector particle” or simply an "rAAV vector". Thus, production of rAAV particle necessarily includes production of rAAV vector, as such a vector is contained within an rAAV particle.
- Recombinant means that the vector, polynucleotide, polypeptide or cell is the product of various combinations of cloning, restriction or ligation steps (e.g. relating to a polynucleotide or polypeptide comprised therein), and/or other procedures that result in a construct that is distinct from a product found in nature.
- a recombinant virus or vector is a viral particle comprising a recombinant polynucleotide. The terms respectively include replicates of the original polynucleotide construct and progeny of the original virus construct.
- the AAV vector comprises a nucleic acid sequence encoding a gene product, e.g. a heterologous nucleotide sequence encoding a heterologous polypeptide.
- a “gene” refers to a polynucleotide containing at least one open reading frame that is capable of encoding a particular protein after being transcribed and translated.
- a “gene product” is a molecule resulting from expression of a particular gene. Gene products include, e.g., a polypeptide, an aptamer, an interfering RNA, an mRNA, and the like.
- Heterologous means derived from a genotypically distinct entity from that of the rest of the entity to which it is being compared.
- a polynucleotide introduced by genetic engineering techniques into a plasmid or vector derived from a different species is a heterologous polynucleotide.
- a promoter removed from its native coding sequence and operatively linked to a coding sequence with which it is not naturally found linked is a heterologous promoter.
- an rAAV that includes a heterologous nucleic acid encoding a heterologous gene product is an rAAV that includes a nucleic acid not normally included in a naturally-occurring, wild-type AAV, and the encoded heterologous gene product is a gene product not normally encoded by a naturally-occurring, wild-type AAV.
- the gene product is a therapeutic protein.
- a "therapeutic" peptide or protein is a peptide or protein that may alleviate or reduce symptoms that result from an absence or defect in a protein in a cell or subject.
- a “therapeutic” peptide or protein is one that otherwise confers a benefit to a subject, e.g., anti- degenerative effects.
- the polypeptide is generally a polypeptide that enhances function of a cell, for example a cell present in neuronal tissue, e.g., a neuron, a glial cell, or a photoreceptor cell.
- Exemplary polypeptides include neuroprotective polypeptides (e.g., GDNF, CNTF, NT4, NGF, and NTN); anti -angiogenic polypeptides (e.g., a soluble vascular endothelial growth factor (VEGF) receptor; a VEGF -binding antibody; a VEGF- binding antibody fragment (e.g., a single chain anti -VEGF antibody); endostatin; tumstatin; angiostatin; a soluble Fit polypeptide (Lai et al. (2005) Mol. Ther. 12:659); an Fc fusion protein comprising a soluble Fit polypeptide (see, e.g., Pechan et al. (2009) Gene Ther.
- VEGF vascular endothelial growth factor
- PEDF pigment epithelium- derived factor
- TMP-3 tissue inhibitor of metalloproteinases-3
- opsin e.g., a rhodopsin
- anti- apoptotic polypeptides e.g., Bcl-2, Bcl-Xl
- Suitable polypeptides include, but are not limited to, glial derived neurotrophic factor (GDNF); fibroblast growth factor 2; neurturin (NTN); ciliary neurotrophic factor (CNTF); nerve growth factor (NGF); neurotrophin-4 (NT4); brain derived neurotrophic factor (BDNF); epidermal growth factor; rhodopsin; X-linked inhibitor of apoptosis; and Sonic hedgehog.
- GDNF glial derived neurotrophic factor
- NTN fibroblast growth factor 2
- CNTF ciliary neurotrophic factor
- NTF nerve growth factor
- NT4 neurotrophin-4
- BDNF brain derived neurotrophic factor
- epidermal growth factor rhodopsin
- X-linked inhibitor of apoptosis and Sonic hedgehog.
- Suitable polypeptides are disclosed, for example, in WO 2012/145601. However in a preferred embodiment, the encoded polypeptide comprises progranulin.
- the polynucleotide sequence is operably coupled to (i) a human growth hormone intron 3 (hGHi3) sequence (ii) a synapsin promoter sequence and/or (iii) a progranulin 3’ untranslated region (UTR) sequence.
- hGHi3 human growth hormone intron 3
- a synapsin promoter sequence and/or a progranulin 3’ untranslated region (UTR) sequence.
- the polynucleotide sequence encoding a polypeptide is operably linked to a promoter, e.g. a constitutive promoter or an inducible promoter.
- the nucleotide sequence encoding the polypeptide of interest is operably linked to a tissue specific or cell type specific regulatory element.
- a nucleotide sequence encoding a gene product of interest is operably linked to a neuron-specific regulatory element (e.g., a neuron-specific promoter), e.g., a regulatory element that confers selective expression of the operably linked gene in a neuron
- a neuron-specific regulatory element e.g., a neuron-specific promoter
- Suitable neuronal-specific promoters include neuron-specific enolase (NSE) promoter, Andersen et al. Cell. Mol. Neurobiok, 13:503-15 (1993; neurofilament light-chain gene promoter, Piccioli et al., Proc. Natl. Acad. Sci.
- the neuron-specific promoter is preferably a synapsin promoter.
- control element or "control sequence” is a nucleotide sequence involved in an interaction of molecules that contributes to the functional regulation of a polynucleotide, including replication, duplication, transcription, splicing, translation, or degradation of the polynucleotide. The regulation may affect the frequency, speed, or specificity of the process, and may be enhancing or inhibitory in nature.
- Control elements known in the art include, for example, transcriptional regulatory sequences such as promoters and enhancers.
- a promoter is a DNA region capable under certain conditions of binding RNA polymerase and initiating transcription of a coding region usually located downstream (in the 3' direction) from the promoter.
- “Operatively linked” or “operably linked” refers to a juxtaposition of genetic elements, wherein the elements are in a relationship permitting them to operate in the expected manner. For instance, a promoter is operatively linked to a coding region if the promoter helps initiate transcription of the coding sequence. There may be intervening residues between the promoter and coding region so long as this functional relationship is maintained.
- promoter or “promoter” as used herein can refer to a DNA sequence that is located adjacent to a DNA sequence that encodes a recombinant product. A promoter is preferably linked operatively to an adjacent DNA sequence.
- a promoter typically increases an amount of recombinant product expressed from a DNA sequence as compared to an amount of the expressed recombinant product when no promoter exists.
- a promoter from one organism can be utilized to enhance recombinant product expression from a DNA sequence that originates from another organism.
- a vertebrate promoter may be used for the expression of jellyfish GFP in vertebrates.
- one promoter element can increase an amount of recombinant products expressed for multiple DNA sequences attached in tandem. Hence, one promoter element can enhance the expression of one or more recombinant products.
- Multiple promoter elements are well-known to persons of ordinary skill in the art.
- Enhancer elements can refer to a DNA sequence that is located adjacent to the DNA sequence that encodes a recombinant product.
- Enhancer elements are typically located upstream of a promoter element or can be located downstream of or within a coding DNA sequence (e.g., a DNA sequence transcribed or translated into a recombinant product or products).
- a coding DNA sequence e.g., a DNA sequence transcribed or translated into a recombinant product or products.
