WO2021025626A1 - Genetically modified nk cells and uses thereof - Google Patents
Genetically modified nk cells and uses thereof Download PDFInfo
- Publication number
- WO2021025626A1 WO2021025626A1 PCT/SG2020/050463 SG2020050463W WO2021025626A1 WO 2021025626 A1 WO2021025626 A1 WO 2021025626A1 SG 2020050463 W SG2020050463 W SG 2020050463W WO 2021025626 A1 WO2021025626 A1 WO 2021025626A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- cell
- cxcr1
- nucleic acid
- tumor
- Prior art date
Links
- 210000000822 natural killer cell Anatomy 0.000 title claims abstract description 322
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 197
- 101000947174 Homo sapiens C-X-C chemokine receptor type 1 Proteins 0.000 claims abstract description 180
- 102100036166 C-X-C chemokine receptor type 1 Human genes 0.000 claims abstract description 179
- 210000004027 cell Anatomy 0.000 claims abstract description 122
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims abstract description 112
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 86
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 82
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 82
- 238000000034 method Methods 0.000 claims abstract description 67
- 201000011510 cancer Diseases 0.000 claims abstract description 56
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 13
- 239000000427 antigen Substances 0.000 claims description 70
- 108091007433 antigens Proteins 0.000 claims description 70
- 102000036639 antigens Human genes 0.000 claims description 70
- 238000009739 binding Methods 0.000 claims description 33
- 230000027455 binding Effects 0.000 claims description 32
- 239000012634 fragment Substances 0.000 claims description 19
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 claims description 11
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 claims description 11
- 230000000735 allogeneic effect Effects 0.000 claims description 9
- 238000004520 electroporation Methods 0.000 claims description 8
- 230000004913 activation Effects 0.000 claims description 7
- 230000004068 intracellular signaling Effects 0.000 claims description 7
- 210000004263 induced pluripotent stem cell Anatomy 0.000 claims description 5
- 210000004700 fetal blood Anatomy 0.000 claims description 4
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 claims description 2
- 210000002798 bone marrow cell Anatomy 0.000 claims description 2
- 210000005259 peripheral blood Anatomy 0.000 claims description 2
- 239000011886 peripheral blood Substances 0.000 claims description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 claims description 2
- 101000589301 Homo sapiens Natural cytotoxicity triggering receptor 1 Proteins 0.000 claims 1
- 101000589305 Homo sapiens Natural cytotoxicity triggering receptor 2 Proteins 0.000 claims 1
- 108010001657 NK Cell Lectin-Like Receptor Subfamily K Proteins 0.000 claims 1
- 102000000812 NK Cell Lectin-Like Receptor Subfamily K Human genes 0.000 claims 1
- 102100032851 Natural cytotoxicity triggering receptor 2 Human genes 0.000 claims 1
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 abstract description 23
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 abstract description 2
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 abstract 1
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 abstract 1
- 230000014509 gene expression Effects 0.000 description 53
- 241000699670 Mus sp. Species 0.000 description 51
- 108090000623 proteins and genes Proteins 0.000 description 38
- 108020004999 messenger RNA Proteins 0.000 description 32
- 108090000765 processed proteins & peptides Proteins 0.000 description 31
- 102100031940 Epithelial cell adhesion molecule Human genes 0.000 description 30
- 125000003275 alpha amino acid group Chemical group 0.000 description 28
- 102000004169 proteins and genes Human genes 0.000 description 27
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 26
- 239000003446 ligand Substances 0.000 description 26
- 230000003211 malignant effect Effects 0.000 description 26
- 125000003729 nucleotide group Chemical group 0.000 description 24
- 241000282414 Homo sapiens Species 0.000 description 23
- 102000004196 processed proteins & peptides Human genes 0.000 description 23
- 238000011282 treatment Methods 0.000 description 23
- 108020004414 DNA Proteins 0.000 description 22
- 239000002773 nucleotide Substances 0.000 description 21
- 125000000539 amino acid group Chemical group 0.000 description 20
- 238000003384 imaging method Methods 0.000 description 19
- 229920001184 polypeptide Polymers 0.000 description 18
- 239000013598 vector Substances 0.000 description 18
- -1 Ras Proteins 0.000 description 17
- 230000005012 migration Effects 0.000 description 17
- 238000013508 migration Methods 0.000 description 17
- 230000002018 overexpression Effects 0.000 description 17
- 108020005345 3' Untranslated Regions Proteins 0.000 description 15
- 239000013604 expression vector Substances 0.000 description 15
- 238000001727 in vivo Methods 0.000 description 15
- 239000007924 injection Substances 0.000 description 15
- 238000002347 injection Methods 0.000 description 15
- 201000010099 disease Diseases 0.000 description 14
- 238000000338 in vitro Methods 0.000 description 14
- 238000011081 inoculation Methods 0.000 description 14
- 239000000203 mixture Substances 0.000 description 14
- 210000004881 tumor cell Anatomy 0.000 description 14
- 108091028043 Nucleic acid sequence Proteins 0.000 description 13
- 210000001744 T-lymphocyte Anatomy 0.000 description 13
- 230000002147 killing effect Effects 0.000 description 13
- 108091033319 polynucleotide Proteins 0.000 description 13
- 102000040430 polynucleotide Human genes 0.000 description 13
- 239000002157 polynucleotide Substances 0.000 description 13
- 150000001413 amino acids Chemical class 0.000 description 12
- 230000010261 cell growth Effects 0.000 description 12
- 208000035475 disorder Diseases 0.000 description 12
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 11
- 102000005962 receptors Human genes 0.000 description 11
- 108020003175 receptors Proteins 0.000 description 11
- 230000011664 signaling Effects 0.000 description 11
- 210000001519 tissue Anatomy 0.000 description 11
- 238000013518 transcription Methods 0.000 description 11
- 230000035897 transcription Effects 0.000 description 11
- 201000009030 Carcinoma Diseases 0.000 description 10
- 206010033128 Ovarian cancer Diseases 0.000 description 10
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 10
- 238000007920 subcutaneous administration Methods 0.000 description 10
- 206010061535 Ovarian neoplasm Diseases 0.000 description 9
- 230000004907 flux Effects 0.000 description 9
- 210000003462 vein Anatomy 0.000 description 9
- 102000004127 Cytokines Human genes 0.000 description 8
- 108090000695 Cytokines Proteins 0.000 description 8
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 8
- 230000029918 bioluminescence Effects 0.000 description 8
- 238000005415 bioluminescence Methods 0.000 description 8
- 238000002474 experimental method Methods 0.000 description 8
- 230000003834 intracellular effect Effects 0.000 description 8
- 238000003752 polymerase chain reaction Methods 0.000 description 8
- 238000013519 translation Methods 0.000 description 8
- 206010025323 Lymphomas Diseases 0.000 description 7
- 208000009956 adenocarcinoma Diseases 0.000 description 7
- 230000000694 effects Effects 0.000 description 7
- 230000006870 function Effects 0.000 description 7
- 238000001990 intravenous administration Methods 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 7
- 230000003612 virological effect Effects 0.000 description 7
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 6
- 210000004899 c-terminal region Anatomy 0.000 description 6
- 230000001976 improved effect Effects 0.000 description 6
- 201000001441 melanoma Diseases 0.000 description 6
- 230000004048 modification Effects 0.000 description 6
- 238000012986 modification Methods 0.000 description 6
- 230000001105 regulatory effect Effects 0.000 description 6
- 241000894007 species Species 0.000 description 6
- 230000004083 survival effect Effects 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 102100027685 Hemoglobin subunit alpha Human genes 0.000 description 5
- 108091005902 Hemoglobin subunit alpha Proteins 0.000 description 5
- 101000920667 Homo sapiens Epithelial cell adhesion molecule Proteins 0.000 description 5
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 5
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 5
- 102000004890 Interleukin-8 Human genes 0.000 description 5
- 108090001007 Interleukin-8 Proteins 0.000 description 5
- 239000002552 dosage form Substances 0.000 description 5
- 239000003814 drug Substances 0.000 description 5
- 210000002865 immune cell Anatomy 0.000 description 5
- 230000008595 infiltration Effects 0.000 description 5
- 238000001764 infiltration Methods 0.000 description 5
- 208000032839 leukemia Diseases 0.000 description 5
- 210000004698 lymphocyte Anatomy 0.000 description 5
- 230000036210 malignancy Effects 0.000 description 5
- 230000002611 ovarian Effects 0.000 description 5
- 208000003200 Adenoma Diseases 0.000 description 4
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 4
- 108010002350 Interleukin-2 Proteins 0.000 description 4
- 206010061269 Malignant peritoneal neoplasm Diseases 0.000 description 4
- 241000699666 Mus <mouse, genus> Species 0.000 description 4
- 102000015636 Oligopeptides Human genes 0.000 description 4
- 108010038807 Oligopeptides Proteins 0.000 description 4
- 206010039491 Sarcoma Diseases 0.000 description 4
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 4
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 4
- 210000000170 cell membrane Anatomy 0.000 description 4
- 238000002659 cell therapy Methods 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 239000002299 complementary DNA Substances 0.000 description 4
- 102000003675 cytokine receptors Human genes 0.000 description 4
- 108010057085 cytokine receptors Proteins 0.000 description 4
- 239000000975 dye Substances 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 201000010536 head and neck cancer Diseases 0.000 description 4
- 208000014829 head and neck neoplasm Diseases 0.000 description 4
- 238000001802 infusion Methods 0.000 description 4
- 229940096397 interleukin-8 Drugs 0.000 description 4
- XKTZWUACRZHVAN-VADRZIEHSA-N interleukin-8 Chemical compound C([C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@@H](NC(C)=O)CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N1[C@H](CCC1)C(=O)N1[C@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC(O)=CC=1)C(=O)N[C@H](CO)C(=O)N1[C@H](CCC1)C(N)=O)C1=CC=CC=C1 XKTZWUACRZHVAN-VADRZIEHSA-N 0.000 description 4
- 108091008582 intracellular receptors Proteins 0.000 description 4
- 102000027411 intracellular receptors Human genes 0.000 description 4
- 238000007912 intraperitoneal administration Methods 0.000 description 4
- 239000007928 intraperitoneal injection Substances 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 238000010369 molecular cloning Methods 0.000 description 4
- 201000002524 peritoneal carcinoma Diseases 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 230000000638 stimulation Effects 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 230000002103 transcriptional effect Effects 0.000 description 4
- 230000004614 tumor growth Effects 0.000 description 4
- 108020005176 AU Rich Elements Proteins 0.000 description 3
- 206010003571 Astrocytoma Diseases 0.000 description 3
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 3
- 206010006187 Breast cancer Diseases 0.000 description 3
- 208000026310 Breast neoplasm Diseases 0.000 description 3
- 101150013553 CD40 gene Proteins 0.000 description 3
- 108050000299 Chemokine receptor Proteins 0.000 description 3
- 102000009410 Chemokine receptor Human genes 0.000 description 3
- 206010009944 Colon cancer Diseases 0.000 description 3
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 3
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 3
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 3
- 208000009329 Graft vs Host Disease Diseases 0.000 description 3
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 3
- 101001002657 Homo sapiens Interleukin-2 Proteins 0.000 description 3
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 3
- 108060003951 Immunoglobulin Proteins 0.000 description 3
- 102100025390 Integrin beta-2 Human genes 0.000 description 3
- 108091092195 Intron Proteins 0.000 description 3
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 3
- 102000043129 MHC class I family Human genes 0.000 description 3
- 108091054437 MHC class I family Proteins 0.000 description 3
- 108700011259 MicroRNAs Proteins 0.000 description 3
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 description 3
- 108091036407 Polyadenylation Proteins 0.000 description 3
- 102100027208 T-cell antigen CD7 Human genes 0.000 description 3
- 108091036066 Three prime untranslated region Proteins 0.000 description 3
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 3
- 239000013543 active substance Substances 0.000 description 3
- 208000020990 adrenal cortex carcinoma Diseases 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 210000001185 bone marrow Anatomy 0.000 description 3
- 210000004556 brain Anatomy 0.000 description 3
- 238000002619 cancer immunotherapy Methods 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 238000012258 culturing Methods 0.000 description 3
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 238000012239 gene modification Methods 0.000 description 3
- 230000005017 genetic modification Effects 0.000 description 3
- 235000013617 genetically modified food Nutrition 0.000 description 3
- 208000024908 graft versus host disease Diseases 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 102000018358 immunoglobulin Human genes 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 210000004072 lung Anatomy 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 210000004379 membrane Anatomy 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 206010027191 meningioma Diseases 0.000 description 3
- 210000004303 peritoneum Anatomy 0.000 description 3
- 102000028499 poly(A) binding Human genes 0.000 description 3
- 108091023021 poly(A) binding Proteins 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 230000035755 proliferation Effects 0.000 description 3
- 238000003259 recombinant expression Methods 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 239000000523 sample Substances 0.000 description 3
- 125000006850 spacer group Chemical group 0.000 description 3
- 230000010473 stable expression Effects 0.000 description 3
- 238000006467 substitution reaction Methods 0.000 description 3
- 230000026683 transduction Effects 0.000 description 3
- 238000010361 transduction Methods 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- 230000001052 transient effect Effects 0.000 description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 102100027207 CD27 antigen Human genes 0.000 description 2
- 102100037904 CD9 antigen Human genes 0.000 description 2
- 201000000274 Carcinosarcoma Diseases 0.000 description 2
- 206010008342 Cervix carcinoma Diseases 0.000 description 2
- 208000005243 Chondrosarcoma Diseases 0.000 description 2
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 2
- 102100026234 Cytokine receptor common subunit gamma Human genes 0.000 description 2
- 201000008808 Fibrosarcoma Diseases 0.000 description 2
- 206010066476 Haematological malignancy Diseases 0.000 description 2
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 2
- 208000017604 Hodgkin disease Diseases 0.000 description 2
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 2
- 101000738354 Homo sapiens CD9 antigen Proteins 0.000 description 2
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 2
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 2
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 2
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 2
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 2
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 2
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 2
- 241000701806 Human papillomavirus Species 0.000 description 2
- 206010021042 Hypopharyngeal cancer Diseases 0.000 description 2
- 206010056305 Hypopharyngeal neoplasm Diseases 0.000 description 2
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 2
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 2
- 208000008839 Kidney Neoplasms Diseases 0.000 description 2
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 2
- 206010024612 Lipoma Diseases 0.000 description 2
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 2
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 2
- 206010027145 Melanocytic naevus Diseases 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 208000034578 Multiple myelomas Diseases 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 201000004458 Myoma Diseases 0.000 description 2
- 206010061309 Neoplasm progression Diseases 0.000 description 2
- 206010029260 Neuroblastoma Diseases 0.000 description 2
- 208000005890 Neuroma Diseases 0.000 description 2
- 201000010133 Oligodendroglioma Diseases 0.000 description 2
- 208000000035 Osteochondroma Diseases 0.000 description 2
- 206010061332 Paraganglion neoplasm Diseases 0.000 description 2
- 108010029485 Protein Isoforms Proteins 0.000 description 2
- 102000001708 Protein Isoforms Human genes 0.000 description 2
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 206010038389 Renal cancer Diseases 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 108091008874 T cell receptors Proteins 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 2
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 description 2
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 2
- 102100023935 Transmembrane glycoprotein NMB Human genes 0.000 description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 2
- 206010046798 Uterine leiomyoma Diseases 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 241000021375 Xenogenes Species 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 230000002707 ameloblastic effect Effects 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 230000000259 anti-tumor effect Effects 0.000 description 2
- 230000006023 anti-tumor response Effects 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 210000004204 blood vessel Anatomy 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 230000005880 cancer cell killing Effects 0.000 description 2
- 125000002091 cationic group Chemical group 0.000 description 2
- 229920006317 cationic polymer Polymers 0.000 description 2
- 230000012292 cell migration Effects 0.000 description 2