- an enhancer element can be located 100 base pairs, 200 base pairs, or 300 or more base pairs upstream or downstream of a DNA sequence that encodes recombinant product.
- Enhancer elements can increase an amount of recombinant product expressed from a DNA sequence above increased expression afforded by a promoter element. Multiple enhancer elements are readily available to persons of ordinary skill in the art.
- the AAV vector may further comprise a polyadenylation signal.
- a poly(A) signal may be present typically at the 3’ end of the cassette comprising the polynucleotide encoding a polypeptide of interest.
- a poly(A) signal is present downstream of a progranulin 3’ untranslated region, i.e. between the 3’ UTR sequence and one of the ITRs flanking the cassette.
- the poly(A) sequence comprises or consists of a bovine growth hormone (bGH) poly(A) signal.
- bGH bovine growth hormone
- Suitable polyadenylation signal are known and are described in e.g. Choi et al.
- the bGH poly(A) signal comprises the sequence of SEQ ID NO: 18, or a homolog or variant thereof:
- composition or medicament comprising: a) an AAV vector, as described herein; and b) a pharmaceutically acceptable carrier, diluent, excipient, or buffer.
- the pharmaceutically acceptable carrier, diluent, excipient, or buffer may be suitable for use in a human.
- pharmaceutically acceptable it is meant a material that is not biologically or otherwise undesirable, e.g., the material may be administered to a subject without causing any undesirable biological effects.
- a pharmaceutical composition may be used, for example, in transfection of a cell ex vivo or in administering a viral particle or cell directly to a subject.
- excipients include any pharmaceutical agent that can be administered without undue toxicity.
- Pharmaceutically acceptable excipients include, but are not limited to, liquids such as water, saline, glycerol and ethanol.
- one or more physiologically or pharmaceutically acceptable carriers, excipients and/or diluents as used herein is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with administration to humans or other vertebrate hosts.
- a pharmaceutically acceptable diluent, excipient, and/or carrier is a diluent, excipient, and/or carrier approved by a regulatory agency of a Federal, a state government, or other regulatory agency, or listed in the US and/or European Pharmacopeia or other generally recognised pharmacopeia for use in animals, including humans as well as non-human mammals.
- diluent, excipient, and/or “carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the pharmaceutical composition is administered.
- Such pharmaceutical diluent, excipient, and/or carriers may be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin. Water, saline solutions and aqueous dextrose and glycerol solutions may be employed as liquid diluents, excipients, and/or carriers, particularly for injectable solutions.
- Suitable pharmaceutical diluents and/or excipients include starch, glucose, lactose, sucrose, gelatine, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
- the composition if desired, may also contain minor amounts of wetting, bulking, emulsifying agents, or pH buffering agents. These compositions may take the form of solutions, suspensions, emulsion, sustained release formulations and the like. Examples of suitable pharmaceutical diluent, excipient, and/or carriers are described in “Remington's Pharmaceutical Sciences” by E. W. Martin. The formulation should suit the mode of administration. The appropriate diluent, excipient, and/or carrier will be evident to those skilled in the art and will depend in large part upon the route of administration.
- Pharmaceutically acceptable salts may be included therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulphates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such vehicles.
- mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulphates, and the like
- organic acids such as acetates, propionates, malonates, benzoates, and the like
- auxiliary substances such as wetting or emulsifying agents, pH buffering substances, and the like
- sterile injectable preparations for example, sterile injectable aqueous or oleaginous suspensions may be formulated according to the known art using suitable dispersing or wetting agents and suspending agents.
- the sterile injectable preparation may also be a sterile injectable solution, suspension, or emulsion in a nontoxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol.
- acceptable vehicles and solvents that may be employed are water, Ringer's solution, and isotonic sodium chloride solution.
- sterile, fixed oils are conventionally employed as a solvent or suspending medium.
- any bland fixed oil may be employed including synthetic mono- or diglycerides.
- fatty acids such as oleic acid are used in the preparation of injectables.
- the injectable formulations may be sterilised, for example, by filtration through a bacteria-retaining filter, or by incorporating sterilising agents in the form of sterile solid compositions which may be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
- Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules.
- the encapsulated or unencapsulated composition is mixed with at least one inert, pharmaceutically acceptable excipient or carrier such as sodium citrate or dicalcium phosphate and/or (a) fillers or extenders such as starches, lactose, sucrose, glucose, mannitol, and silicic acid, (b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia, (c) humectants such as glycerol, (d) disintegrating agents such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, (e) solution retarding agents such as paraffin, (f) absorption accelerators such as quaternary ammonium compounds, (g) wetting agents such as, for example,
- Medicaments described herein may be provided as a kit which comprises at least one container and a package insert.
- the container contains at least one dose of a medicament comprising a composition as described herein.
- the package insert, or label comprises instructions for treating a patient using the medicaments as described herein.
- the kit may further comprise other materials that may be useful in administering the medicaments, such as diluents, filters, IV bags and lines, needles and syringes.
- the methods of the present invention provide a means for delivering nucleic acid sequences into a host tissue or cell.
- the vectors and other reagents, methods and pharmaceutical formulations of the present invention are additionally useful in a method of administering a protein or peptide to a subject in need thereof, as a method of treatment or otherwise.
- the protein or peptide may thus be produced in vivo in the subject.
- the subject may be in need of the protein or peptide as a method of treatment or otherwise because the subject has a deficiency of the protein or peptide, as explained further below.
- treatment refers to obtaining a desired pharmacologic and/or physiologic effect.
- the effect may be prophylactic in terms of completely or partially preventing or reversing a disease or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease.
- Treatment covers any treatment of a disease in a mammal, particularly in a human, and includes: (a) preventing the disease from occurring in a subject which may be predisposed to the disease or at risk of acquiring the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., arresting its development; and (c) relieving the disease, i.e., causing regression of the disease.
- the present invention may be employed to deliver any foreign nucleic acid with a biological effect to treat or ameliorate the symptoms associated with any disorder related to gene expression in any organ, tissue or cell, especially those associated with e.g. the brain.
- Gene transfer has substantial potential use in understanding and providing therapy for disease states.
- disease states There are a number of inherited diseases in which defective genes are known and have been cloned. In some cases, the function of these cloned genes is known.
- the above disease states fall into two classes: deficiency states, usually of enzymes, which are generally inherited in a recessive manner, and unbalanced states, at least sometimes involving regulatory or structural proteins, which are inherited in a dominant manner.
- gene transfer could be used to bring a normal gene into affected tissues for replacement therapy, as well as to create animal models for the disease using antisense mutations.
- gene transfer could be used to create a disease state in a model system, which could then be used in efforts to counteract the disease state.
- the methods of the present invention permit the treatment of genetic diseases.
- a disease state is treated by partially or wholly remedying the deficiency or imbalance that causes the disease or makes it more severe.
- the use of site-specific integration of nucleic sequences to cause mutations or to correct defects is also possible.
- the present invention provides a method of delivering a gene product to a tissue or cell (e.g. a neuronal tissue or cell) in a subject, the method comprising administering to the subject an AAV vector as described above.
- the gene product may be a polypeptide e.g. as described above.
- the cell may, for example, be a blood cell, stem cell, bone marrow (e.g. hematopoietic) cell, liver cell, cancer cell, vascular cell, pancreatic cell, neural cell, glial cell, epithelial or endothelial cell, dendritic cell, fibroblast, lung cell, muscle cell, cardiac cell, intestinal cell or renal cell.
- tissue may, for example, be selected from blood, bone marrow, muscle tissue (e.g. skeletal muscle, cardiac muscle or smooth muscle including vascular smooth muscle), central or peripheral nervous system tissue (e.g. brain, neuronal tissue or retinal tissue), pancreatic tissue, liver tissue, kidney tissue, lung tissue, intestinal tissue or heart tissue.
- muscle tissue e.g. skeletal muscle, cardiac muscle or smooth muscle including vascular smooth muscle
- central or peripheral nervous system tissue e.g. brain, neuronal tissue or retinal tissue
- pancreatic tissue e.g. liver tissue, kidney tissue, lung tissue, intestinal tissue or heart tissue.
- Delivering a gene product to a neuronal tissue or cell may provide for treatment of a neurological disorder.
- the gene product may be delivered to various cell types present in neuronal tissue, e.g. neurons or glial cells (e.g. astrocytes, oligodendrocytes and so on).
- the present disclosure provides a method of treating a disease (e.g. a neurological disease), the method comprising administering to an individual in need thereof an effective amount of an AAV vector as described above.
- a subject AAV vector may be administered via intracranial injection, intracerebral injection, intraocular injection, intravenous injection or by any other convenient mode or route of administration.
- exemplary modes of administration include oral, rectal, transmucosal, topical, transdermal, inhalation, parenteral (e.g., intravenous, subcutaneous, intradermal, intramuscular, and intraarticular) administration, and the like, as well as direct tissue or organ injection, alternatively, intrathecal, direct intramuscular, intraventricular, intravenous, intraperitoneal, intranasal, or intraocular injections.
- injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution or suspensions in liquid prior to injection, or as emulsions.
- Recombinant virus vectors are preferably administered to the subject in an amount that is sufficient to result in infection (or transduction) and expression of the heterologous nucleic acid sequence in cells (e.g. neuronal cells) of the subject.
- the target cells are neural cells (including cells of the central and peripheral nervous systems, in particular, brain cells).
- the vector is administered in a therapeutically effective amount.
- a “therapeutically- effective” amount as used herein is an amount of that is sufficient to alleviate (e.g., mitigate, decrease, reduce) at least one of the symptoms or causes associated with a disease state.
- a “therapeutically-effective” amount is an amount that is sufficient to provide some improvement in the condition of the subject.
- a “therapeutically effective amount” will fall in a relatively broad range that may be determined through experimentation and/or clinical trials.
- a therapeutically effective dose may be on the order of from about 10 6 to about 10 15 of AAV virions, e.g., from about 10 8 to 10 12 AAV virions.
- an effective amount of AAV virions to be delivered to cells will be on the order of from about 10 8 to about 10 13 of the AAV virions.
- Other effective dosages may be readily established by one of ordinary skill in the art through routine trials establishing dose response curves.
- the effective amount of a composition or medicament comprising an AAV vector as described herein may vary depending on such factors as the desired biological endpoint, the drug to be delivered, the target tissue, the route of administration, etc. Additional factors which may be taken into account include disease severity; age, weight and gender of the patient being treated; diet, time and frequency of administration; drug combinations; reaction sensitivities; and tolerance/response to therapy.
- more than one administration may be employed to achieve the desired level of gene expression over a period of various intervals, e.g., daily, weekly, monthly, yearly, etc.
- Suitable subjects include both avians and mammals, with mammals being preferred.
- avian as used herein includes, but is not limited to, chickens, ducks, geese, quail, turkeys and pheasants.
- mammal as used herein includes, but is not limited to, humans, bovines, ovines, caprines, equines, felines, canines, lagomorphs, etc.
- Human subjects are the most preferred. Human subjects include foetal, neonatal, infant, juvenile and adult subjects.
- the rate of protein translation from RNA transcripts may be improved by changing codons to use those that are optimal for a particular species and can increase gene expression in specific cell types. By optimising protein production from each transcript, the amount of viral vector used is less, reducing the risk of toxicity and cost.
- the optimisation of wild-type PGRN transcript was modelled using three open source programmes (IDT, Geneart and Genscript: see details in materials and methods).
- a rare-codon analysis tool was used to validate the codon adaptation index (CAI; https://www.genscript.com/tools/rare-codon-analysis).
- a CAI of 1.0 is considered ideal while a CAI of >0.8 is rated as good for expression in the desired expression organism. The lower the number, the higher the chance that the gene will be expressed poorly.
- the coding sequence of CRN was redesigned using commercially available codon optimisation algorithms (IDT ® , https://eu.idtdna.com/CodonOpt), (GeneArt ® , https://www.thermofisher.com/order/geneartgenes/projectmgmt) and (GenScript ® , https://www.genscript.com/tools/rare-codon-analysis)).
- the codon adaptation index (CAI, GeneScript) was utilised to rank the modified CRN sequences.
- a CAI of >0.8 is rated suitable for expression in the desired organism and the sequences and CAIs generated using the different algorithms are illustrated in Figures la and lb.
- PGRN expression and secretion levels tested by western blot did not dramatically improve PGRN protein expression, except for one which was optimised for human and mouse (codopl2, PGRN-GS; Figures la and lb). Therefore, additional algorithms for human PGRN were applied to create PGRN-IDT and PGRN-GA. All three constructs (PGRN-GS, PGRN-GA and PGRN-IDT) were then tested for optimal expression levels.
- the Codon Adaptation Index (CAI) of wild-type human PGRN is 0.83 and GC content is 63.22 %.
- the ideal percentage range of GC content is between 30 % and 70 %.
- PGRN-IDT Candidate I (PGRN-IDT) artificial codon-optimised PGRN DNA coding sequence (CDS length: 1782 bp) [SEQ ID NO:2]:
- the CAI of codon-optimised candidate III (PGRN-GS) is 0.92 in human and 0.94 in mouse.
- the GC content of candidate 3 is 63.23%.
- the codon-optimised sequence is 81.34 % homologous to wildtype.
- Each of candidates I to III and the wild type coding sequence encodes the amino acid sequence of progranulin (SEQ ID NO: 16): MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQ VDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAI QCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHP LAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCP QDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFT QAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSC PSSDTCCQLTSGEWGCCPIPE
- the 5’ guide sequence is important for secretion signalling. It was hypothesised that the RNA sequence might have a critical role in guiding the mRNA to the Endoplasmic Reticulum for translation. Therefore, the 5’ region of the codon- optimised sequence was replaced with the wild-type 5’ GRN sequence (392bp) upstream of the codon-optimised protein coding sequence using the Bamhl and BstBl restrictions sites. This generated pAAV-CMV-PGRN-IDT-Fusion, pAAV-CMV-PGRN-GA-Fusion, and pAAV- CMV-PGRN-GS-Fusion.
- Figure 2b is a schematic diagram of a fusion plasmid for the three codon optimised candidates in which the 5’ sequence from the codon-optimised sequence has been replaced with the 5’ sequence from wild-type human PGRN.