- 239000006285 cell suspension Substances 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 201000010881 cervical cancer Diseases 0.000 description 2
- 208000009060 clear cell adenocarcinoma Diseases 0.000 description 2
- 210000001072 colon Anatomy 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 229940127089 cytotoxic agent Drugs 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 230000003292 diminished effect Effects 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- 210000001671 embryonic stem cell Anatomy 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 206010016629 fibroma Diseases 0.000 description 2
- 230000003325 follicular Effects 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 206010017758 gastric cancer Diseases 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 201000011066 hemangioma Diseases 0.000 description 2
- 208000019691 hematopoietic and lymphoid cell neoplasm Diseases 0.000 description 2
- 201000006866 hypopharynx cancer Diseases 0.000 description 2
- 230000002519 immonomodulatory effect Effects 0.000 description 2
- 230000005965 immune activity Effects 0.000 description 2
- 239000012642 immune effector Substances 0.000 description 2
- 229940121354 immunomodulator Drugs 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 210000005007 innate immune system Anatomy 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 201000010982 kidney cancer Diseases 0.000 description 2
- 201000010260 leiomyoma Diseases 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 201000007270 liver cancer Diseases 0.000 description 2
- 208000014018 liver neoplasm Diseases 0.000 description 2
- 230000004807 localization Effects 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- 230000000527 lymphocytic effect Effects 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 210000003205 muscle Anatomy 0.000 description 2
- 208000025113 myeloid leukemia Diseases 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 201000008968 osteosarcoma Diseases 0.000 description 2
- 208000007312 paraganglioma Diseases 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 210000003491 skin Anatomy 0.000 description 2
- 210000000278 spinal cord Anatomy 0.000 description 2
- 206010041823 squamous cell carcinoma Diseases 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 201000011549 stomach cancer Diseases 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 101150047061 tag-72 gene Proteins 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- ANRHNWWPFJCPAZ-UHFFFAOYSA-M thionine Chemical compound [Cl-].C1=CC(N)=CC2=[S+]C3=CC(N)=CC=C3N=C21 ANRHNWWPFJCPAZ-UHFFFAOYSA-M 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- 230000010474 transient expression Effects 0.000 description 2
- 230000014621 translational initiation Effects 0.000 description 2
- 108091007466 transmembrane glycoproteins Proteins 0.000 description 2
- 230000032258 transport Effects 0.000 description 2
- 230000005751 tumor progression Effects 0.000 description 2
- 210000001835 viscera Anatomy 0.000 description 2
- LKKMLIBUAXYLOY-UHFFFAOYSA-N 3-Amino-1-methyl-5H-pyrido[4,3-b]indole Chemical compound N1C2=CC=CC=C2C2=C1C=C(N)N=C2C LKKMLIBUAXYLOY-UHFFFAOYSA-N 0.000 description 1
- HVCOBJNICQPDBP-UHFFFAOYSA-N 3-[3-[3,5-dihydroxy-6-methyl-4-(3,4,5-trihydroxy-6-methyloxan-2-yl)oxyoxan-2-yl]oxydecanoyloxy]decanoic acid;hydrate Chemical compound O.OC1C(OC(CC(=O)OC(CCCCCCC)CC(O)=O)CCCCCCC)OC(C)C(O)C1OC1C(O)C(O)C(O)C(C)O1 HVCOBJNICQPDBP-UHFFFAOYSA-N 0.000 description 1
- WEVYNIUIFUYDGI-UHFFFAOYSA-N 3-[6-[4-(trifluoromethoxy)anilino]-4-pyrimidinyl]benzamide Chemical compound NC(=O)C1=CC=CC(C=2N=CN=C(NC=3C=CC(OC(F)(F)F)=CC=3)C=2)=C1 WEVYNIUIFUYDGI-UHFFFAOYSA-N 0.000 description 1
- UZOVYGYOLBIAJR-UHFFFAOYSA-N 4-isocyanato-4'-methyldiphenylmethane Chemical compound C1=CC(C)=CC=C1CC1=CC=C(N=C=O)C=C1 UZOVYGYOLBIAJR-UHFFFAOYSA-N 0.000 description 1
- 102100030310 5,6-dihydroxyindole-2-carboxylic acid oxidase Human genes 0.000 description 1
- 101710163881 5,6-dihydroxyindole-2-carboxylic acid oxidase Proteins 0.000 description 1
- 101710163573 5-hydroxyisourate hydrolase Proteins 0.000 description 1
- 208000002008 AIDS-Related Lymphoma Diseases 0.000 description 1
- 206010000060 Abdominal distension Diseases 0.000 description 1
- 208000016557 Acute basophilic leukemia Diseases 0.000 description 1
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 206010001233 Adenoma benign Diseases 0.000 description 1
- 208000004804 Adenomatous Polyps Diseases 0.000 description 1
- 101710170885 Alpha-catulin Proteins 0.000 description 1
- 208000012791 Alpha-heavy chain disease Diseases 0.000 description 1
- 201000003076 Angiosarcoma Diseases 0.000 description 1
- 108010031480 Artificial Receptors Proteins 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- 206010065869 Astrocytoma, low grade Diseases 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 102100035526 B melanoma antigen 1 Human genes 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000003950 B-cell lymphoma Diseases 0.000 description 1
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 208000035821 Benign schwannoma Diseases 0.000 description 1
- 102000015735 Beta-catenin Human genes 0.000 description 1
- 108060000903 Beta-catenin Proteins 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 208000007690 Brenner tumor Diseases 0.000 description 1
- 206010073258 Brenner tumour Diseases 0.000 description 1
- 208000003170 Bronchiolo-Alveolar Adenocarcinoma Diseases 0.000 description 1
- 102100028989 C-X-C chemokine receptor type 2 Human genes 0.000 description 1
- 108050009406 C-type lectin-like Proteins 0.000 description 1
- 102000002086 C-type lectin-like Human genes 0.000 description 1
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 1
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 1
- 102100025221 CD70 antigen Human genes 0.000 description 1
- 102100035793 CD83 antigen Human genes 0.000 description 1
- 101150013700 CXCR1 gene Proteins 0.000 description 1
- 102000000905 Cadherin Human genes 0.000 description 1
- 108050007957 Cadherin Proteins 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 206010007275 Carcinoid tumour Diseases 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 102000016289 Cell Adhesion Molecules Human genes 0.000 description 1
- 108010067225 Cell Adhesion Molecules Proteins 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 206010008583 Chloroma Diseases 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 208000006332 Choriocarcinoma Diseases 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 108010025464 Cyclin-Dependent Kinase 4 Proteins 0.000 description 1
- 102000013701 Cyclin-Dependent Kinase 4 Human genes 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- 101710189311 Cytokine receptor common subunit gamma Proteins 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 108010054576 Deoxyribonuclease EcoRI Proteins 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 208000037162 Ductal Breast Carcinoma Diseases 0.000 description 1
- 208000007033 Dysgerminoma Diseases 0.000 description 1
- 101150084967 EPCAM gene Proteins 0.000 description 1
- 201000009051 Embryonal Carcinoma Diseases 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 101710147220 Ent-copalyl diphosphate synthase, chloroplastic Proteins 0.000 description 1
- 206010014958 Eosinophilic leukaemia Diseases 0.000 description 1
- 206010014967 Ependymoma Diseases 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 208000031637 Erythroblastic Acute Leukemia Diseases 0.000 description 1
- 208000036566 Erythroleukaemia Diseases 0.000 description 1
- 208000006168 Ewing Sarcoma Diseases 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 201000006107 Familial adenomatous polyposis Diseases 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 102100028073 Fibroblast growth factor 5 Human genes 0.000 description 1
- 108090000380 Fibroblast growth factor 5 Proteins 0.000 description 1
- 206010053717 Fibrous histiocytoma Diseases 0.000 description 1
- 108090000331 Firefly luciferases Proteins 0.000 description 1
- 101710164820 Flotillin-2 Proteins 0.000 description 1
- 208000004463 Follicular Adenocarcinoma Diseases 0.000 description 1
- 102100039717 G antigen 1 Human genes 0.000 description 1
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 1
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 1
- 101710113436 GTPase KRas Proteins 0.000 description 1
- 102100040510 Galectin-3-binding protein Human genes 0.000 description 1
- 101710197901 Galectin-3-binding protein Proteins 0.000 description 1
- 206010017708 Ganglioneuroblastoma Diseases 0.000 description 1
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 1
- 208000031852 Gastrointestinal stromal cancer Diseases 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 208000034951 Genetic Translocation Diseases 0.000 description 1
- 208000008999 Giant Cell Carcinoma Diseases 0.000 description 1
- 208000002966 Giant Cell Tumor of Bone Diseases 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 1
- 229930186217 Glycolipid Natural products 0.000 description 1
- 208000005234 Granulosa Cell Tumor Diseases 0.000 description 1
- 102100028967 HLA class I histocompatibility antigen, alpha chain G Human genes 0.000 description 1
- 101710197836 HLA class I histocompatibility antigen, alpha chain G Proteins 0.000 description 1
- 208000002125 Hemangioendothelioma Diseases 0.000 description 1
- 208000006050 Hemangiopericytoma Diseases 0.000 description 1
- 208000001258 Hemangiosarcoma Diseases 0.000 description 1
- 108091005904 Hemoglobin subunit beta Proteins 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 208000002291 Histiocytic Sarcoma Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000874316 Homo sapiens B melanoma antigen 1 Proteins 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101100165850 Homo sapiens CA9 gene Proteins 0.000 description 1
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 1
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 description 1
- 101100441536 Homo sapiens CXCR1 gene Proteins 0.000 description 1
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 1
- 101000886137 Homo sapiens G antigen 1 Proteins 0.000 description 1
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 1
- 101001103039 Homo sapiens Inactive tyrosine-protein kinase transmembrane receptor ROR1 Proteins 0.000 description 1
- 101001078143 Homo sapiens Integrin alpha-IIb Proteins 0.000 description 1
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 1
- 101000991061 Homo sapiens MHC class I polypeptide-related sequence B Proteins 0.000 description 1
- 101000934372 Homo sapiens Macrosialin Proteins 0.000 description 1
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 1
- 101001103036 Homo sapiens Nuclear receptor ROR-alpha Proteins 0.000 description 1
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 101001062222 Homo sapiens Receptor-binding cancer antigen expressed on SiSo cells Proteins 0.000 description 1
- 101000973629 Homo sapiens Ribosome quality control complex subunit NEMF Proteins 0.000 description 1
- 101000914496 Homo sapiens T-cell antigen CD7 Proteins 0.000 description 1
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 description 1
- 101000847107 Homo sapiens Tetraspanin-8 Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- 101000671653 Homo sapiens U3 small nucleolar RNA-associated protein 14 homolog A Proteins 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 108010052919 Hydroxyethylthiazole kinase Proteins 0.000 description 1
- 108010027436 Hydroxymethylpyrimidine kinase Proteins 0.000 description 1
- 206010048643 Hypereosinophilic syndrome Diseases 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 208000007866 Immunoproliferative Small Intestinal Disease Diseases 0.000 description 1
- 102100039615 Inactive tyrosine-protein kinase transmembrane receptor ROR1 Human genes 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102100025306 Integrin alpha-IIb Human genes 0.000 description 1
- 108010030506 Integrin alpha6beta4 Proteins 0.000 description 1
- 102000002227 Interferon Type I Human genes 0.000 description 1
- 108010014726 Interferon Type I Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 108010018951 Interleukin-8B Receptors Proteins 0.000 description 1
- 201000008869 Juxtacortical Osteosarcoma Diseases 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 102100031413 L-dopachrome tautomerase Human genes 0.000 description 1
- 101710093778 L-dopachrome tautomerase Proteins 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 206010024305 Leukaemia monocytic Diseases 0.000 description 1
- 201000004462 Leydig Cell Tumor Diseases 0.000 description 1
- 208000000265 Lobular Carcinoma Diseases 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 241000219745 Lupinus Species 0.000 description 1
- 208000028018 Lymphocytic leukaemia Diseases 0.000 description 1
- 206010025312 Lymphoma AIDS related Diseases 0.000 description 1
- 102000016200 MART-1 Antigen Human genes 0.000 description 1
- 108010010995 MART-1 Antigen Proteins 0.000 description 1
- 102100030300 MHC class I polypeptide-related sequence B Human genes 0.000 description 1
- 102100025136 Macrosialin Human genes 0.000 description 1
- 208000035771 Malignant Sertoli-Leydig cell tumor of the ovary Diseases 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 208000025205 Mantle-Cell Lymphoma Diseases 0.000 description 1
- 208000007054 Medullary Carcinoma Diseases 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 208000002030 Merkel cell carcinoma Diseases 0.000 description 1
- 201000009574 Mesenchymal Chondrosarcoma Diseases 0.000 description 1
- 102000003735 Mesothelin Human genes 0.000 description 1
- 108090000015 Mesothelin Proteins 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 206010054949 Metaplasia Diseases 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 206010057269 Mucoepidermoid carcinoma Diseases 0.000 description 1
- 208000010357 Mullerian Mixed Tumor Diseases 0.000 description 1
- 101000989934 Mus musculus Hemoglobin subunit alpha Proteins 0.000 description 1
- 101100404853 Mus musculus Klrk1 gene Proteins 0.000 description 1
- 108091061960 Naked DNA Proteins 0.000 description 1
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 1
- 206010029488 Nodular melanoma Diseases 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 208000007871 Odontogenic Tumors Diseases 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 102000043276 Oncogene Human genes 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 208000010191 Osteitis Deformans Diseases 0.000 description 1
- 206010073261 Ovarian theca cell tumour Diseases 0.000 description 1
- 208000027868 Paget disease Diseases 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 208000030852 Parasitic disease Diseases 0.000 description 1
- 208000009077 Pigmented Nevus Diseases 0.000 description 1
- 208000019262 Pilomatrix carcinoma Diseases 0.000 description 1
- 208000007641 Pinealoma Diseases 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 229920002873 Polyethylenimine Polymers 0.000 description 1
- 108010039918 Polylysine Proteins 0.000 description 1
- 208000037062 Polyps Diseases 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 102100037681 Protein FEV Human genes 0.000 description 1
- 101710198166 Protein FEV Proteins 0.000 description 1
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 1
- 102100029165 Receptor-binding cancer antigen expressed on SiSo cells Human genes 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 102000009661 Repressor Proteins Human genes 0.000 description 1
- 108010034634 Repressor Proteins Proteins 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 102100022213 Ribosome quality control complex subunit NEMF Human genes 0.000 description 1
- 206010061934 Salivary gland cancer Diseases 0.000 description 1
- 206010070834 Sensitisation Diseases 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 208000000097 Sertoli-Leydig cell tumor Diseases 0.000 description 1
- 101710173693 Short transient receptor potential channel 1 Proteins 0.000 description 1
- 101710173694 Short transient receptor potential channel 2 Proteins 0.000 description 1
- 208000003252 Signet Ring Cell Carcinoma Diseases 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- 208000009574 Skin Appendage Carcinoma Diseases 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- 102100021912 Sperm-associated antigen 7 Human genes 0.000 description 1
- 206010042553 Superficial spreading melanoma stage unspecified Diseases 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 102100037906 T-cell surface glycoprotein CD3 zeta chain Human genes 0.000 description 1
- 101710156660 T-cell surface glycoprotein CD3 zeta chain Proteins 0.000 description 1
- 101150057140 TACSTD1 gene Proteins 0.000 description 1
- 101150031162 TM4SF1 gene Proteins 0.000 description 1
- 206010043276 Teratoma Diseases 0.000 description 1
- 201000009365 Thymic carcinoma Diseases 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- 102100034902 Transmembrane 4 L6 family member 1 Human genes 0.000 description 1
- LVTKHGUGBGNBPL-UHFFFAOYSA-N Trp-P-1 Chemical compound N1C2=CC=CC=C2C2=C1C(C)=C(N)N=C2C LVTKHGUGBGNBPL-UHFFFAOYSA-N 0.000 description 1
- 102000044209 Tumor Suppressor Genes Human genes 0.000 description 1
- 108700025716 Tumor Suppressor Genes Proteins 0.000 description 1
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- 102000003425 Tyrosinase Human genes 0.000 description 1
- 108060008724 Tyrosinase Proteins 0.000 description 1
- 102100040099 U3 small nucleolar RNA-associated protein 14 homolog A Human genes 0.000 description 1
- 102100040012 UL16-binding protein 1 Human genes 0.000 description 1
- 101710173409 UL16-binding protein 1 Proteins 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- 208000006336 acinar cell carcinoma Diseases 0.000 description 1
- 206010000583 acral lentiginous melanoma Diseases 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000011149 active material Substances 0.000 description 1
- 208000021841 acute erythroid leukemia Diseases 0.000 description 1
- 230000033289 adaptive immune response Effects 0.000 description 1
- 239000012082 adaptor molecule Substances 0.000 description 1
- 208000002517 adenoid cystic carcinoma Diseases 0.000 description 1
- 201000008395 adenosquamous carcinoma Diseases 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N adenyl group Chemical group N1=CN=C2N=CNC2=C1N GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 210000001789 adipocyte Anatomy 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 238000011467 adoptive cell therapy Methods 0.000 description 1
- 230000001919 adrenal effect Effects 0.000 description 1
- 210000004100 adrenal gland Anatomy 0.000 description 1
- 208000007128 adrenocortical carcinoma Diseases 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 229960000548 alemtuzumab Drugs 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- 206010065867 alveolar rhabdomyosarcoma Diseases 0.000 description 1
- 208000006431 amelanotic melanoma Diseases 0.000 description 1
- 208000010029 ameloblastoma Diseases 0.000 description 1
- 238000000540 analysis of variance Methods 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 238000011224 anti-cancer immunotherapy Methods 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 239000002260 anti-inflammatory agent Substances 0.000 description 1
- 230000003110 anti-inflammatory effect Effects 0.000 description 1
- 230000001139 anti-pruritic effect Effects 0.000 description 1
- 210000000612 antigen-presenting cell Anatomy 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 239000003908 antipruritic agent Substances 0.000 description 1
- 201000007436 apocrine adenocarcinoma Diseases 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 239000003212 astringent agent Substances 0.000 description 1
- 201000005476 astroblastoma Diseases 0.000 description 1
- 239000012752 auxiliary agent Substances 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 201000007551 basophilic adenocarcinoma Diseases 0.000 description 1
- 208000001119 benign fibrous histiocytoma Diseases 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 239000003124 biologic agent Substances 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 201000000053 blastoma Diseases 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 208000007047 blue nevus Diseases 0.000 description 1
- 201000011143 bone giant cell tumor Diseases 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 201000008275 breast carcinoma Diseases 0.000 description 1
- 201000003714 breast lobular carcinoma Diseases 0.000 description 1
- 201000011054 breast malignant phyllodes tumor Diseases 0.000 description 1
- 229960000455 brentuximab vedotin Drugs 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 208000002458 carcinoid tumor Diseases 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 210000000845 cartilage Anatomy 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 210000004534 cecum Anatomy 0.000 description 1
- 210000003855 cell nucleus Anatomy 0.000 description 1
- 239000002458 cell surface marker Substances 0.000 description 1
- 238000009172 cell transfer therapy Methods 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 201000007455 central nervous system cancer Diseases 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 201000002891 ceruminous adenocarcinoma Diseases 0.000 description 1
- 208000024188 ceruminous carcinoma Diseases 0.000 description 1
- YTRQFSDWAXHJCC-UHFFFAOYSA-N chloroform;phenol Chemical compound ClC(Cl)Cl.OC1=CC=CC=C1 YTRQFSDWAXHJCC-UHFFFAOYSA-N 0.000 description 1
- 208000006990 cholangiocarcinoma Diseases 0.000 description 1
- 201000005217 chondroblastoma Diseases 0.000 description 1
- 201000010240 chromophobe renal cell carcinoma Diseases 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 208000021668 chronic eosinophilic leukemia Diseases 0.000 description 1
- 208000029664 classic familial adenomatous polyposis Diseases 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 208000011588 combined hepatocellular carcinoma and cholangiocarcinoma Diseases 0.000 description 1
- 239000003636 conditioned culture medium Substances 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 108091008034 costimulatory receptors Proteins 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 208000002445 cystadenocarcinoma Diseases 0.000 description 1
- 230000016396 cytokine production Effects 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 210000004292 cytoskeleton Anatomy 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 229960002204 daratumumab Drugs 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 229960004137 elotuzumab Drugs 0.000 description 1
- 201000008184 embryoma Diseases 0.000 description 1
- 201000009409 embryonal rhabdomyosarcoma Diseases 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 201000003914 endometrial carcinoma Diseases 0.000 description 1
- 230000002357 endometrial effect Effects 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 108010087914 epidermal growth factor receptor VIII Proteins 0.000 description 1
- 201000010877 epithelioid cell melanoma Diseases 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 229940012356 eye drops Drugs 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 230000008175 fetal development Effects 0.000 description 1
- 201000001169 fibrillary astrocytoma Diseases 0.000 description 1
- 201000008825 fibrosarcoma of bone Diseases 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical group C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 201000003444 follicular lymphoma Diseases 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 208000015419 gastrin-producing neuroendocrine tumor Diseases 0.000 description 1
- 201000000052 gastrinoma Diseases 0.000 description 1
- 229960000578 gemtuzumab Drugs 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 230000008570 general process Effects 0.000 description 1
- 210000004907 gland Anatomy 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 201000002264 glomangiosarcoma Diseases 0.000 description 1
- 201000007574 granular cell carcinoma Diseases 0.000 description 1
- 201000009277 hairy cell leukemia Diseases 0.000 description 1
- 210000003128 head Anatomy 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 208000006359 hepatoblastoma Diseases 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- 208000029824 high grade glioma Diseases 0.000 description 1
- 230000021158 homophilic cell adhesion Effects 0.000 description 1
- 230000030294 homotypic cell-cell adhesion Effects 0.000 description 1
- 102000044042 human KLRK1 Human genes 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 230000002631 hypothermal effect Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000008105 immune reaction Effects 0.000 description 1
- 102000027596 immune receptors Human genes 0.000 description 1
- 108091008915 immune receptors Proteins 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000037451 immune surveillance Effects 0.000 description 1
- 230000001024 immunotherapeutic effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000126 in silico method Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 108010038415 interleukin-8 receptors Proteins 0.000 description 1
- 102000010681 interleukin-8 receptors Human genes 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000007914 intraventricular administration Methods 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- 206010073096 invasive lobular breast carcinoma Diseases 0.000 description 1
- 208000022013 kidney Wilms tumor Diseases 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- 210000000867 larynx Anatomy 0.000 description 1
- 206010024217 lentigo Diseases 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 125000003473 lipid group Chemical group 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 229960005015 local anesthetics Drugs 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 201000005249 lung adenocarcinoma Diseases 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 201000000014 lung giant cell carcinoma Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 208000012804 lymphangiosarcoma Diseases 0.000 description 1
- 201000010953 lymphoepithelioma-like carcinoma Diseases 0.000 description 1
- 208000003747 lymphoid leukemia Diseases 0.000 description 1
- 208000025036 lymphosarcoma Diseases 0.000 description 1
- 208000018013 malignant glomus tumor Diseases 0.000 description 1
- 201000004102 malignant granular cell myoblastoma Diseases 0.000 description 1
- 201000006812 malignant histiocytosis Diseases 0.000 description 1
- 206010061526 malignant mesenchymoma Diseases 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 201000009020 malignant peripheral nerve sheath tumor Diseases 0.000 description 1
- 201000002338 malignant struma ovarii Diseases 0.000 description 1
- 208000027202 mammary Paget disease Diseases 0.000 description 1
- 208000000516 mast-cell leukemia Diseases 0.000 description 1
- 201000008749 mast-cell sarcoma Diseases 0.000 description 1
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 230000015689 metaplastic ossification Effects 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 238000012737 microarray-based gene expression Methods 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000010232 migration assay Methods 0.000 description 1
- 201000010225 mixed cell type cancer Diseases 0.000 description 1
- 208000029638 mixed neoplasm Diseases 0.000 description 1
- 238000003032 molecular docking Methods 0.000 description 1
- 201000006894 monocytic leukemia Diseases 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 201000010879 mucinous adenocarcinoma Diseases 0.000 description 1
- 208000010492 mucinous cystadenocarcinoma Diseases 0.000 description 1
- 238000012243 multiplex automated genomic engineering Methods 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 201000005962 mycosis fungoides Diseases 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 201000005987 myeloid sarcoma Diseases 0.000 description 1
- 208000001611 myxosarcoma Diseases 0.000 description 1
- 208000014761 nasopharyngeal type undifferentiated carcinoma Diseases 0.000 description 1
- 239000006199 nebulizer Substances 0.000 description 1
- 210000003739 neck Anatomy 0.000 description 1
- 201000008026 nephroblastoma Diseases 0.000 description 1
- 210000005036 nerve Anatomy 0.000 description 1
- 208000007538 neurilemmoma Diseases 0.000 description 1
- 208000027831 neuroepithelial neoplasm Diseases 0.000 description 1
- 208000029974 neurofibrosarcoma Diseases 0.000 description 1
- 230000001272 neurogenic effect Effects 0.000 description 1
- 201000000032 nodular malignant melanoma Diseases 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 208000027825 odontogenic neoplasm Diseases 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 239000003605 opacifier Substances 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 208000012221 ovarian Sertoli-Leydig cell tumor Diseases 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 210000002741 palatine tonsil Anatomy 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 208000004019 papillary adenocarcinoma Diseases 0.000 description 1
- 201000010198 papillary carcinoma Diseases 0.000 description 1
- 201000010210 papillary cystadenocarcinoma Diseases 0.000 description 1
- 208000024641 papillary serous cystadenocarcinoma Diseases 0.000 description 1
- 201000001494 papillary transitional carcinoma Diseases 0.000 description 1
- 208000031101 papillary transitional cell carcinoma Diseases 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000001991 pathophysiological effect Effects 0.000 description 1
- 210000002568 pbsc Anatomy 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 108010011903 peptide receptors Proteins 0.000 description 1
- 102000014187 peptide receptors Human genes 0.000 description 1
- 210000003200 peritoneal cavity Anatomy 0.000 description 1
- 201000002628 peritoneum cancer Diseases 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- 208000028591 pheochromocytoma Diseases 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 208000024724 pineal body neoplasm Diseases 0.000 description 1
- 201000004123 pineal gland cancer Diseases 0.000 description 1
- 230000001817 pituitary effect Effects 0.000 description 1
- 210000003635 pituitary gland Anatomy 0.000 description 1
- 208000021857 pituitary gland basophilic carcinoma Diseases 0.000 description 1
- 208000031223 plasma cell leukemia Diseases 0.000 description 1
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000656 polylysine Polymers 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 239000000651 prodrug Substances 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 201000008520 protoplasmic astrocytoma Diseases 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 238000004445 quantitative analysis Methods 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 239000013074 reference sample Substances 0.000 description 1
- 230000008844 regulatory mechanism Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 108020004418 ribosomal RNA Proteins 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 235000002020 sage Nutrition 0.000 description 1
- 201000007416 salivary gland adenoid cystic carcinoma Diseases 0.000 description 1
- 201000003804 salivary gland carcinoma Diseases 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 208000014212 sarcomatoid carcinoma Diseases 0.000 description 1
- 206010039667 schwannoma Diseases 0.000 description 1
- 201000008407 sebaceous adenocarcinoma Diseases 0.000 description 1
- 230000008313 sensitization Effects 0.000 description 1
- 210000000717 sertoli cell Anatomy 0.000 description 1
- 208000002491 severe combined immunodeficiency Diseases 0.000 description 1
- 201000008123 signet ring cell adenocarcinoma Diseases 0.000 description 1
- 230000003584 silencer Effects 0.000 description 1
- 201000002078 skin pilomatrix carcinoma Diseases 0.000 description 1
- 208000000649 small cell carcinoma Diseases 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 208000028210 stromal sarcoma Diseases 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 208000030457 superficial spreading melanoma Diseases 0.000 description 1
- 230000003319 supportive effect Effects 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 230000008961 swelling Effects 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 206010042863 synovial sarcoma Diseases 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 208000001644 thecoma Diseases 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- 208000030901 thyroid gland follicular carcinoma Diseases 0.000 description 1
- 208000015191 thyroid gland papillary and follicular carcinoma Diseases 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 208000029335 trabecular adenocarcinoma Diseases 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 206010044412 transitional cell carcinoma Diseases 0.000 description 1
- 229960000575 trastuzumab Drugs 0.000 description 1
- 108010020589 trehalose-6-phosphate synthase Proteins 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 230000005740 tumor formation Effects 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 238000012762 unpaired Student’s t-test Methods 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 208000012991 uterine carcinoma Diseases 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4613—Natural-killer cells [NK or NK-T]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4631—Chimeric Antigen Receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4637—Other peptides or polypeptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464402—Receptors, cell surface antigens or cell surface determinants
- A61K39/464416—Receptors for cytokines
- A61K39/464421—Receptors for chemokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464402—Receptors, cell surface antigens or cell surface determinants
- A61K39/464429—Molecules with a "CD" designation not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464466—Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4748—Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/7056—Lectin superfamily, e.g. CD23, CD72
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/715—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/715—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
- C07K14/7155—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
- C12N15/625—DNA sequences coding for fusion proteins containing a sequence coding for a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0646—Natural killers cells [NK], NKT cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5156—Animal cells expressing foreign proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5158—Antigen-pulsed cells, e.g. T-cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/11—Antigen recognition domain
- A61K2239/15—Non-antibody based
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
- A61K2239/59—Reproductive system, e.g. uterus, ovaries, cervix or testes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/20—Cytokines; Chemokines
- C12N2501/21—Chemokines, e.g. MIP-1, MIP-2, RANTES, MCP, PF-4
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/20—Cytokines; Chemokines
- C12N2501/23—Interleukins [IL]
- C12N2501/2302—Interleukin-2 (IL-2)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/50—Cell markers; Cell surface determinants
- C12N2501/515—CD3, T-cell receptor complex
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2502/00—Coculture with; Conditioned medium produced by
- C12N2502/99—Coculture with; Conditioned medium produced by genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/14011—Baculoviridae
- C12N2710/14041—Use of virus, viral particle or viral elements as a vector
- C12N2710/14043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vectore
Definitions
- the present invention relates generally to the field of biotechnology and cell therapy.
- the present invention relates to genetically modified NK cells for cancer immunotherapy, their preparation method and use in patients in need thereof.
- CARs chimeric antigen receptors
- scFv single-chain variable fragment
- NK cells Natural killer cells
- MHC major histocompatibility complex
- NK cell cytotoxicity can be triggered rapidly upon appropriate stimulation through an array of native receptors, which in principle could reduce the risk of relapse or resistance mediated by loss of CAR-targeted antigen.
- a favorable safety profile without obvious toxicity following the transfer of allogeneic NK cells in clinical settings has been considered as an important practical advantage over T cell therapy.
- NK cells natural killer cells
- NK cell transfer therapy with natural killer (NK) cells is one of the most promising immunotherapeutic modalities for cancer patients.
- the success of the approach has so far been limited to patients with haematological malignancies.
- the translation of NK cell therapy to non-haematological malignancies is challenging due to the special pathophysiological characteristics of solid tumors, including target antigen heterogeneity, obstacles to CAR immune cell trafficking, and intrinsic negative regulatory mechanisms of tumor microenvironment.
- the present invention discloses a natural killer (NK) cell genetically modified to comprise a recombinant nucleic acid encoding C-X-C Motif Chemokine Receptor 1 (CXCR1).