- the expression levels of codon-optimised PGRN were compared to wild-type human PGRN.
- Levels of secreted PGRN were directly measured in the cell culture medium and cellular lysates and normalised to cell count as a ratio to the house keeping protein GAPDH.
- To directly compare the relative efficiency of PGRN production per PGRN cassette the copy number of vector genomes per cell was quantified by quantitative qPCR of CMV as a ratio of the same house-keeping gene GAPDH (CMV/GAPDH), which represents effective HEK-293 cell transduction. This was used as the denominator to normalise and accurately quantify the levels of PGRN per cassette.
- a human kidney cell line (HEK-293) line was maintained at 37°C in a humidified chamber with CO2 (5%) and kept in Dulbecco’s Modified Medium (DMEM, Thermo Scientific) supplied with 10% Fetal Bovine Serum and 1% penicillin-streptomycin. The cells were passaged every third day.
- HEK-293 cells were transfected at 80% confluency in a 24 well plate for Western blot using lipofectamine 2000 (Life Technologies) according to manufacturer's protocol. A total of 250ng of DNA was transfected or co-transfected in 40,000 cells. pAAV-CMV-EGFP or pAAV-Syn- EGFP were used as transfection efficiency controls.
- the medium was changed to non-serum containing medium which is supplemented with insulin transferrin selenium (ITS) the following day. 48 hours later, the medium was collected and immediately used for western blot analysis.
- the cells were lysed with mild lysis buffer (NP40) then centrifuged at 10,000 x g for 10 min. The supernatant of transfected wells is collected to be used in PGRN ELISAs, and the pellets are stored in -80 C for genomic DNA extraction.
- NP40 mild lysis buffer
- Protein samples were loaded on pre-cast NuPage ® NovexTM 10% Bis-Tris Midi gels with MOPS SDS running buffer (Thermo Fisher) and run at constant 100V. Gels were briefly soaked in NuPage Transfer Buffer (Thermo Fisher) before transferring the protein using an iBlot 2TM (Thermo Fisher). Blocking reagent (Roche, 10%) containing Phosphate-buffered saline (PBS) was used to block the protein membranes for an hour. Afterwards, the membrane was incubated in primary antibody diluted in 5% blocking buffer overnight at 4°C. After washing three times with Tris buffered saline with Tween 20 (TBS-T), membranes were incubated with secondary antibodies for an hour.
- PBS Phosphate-buffered saline
- EXAMPLE 2 Developing an intronic enhancing element to increase PGRN expression.
- intron-mediated enhancement (IME) (Shaul O. Int J Biochem Cell Biol. 2017 Oct;91(Pt B): 145-155).
- IME intron-mediated enhancement
- Introns within the human growth hormone (hGH) gene were selected as suitable candidates (see Figure 5a).
- the wild-type GRN sequences were gene synthesised and cloned into pAAV plasmid (Addgene; 99280) using the BamHl and Xhol restriction sites. These constructs were used as master vectors (pAAV-CMV-PGRNwt) to sub-clone the previously codon optimised constructs.
- the human synapsin promoter sequence is replaced from Addgene vector (58881) using the Pcil and Bamhl restriction sites for pAAV-Syn-PGRNwt.
- polynucleotide sequence of the synapsin promoter is shown in (SEQ ID NO: 15):
- hGHl human growth hormone
- hGHl is composed of four introns which were synthesised by GenScript and cloned into pAAV-CMV-PGRN plasmids using the BamHl and Agel restriction sites to generate p AAV -CM V -hGHi 1 -PGRN, pAAV-CMV-hGHi2-PGRN, p AAV-CMV -hGHi3 -PGRN and pAAV-CMV-hGHi4-PGRN.
- Structural elements are important for intron-mediated enhancement (IME).
- the wild-type PGRN coding sequence was analysed by exonic splice enhancer (ESE)-fmder (ESE 3.0, http://krainer01.cshl.edu/cgi- bin/tools/ESE3/esefmder.cgi) and the high frequency of ESE predicted on GRN.
- ESE exonic splice enhancer
- the hGHi3 intron was introduced into fusion constructs which preserve the 5’ ESE element of wild-type PGRN to generate pAAV-CMV-hGHi3-PGRN-GA- Fusion, and pAAV-CMV-hGHi3-PGRN-GS-Fusion.
- the Bamhl and Agel restriction sites were used to generate the neuron-specific expression construct pAAV-Syn-hGHi3-PGRN-GA- Fusion and pAAV-Syn-hGHi3-PGRN-GS.
- SEQ ID NO:5 is the sequence of the human growth hormone intron 1 (261 bp):
- SEQ ID NO:6 is the sequence of the human growth hormone intron 2 (209 bp):
- SEQ ID NO:7 is the sequence of the human growth hormone intron 3 (92 bp):
- SEQ ID NO:7 is the sequence of the human growth hormone intron 4 (253 bp):
- the region flanked by the restriction sites Bamhl and BstBl (1-392 bp) in pAAV-CMV- PGRNwt and pAAV-CMV-PGRN-GS was used for signalling sequence replacement.
- SEQ ID NO:9 is the generic DNA signalling sequence of the human growth hormone which replaced the PGRN signalling sequence: ATG GCT ACA GGC TCC CGG ACG TCC CTG CTC CTG GCT TTT GGC CTG CTC TGC CTG CCC TGG CTT CAA GAG GGC AGT GCC (SEQ ID NO:9)
- SEQ ID NO: 10 is a translated amino acid sequence for the generic signalling sequence of the human growth hormone:
- hGH introns 2, 3 and 4 sequences were cloned into the 5’ UTR region of PGRN-WT (see Figure 5b).
- the wild-type signalling sequence of PGRN was substituted with the hGH signalling sequence (see Figure 5c).
- Example 3 Combining intronic and exonic enhancing elements.
- the hGHi3 element was subcloned in the 5’ position of PGRN-GS.
- the intronic enhancer, hGHi3 was combined with the PGRN fusion constructs which harboured the initial 392bp sequence of wildtype GRN fused to PGRN-GA codon optimised sequence (see Figure 9a). This was packaged into an AAV9 vector and delivered to rat primary cortical neurons in culture at the MOI of le6.
- UCHL1 TTTCCCCCTCGCTTGGTTCTGCCCCTGCTCCCCCTGCACAGGCCTCACAGTGCGTCTGGCCG
- the 5’ ESE flanking sequences described above can be used in some embodiments of the present invention. However in the following examples these sequences were not further studied.
- HEK-293T cells were used at approximately 80% confluence on the day of transfection.
- Cells were cultured at 37°C, 5% CO2 in Dulbecco’s Modified Eagle Medium (DMEM, Gibco) with 10% heat-inactivated FBS.
- DMEM Modified Eagle Medium
- Adeno helper plasmid containing essential genes from the adenoviral genome that support rescue and replication of AAV genomes
- 80pg of Rep2/Cap9 plasmid and 80pg of single stranded transgene containing plasmid was added to serum free DMEM to a final volume of 30mL.
- the mixture containing DNA was then filtered into the PEI-containing mixture through a 0.45pm of polyethersulphone (PES, Sartorius, Epsom, UK) syringe filter.