- NK natural killer
- the present invention discloses a pharmaceutical composition
- a pharmaceutical composition comprising a pharmaceutically effective amount of the NK cell of the present invention and a pharmaceutically acceptable excipient.
- the present invention discloses a method of treating cancer or tumor in a subject in need thereof, comprising administering to the subject a pharmaceutically effective amount of the NK cell of the present invention, or the pharmaceutical composition of the present invention.
- the present invention discloses a method of treating cancer or tumor in a subject in need thereof, the method comprises: (i) obtaining NK cells from the subject, or from a donor which is different from the subject to be treated; (ii) providing a recombinant nucleic acid encoding CXCR1; (iii) transferring the recombinant nucleic acid encoding CXCR1 into the NK cell to obtain genetically modified NK cells; and (iv) administering to the subject a pharmaceutically effective amount of the NK cells obtained from (iii).
- the present invention discloses a method of treating cancer or tumor in a subject in need thereof, the method comprises: (i) obtaining NK cells from the subject, or from a donor which is different from the subject to be treated; (ii) providing a recombinant nucleic acid encoding CXCR1 and a recombinant nucleic acid encoding a recombinant chimeric antigen receptor (CAR); (iii) transferring the recombinant nucleic acid encoding CXCR1 and the recombinant nucleic acid encoding the recombinant CAR into the NK cell to obtain genetically modified NK cells; and (iv) administering to the subject a pharmaceutically effective amount of the NK cells obtained from (iii).
- CAR chimeric antigen receptor
- the present invention discloses a method of preparing the NK cell of the present invention, the method comprises: (i) obtaining or providing NK cells; (ii) providing a recombinant nucleic acid encoding CXCR1; and (iii) transferring the recombinant nucleic acid encoding CXCR1 into the NK cell.
- the present invention discloses a method of preparing the NK cell of the present invention, the method comprises: (i) obtaining or providing NK cells; (ii) providing a recombinant nucleic acid encoding CXCR1 and a recombinant nucleic acid encoding the recombinant CAR; and (iii) transferring the recombinant nucleic acid encoding CXCR1 and the recombinant nucleic acid encoding the recombinant CAR into the NK cell.
- FIG. 1 is a schematic overview of the design concepts for constructs useful for modifying the NK cells as described in the present disclosure (A-C).
- the particular constructs as described in the examples of this disclosure (D, E) are used for generating recombinant mRNA transcripts of CXCR1 (D) and NKG2D chimeric antigen receptor (CAR) (E).
- Fig. 2 are flow cytometry histograms showing the expression of CXCR1 in NK cells.
- A CXCR1 expression was seen in most freshly isolated NK cells.
- B CXCR1 expression was almost completely lost in NK cells after ex vivo expansion as outlined in the Methods section, with an expression profile almost identical to that of the isotype control.
- C The large majority of the ex vivo expanded NK cells expressed CXCR1 after electroporation with CXCR1 mRNA, while the ex vivo expanded NK cells which were electroporated without CXCR1 mRNA (‘mock’) showed little or no expression of CXCR1. The results show that electroporation of NK cells with mRNA encoding CXCR1 successfully restored and elevated CXCR1 expression in the ex vivo expanded NK cells.
- Fig. 3 is a histogram showing the migration of CXCR1 transfected NK cells towards three different human cancer cells.
- NK cells electroporated with CXCR1 mRNA towards conditioned media derived from different ovarian cancer cell lines (SKOV3, CaOV3 and SW626) were assessed and compared with that of NK cells electroporated without the addition of any mRNA (mock NK cells).
- the ability to migrate towards IL-8 secreting tumor cells is better in NK cells electroporated with CXCR1 mRNA compared to mock NK cells.
- the results show that CXCR1 overexpression increases the migration ability of ex vivo expanded NK cells towards cancer cells.
- FIG. 5 shows the results of the studies of in vivo killing capacities of CXCR1 overexpressing NK cells and mock NK cells against intraperitoneal (i.p) xenografts of human SKOV3 ovarian cancer cells.
- SKOV3-luc cells were i.p injected to establish a peritoneal ovarian carcinoma xenograft model. Seven days after inoculation, tumor burden was confirmed by luciferin imaging and NK cells were injected as outlined in Material and Methods.
- A Bioluminescence images at day 7 and day 21 post-tumor inoculation are shown.
- Fig. 6 shows the results of the studies of in vivo killing capacities of NKG2D CAR-modified, CXCR1 overexpressing NK cells and NKG2D CAR-modified NK cells without CXCR1 overexpression against tumor cells.
- the SKOV3 xenograft model was established by intraperitoneal injection of SKOV3-luc cells. Seven days after tumor inoculation, mice were imaged using luciferin to confirm tumor presence in the peritoneum. Mice were then assigned based on similar tumor burden prior to the intravenous tail vein injection of NK cells. NK cells were injected as outlined in the Method section.
- FIG. 7 shows the results of the studies of in vitro cancer cell killing capacities of EpCAM CAR-modified, CXCR1 overexpressing NK cells. NK cells were electroporated with an mRNA encoding anti-EpCAM CAR.
- modified NK cells showed an improved in vitro killing capacity against SKOV3 cancer cells as compared to mock-control NK cells, demonstrating the potential of CXCR1 modified CAR NK cells to kill tumor cells expressing targets other than NKG2D ligands. Therefore, a scFv of a monoclonal antibody (in this case an anti-EPCAM) can also be used in the recombinant CAR, which together with overexpressed CXCR1 in NK cells leads to improved killing capacity against ovarian cancer cells.
- a monoclonal antibody in this case an anti-EPCAM
- Fig. 8 shows the results of studies of in vivo tumor infiltration of CXCR1 overexpressing NK cells in a FaDu subcutaneous xenograft model.
- Mice were inoculated with FaDu human hypopharyngeal cancer cells subcutaneously at the left flank, and 10 days later DiR-labelled NK cells were intravenously injected through the tail vein. After the NK cell injection, mice were imaged every 24 hours up till 72 hours.
- (A) Whole-body imaging of mice. Flux values at the tumour sites (circled) were plotted in the bar graph, n 5.
- (B) Ex vivo imaging of isolated tumours from the right flank 72 hours after NK cell injection. Tumours obtained from mice without NK cell injection served as control.
- a “genetically modified cell” means any cell of any organism that is modified, transformed, or manipulated by addition or modification of a gene, a DNA or RNA molecule, or protein or polypeptide.
- NK cell refers to a type of cytotoxic lymphocyte critical to the innate immune system.
- NK cells are large granular lymphocytes (LGL) and constitute the third kind of cells differentiated from the common lymphoid progenitor-generating B and T lymphocytes.
- LGL large granular lymphocytes
- NK cells are known to differentiate and mature in the bone marrow, lymph nodes, spleen, tonsils, and thymus, where they then enter into the circulation.
- NK cells provide rapid responses to virus-infected cells, and respond to tumor formation.
- immune cells detect major histocompatibility complex (MHC) presented on infected cell surfaces, triggering cytokine release, causing lysis or apoptosis.
- MHC major histocompatibility complex
- NK cells are different, however, as they have the ability to recognize stressed cells in the absence of antibodies and MHC, allowing for a much faster immune reaction. They were named "natural killers" because of the initial notion that they do not require activation to kill cells that are missing markers of MHC class I. This role is especially important because harmful cells that are missing MHC I markers cannot be detected and destroyed by other immune cells, such as T lymphocyte cells. Since NK cell action is non- MHC-restricted, it is not necessary to match the histocompatibility complex of the individual patient in use, that is, NK cells can be used for cell therapy of allogeneic patients, and have wide clinical application value.
- CX-C Motif Chemokine Receptor 1 refers to interleukin 8 receptor alpha, which is a chemokine receptor. In human, it is encoded by the gene CXCR1 (GeneCards identifier: GC02M218162). CXCR1 is a member of the G-protein- coupled receptor family. It is a receptor for interleukin 8 (IL8), which binds to IL8 with high affinity. CXCR1 also binds to C-X-C Motif Ligand 6 (CXCL6) with high affinity. In one specific example, the nucleotide sequence encoding human CXCR1 is 5’-
- CCTCTGA-3 (SEQ ID NO: 1) (NCBI Reference Sequence: NM 000634.3).
- amino acid sequence of the CXCR1 is (from the N-terminal to the C-terminal):
- chimeric antigen receptor or the short form “CAR” as used herein refers to artificial receptor proteins, or chimeric immunoreceptors, and encompass engineered receptors that graft an artificial specificity onto a particular immune effector cell.
- CARs may be employed to impart the specificity of a monoclonal antibody onto a NK cell, thereby allowing a large number of specific NK cells to be generated, for example, for use in adoptive cell therapy.
- CARs typically comprise an intracellular activation domain, a transmembrane domain, and an extracellular domain comprising an antigen binding region.
- CARs can combine antibody-based specificity for a desired antigen with a NK cell receptor-activating intracellular domain to generate a chimeric protein that exhibits a specific cellular immune activity such as anti-tumor cellular immune activity.
- molecules can be co expressed with the CAR, including co-stimulatory molecules, reporter genes for imaging, gene products that conditionally ablate the NK cells upon addition of a pro-drug, homing receptors, chemokines, chemokine receptors, cytokines, and cytokine receptors.
- antibody fragment is a portion of an intact antibody such as F(ab') 2, F(ab) 2, Fab', Fab, Fv, scFv, or dAb. Regardless of structure, an antibody fragment as used herein binds with the same antigen that is recognized by the full-length antibody.
- antibody fragments include isolated fragments consisting of the variable regions, such as the "Fv” fragments consisting of the variable regions of the heavy and light chains or recombinant single chain polypeptide molecules in which light and heavy variable regions are connected by a peptide linker ("scFv proteins").
- a “fragment” of an antibody comprises an amino acid sequence of at least 5 contiguous amino acid residues, at least 10 contiguous amino acid residues, at least 15 contiguous amino acid residues, at least 20 contiguous amino acid residues, at least 25 contiguous amino acid residues, at least 40 contiguous amino acid residues, at least 50 contiguous amino acid residues, at least 60 contiguous amino residues, at least 70 contiguous amino acid residues, at least 80 contiguous amino acid residues, at least 90 contiguous amino acid residues, at least 100 contiguous amino acid residues, at least 125 contiguous amino acid residues, at least 150 contiguous amino acid residues, at least 175 contiguous amino acid residues, at least 200 contiguous amino acid residues, or at least 250 contiguous amino acid residues of the amino acid sequence of the antibody.
- nucleic acid/complementary nucleic acid, antibody/antigen, or other binding pair indicates a binding reaction which is determinative of the presence of the protein in a heterogeneous population of proteins and other biologies.
- a specified ligand binds to a particular receptor and does not bind in a significant amount to other proteins present in the sample.
- Specific binding can also mean, e.g., that the binding compound, nucleic acid ligand, antibody, or binding composition derived from the antigen -binding site of an antibody, binds to its target with an affinity that is at least 25% greater, at least 50% greater, at least 100% (2-fold) greater, at least five times greater, at least ten times greater, at least 20-times greater, or at least 100-times greater than the affinity with any other binding compound.
- Natural-killer group 2 member D, also known as Klrkl (NKG2D)
- Klrkl is a C-type lectin-like receptor, which was firstly identified in NK cells as an activating immune receptor.
- NKG2D is a type II transmembrane glycoprotein, which does not contain any known signaling elements in the intracellular domain. Resembling many activating receptors, NKG2D depends on an adaptor molecule to initiate signaling transduction and cellular activation. In human, NKG2D is not only expressed by all NK cells, but is also expressed by all CD8 + T cells, and subsets of gd + T cells as a co-stimulatory receptor.
- NKG2D expression and signaling can be regulated by cytokines and tumor-derived factors.
- Cytokines such as IL-2, IL-7, IL-12, IL-15, and type I interferons (IFNs) increase cell surface expression of NKG2D.
- Cytokines such as IL-21, IFN-g, and TGF-b have been shown to decrease NKG2D expression.
- IL-21 has been reported to reduce expressions of NKG2D in human CD8 + T cells and NK cells. In mice, IL-21 stimulation of NK cells is dependent on regulating the NKG2D expression in mouse model of breast carcinoma.
- EpCAM Epithelial cell adhesion molecule
- Polynucleotides can have any three-dimensional structure and may perform any function, known or unknown.
- a gene or gene fragment for example, a probe, primer, EST or SAGE tag
- exons for example, a probe, primer, EST or SAGE tag
- exons introns
- messenger RNA messenger RNA
- transfer RNA transfer RNA
- ribosomal RNA ribozymes
- cDNA recombinant polynucleot
- a polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogues. If present, modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide.
- the sequence of nucleotides can be interrupted by non-nucleotide components.
- a polynucleotide can be further modified after polymerization, such as by conjugation with a labelling component.
- the term also refers to both double- and single- stranded molecules. Unless otherwise specified or required, a polynucleotide encompasses both the double-stranded form and each of two complementary single- stranded forms known or predicted to make up the double-stranded form.
- recombinant nucleic acid refers to nucleic acid formed by laboratory methods of genetic recombination (such as molecular cloning) to bring together genetic material from multiple sources.
- the nucleic acid sequences used in the construction of recombinant nucleic acid molecules can originate from any species. For example, human nucleic acid may be joined with bacterial nucleic acid.
- nucleic acid sequences that do not occur anywhere in nature may be created by the chemical synthesis of nucleic acid, and incorporated into recombinant molecules. Proteins that can result from the expression of recombinant nucleic acid within living cells are termed recombinant proteins.
- vector refers to a non-chromosomal nucleic acid comprising an intact replicon such that the vector may be replicated when placed within a permissive cell, for example by a process of transformation.
- a vector may replicate in one cell type, such as bacteria, but have limited ability to replicate in another cell, such as mammalian cells.
- Vectors may be viral or non-viral.
- Exemplary non- viral vectors for delivering nucleic acid include naked DNA; DNA complexed with cationic lipids, alone or in combination with cationic polymers; anionic and cationic liposomes; DNA-protein complexes and particles comprising DNA condensed with cationic polymers such as heterogeneous polylysine, defined-length oligopeptides, and polyethylene imine, in some cases contained in liposomes; and the use of ternary complexes comprising a virus and polylysine-DNA.
- operably linked as used in the context of a promoter and a nucleic acid means that the promoter can be used to initiate transcription of that nucleic acid.
- transfer or “transfect” as used herein refer to the general process by which exogenous nucleic acid is introduced into the host cell, said process can be mechanical transfection (including electroporation), chemical transfection or viral transduction.
- a “transfected” cell is one which has been transfected with exogenous nucleic acid using any of the above mentioned methods.
- the cell includes the primary subject cell and its progeny.
- autologous is meant to refer to any material derived from the same individual to which it is later to be re-introduced into the individual.
- allogeneic refers to any material derived from an individual other than the individual to which it is later to be introduced into.
- percent identity refers to sequence identity between two peptides or between two nucleic acid molecules. Percent identity can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are identical at that position.
- peptide As used herein, the terms “peptide”, “polypeptide”, and “protein” are used interchangeably, and refer to a compound having amino acid residues covalently linked by peptide bonds.
- a protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can include a protein's or peptide's sequence.
- Polypeptides include any peptide or protein having two or more amino acids joined to each other by peptide bonds.
- the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides, and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types.
- Polypeptides include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others.
- the polypeptides include natural peptides, recombinant peptides, synthetic peptides, or a combination thereof.
- homologous nucleotide sequence refers to sequences characterized by identity, at the nucleotide level or amino acid level, of at least a specified percentage.
- Homologous nucleotide sequences include those sequences coding for naturally occurring allelic variants and mutations of the nucleotide sequences set forth herein.
- Homologous nucleotide sequences include nucleotide sequences encoding for a protein of a mammalian species other than humans.
- homologous amino acid sequences include those amino acid sequences which contain conservative amino acid substitutions and which polypeptides have the same binding and/or activity.
- a homologous nucleotide or amino acid sequence has at least 60% or greater, for example at least 70%, or at least 75%, or at least 80%, or at least 85%, or at least 90%, or at least 95%, or at least 98%, or at least 99%, with a comparator sequence.
- a homologous nucleotide or amino acid sequence has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with a comparator sequence.
- a homologous amino acid sequence has no more than 15, or no more than 10, or no more than 5 or no more than 3 conservative amino acid substitutions. Percent identity can be determined by, for example, the Gap program (Wisconsin Sequence Analysis Package, Version 8 for UNIX, Genetics Computer Group, University Research Park, Madison Wis.), using default settings, which uses the algorithm of Smith and Waterman.
- the recombinant nucleic acid molecules used to modify the NK cells according to the present disclosure are homologous to the exemplary nucleotide sequences disclosed herein, such as the sequences provided in any of SEQ ID NO: 1, 3, 4, 5, 6, 7, 9, 12, 13, 14, 15 or 16.
- the CXCR1 and/or chimeric antigen receptor (CAR) expressed in the modified NK cells are homologous to the exemplary amino acid sequences disclosed herein, such as the sequences provided in any of SEQ ID NO: 2, 8, 10 or 11.
- control cell refers to the production of a gene product in a cell.
- overexpress or “overexpression” refers to the artificial expression of a gene in increased quantity, as compared to the level of expression in a control cell.
- the control cell is a primary NK cell isolated from a subject.
- the control cell is an NK cell obtained from the expansion of a primary NK cell isolated from a subject.
- the control cell is one of the ex vivo expanded NK cells from a subject, said cells have been transfected with an empty vector or without any nucleic acids.
- transient when referred to expression means a polynucleotide is not incorporated into the genome of the cell.
- stable when referred to expression means a polynucleotide is incorporated into the genome of the cell.
- Transient expression can occur from introduced constructs which contain expression signals functional in the host cell, but which constructs do not replicate and rarely integrate in the host cell, or where the host cell is not proliferating. Transient expression also can be accomplished by inducing the activity of a regulatable promoter operably linked to the gene of interest, although such inducible systems frequently exhibit a low basal level of expression.
- Stable expression can be achieved by introduction of a nucleic acid construct that can integrate into the host genome or that autonomously replicates in the host cell. Stable expression of the gene of interest can be selected for through the use of a selectable marker located on or transfected with the expression construct, followed by selection for cells expressing the marker. When stable expression results from integration, integration of constructs can occur randomly within the host genome or can be targeted through the use of constructs containing regions of homology with the host genome sufficient to target recombination with the host locus. Where constructs are targeted to an endogenous locus, all or some of the transcriptional and translational regulatory regions can be provided by the endogenous locus.
- the transformed nucleic acid is operably associated with transcriptional and translational initiation and termination regulatory regions that are functional in the host cell.
- Tumors can be benign or malignant (i.e cancerous). A benign tumor does not invade nearby tissue or spread to other parts of the body. Common types of benign tumors include adenomas, fibromas (or fibroids), hemangiomas, lipomas, meningiomas, myomas, neuromas, and osteochondromas. Adenomas are benign tumors starting in the epithelial tissue of a gland or gland-like structure.
- a common type of adenoma is a polyp in the colon.
- Adenomas might also grow in the liver or the adrenal, pituitary, or thyroid gland.
- Fibromas or fibroids are tumors of fibrous or connective tissue that can grow in any organ.
- Hemangiomas are a buildup of blood vessel cells in the skin or internal organs. Lipomas grow from fat cells. They are the most common benign tumor in adults, often found in the neck, shoulders, back, or arms. Meningiomas are tumors that develop from the membrane surrounding the brain and spinal cord. Myomas are tumors that grow from muscle. Neuromas are tumors that develop from the nerves. Osteochondromas are tumors that develop from the bones.
- cancer refers to an unregulated proliferation of cells due to loss or normal controls, resulting in unregulated growth, lack of differentiation, local tissue invasion, and, often, metastasis.
- Carcinoma is a cancer that begins in the skin or in tissues that line or cover internal organs.
- Sarcoma is a cancer that begins in bone, cartilage, fat, muscle, blood vessels, or other connective or supportive tissue.
- Leukemia is a cancer that starts in blood-forming tissue, such as the bone marrow, and causes large numbers of abnormal blood cells to be produced and enter the blood.
- Lymphoma and multiple myeloma are cancers that begin in the cells of the immune system.
- Central nervous system cancers are cancers that begin in the tissues of the brain and spinal cord.
- the present invention refers to a natural killer (NK) cell genetically modified to comprise a recombinant nucleic acid encoding C-X-C Motif Chemokine Receptor 1 (CXCR1).
- NK natural killer
- CXCR1 recombinant nucleic acid encoding CXCR1
- CXCR1 The expression levels of CXCR1 vary among different types of NK cells.
- the unmodified primary NK cells isolated from a subject do not express CXCR1.
- genetic modification is carried out to express CXCR1.
- the unmodified primary NK cells isolated from a subject express CXCR1 upon isolation. However, after NK cell expansion, which is necessary for providing sufficient NK cells for clinical uses, the expression of CXCR1 is diminished.
- NK cells genetic modification is carried out after NK cell expansion to restore the expression of CXCR1 to at least the same level as the level of expression of CXCR1 in the isolated NK cells before cell expansion, or to overexpress CXCR1 to a level higher than the level of expression of CXCR1 in the isolated NK cells before cell expansion.
- the unmodified primary NK cells isolated from a subject express CXCR1, and the level of expression of CXCR1 does not diminish after NK cell expansion.
- genetic modification is carried out to overexpress CXCR1 to a level higher than the level of expression of CXCR1 in the isolated NK cells before or after cell expansion.
- overexpression of CXCR1 results in at least about 10%, or at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90%, or at least about a 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100 fold increase in expression of CXCR1 in the genetically modified NK cells as compared to the control NK cells.
- expression or overexpression of CXCR1 in the genetically modified NK cells can be transient or stable.
- NK cells are derived from human peripheral blood mononuclear cells (PBMC), unstimulated leukapheresis products (PBSC), human embryonic stem cells (hESCs), induced pluripotent stem cells (iPSCs), bone marrow, or umbilical cord blood by methods well known in the art.
- PBMC peripheral blood mononuclear cells
- hESCs human embryonic stem cells
- iPSCs induced pluripotent stem cells
- bone marrow or umbilical cord blood by methods well known in the art.
- human peripheral blood mononuclear cells are used to derive NK cells.
- NK cells can be isolated and expanded by methods well known in the art.
- PBMCs are isolated by gradient centrifugation from huffy coats.
- NK cells After PBMC isolation, cells are co-cultured with g- irradiated K562 cells in SCGM media (Cellgenix GmbH, Freiburg, Germany) supplemented with FBS and IL2 (Peprotech, Rocky Hills, NJ). Half media was refreshed every 2 - 3 days. After 7 days of cell expansion, NK cells are re-stimulated with K562 cells. After 2 rounds of stimulation in total, NK cells can be used for downstream experiments.
- a method of preparing a natural killer (NK) cell genetically modified to comprise a recombinant nucleic acid encoding C-X-C Motif Chemokine Receptor 1 comprises: (1) obtaining or providing NK cells; (2) providing a recombinant nucleic acid encoding CXCR1; and (3) transferring the recombinant nucleic acid encoding CXCR1 into the NK cell.
- some, or the majority, or all of the NK cells into which the recombinant nucleic acid is to be transferred in step (3) are not expressing CXCR1 or have lost the expression of CXCR1.
- the method further comprises, after step (1), culturing the NK cells to expand the number of NK cells.
- NK cell expansion methods are known in the art and exemplified in the Experimental Section of the present application.
- a recombinant nucleic acid encoding CXCR1 can be created using methods known in the art.
- the nucleotide sequence coding for CXCR1 can be inserted into an appropriate expression vector, i.e., a vector which contains the necessary elements for the transcription and translation of the inserted protein-coding sequence.
- the necessary transcriptional and translational signals can also be supplied by the native CXCR1 gene and/or its flanking regions.
- a variety of host-vector systems may be utilized to express the protein-coding sequence.
- mammalian cell systems infected with virus e.g., vaccinia virus, adenovirus, etc.
- insect cell systems infected with vims e.g., baculovirus
- microorganisms such as yeast containing yeast vectors, or bacteria transformed with bacteriophage, DNA, plasmid DNA, or cosmid DNA, transgenic plants or transgenic non-human animals.
- the expression elements of vectors vary in their strengths and specificities. Depending on the host-vector system utilized, any one of a number of suitable transcription and translation elements may be used.
- Any of the known methods for the insertion of DNA fragments into a vector may be used to construct expression vectors containing a chimeric gene consisting of appropriate transcriptional/translational control signals and the protein coding sequences.
- Exemplary methods include in vitro recombinant DNA and synthetic techniques.
- Expression of a nucleic acid sequence encoding CXCR1 may be regulated by a second nucleic acid sequence so that the CXCR1 peptide is expressed in a host transformed with the recombinant DNA molecule.
- expression of CXCR1 may be controlled by any promoter/enhancer element known in the art.
- Promoters that are not native CXCR1 promoters which may be used to control CXCR1 expression include, but are not limited to, prokaryotic promoters such as T7 promoter, T71ac promoter, Sp6 promoter, araBAD promoter, trp promoter, lac promoter, Ptac promoter and pL promoter.
- prokaryotic promoters such as T7 promoter, T71ac promoter, Sp6 promoter, araBAD promoter, trp promoter, lac promoter, Ptac promoter and pL promoter.
- the promoter used is T7 promoter having the sequence of 5’-TAATACGACTCACTATAGGG-3’ (SEQ ID NO: 3).
- the T7 promoter functions to initiate transcription of downstream DNA sequences, for example the CXCR1 encoding sequence.
- the expression vector as described above can further include a 3' untranslated region (3’ UTR) following the DNA encoding CXCR1.
- the 3' UTR can contain regulatory regions that influence expression of CXCR1 post-transcriptionally, by influencing, for example, polyadenylation, translation efficiency, localization, and/or stability of the mRNA.
- 3'-UTR contains both binding sites for regulatory proteins as well as microRNAs (miRNAs). By binding to specific sites within the 3'-UTR, miRNAs can decrease gene expression of various mRNAs by either inhibiting translation or directly causing degradation of the transcript.
- 3 '-UTR can also have silencer regions which bind to repressor proteins and inhibit the expression of the mRNA.
- 3'-UTRs also contain AU-rich elements (AREs). Proteins bind AREs to affect the stability or decay rate of transcripts in a localized manner or affect translation initiation. Furthermore, 3'-UTRs can contain the sequence AAUAAA that directs addition of several hundred adenine residues called the poly(A) tail to the end of the mRNA transcript.
- Poly(A) binding protein (PABP) binds to this tail, contributing to regulation of mRNA translation, stability, and export. For example, poly(A) tail bound PABP interacts with proteins associated with the 5' end of the transcript, causing a circularization of the mRNA that promotes translation.
- the 3'-UTR can also contain sequences that attract proteins to associate the mRNA with the cytoskeleton, transport it to or from the cell nucleus, or perform other types of localization.
- sequences within the 3 '-UTR the physical characteristics of the region, including its length and secondary structure, contribute to translation regulation.
- the 3’UTR used in the CXCR1 expression vector is the 3’UTR from an alpha globin, a beta globin gene, a growth hormone gene.
- the 3’UTR used is a mouse alpha globin 3’UTR having the sequence of 5’- GCTGCCTTCTGCGGGGCTTGCCTTCTGGCCATGCCCTTCTTCTCTCCCTTGCACCT GTACCTCTTGGTCTTTGAATAAAGCCTGAGTAGGAAG-3’ (SEQ ID NO: 4) (NCBI Reference Sequence NM_008218.2), wherein the underlined sequence is a polyA signal enhancing the stability of mRNA.
- the recombinant construct containing the T7 promoter, the nucleotide sequence encoding CXCR1, and the alpha globin 3’UTR has the following nucleotide sequence: 5’-
- AAAGCCTGAGTAGGAAG-3 (SEQ ID NO: 5).
- the basic backbone of the recombinant expression vector is a commercially available vector into which each of the above elements is inserted.
- the nucleic acid encoding CXCR1 can be cloned into the expression vector using molecular cloning techniques commonly known in the art.
- the primers used for molecular cloning are as follows: forward primer 5’-
- Methods generally known in the field can be used for the transcription of mRNA from the recombinant expression vectors described above.
- PCR can be performed using the recombinant expression vectors as the DNA template to generate the linear DNA template.
- In vitro transcription of the linear DNA template generated can then be used to generate the CXCR1 mRNA.
- the linear DNA template is purified before in vitro transcription is carried out.
- the recombinant nucleic acid encoding CXCR1 to be transferred into the NK cell can be a DNA encoding the CXCR1, or an mRNA obtained by transcription of the DNA.
- the transfer can be carried out by electroporation, non-viral chemical transfection, viral transduction using retroviral or lentiviral vectors, in a manner commonly used in the art.
- the natural killer (NK) cell modified as described above is further genetically modified to express a recombinant chimeric antigen receptor (CAR).
- the CAR comprises an intracellular signaling domain, a transmembrane domain, and an extracellular domain comprising an antigen binding region.
- the expression of such recombinant CAR allows the genetically modified NK cells to express the antibody binding domain of the CAR on the cell surface, conferring novel antigen specificity that is MHC independent.
- the antigen recognition domain includes a polypeptide that is selective for or targets an antigen, receptor, peptide ligand, or protein ligand of the target; or a polypeptide of the target.
- the antigen recognition domain may be obtained from any of the wide variety of extracellular domains or secreted proteins associated with ligand binding and/or signal transduction.
- the antigen recognition domain may include a portion of Ig heavy chain linked with a portion of Ig light chain, constituting a single chain fragment variable (scFv) that binds specifically to a target antigen.
- the antibody may be monoclonal or polyclonal antibody or may be of any type that binds specifically to the target antigen.
- the antigen recognition domain can be a receptor or ligand.
- the choice of the antigen binding region depends upon the type and number of ligands that define the surface of a target cell.
- the antigen binding region may be chosen to recognize a ligand that acts as a cell surface marker on target cells associated with a particular disease state.
- cell surface markers that can act as ligands for the antigen binding region in the CARs include those associated with or specific to cancer and/or tumor cells, autoimmune diseases, and viral, bacterial and parasitic infections.
- the antigen binding region of the extracellular domain binds to a tumor associated antigen, a tumor specific antigen, or a pathogen-specific antigen.
- the genetically modified NK cells comprising such CARs can then be redirected to the tumor associated antigen, tumor specific antigen or a pathogen- specific antigen based on the antigen binding specificity.
- a tumor specific antigen is unique to tumor cells and does not occur on other cells in the body.
- a tumor associated antigen is not unique to a tumor cell and instead is also expressed on a normal cell under conditions that fail to induce a state of immunologic tolerance to the antigen.
- the expression of the antigen on the tumor may occur under conditions that enable the immune system to respond to the antigen.
- Tumor associated antigens can be antigens that are expressed on normal cells during fetal development when the immune system is immature and unable to respond or they may be antigens that are normally present at extremely low levels on normal cells but which are expressed at much higher levels on tumor cells.
- Non-limiting examples of tumor associated or tumor specific antigens include the following: NKG2D, differentiation antigens such as MART-l/MelanA (MART-1), gplOO (Pmel 17), tyrosinase, TRP-1, TRP-2 and tumor- specific multilineage antigens such as MAGE-1, MAGE-3, BAGE, GAGE-1, GAGE-2, pl5; overexpressed embryonic antigens such as CEA; overexpressed oncogenes and mutated tumor-suppressor genes such as p53, Ras, HER-2/neu; unique tumor antigens resulting from chromosomal translocations such as BCR-ABL, E2A-PRL, H4-RET, 1GH-IGK, MYL-RAR; and viral antigens such as the Epstein Barr virus antigens EBVA and the human papillomavirus (HPV) antigens E6 and E7.