- PES polyethersulphone
- the AAV virus particles were harvested after 72 hours of transfection.
- the soup and pellets were collected and subjected to freeze thaw cycles. All supernatant and pellets were treated with benzonase (50Unit/mL, 37 C, 30 minutes) then centrifuged at 2000xg for 30 mins at 18 °C.
- the supernatants were filtered with 0.45pM pore size filter and then applied to a pre- equilibrized AAVX POROS affinity column (Thermo Fisher) on the AKTA system for AAV purification.
- the purified AAV is kept at -80 °C.
- Neuronal cells were isolated from cortical tissue at embryonic day 18 (El 8) (Sprague-Dawley rat). 100,000 cells were plated on PDL-coated 24-well plates. Cells were grown in Neurobasal media that was supplemented with penicillin/streptomycin (0.5%), Glutamax (1%) and B27 (2%, Thermo Fisher). Cells were transduced with AAV on the day in vitro (DIV) 7 at the multiplicity of infection (MOI) of le6. Neurons were harvested on DIV 12 and processed for western blot (see above for methodology) and ELISA. Genomic DNA was isolated 48 hours post-transfection using DNeasy Blood and Tissue kits (Qiagen) following the manufacturer’s protocol. DNA concentrations were measured using NanodropTM.
- the PGRN content of samples was assessed using the Adipogen Life Sciences Progranulin (human) ELISA Kit (AG-45A-0018YEK-KI01).
- the sandwich ELISA Kit captures human progranulin in the sample with a polyclonal antibody precoated on microtitre plates and detects protein using a second biotinylated polyclonal antibody.
- a STREP -HRP solution was added to the wells and the PGRN signal was detected by using TMB substrate for 10 minutes, adding an acidic stop solution and measuring the absorbance of each well at 450nm.
- the concentration of PGRN was calculated within a range of 0.063-4ng/ml using a recombinant human PGRN standard. The standard and all other reagents required for the assay were included within the kit.
- PGRN secretion by cortical neurons transduced by the hGHi3- PGRN-GA construct was greater than that of hGHi3-wild type PGRN alone.
- hGHi3 is acting as an intronic splicing element (ISE).
- ISE intronic splicing element
- hGHi3 works in combination with an exonic splicing element (ESE) which is present in the initial 392bp sequence of wild-type PGRN.
- ESE exonic splicing element
- hGHi3 is likely to harbour a cryptic ISE sequence, which may require an ESE present in wild-type PGRN sequence to enhance splicing (McCarthy and Philips (1998) Human Molecular Genetics. 7 ⁇ 491-1496).
- the predicted mechanism is that this combination facilitates the binding of serine and arginine rich (SR) splicing proteins which accelerates RNA processing and subsequent translation.
- SR serine and arginine rich
- EXAMPLE 4 Restricting expression using the neuronal-specific promoter synapsin.
- PGRN is used by many cell types. However, in the brain, its expression and secretion are largely determined by microglia and neurons and both cell types are affected by PGRN deficiency. Microglia are very difficult to transduce using viral vectors, so the focus was on maximising the transduction and expression of PGRN into post mitotic neurons, which also avoids the risk of accelerating cell division in microglia and astrocytes by PGRN which could be carcinogenic. Wild-type PGRN expression under the pan-mammalian generic promoter CMV was compared to the human neuron-specific promoter synapsin. As shown in Figure 10, expression was restricted and PGRN secretion was significantly increased in rat cortical neuron cultures with the synapsin promoter.
- AAV9 carrying either CMV-PGRNwt or Syn-PGRNwt was generated. Rat primary cortical neurons were cultured for seven days and transduced with AAV9-GRN vectors. After five days the cell culture medium was sampled and processed by Western blot. The synapsin promoter increased GRN expression by 5.4-fold compared to CMV, which was confirmed by PGRN ELISA (see Figure 11).
- AAV9-CMV-PGRNwt and AAV9-Syn-PGRN vectors were injected via bilateral intra-cerebroventricular (ICV) into 8-week old C57BL ⁇ 6J male mice (Fig. 12a).
- Mice were deeply anaesthetized with isoflurane and immobilised in a stereotaxic frame installed with a digital stereotaxic control panel.
- Mice were injected bilaterally in the anterior ventricle or the posterior thalamus using a Hamilton syringe. Each mouse received 3 pL of total dose of 5e+10 VG, infused at a rate of 0.5 pL/min with 2 minutes wait time post-infusion prior to withdrawal of the trochanter.
- mice were injected at 8 weeks of age and sacrificed 4 weeks post-injection at 12 weeks of age.
- Half of the brain and spinal cord, spleen, heart, liver, kidney, lung, testes, blood and cerebrospinal fluid (CSF) were harvested and freshly frozen in liquid nitrogen.
- the other half of the brain was paraformaldehyde (PFA) post-fixed and processed for histology and immunocytochemistry (IHC).
- mice For brain, plasma and organ collection, the mice were anesthetised with pentobarbital (100 mg/kg, Fatal Plus, Vortech Pharmaceuticals, Dearborn, MI) and blood was collected by cardiac puncture in syringes containing EDTA (250 mM) to prevent clotting. The blood was kept on ice and later centrifuged at 1000 x g for 10 minutes at 4 °C to separate plasma. The mice were then transcardially perfused with PBS.
- pentobarbital 100 mg/kg, Fatal Plus, Vortech Pharmaceuticals, Dearborn, MI
- EDTA 250 mM
- the blood was kept on ice and later centrifuged at 1000 x g for 10 minutes at 4 °C to separate plasma.
- the mice were then transcardially perfused with PBS.
- Brains were removed and bisected into hemispheres, one of which was micro dissected into prefrontal cortex, striatum, hippocampus, cerebellum, subcortical regions and cortices and flash-frozen in liquid nitrogen for biochemical analysis, and one of which was post-fixed for 24 hours in 4% paraformaldehyde for histological analysis.
- Spinal cord, spleen, heart, liver, kidney, lung, testes, blood and cerebrospinal fluid were removed and frozen immediately in liquid nitrogen for ELISA and western blot analysis.
- CMV-PGRN and Syn-PGRN transduction in each tissue was measured by amplifying human PGRN from genomic DNA by qPCR. Genomic DNA was diluted to 7.5ng/ul in nuclease-free H2O. qPCR was carried out using the PowerupTM SYBR ® Green Master Mix following a standard protocol. For each set of reactions, a standard curve was also run using known concentrations of DNA.
- ELISA was used to quantify PGRN expression levels from serum, CSF and cortical tissue of transduced mice.
- Mice injected with AAV9-CMV-PGRN showed high serum PGRN levels which was almost undetectable in AAV9-Syn-PGRN injected mice (see Figure 13).
- PGRN levels in the cortex and CSF were much higher in AAV9-Syn-PGRN compared to AAV9-CMV-PGRN injected mice (see Figures 13c and 13d), confirming the neuronal specificity of synapsin in vivo.
- mice injected with AAV9-Syn-PGRN-wt via ICV injection were harvested after 4 weeks (Fig. 15). Post PFA fixed brains were sliced and used for IHC.
- the goat anti-human specific PGRN antibody green
- the rabbit anti -neuron-specific antibody NeuN was used for counter staining. No human PGRN was detected in un-injected mice brain tissues, whereas intense staining in the hippocampus, and to a lesser extent the thalamus and cortex of mice that were injected with AAV-Syn-PGRNwt (Fig. 15d).
- the 3’UTR sequence (284 bp) of wild type PGRN is shown in Fig. 17b and below (SEQ ID NO: 14):
- This sequence including 5’ Pmel and 3’ Xhol was synthesized using gene synthesis service from GenScript.
- the UTR sequences was cloned into AAV-Syn-hGHi3-PGRN-GS to form AAV-Syn-hGHi3-PGRN-GS-UTR.
- a vector map showing a plasmid comprising the cassette as shown in Fig. 17 is shown in Fig. 21.
- the DNA sequence for the Syn-hGHi3-PGRN-GS- UTR vector cassette (from ITR to ITR) is shown below (SEQ ID NO: 17).
- SEQ ID NO: 17 includes the following sequence elements
- AAV2 ITR - residues 3245-3385 EXAMPLE 7 Widespread PGRN expression of AAV9-Syn-PGRN-GS, AAV9-Syn- hGHi3-PGRN-GS and AAV9-Syn-hGHi3-PGRN-GS-UTR after Intra-Thalamic injection.
- Cortical levels of PGRN were quantified by ELISA and IHC following IT injection of low (6.2E+10), middle (1.2E+11) and high (2.5E+11) dose of vector, confirming a dose-abundance effect in target tissues (Fig. 18c).
- Granular PGRN positive foci are abundant in cortical neurons (Fig. 20 a and c). Because pathological changes are seen in microglia and neurons, we sought to determine whether PGRN secreted by neurons is taken up by non-neuronal cells including microglia. PGRN under the synapsin promoter is exclusively expressed in neurons but is detected in many NeuN-negative cells (Fig. 20 a) and small foci of PGRN can be detected within IB A1 -positive microglia (Fig. 20 b and d).
- EXAMPLE 8 GRN biodistribution, toxicology and efficacy using in vivo models
- AAV particles containing a PGRN cassette as illustrated in Figure 2, 5, 9, 14, or 17 is injected to non-transgenic (NTg) mice via intraparenchymal and intracerebroventricular injections to compare the efficiency of different routes of administration.
- NTg non-transgenic mice
- the transduction efficacy of AAV-PGRN is tested by qPCR and protein expression by ELISA and IHC.
- AAV-PGRN The biodistribution and toxicology of AAV-PGRN is tested in non-transgenic (NTg) and PGRN knockout (PGRN +/- and -/-) mice (see above for stereotactic surgery procedure). Additionally, the biodistribution is investigated by injection of AAV-PGRN into wild-type sheep, whose spinal cord is the same length as man and brain is twice that of the other common non-human primate model, the macaque. Efficacy studies are performed by injecting AAV-PGRN into PGRN +/- and -/-, TDP-43 Q331K and TDP-43 Q331KxWT transgenic mice.
- TDP-43 transgenic mice develop either a slow (Q331K) or more rapid disease progression (TDP-43 Q331K xWT). Their behaviour is monitored using rotarod and grip strength tests to assess motor function, as well as an elevated plus maze for short-term social working memory cognitive testing. Tissues are collected and processed as described above. Animals are injected at 8 weeks of age (IT or ICV) for PGRN and TDP-43 Q33 IK transgenic mice or 2 weeks of age in the case of the TDP-43 Q33 lKxWT transgenic mice due to their aggressive phenotype. Animals are kept for 4 weeks or 6 months and behaviour is monitored on a monthly basis using the tests described above.
- Tissue collected from both sheep and mice is processed for IHC, ELISA, ddPCR and Western blot to measure levels of expression and protein of PGRN, to quantify PGRN mRNA levels and to determine vector genome levels.
- Therapeutic efficacy in TDP-43 transgenic animals is determined by quantifying insoluble TDP-43 levels and activation of microglia and astrocytes by western blot and IHC. Differences in the rate of disease progression and severity of pathology between PGRN and a control vector are statistically analysed.
- Efficacy studies of AAV-PGRN in PGRN +/- and -/- mice is more difficult as the mice show only a very mild phenotype of decreased social dominance in the test tube test and no neuronal loss.
- the -/- mice do show an accumulation of lipofuscin and activated microglia which are readily quantifiable.
- Target engagement will be measured by quantifying lipofuscin reduction and levels of microglia and astroglia activation.
- PGRN localisation to lysosomes will be confirmed to establish correct cellular targeting. Differences in the severity of pathology between PGRN and a control vector will be statistically analysed.
- the PGRN cassette illustrated in Figure 2, 5, 9, 14 or 17 is packaged into AAV serotype 9 and 5 to determine whether the enhanced PRGRN expression is specific to AAV9 or is relevant to other AAV serotypes.
- AKTA purified AAV is tested in vivo and in vitro.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Organic Chemistry (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Neurology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Neurosurgery (AREA)
- Biochemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Virology (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Psychology (AREA)
- Environmental Sciences (AREA)
- Biodiversity & Conservation Biology (AREA)
- Animal Husbandry (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Physical Education & Sports Medicine (AREA)
- Hospice & Palliative Care (AREA)
- Psychiatry (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202410972634.7A CN119753024A (zh) | 2019-09-27 | 2020-09-28 | 载体 |
| US17/763,644 US20220380804A1 (en) | 2019-09-27 | 2020-09-28 | Vector |
| CN202410972636.6A CN119913208A (zh) | 2019-09-27 | 2020-09-28 | 载体 |
| AU2020354538A AU2020354538A1 (en) | 2019-09-27 | 2020-09-28 | Vector |
| CN202080067598.XA CN114450413B (zh) | 2019-09-27 | 2020-09-28 | 载体 |
| EP20781509.3A EP4034664A1 (en) | 2019-09-27 | 2020-09-28 | Vector |
| JP2022519283A JP2022549892A (ja) | 2019-09-27 | 2020-09-28 | ベクター |
| CA3155742A CA3155742A1 (en) | 2019-09-27 | 2020-09-28 | Vector |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GB201913974A GB201913974D0 (en) | 2019-09-27 | 2019-09-27 | Vector |