- NKG2D differentiation antigens
- MART-1 M
- the CAR recognizes cell-surface tumor associated antigen or tumor specific antigen independent of human leukocyte antigen (HLA) and employs one or more signaling molecules to activate the genetically modified NK cells for killing, proliferation, and/or cytokine production.
- HLA human leukocyte antigen
- the antigen binding region of the extracellular domain of the CARs target an antigen that includes but is not limited to CD 19, CD20, CD22, ROR1 , Mesothelin, CD33/lL3Ra, c-Met, PSMA, Glycolipid F77, EGFRvIII, GD-2, MY-ESO-1 TCR, MAGE A3 TCR, EpCAM and the like.
- the tumor associated antigen is a ligand of NKG2D, and therefore the extracellular domain of the chimeric antigen receptor comprises NKG2D or an antigen binding fragment thereof.
- the antigen binding fragment of NKG2D is or comprises the extracellular domain of NKG2D having the following amino acid sequence (from the N-terminal to the C-terminal): FN QE V QIPLTES YCGPCPKNWIC YKNN C Y QFFDES KNW YES Q AS CMS QN AS LLKV Y SKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDC ALYAS S FKG YIENCS TPNT YICMQRT V (SEQ ID NO: 8)(UniProt P26718, amino acid residues 83-216), encoded by the following exemplary nucleotide sequence: 5’- TTCAACCAAGAAGTTCAAATTCCCTTGACCGAA
- NKG2D ligands are structural homologs of MHC class I molecules. NKG2D ligands are absent or rarely expressed in normal tissues, but are extensively expressed in various malignancies and viral-infected tissues. Examples of human NKG2D ligands include class-I-related chains-related molecules A and B (MICA and MICB) proteins and retinoic acid early transcripts-1 (RAET1), also known as UL-16 binding proteins.
- MICA and B class-I-related chains-related molecules A and B
- RAET1 retinoic acid early transcripts-1
- mouse NKG2D ligands include five different RAETl isoforms (RAETla, RAET1 b, RAETl g, RAETl d, and RAETl e), three different H60 isoforms (H60a, b, and c), and UL16 binding protein 1 (encoded by MULTI gene).
- RAETla RAETl isoforms
- RAET1 b RAETl g, RAETl d, and RAETl e
- H60a, b, and c three different H60 isoforms
- UL16 binding protein 1 encoded by MULTI gene.
- NKG2D ligands are structural homologs of MHC class I molecules, they do not present antigen to T cells or bind b2 -microglobulin.
- the NKG2D ligands for which the extracellular domain of the chimeric antigen receptor binds to are membrane- bound ligands.
- the tumor associated antigen is EpCAM
- the extracellular domain of the chimeric antigen receptor comprises the single-chain variable fragment (scFv) of a monoclonal EpCAM antibody.
- the scFv of an monoclonal EpCAM antibody has the following amino acid sequence (from the N-terminal to the C-terminal) :
- the extracellular domain of the CAR has the following amino acid sequence (from the N-terminal to the C-terminal):
- the extracellular domain of the CAR has the following amino acid sequence (from the N-terminal to the C-terminal):
- the extracellular domain of a chimeric antigen receptor generally also comprises a hinge region.
- the hinge region is a sequence positioned between for example, the antigen binding region, and the transmembrane domain.
- the sequence of the hinge region can be obtained from, for example, any suitable sequence from any genus, including human or a part thereof.
- the hinge region includes the hinge region of a human protein including CD-8 alpha, CD28, 4-1BB, 0X40, T cell receptor a or b chain, a O ⁇ 3z chain, CD28, CD3e, CD45, CD4, CD5, CD8, CD8a, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, ICOS, CD154, functional derivatives thereof, and combinations thereof.
- the hinge region includes the CD8 hinge region.
- the hinge region can be one selected from, but is not limited to, immunoglobulin (e.g. IgGl, IgG2, IgG3, IgG4, and IgD).
- the hinge region of the CAR has the following amino acid sequence (from the N-terminal to the C- terminal): F VP VFLP AKPTTTP APRPPTP APTIAS QPLS LRPE ACRP A AG (SEQ ID NO: 14), encoded by the following exemplary nucleotide sequence: 5’-
- the transmembrane domain of a CAR includes a hydrophobic polypeptide that spans the cellular membrane.
- the transmembrane domain spans from one side of a cell membrane (extracellular) through to the other side of the cell membrane (intracellular or cytoplasmic).
- the transmembrane domain is artificially designed so that more than 25%, more than 50% or more than 75% of the amino acid residues of the domain are hydrophobic residues such as leucine and valine.
- the transmembrane domain may be in the form of an alpha helix or a beta barrel, or combinations thereof.
- the transmembrane domain may include a polytopic protein, which has many transmembrane segments, each alpha-helical, beta sheets, or combinations thereof.
- the transmembrane domain that is naturally associated with one of the domains in the CAR is used.
- the transmembrane domain is selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
- a transmembrane domain includes a transmembrane domain of a T- cell receptor a or b chain, a O ⁇ 3z chain, CD28, CD3e, CD45, CD4, CD5, CD7, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD68, CD134, CD137, ICOS, CD41, CD 154, functional derivatives thereof, and combinations thereof.
- the transmembrane domain is a CD8 transmembrane domain.
- the transmembrane domain of the CAR has the following amino acid sequence (from the N- terminal to the C -terminal):
- GAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRN (SEQ ID NO: 10), encoded by the following exemplary nucleotide sequence: 5’-
- the intracellular signaling domain of a chimeric antigen receptor is responsible for activation of at least one of the normal effector functions of the immune cell in which the chimeric antigen receptor has been placed.
- effector function refers to a specialized function of a differentiated cell, such as a NK cell.
- the intracellular receptor signaling domain generally includes at least one immunoreceptor tyrosine based activation motif (ITAM)-containing domain. Each ITAM possesses two repeats of the consensus sequence Tyr-X-X-Leu/Ile (X being any amino acid) spaced by six to eight amino acids.
- intracellular receptor signaling domains in the CAR include part or all of CD3C, OX40/CD134, FceRIy, ICOS/CD278, ILRB/CD122, IL-2RG/CD132, DAP molecules, CD70, cytokine receptor, CD40, or a combination thereof.
- the intracellular receptor signaling domain used is O03z.
- the intracellular receptor signaling domain of the CAR has the following amino acid sequence (from the N-terminal to the C-terminal): RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQ EGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQAL PPR (SEQ ID NO: 11), encoded by the following exemplary nucleotide sequence: 5’- AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAA CCAGCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGA CAAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACC CTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACA GTGAGATTGGGATGAAAGGCGAGCCGGA
- the at least one co-stimulatory domain and intracellular signaling domain may be collectively referred to as the intracellular domain of the chimeric antigen receptor.
- the hinge region and the antigen binding region may be collectively referred to as the extracellular domain of the chimeric antigen receptor.
- spacer domain generally means any oligo- or polypeptide that functions to link the transmembrane domain to, either the extracellular domain or, the intracellular domain in the polypeptide chain,
- a spacer domain can comprise up to about 300 amino acids, or about 10 to about 100 amino acids, or about 25 to about 50 amino acids.
- the desired CAR in the genetically modified NK cell comprises NKG2D, CD8 alpha hinge and transmembrane domain, and CD3z signaling domains.
- the recombinant construct containing a T7 promoter, the nucleotide sequence encoding such CAR, and the alpha globin 3’UTR has the following codon optimized nucleotide sequence: 5’-
- the desired CAR in the genetically modified NK cell comprises a scFv fragment of an anti-EPCAM antibody, CD8 alpha hinge and transmembrane domain, and O03z signaling domains.
- the recombinant construct containing a T7 promoter, the nucleotide sequence encoding such CAR, and the alpha globin 3’UTR has the following nucleotide sequence: 5’- TAAT ACGACTC ACT AT AGGGAA AT AAGAGAGAAAAGAAGAGT AAGAAGAAAT A TAAGAGCCACCATGCTTCTCCTGGTGACAAGCCTTCTGCTCTGTGAGTTACCACA CCCAGCATTCCTCCTGATCCCAGGCGCGCATGCCTTCAACCAAGAAGTTCAAATT CCCTTGACCGAAAGTTACTGTGGCCCATGTCCTAAAAACTGGATATGTTACAAAA ATAACTGCTACCAATTTTTTGATGAGAGTAAAAACTGGTATGAGAGAGAG
- Expression of CARs in the genetically modified NK cells can be transient or stable.
- the constructs in each of Figs. 1A - IF are transiently or stably expressed in the genetically modified NK cells.
- a method of preparing a natural killer (NK) cell genetically modified to comprise a recombinant nucleic acid encoding CXCR1, and also expressing a CAR comprises: (1) obtaining or providing NK cells; (2) providing a recombinant nucleic acid encoding CXCR1 and a recombinant nucleic acid encoding the CAR; and (3) transferring the recombinant nucleic acid encoding CXCR1 and the recombinant nucleic acid encoding the CAR into the NK cell.
- the method further comprises, after step (1), culturing the NK cells to expand the number of NK cells.
- NK cell expansion methods are known in the art and exemplified in the Experimental Section of the present application.
- the recombinant nucleic acids encoding CXCR1 and the CAR are transferred into the NK cells simultaneously.
- the recombinant nucleic acids encoding CXCR1 and the CAR are transferred into the NK cells simultaneously, the recombinant nucleic acids encoding CXCR1 and the CAR are cloned into the same vector. In some other examples, the recombinant nucleic acids encoding CXCR1 and the CAR are transferred into the NK cells sequentially.
- the molecular cloning and techniques described above for preparing and transferring the recombinant nucleic acid encoding CXCR1 into the NK cell can also be used for preparing and transferring the recombinant nucleic acid encoding the CAR into the NK cell.
- the recombinant nucleic acid encoding the CAR can be prepared from an amino acid sequence of the specified CAR by any conventional method.
- a base sequence encoding an amino acid sequence can be obtained from the NCBI RefSeq IDs or accession numbers of GenBenk for an amino acid sequence of each domain, and the nucleic acid as disclosed herein can be prepared using a standard molecular biological and/or chemical procedure.
- the modified NK cells are able to replicate in vivo resulting in long-term persistence that can lead to sustained tumor control.
- the sequence of the open reading frame encoding the chimeric antigen receptor can be obtained from a genomic DNA source, a cDNA source, or can be synthesized (e.g. via PCR), or combinations thereof. Depending upon the size of the genomic DNA and the number of introns, it may be desirable to use cDNA or a combination thereof as it is found that introns stabilize the mRNA. Also, it may be further advantageous to use endogenous or exogenous non-coding regions to stabilize the mRNA.
- the NK cells as described herein can be provided as a composition or a pharmaceutical composition.
- the compositions as described herein may be administered in a number of ways depending upon whether local or systemic treatment is desired. Administration may be topical, pulmonary (e.g., by inhalation or insufflation of powders or aerosols, including by nebulizer; intratracheal, intranasal, epidermal and transdermal) or systemic such as oral, and/or parenteral. Parenteral administration includes intravenous, intraarterial, subcutaneous, intraperitoneal or intramuscular injection or infusion; or intracranial, e.g., intrathecal or intraventricular, administration. In some examples, the route of administration may be selected from the group consisting of systemic administration, oral administration, intravenous administration and parenteral administration.
- a composition or pharmaceutical composition as described herein can be provided in unit dosage form wherein each dosage unit, e.g., an injection, contains a predetermined amount of the NK cells as disclosed herein, alone or in appropriate combination with other active agents.
- unit dosage form refers to physically discrete units suitable as unitary dosages for human and animal subjects, each unit containing a predetermined quantity of the NK cells as disclosed herein, alone or in combination with other active agents, calculated in an amount sufficient to produce the desired effect, in association with a pharmaceutically acceptable diluent, carrier, or vehicle, where appropriate.
- the specifications for the unit dosage forms depend on the particular pharmacodynamics associated with the pharmaceutical composition in the particular subject.
- Unit dosage forms can be prepared according to conventional techniques well known in the pharmaceutical industry. Such techniques include the step of bringing into association the active ingredients with the pharmaceutical carrier(s) or excipient(s). In general the formulations are prepared by uniformly and intimately bringing into association the active ingredients with liquid or semi liquid carriers.
- a medical disease or disorder can be treated by administering a population of the NK cell as disclosed herein.
- the medical disease or disorder is cancer or tumor. Due to their release of pro -inflammatory cytokines, NK cells may reverse the anti-inflammatory tumor microenvironment and increase adaptive immune responses by promoting differentiation, activation, and/or recruitment of accessory immune cell to sites of malignancy.
- a method of treating cancer or tumor in a subject in need thereof comprising administering to the subject a pharmaceutically effective amount of the NK cells or the pharmaceutical composition as disclosed herein.
- a pharmaceutically effective amount of the NK cells or the pharmaceutical composition as disclosed herein in the manufacture of a medicament for treating cancer or tumor.
- the NK cells or the pharmaceutical composition as disclosed herein for use in treating cancer or tumor.
- the genetically modified NK cells used to treat cancer or tumor are prepared during the course of treatment.
- a method of treating cancer or tumor in a subject in need thereof comprises: (i) obtaining NK cells from the subject, or from a donor which is different from the subject to be treated; (ii) providing a recombinant nucleic acid encoding CXCR1; (iii) transferring the recombinant nucleic acid encoding CXCR1 into the NK cell to obtain genetically modified NK cells; and (iv) administering to the subject a pharmaceutically effective amount of the NK cells obtained from (iii).
- a method of treating cancer or tumor in a subject in need thereof comprises: (i) obtaining NK cells from the subject, or from a donor which is different from the subject to be treated; (ii) providing a recombinant nucleic acid encoding CXCR1 and a recombinant nucleic acid encoding the CAR; (iii) transferring the recombinant nucleic acid encoding CXCR1 and the recombinant nucleic acid encoding the CAR into the NK cell to obtain genetically modified NK cells; and (iv) administering to the subject a pharmaceutically effective amount of the NK cells obtained from (iii).
- the method further comprises, after step (i), culturing the NK cells to expand the number of NK cells.
- NK cell expansion methods are known in the art and exemplified in the Experimental Section of the present application.
- pharmaceutically effective amount as used herein includes within its meaning a sufficient but non-toxic amount of the NK cells as described herein to provide the desired treatment effect.
- an effective amount or sufficient number of the NK cells as described herein is present in the composition and introduced into the subject such that long-term, specific, anti-tumor responses are established to reduce the size of a tumor or eliminate tumor growth or regrowth than would otherwise result in the absence of such treatment.
- the amount of NK cells introduced into the subject causes at least a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, or 100% decrease in tumor size when compared to otherwise same conditions wherein the NK cells are not present.
- the exact amount of NK cells required will vary from subject to subject depending on factors such as the species being treated, the age and general condition of the subject, the severity of the condition being treated (e.g.
- the concentration of NK cells desirably should be sufficient to provide in the subject being treated at least from about lxlO 6 to about lxlO 9 NK cells, even more desirably, from about lxlO 7 to about 5xl0 8 NK cells, although any suitable amount can be utilized either above, e.g., 5xl0 8 cells, or below, e.g., lxlO 7 cells.
- the dosing schedule can be based on well-established cell-based therapies, or an alternate continuous infusion strategy can be employed.
- the actual dose and schedule can vary depending on whether the compositions are administered in combination with other pharmaceutical compositions, or depending on inter individual differences in pharmacokinetics, drug disposition, and metabolism. In any given case, an appropriate “effective amount” may be determined by one of ordinary skill in the art using only routine experimentation.
- Cancers or tumors for which the present treatment methods are useful include any malignant cell type, such as those found in a solid tumor or a hematological tumor.