| GB1913974.0 | 2019-09-27 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021058830A1 true WO2021058830A1 (en) | 2021-04-01 |
Family
ID=68538788
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2020/077144 Ceased WO2021058830A1 (en) | 2019-09-27 | 2020-09-28 | Vector |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US20220380804A1 (https=) |
| EP (1) | EP4034664A1 (https=) |
| JP (1) | JP2022549892A (https=) |
| CN (3) | CN119913208A (https=) |
| AU (1) | AU2020354538A1 (https=) |
| CA (1) | CA3155742A1 (https=) |
| GB (1) | GB201913974D0 (https=) |
| WO (1) | WO2021058830A1 (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023017098A3 (en) * | 2021-08-11 | 2023-03-23 | King's College London | Compositions and methods for improved treatment of disorders affecting the central nervous system |
| WO2024245120A1 (en) * | 2023-05-26 | 2024-12-05 | Shanghai Vitalgen Biopharma Co., Ltd. | Recombinant aav vectors for treating proteinopathies in central nervous system |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN116064624A (zh) * | 2022-09-15 | 2023-05-05 | 思鹏生物科技(苏州)有限公司 | 利用rpl基因促进载体稳定表达的方法及其功能基因 |
Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5122458A (en) | 1984-08-24 | 1992-06-16 | The Upjohn Company | Use of a bgh gdna polyadenylation signal in expression of non-bgh polypeptides in higher eukaryotic cells |
| WO1998011244A2 (en) | 1996-09-11 | 1998-03-19 | The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services | Aav4 vector and uses thereof |
| WO1999061601A2 (en) | 1998-05-28 | 1999-12-02 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Aav5 vector and uses thereof |
| WO2000028061A2 (en) | 1998-11-05 | 2000-05-18 | The Trustees Of The University Of Pennsylvania | Adeno-associated virus serotype 1 nucleic acid sequences, vectors and host cells containing same |
| US6156303A (en) | 1997-06-11 | 2000-12-05 | University Of Washington | Adeno-associated virus (AAV) isolates and AAV vectors derived therefrom |
| WO2008019187A2 (en) * | 2006-05-30 | 2008-02-14 | Mayo Foundation For Medical Education And Research | Detecting and treating dementia |
| WO2012145601A2 (en) | 2011-04-22 | 2012-10-26 | The Regents Of The University Of California | Adeno-associated virus virions with variant capsid and methods of use thereof |
| WO2016115503A1 (en) * | 2015-01-16 | 2016-07-21 | Voyager Therapeutics, Inc. | Central nervous system targeting polynucleotides |
| WO2017151884A1 (en) | 2016-03-02 | 2017-09-08 | The Children's Hospital Of Philadelphia | Therapy for frontotemporal dementia |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6083725A (en) * | 1996-09-13 | 2000-07-04 | Transkaryotic Therapies, Inc. | Tranfected human cells expressing human α-galactosidase A protein |
| US7071172B2 (en) * | 2002-04-30 | 2006-07-04 | The University Of North Carolina At Chapel Hill | Secretion signal vectors |
| DK2931897T3 (en) * | 2012-12-12 | 2018-02-05 | Broad Inst Inc | CONSTRUCTION, MODIFICATION AND OPTIMIZATION OF SYSTEMS, PROCEDURES AND COMPOSITIONS FOR SEQUENCE MANIPULATION AND THERAPEUTICAL APPLICATIONS |
| MX2015017312A (es) * | 2013-06-17 | 2017-04-10 | Broad Inst Inc | Suministro y uso de composiciones, vectores y sistemas crispr-cas para la modificación dirigida y terapia hepáticas. |
| KR102423442B1 (ko) * | 2015-12-11 | 2022-07-20 | 캘리포니아 인스티튜트 오브 테크놀로지 | 아데노-관련 바이러스를 지시하기 위한 타겟팅 펩타이드 |
| KR102709597B1 (ko) * | 2017-10-03 | 2024-09-26 | 프리베일 테라퓨틱스, 인크. | 리소좀 장애를 위한 유전자 요법 |
| IL274926B2 (en) * | 2017-12-01 | 2026-04-01 | Encoded Therapeutics Inc | Pyrazolopyrimidines with activity against respiratory syncytial virus |
| KR102171360B1 (ko) * | 2018-06-22 | 2020-10-28 | 재단법인대구경북과학기술원 | 사이토카인 융합 폴리펩티드, 및 이를 포함하는 사이토카인 라이브러리 |
| JP2022522995A (ja) * | 2019-01-18 | 2022-04-21 | ボイジャー セラピューティクス インコーポレイテッド | Aav粒子を生成するための方法及びシステム |
| BR112021015817A2 (pt) * | 2019-02-22 | 2021-10-13 | The Trustees Of The University Of Pennsylvania | Vírus adeno-associado recombinante para tratamento de neurodegeneração com início na idade adulta associado a grn |
| US12595479B2 (en) * | 2019-03-20 | 2026-04-07 | President And Fellows Of Harvard College | Antisense oligonucleotide-based progranulin augmentation therapy in neurodegenerative diseases |
-
2019
- 2019-09-27 GB GB201913974A patent/GB201913974D0/en not_active Ceased
-
2020
- 2020-09-28 CN CN202410972636.6A patent/CN119913208A/zh active Pending
- 2020-09-28 CN CN202080067598.XA patent/CN114450413B/zh active Active
- 2020-09-28 WO PCT/EP2020/077144 patent/WO2021058830A1/en not_active Ceased
- 2020-09-28 EP EP20781509.3A patent/EP4034664A1/en active Pending
- 2020-09-28 AU AU2020354538A patent/AU2020354538A1/en active Pending
- 2020-09-28 JP JP2022519283A patent/JP2022549892A/ja active Pending
- 2020-09-28 CA CA3155742A patent/CA3155742A1/en active Pending
- 2020-09-28 US US17/763,644 patent/US20220380804A1/en active Pending
- 2020-09-28 CN CN202410972634.7A patent/CN119753024A/zh active Pending
Patent Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5122458A (en) | 1984-08-24 | 1992-06-16 | The Upjohn Company | Use of a bgh gdna polyadenylation signal in expression of non-bgh polypeptides in higher eukaryotic cells |
| WO1998011244A2 (en) | 1996-09-11 | 1998-03-19 | The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services | Aav4 vector and uses thereof |
| US6156303A (en) | 1997-06-11 | 2000-12-05 | University Of Washington | Adeno-associated virus (AAV) isolates and AAV vectors derived therefrom |
| WO1999061601A2 (en) | 1998-05-28 | 1999-12-02 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Aav5 vector and uses thereof |
| WO2000028061A2 (en) | 1998-11-05 | 2000-05-18 | The Trustees Of The University Of Pennsylvania | Adeno-associated virus serotype 1 nucleic acid sequences, vectors and host cells containing same |
| WO2008019187A2 (en) * | 2006-05-30 | 2008-02-14 | Mayo Foundation For Medical Education And Research | Detecting and treating dementia |
| WO2012145601A2 (en) | 2011-04-22 | 2012-10-26 | The Regents Of The University Of California | Adeno-associated virus virions with variant capsid and methods of use thereof |
| WO2016115503A1 (en) * | 2015-01-16 | 2016-07-21 | Voyager Therapeutics, Inc. | Central nervous system targeting polynucleotides |