- the malignancy is a solid tumor.
- Exemplary solid tumors can include, but are not limited to, a tumor of an organ selected from the group consisting of pancreas, colon, cecum, stomach, brain, head, neck, ovary, kidney, larynx, sarcoma, lung, bladder, melanoma, prostate, and breast.
- the malignancy is a hematological tumor.
- Exemplary hematological tumors include tumors of the bone marrow, T or B cell malignancies, leukemias, lymphomas, blastomas, myelomas, and the like.
- Further examples of cancers that may be treated using the methods provided herein include, but are not limited to, lung cancer (including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung), cancer of the peritoneum, gastric or stomach cancer (including gastrointestinal cancer and gastrointestinal stromal cancer), pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, various types of head and neck cancer, and melanoma.
- lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma
- the cancer may specifically be of the following histological type, though it is not limited to these: neoplasm, malignant; carcinoma; carcinoma, undifferentiated; giant and spindle cell carcinoma; small cell carcinoma; papillary carcinoma; squamous cell carcinoma; lymphoepithelial carcinoma; basal cell carcinoma; pilomatrix carcinoma; transitional cell carcinoma; papillary transitional cell carcinoma; adenocarcinoma; gastrinoma, malignant; cholangiocarcinoma; hepatocellular carcinoma; combined hepatocellular carcinoma and cholangiocarcinoma; trabecular adenocarcinoma; adenoid cystic carcinoma; adenocarcinoma in adenomatous polyp; adenocarcinoma, familial polyposis coli; solid carcinoma; carcinoid tumor, malignant; branchiolo-alveolar adenocarcinoma; papillary adenocarcinoma; chromophobe carcinoma; acidophil carcinoma
- the cancer/tumor that can be treated using the genetically modified NK cells provided herein include colorectal cancer, ovarian cancer, head and neck cancer, liver cancer, breast cancer, cervical cancer, neuroblastoma, osteosarcoma, lymphoma and glioma.
- the cancer/tumor that can be treated is ovarian cancer.
- the cancer/tumor than can be treated is head and neck cancer.
- the cancer/tumor expresses NKG2D ligand or EpCAM.
- the cancer/tumor expresses NKG2D ligand or EpCAM after treatment with another drug, radiation or biological agent.
- beneficial or desired clinical results include, but are not limited to, alleviation of symptoms; diminishment of extent of condition, disorder or disease; stabilized (i.e. not worsening) state of condition, disorder or disease; delay or slowing of condition, disorder or disease progression; amelioration of the condition, disorder or disease state, remission (whether partial or total), whether detectable or undetectable; or enhancement or improvement of condition, disorder or disease.
- Treatment includes eliciting a cellular response that is clinically significant, without excessive levels of side effects. Treatment also includes prolonging survival as compared to expected survival if not receiving treatment.
- the terms “decrease”, “reduced”, “reduction” , “decrease”, “removal” or “inhibit” are all used herein generally to mean a decrease by a statistically significant amount. However, for avoidance of doubt, “reduced”, “reduction” or “decrease”, “removal”, or “inhibit” means a decrease by at least 10% as compared to a reference level, for example a decrease by at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% or up to and including a 100% decrease (e.g. absent level as compared to a reference sample), or any decrease between 10-100% as compared to a reference level (e.g., in the absence of a treatment as described herein).
- a 100% decrease e.g. absent level as compared to a reference sample
- the subject or patient to be treated is an animal, mammal, human, including, without limitation, animals classed as bovine, porcine, equine, canine, lupine, feline, murine, ovine, avian, piscine, caprine, corvine, acrine, or delphine.
- the patient is a human.
- the source of NK cells that can be used for treating a medical disease or disorder may be of any kind, but in specific examples the cells are obtained from a bank of umbilical cord blood, peripheral blood, human embryonic stem cells, or induced pluripotent stem cells.
- the NK cells that can be used for treating a medical disease or disorder are autologous, i.e. obtained from the same individual to which the treatment is to be administered.
- autologous source of NK cells can be collected from a patient in need of treatment and NK cells are activated and modified using the methods described herein and known in the art and then infused back into the patient.
- NK cells include PBMCs, umbilical cord blood obtained when the patient was born and subsequently preserved, and induced pluripotent stem cells derived from cells obtained from the patient.
- the NK cells that can be used for treating a medical disease or disorder are allogeneic, i.e. derived from a different individual of the same species as the patient, such as an NK cell donor.
- the NK cells that can be used for treating a medical disease or disorder are xenogeneic, i.e. derived from an animal of a different species as the patient. Genetically modified NK cells derived from allogeneic xenogeneic sources can provide an off-the-shelf product.
- Allogeneic or autologous NK cells induce a rapid immune response but disappear relatively rapidly from the circulation due to their limited lifespan. Thus, there is reduced concern of persisting side effects using the treatment methods as disclosed herein.
- the NK cells as described herein are administered in combination with a second therapeutic agent.
- the second therapeutic agent may comprise T cells, an immunomodulatory agent, a monoclonal antibody, or a chemotherapeutic agent.
- the immunomodulatory agent is lenolidomide
- the monoclonal antibody is alemtuzumab, rituxumab, trastuzumab, ibritumomab, gemtuzumab, brentuximab, adotranstuzumab, blinatunomab, daratumumab or elotuzumab
- the chemotherapeutic agent is fludarabine or cyclophosphamide.
- the efficacy of the treatment can be assessed in various ways well known to the skilled practitioner. For instance, one of ordinary skill in the art will understand that a therapeutic genetically modified cell delivered in conjunction with the chemo-adjuvant is efficacious in treating or inhibiting a cancer in a patient by observing that the therapeutic genetically modified cell reduces the cancer cell load or prevents a further increase in cancer cell load.
- Cancer cell loads can be measured by methods that are known in the art, for example, using polymerase chain reaction assays to detect the presence of certain cancer cell nucleic acids or identification of certain cancer cell markers in the blood using, for example, an antibody assay to detect the presence of the markers in a sample (e.g., but not limited to, blood) from a subject or patient, or by measuring the level of circulating cancer cell antibody levels in the patient.
- polymerase chain reaction assays to detect the presence of certain cancer cell nucleic acids or identification of certain cancer cell markers in the blood using, for example, an antibody assay to detect the presence of the markers in a sample (e.g., but not limited to, blood) from a subject or patient, or by measuring the level of circulating cancer cell antibody levels in the patient.
- the term "about”, in the context of amounts or concentrations of components of the formulations, typically means +/- 5% of the stated value, more typically +/- 4% of the stated value, more typically +/- 3% of the stated value, more typically, +/- 2% of the stated value, even more typically +/- 1% of the stated value, and even more typically +/- 0.5% of the stated value.
- K562 feeder cells engineered to express different cytokines were maintained in IMDM medium.
- Ovarian cancer cell lines: SKOV3-luc, SW626 and CaOV3 were maintained in McCoy’s 5 A medium. All types of medium were supplemented with 10% FBS (Gibco).
- PBMCs Peripheral blood mononuclear cells
- HSA Health Sciences Authority
- NK cells were re-stimulated with K562 cells at a cell ratio of 1:1. After 2 rounds of stimulation in total, NK cells were used for downstream experiments.
- CXCR1 (SEQ ID NO: 1) was cloned into a pFastbacl expression vector (Thermo Fisher) modified with a T7 promoter (SEQ ID NO: 3) and an alpha-globin 3’ UTR sequence (SEQ ID NO: 4) using primers 5’-aataACCGGTgccaccatgtcaaatattacagatccacagatg- 3’ (containing Age-I site) (SEQ ID NO: 6) and 5’-taaaGTCGACtcagaggttggaagagacattga- 3’(containing Sal-I site) (SEQ ID NO: 7).
- Fig.lA provides a schematic representation of the CXCR1 expression cassette comprised in the final vector.
- the sequences was designed by in silico assembly of fragments encoding the NKG2D extracellular domain (DNA sequence of SEQ ID NO: 9, corresponding to amino acid sequence of SEQ ID NO: 8 or UniProt P26718, residues 83-216) or the scFv of anti-EpCAM monoclonal antibody (DNA sequence of SEQ ID NO: 18, corresponding to amino acid sequence of SEQ ID NO: 19), the CD8 alpha hinge (DNA sequence of SEQ ID NO: 13, corresponding to amino acid sequence of SEQ ID: 14 or UniProt P01732, residues 128 - 169) and transmembrane domain (DNA sequence of SEQ ID NO: 15, corresponding to amino acid sequence of SEQ ID NO: 10 or UniProt P01732, residues 170-210) and the O ⁇ 3z intracellular ITAM domain (DNA sequence of SEQ ID NO: 16, corresponding to amino acid sequence of SEQ ID NO: 11 or UniProt P20963,
- Fig. IE provides a schematic representation of the NKG2D CAR expression cassette comprised in the final vector.
- RNA preparation and electroporation For in vitro transcription of mRNA, PCR was performed using the pFastbacl vectors as the DNA template, a forward primer CMV-F (5’- atccgctcgagtagttattaatagtaatcaattacggggtc-3’) (SEQ ID NO: 17), and reverse primer containing a synthesized 150-nt poly (A) tail to generate the linear DNA template. The PCR products were then purified with phenol-chloroform. Capped mRNA was generated through in vitro transcription of the PCR DNA templates using the mMESSAGE mMACHINE T7 ULTRA transcription kit (Thermo Fisher).
- RNA template provided in the kit was also generated. RNA pellets were re-suspended in RNase-free water and frozen at -80°C for storage.
- expanded NK cells was mixed with CXCR1 mRNA and electroporated in a 2-mm cuvette (Bio-Rad, Hercules, CA) using an electroporator.
- expanded NK cells was mixed with NKG2D CAR mRNA and CXCR1 mRNA and electroporated.
- CXCR1 mRNA were replaced with control RNA with amount unchanged. NK cells were rested overnight prior to downstream experiments.
- NK cells To phenotype NK cells, the following monoclonal antibodies conjugated to PE or APC were used (Becton Dickinson Biosciences, San Diego, CA): CD3, CD56, CXCR1, CXCR2 and NKG2D. Cells were acquired using a FACSCalibur flow cytometers (BD Biosciences) or Acuri C6 (BD Biosciences) and analyzed.
- mice Female NSG mice (8-10 weeks) were injected i.p with lxlO 7 SKOV3-luc tumor cells. On day 10 post-tumor inoculation, tumor engraftment was confirmed by live bioluminescence imaging. Two groups of mice were then injected via the tail vein with either 5xl0 6 CXCR1+ NK cells or Mock NK cells labelled with DiR (Perkin Elmer, Ohio, USA). Following NK cell infusion, mice received single dose of 20,000 IU/mouse recombinant human IL-2 intraperitoneally (i.p). Biodistribution of NK cells was examined by DIR imaging at time points of 24 and 48 hours. Peritoneal tumors were isolated after 48 hours and imaged. Photon emission was analyzed by constant region-of-interest (ROI) drawn over the tumor region and the signal measured as radiant efficiency.
- ROI region-of-interest
- mice 8-10 weeks old female NSG mice were used. Mice were injected i.p. with lxlO 7 SKOV3 luc cells and on day 7 post tumor inoculation, tumor engraftment was confirmed by live bioluminescence imaging (BLI) monitored using an IVIS100 Imaging platform. Mice with similar BLI signal intensity randomly divided into 3 different treatment groups containing 5 mice per group.
- mice On day 7, IOOmI of PBS or IOOmI cell suspension containing lx 10 7 NK cells of two different group: (1) Mock NK cells, (2) CXCR1+ NK cells was injected intravenously (i.v.). A total of four injections at the same dose were given in a 3 - 4 days interval.
- mice received dose of 20,000 IU/mouse recombinant human IL-2 intraperitoneally (i.p) every 2 - 3 days from the start of NK cell inoculation till 4 days after the last NK cell injection. Tumor progression was monitored by BLI every week up to 42 days post tumor inoculation, after which survival of mice was monitored.
- NK cells 5xl0 6 Fadu tumour cells were subcutaneously injected in the left flank in male NSG mice (8-10 weeks). After tumours were established and palpable, NK cells (5xl0 6 ) were labelled with Xenolight DiR (Perkin Elmer, Ohio, USA) and injected via the tail vein (intravenous; i.v.) into tumor-bearing mice. Following NK cell infusion, mice received a single dose of 20,000 IU/mouse recombinant human IL-2 intraperitoneally (i.p). Bio-distribution of NK cells was examined by DIR imaging at time points indicated and using the IVIS imaging system (Xenogen).
- Photon emission was analyzed by constant region-of-interest (ROI) drawn over the tumour region.
- ROI constant region-of-interest
- Subcutaneous tumours were isolated after 72 hours, respectively, and imaged again ex vivo using the IVIS imaging system.
- Photon emission was analyzed by constant region-of-interest (ROI) drawn over the tumour region and the signal measured as radiant efficiency.
- CXCR1 expression in NK cells was investigated. While the majority of freshly isolated NK cells express CXCR1, after NK cell expansion, which is necessary for clinical treatment, CXCR1 expression diminished in the ex vivo expanded primary NK cells (Fig. 2 A, B). Electroporation of NK cells with mRNA encoding CXCR1 successfully restored and elevated CXCR1 expression in the ex vivo expanded NK cells (Fig. 2C). The migration of the transfected NK cells towards three different human cancer cells was then tested. As shown in Fig. 3, the condition media generated by these cancer cells was effective to attract CXCR1 modified NK cells but not those without CXCR1 modification (mock controls), demonstrating that CXCR1 overexpression increases the migration ability of ex vivo expanded NK cells towards cancer cells.
- mice were randomized based on ROI values obtained via BLI imaging and similar tumor burden was used as a criterion for randomization. The mice were then intravenously injected through tail vein with mock NK cells or CXCR1 overexpressing NK cells.
- NK cells were pre-labelled with DIR dye, a lipophilic, NIR fluorescent cyanine dye ideal for staining cytoplasmic membrane.
- Fig. 4A shows bioluminescence imaging results: similar tumor burdens were observed in SKOV3 -inoculated NSG mice that received mock NK cells or CXCR1+ NK cells, before NK cell injection.
- Fig.4B addresses whether there was an increase in DIR signal at the peritoneal region of the mice inoculated with SKOV3 cancer cells. Increased DIR signals over the peritoneal region were observed in the mice receiving CXCR1+ NK cells, but not in those injected with mock NK cells.
- Fig. 4C showed that the DIR signals of tumor tissues from the mice injected with CXCR1+ NK cells were significantly higher compared to those from the mice receiving mock NK cells.
- the flux value differences were statistically significant between two groups, P ⁇ 0.0001. Therefore, overexpression of CXCR1 on NK cells can improve the migration of intravenously (i.v.) injected NK cells towards peritoneal tumors.
- a human head and neck cancer xenograft model was established to investigate whether overexpression of CXCR1 could enhance migration of NK cells toward subcutaneous tumor cells in vivo.
- the xenograft model was established by inoculating FaDu human hypopharyngeal cancer cells subcutaneously (s.c.) at the left flank of NSG mice.
- NK cells were labeled with l,l’-dioctadecyl-3,3,3’,3’- tetramethylindotricarbocyanine iodide or DiOC18(7) (DiR), a lipophilic, near-infrared (NIR) fluorescent cyanine dye ideal for staining cytoplasmic membrane, and DiR-labeled NK cells were intravenously (i.v.) injected through the tail vein. Cell distribution in mice was imaged every 24 h for 3 days.
- DiOC18(7) DiOC18(7)
- NIR near-infrared
- mRNAs of CXCR1 and a CAR specific to NKG2D ligands was electroporated to the expanded primary NK cells.
- the SKOV3-luc tumor model was used again, and the mice inoculated with SKOV3-luc cells were treated via intravenous tail vein injection with three different materials: PBS, NK cells expressing NKG2D CAR, and NK cells co-expressing NKG2D CAR and CXCR1. The treatments started 7 days after tumor inoculation.