| WO2017151884A1 (en) | 2016-03-02 | 2017-09-08 | The Children's Hospital Of Philadelphia | Therapy for frontotemporal dementia |
Non-Patent Citations (40)
| Title |
|---|
| "Current Methods in Sequence Comparison and Analysis, Macromolecule Sequencing and Synthesis, Selected Methods and Applications", 1988, ALAN R. LISS, INC, pages: 127 - 149 |
| "GenBan k", Database accession no. NC-006261 |
| "GenBank", Database accession no. MK801287.1 |
| "Methods in Enzymology", vol. 266, 1996, ACADEMIC PRESS, INC., article "Computer Methods for Macromolecular Sequence Analysis" |
| "Pharmaceutical Dosage Forms and Drug Delivery Systems", 1999, LIPPINCOTT, WILLIAMS, & WILKINS |
| A. GENNARO: "Remington: The Science and Practice of Pharmacy", 2000, LIPPINCOTT, WILLIAMS, & WILKINS |
| ALAN B. ROSE: "Introns as Gene Regulators: A Brick on the Accelerator", FRONTIERS IN GENETICS, vol. 9, 7 February 2019 (2019-02-07), Switzerland, XP055758567, ISSN: 1664-8021, DOI: 10.3389/fgene.2018.00672 * |
| ANDERSEN ET AL., CELL. MOL. NEUROBIOL., vol. 13, 1993, pages 503 - 15 |
| ARRANT AW, J. NEUROSCI., vol. 38, no. 9, 2018, pages 2341 - 2358 |
| BANTEL-SCHAAL ET AL., J. VIROLOGY, vol. 73, 1999, pages 3994 |
| BEEL S ET AL., MOL. NEURODEGENER., vol. 13, no. 1, 2018, pages 55 |
| BENJAMIN E. DEVERMAN ET AL: "Gene therapy for neurological disorders: progress and prospects", NATURE REVIEWS DRUG DISCOVERY, vol. 17, no. 9, 10 August 2018 (2018-08-10), GB, pages 641 - 659, XP055609922, ISSN: 1474-1776, DOI: 10.1038/nrd.2018.110 * |
| CHIORINI ET AL., J. VIROLOGY, vol. 71, 1998, pages 6823 |
| CHITRAMUTHU BP ET AL., BRAIN, vol. 140, no. 12, 2017, pages 1447 - 1465 |
| CHOI ET AL., MOLECULAR BRAIN, vol. 7, 2014, pages 17 |
| CHOI T ET AL: "A GENERIC INTRON INCREASES GENE EXPRESSION IN TRANSGENIC MICE", MOLECULAR AND CELLULAR BIOLOGY, AMERICAN SOCIETY FOR PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, US, vol. 11, no. 6, 1 January 1991 (1991-01-01), pages 3070 - 3074, XP007900213, ISSN: 0270-7306 * |
| GAO ET AL., PROC. NAT. ACAD. SCI. USA, vol. 99, 2002, pages 11854 |
| GOODWIN EC, J BIOL CHEM., vol. 267, 1992, pages 16330 - 16334 |
| HINDERER C ET AL., HUM. GENE THER., vol. 29, 2018, pages 285 - 298 |
| HOLLER CJ ET AL., ENEURO, vol. 18, 2017, pages 4 |
| J. MOL. BIOL., vol. 48, 1970, pages 443 - 453 |
| LAI ET AL., MOL. THER., vol. 12, 2005, pages 659 |
| MCCARTHYPHILIPS, HUMAN MOLECULAR GENETICS, vol. 7, 1998, pages 1491 - 1496 |
| MENDELL JR ET AL., N. ENGL. J. MED., vol. 377, no. 18, 2017, pages 1713 - 1722 |
| METH. MOL. BIOL., vol. 70, 1997, pages 173 - 187 |
| MINAMI SS ET AL., NAT. MED., vol. 20, no. 10, 2014, pages 1157 - 64 |
| MORIS ET AL., VIROLOGY, vol. 33, 2004, pages 375 - 383 |
| MURAMATSU ET AL., VIROLOGY, vol. 221, 1996, pages 208 |
| PECHAN ET AL., GENE THER, vol. 16, 2009, pages 10 |
| PETKAU TL ET AL., J. NEUROINFLAMMATION, vol. 14, no. 1, 2017, pages 225 |
| PETKAU TL, NEUROBIOL DIS, vol. 106, 2017, pages 14 - 22 |
| PICCIOLI ET AL., NEURON, vol. 15, 1995, pages 373 - 84 |
| PICCIOLI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, no. 561, 1991, pages 1 - 5 |
| ROHRER JD ET AL., LANCET NEUROL, vol. 14, pages 253 - 262 |
| SHADE ET AL., J. VIROL., vol. 58, 1986, pages 921 |
| SHAUL O., INT J BIOCHEM CELL BIOL, vol. 91, October 2017 (2017-10-01), pages 145 - 155 |
| SMITHWATERMAN, ADVANCES IN APPLIED MATHEMATICS, vol. 2, 1981, pages 482 - 489 |
| SRIVISTAVA ET AL., J. VIROLOGY, vol. 45, 1983, pages 555 |
| VAN KAMPEN JM ET AL., PLOS ONE, vol. 9, no. 5, 2014, pages e97032 |
| WILMOTT ET AL., HUMAN GENE THERAPY METHODS, vol. 30, no. 6, 2019, pages 206 - 213 |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023017098A3 (en) * | 2021-08-11 | 2023-03-23 | King's College London | Compositions and methods for improved treatment of disorders affecting the central nervous system |
| WO2024245120A1 (en) * | 2023-05-26 | 2024-12-05 | Shanghai Vitalgen Biopharma Co., Ltd. | Recombinant aav vectors for treating proteinopathies in central nervous system |
Also Published As
| Publication number | Publication date |
|---|---|
| US20220380804A1 (en) | 2022-12-01 |
| GB201913974D0 (en) | 2019-11-13 |
| CN114450413B (zh) | 2024-08-06 |
| CN119753024A (zh) | 2025-04-04 |
| AU2020354538A1 (en) | 2022-03-31 |
| CN119913208A (zh) | 2025-05-02 |
| EP4034664A1 (en) | 2022-08-03 |
| CA3155742A1 (en) | 2021-04-01 |
| JP2022549892A (ja) | 2022-11-29 |
| CN114450413A (zh) | 2022-05-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP3702466B1 (en) | Products and methods for treatment of amyotrophic lateral sclerosis | |
| US12023386B2 (en) | Composition for treatment of Crigler-Najjar syndrome | |
| US20200289673A1 (en) | Treatment of glycogen storage disease iii | |
| US20220380804A1 (en) | Vector | |
| US20230295657A1 (en) | Gene therapy using nucleic acid constructs comprising methyl cpg binding protein 2 (mecp2) promoter sequences | |
| KR20250131772A (ko) | 전두측두엽 치매에 대한 유전자 요법 | |
| US20250188128A1 (en) | Adeno-associated virus compositions having increased heart enrichment | |
| EP3860659A1 (en) | Compositions useful for treating gm1 gangliosidosis | |
| EP4153757A1 (en) | Vectors encoding a glucose-6-phosphatase (g6pase-a) for gene therapy | |
| TWI874898B (zh) | 用於高歇氏(gaucher)病之基因療法 | |
| EP4680752A1 (en) | Gene therapy | |
| HK40098369A (en) | Products and methods for treatment of amyotrophic lateral sclerosis | |
| WO2023168400A2 (en) | Materials and methods for the treatment of eif2b5 mutations and diseases resulting therefrom | |
| AU2024320694A1 (en) | Compositions and methods for treatment of spinal muscular atrophy | |
| HK40031811A (en) | Products and methods for treatment of amyotrophic lateral sclerosis |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20781509 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3155742 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022519283 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020354538 Country of ref document: AU Date of ref document: 20200928 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2020781509 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2020781509 Country of ref document: EP Effective date: 20220428 |