- CXCR1 modified NK cells can also be combined with a conventional CAR construct for enhancing cancer cell killing capacity
- expanded primary NK cells were electroporated with mRNAs of CXCR1 and EpCAM CAR that contains a scFv for EpCAM recognition, and tested their in vitro cancer killing capacity against SKOV3, a human ovarian cancer cell line known to express EpCAM.
- the modified NK cells showed an improved in vitro killing capacity against SKOV3 cancer cells over mock-control NK cells, demonstrating that CXCR1 incorporation is compatible with EpCAM CAR, and the potential of CXCR1 modified CAR NK cells to eliminate tumors expressing targets other than NKG2D ligands.
- a conventional CAR with a scFv fragment of a monoclonal antibody in this case an anti-EpCAM monoclonal antibody
- a monoclonal antibody in this case an anti-EpCAM monoclonal antibody
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Cell Biology (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Biomedical Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Epidemiology (AREA)
- General Engineering & Computer Science (AREA)
- Mycology (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Virology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Developmental Biology & Embryology (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Disclosed herein include a natural killer (NK) cell genetically modified to comprise a recombinant nucleic acid encoding C-X-C Motif Chemokine Receptor 1 (CXCR1), a pharmaceutical composition comprising the NK cell, methods of preparing the NK cell, and method of treating cancer or tumor using the NK cell. In one embodiment, NK cells co-expresses CXCR1 as well as NKG2D chimeric antigen receptor (CAR) or EpCAM CAR.
Description
GENETICALLY MODIFIED NK CELLS AND USES THEREOF
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of priority of the Singapore application No. 10201907378Q, filed on 8 August 2019, the contents of it being hereby incorporated by reference in its entirety for all purposes.
FIELD OF THE INVENTION
[0002] The present invention relates generally to the field of biotechnology and cell therapy. In particular, the present invention relates to genetically modified NK cells for cancer immunotherapy, their preparation method and use in patients in need thereof.
BACKGROUND OF THE INVENTION
[0003] Recent years have seen tremendous progress in utilizing immune effector cells for cancer therapy. Cancer immunotherapy employing genetically engineered T lymphocytes that express chimeric antigen receptors (CARs) is an effective approach in treating several haematological cancers. CARs are composed of an extracellular antigen -binding domain, typically the single-chain variable fragment (scFv) derived from a monoclonal antibody, and an intracellular signaling domain. Despite recent success in clinical trials, several major limitations are associated with CAR-modified T cells. In addition, the need to generate an autologous CAR-T cell product for each individual patient is logistically demanding and restrictive for a wider adoption in the medical practice. Secondly, manufacturing patient specific CAR-T cells often takes several weeks, which is a significant drawback for treating patients with advancing disease. Furthermore, it is not always possible to collect enough lymphocytes from heavily pretreated patients to generate sufficient quantities of CAR-T cells. An allogeneic “off-the-shelf’ product could overcome these challenges, but allogeneic T cells pose significant risk of graft- versus-host disease (GVHD).
[0004] Natural killer cells (NK cells) are a type of lymphocyte that is a part of the innate immune system. NK cells play an important role in cancer immune-surveillance. In contrast to T cells, they do not require prior sensitization and recognition of peptide antigens presented in complex with major histocompatibility complex (MHC) molecules. Instead, NK cell cytotoxicity can be triggered rapidly upon appropriate stimulation through an array of
native receptors, which in principle could reduce the risk of relapse or resistance mediated by loss of CAR-targeted antigen. Importantly, a favorable safety profile without obvious toxicity following the transfer of allogeneic NK cells in clinical settings (lack of the potential to cause GVHD) has been considered as an important practical advantage over T cell therapy. Therefore, adoptive cell transfer therapy with natural killer (NK) cells is one of the most promising immunotherapeutic modalities for cancer patients. However, the success of the approach has so far been limited to patients with haematological malignancies. Furthermore, the translation of NK cell therapy to non-haematological malignancies is challenging due to the special pathophysiological characteristics of solid tumors, including target antigen heterogeneity, obstacles to CAR immune cell trafficking, and intrinsic negative regulatory mechanisms of tumor microenvironment.
[0005] Therefore, it is an objective of the present invention to provide improved NK cells for cancer immunotherapy, which address some or all of the above mentioned problems.
SUMMARY OF THE INVENTION
[0006] In one aspect, the present invention discloses a natural killer (NK) cell genetically modified to comprise a recombinant nucleic acid encoding C-X-C Motif Chemokine Receptor 1 (CXCR1).
[0007] In another aspect, the present invention discloses a pharmaceutical composition comprising a pharmaceutically effective amount of the NK cell of the present invention and a pharmaceutically acceptable excipient.
[0008] In another aspect, the present invention discloses a method of treating cancer or tumor in a subject in need thereof, comprising administering to the subject a pharmaceutically effective amount of the NK cell of the present invention, or the pharmaceutical composition of the present invention.
[0009] In another aspect, the present invention discloses a method of treating cancer or tumor in a subject in need thereof, the method comprises: (i) obtaining NK cells from the subject, or from a donor which is different from the subject to be treated; (ii) providing a recombinant nucleic acid encoding CXCR1; (iii) transferring the recombinant nucleic acid encoding CXCR1 into the NK cell to obtain genetically modified NK cells; and (iv) administering to the subject a pharmaceutically effective amount of the NK cells obtained from (iii).
[0010] In another aspect, the present invention discloses a method of treating cancer or tumor in a subject in need thereof, the method comprises: (i) obtaining NK cells from the subject, or from a donor which is different from the subject to be treated; (ii) providing a recombinant nucleic acid encoding CXCR1 and a recombinant nucleic acid encoding a recombinant chimeric antigen receptor (CAR); (iii) transferring the recombinant nucleic acid encoding CXCR1 and the recombinant nucleic acid encoding the recombinant CAR into the NK cell to obtain genetically modified NK cells; and (iv) administering to the subject a pharmaceutically effective amount of the NK cells obtained from (iii).
[0011] In another aspect, the present invention discloses a method of preparing the NK cell of the present invention, the method comprises: (i) obtaining or providing NK cells; (ii) providing a recombinant nucleic acid encoding CXCR1; and (iii) transferring the recombinant nucleic acid encoding CXCR1 into the NK cell.
[0012] In a further aspect, the present invention discloses a method of preparing the NK cell of the present invention, the method comprises: (i) obtaining or providing NK cells; (ii) providing a recombinant nucleic acid encoding CXCR1 and a recombinant nucleic acid encoding the recombinant CAR; and (iii) transferring the recombinant nucleic acid encoding CXCR1 and the recombinant nucleic acid encoding the recombinant CAR into the NK cell.
BRIEF DESCRIPTION OF THE DRAWINGS
[0013] The invention will be better understood with reference to the detailed description when considered in conjunction with the non-limiting examples and the accompanying drawings, in which:
[0014] Fig. 1 is a schematic overview of the design concepts for constructs useful for modifying the NK cells as described in the present disclosure (A-C). The particular constructs as described in the examples of this disclosure (D, E) are used for generating recombinant mRNA transcripts of CXCR1 (D) and NKG2D chimeric antigen receptor (CAR) (E).
[0015] Fig. 2 are flow cytometry histograms showing the expression of CXCR1 in NK cells. (A) CXCR1 expression was seen in most freshly isolated NK cells. (B) CXCR1 expression was almost completely lost in NK cells after ex vivo expansion as outlined in the Methods section, with an expression profile almost identical to that of the isotype control. (C) The large majority of the ex vivo expanded NK cells expressed CXCR1 after electroporation with CXCR1 mRNA, while the ex vivo expanded NK cells which were electroporated
without CXCR1 mRNA (‘mock’) showed little or no expression of CXCR1. The results show that electroporation of NK cells with mRNA encoding CXCR1 successfully restored and elevated CXCR1 expression in the ex vivo expanded NK cells.
[0016] Fig. 3 is a histogram showing the migration of CXCR1 transfected NK cells towards three different human cancer cells. In vitro migration of NK cells electroporated with CXCR1 mRNA towards conditioned media derived from different ovarian cancer cell lines (SKOV3, CaOV3 and SW626) were assessed and compared with that of NK cells electroporated without the addition of any mRNA (mock NK cells). The ability to migrate towards IL-8 secreting tumor cells is better in NK cells electroporated with CXCR1 mRNA compared to mock NK cells. The results show that CXCR1 overexpression increases the migration ability of ex vivo expanded NK cells towards cancer cells.
[0017] Fig. 4 shows the results of the cell migration studies of CXCR1 overexpressing NK cells and mock NK cells towards SKOV3 intraperitoneal xenografts. The SKOV3 xenograft model was established by intraperitoneal injection of SKOV3-luc cells. Seven days after tumor inoculation, mice were imaged using luciferin to confirm tumor presence in the peritoneum. Mice were then assigned based on similar tumor burden prior to the intravenous tail vein injection of DiR-lablled NK cells. (A) Bioluminescence images to show tumor growth in the two groups of mice. (B) In vivo migration of mock NK cells versus CXCR1 overexpressing NK cells towards SKOV3 xenografts. After NK cell injection, mice were imaged 24 and 48 hours later. (C) Ex vivo imaging of isolated tumors from the peritoneum 48 hours after NK cell injection. Tumors obtained from mice without NK cell treatment served as controls (control tumor). Flux values of the isolated tumors are shown on the right. ****: P < 0.0001 statistical significance between CXCR1 overexpressing NK cells and mock NK cells. The results show that overexpression of CXCR1 in NK cells can improve the migration of intravenously (i.v.) injected NK cells towards peritoneal tumors.
[0018] Fig. 5 shows the results of the studies of in vivo killing capacities of CXCR1 overexpressing NK cells and mock NK cells against intraperitoneal (i.p) xenografts of human SKOV3 ovarian cancer cells. SKOV3-luc cells were i.p injected to establish a peritoneal ovarian carcinoma xenograft model. Seven days after inoculation, tumor burden was confirmed by luciferin imaging and NK cells were injected as outlined in Material and Methods. (A) Bioluminescence images at day 7 and day 21 post-tumor inoculation are shown. (B) Flux values of tumor burden at day 7 and day 21 were plotted in the bar graph. *:
P < 0.05 statistical significance between CXCR1 overexpressing NK cells and mock NK cells at day 21. The results show that CXCR1 overexpressing NK cells display higher killing capacity against cancer cells, as compared to mock NK cells.
[0019] Fig. 6 shows the results of the studies of in vivo killing capacities of NKG2D CAR-modified, CXCR1 overexpressing NK cells and NKG2D CAR-modified NK cells without CXCR1 overexpression against tumor cells. The SKOV3 xenograft model was established by intraperitoneal injection of SKOV3-luc cells. Seven days after tumor inoculation, mice were imaged using luciferin to confirm tumor presence in the peritoneum. Mice were then assigned based on similar tumor burden prior to the intravenous tail vein injection of NK cells. NK cells were injected as outlined in the Method section. (A) Bioluminescence images at day 7 and day 21 post-tumor inoculation are shown. (B) Flux values of tumor burden at day 7 and day 21 were plotted in the bar graph. **: P < 0.01 statistical significance between NKG2D CAR-modified, CXCR1 overexpressing NK cells and NKG2D CAR- modified NK cells without CXCR1 at day 21. The results show that killing capacity of NKG2D CAR-modified, CXCR1 overexpressing NK cells against tumor cells is higher than that of NKG2D CAR-modified NK cells without CXCR1 overexpression. [0020] Fig. 7 shows the results of the studies of in vitro cancer cell killing capacities of EpCAM CAR-modified, CXCR1 overexpressing NK cells. NK cells were electroporated with an mRNA encoding anti-EpCAM CAR. The results show that modified NK cells showed an improved in vitro killing capacity against SKOV3 cancer cells as compared to mock-control NK cells, demonstrating the potential of CXCR1 modified CAR NK cells to kill tumor cells expressing targets other than NKG2D ligands. Therefore, a scFv of a monoclonal antibody (in this case an anti-EPCAM) can also be used in the recombinant CAR, which together with overexpressed CXCR1 in NK cells leads to improved killing capacity against ovarian cancer cells.
[0021] Fig. 8 shows the results of studies of in vivo tumor infiltration of CXCR1 overexpressing NK cells in a FaDu subcutaneous xenograft model. Mice were inoculated with FaDu human hypopharyngeal cancer cells subcutaneously at the left flank, and 10 days later DiR-labelled NK cells were intravenously injected through the tail vein. After the NK cell injection, mice were imaged every 24 hours up till 72 hours. (A) Whole-body imaging of mice. Flux values at the tumour sites (circled) were plotted in the bar graph, n = 5. (B) Ex vivo imaging of isolated tumours from the right flank 72 hours after NK cell injection.
Tumours obtained from mice without NK cell injection served as control. Flux values of the isolated tumours are shown on the right, n = 5. *: P < 0.05, statistical significance between CXCR1 overspressing NK cells and mock NK cells. The results show that overexpression of CXCR1 in NK cells can improve the migration/infiltration of i.v. -injected NK cells toward subcutaneous tumors.
DEFINITIONS
[0022] A “genetically modified cell” means any cell of any organism that is modified, transformed, or manipulated by addition or modification of a gene, a DNA or RNA molecule, or protein or polypeptide.
[0023] The term “natural killer cell” or “NK cell” as used herein refers to a type of cytotoxic lymphocyte critical to the innate immune system. NK cells are large granular lymphocytes (LGL) and constitute the third kind of cells differentiated from the common lymphoid progenitor-generating B and T lymphocytes. NK cells are known to differentiate and mature in the bone marrow, lymph nodes, spleen, tonsils, and thymus, where they then enter into the circulation. NK cells provide rapid responses to virus-infected cells, and respond to tumor formation. Typically, immune cells detect major histocompatibility complex (MHC) presented on infected cell surfaces, triggering cytokine release, causing lysis or apoptosis. NK cells are different, however, as they have the ability to recognize stressed cells in the absence of antibodies and MHC, allowing for a much faster immune reaction. They were named "natural killers" because of the initial notion that they do not require activation to kill cells that are missing markers of MHC class I. This role is especially important because harmful cells that are missing MHC I markers cannot be detected and destroyed by other immune cells, such as T lymphocyte cells. Since NK cell action is non- MHC-restricted, it is not necessary to match the histocompatibility complex of the individual patient in use, that is, NK cells can be used for cell therapy of allogeneic patients, and have wide clinical application value.
[0024] The term “C-X-C Motif Chemokine Receptor 1 (CXCR1)” as used herein refers to interleukin 8 receptor alpha, which is a chemokine receptor. In human, it is encoded by the gene CXCR1 (GeneCards identifier: GC02M218162). CXCR1 is a member of the G-protein- coupled receptor family. It is a receptor for interleukin 8 (IL8), which binds to IL8 with high affinity. CXCR1 also binds to C-X-C Motif Ligand 6 (CXCL6) with high affinity. In one
specific example, the nucleotide sequence encoding human CXCR1 is 5’-
ATGTCAAATATTACAGATCCACAGATGTGGGATTTTGATGATCTAAATTTCACTG
GCATGCCACCTGCAGATGAAGATTACAGCCCCTGTATGCTAGAAACTGAGACAC
TCAACAAGTATGTTGTGATCATCGCCTATGCCCTAGTGTTCCTGCTGAGCCTGCT
GGGAAACTCCCTGGTGATGCTGGTCATCTTATACAGCAGGGTCGGCCGCTCCGTC
ACTGATGTCTACCTGCTGAACCTGGCCTTGGCCGACCTACTCTTTGCCCTGACCTT
GCCCATCTGGGCCGCCTCCAAGGTGAATGGCTGGATTTTTGGCACATTCCTGTGC
AAGGTGGTCTCACTCCTGAAGGAAGTCAACTTCTACAGTGGCATCCTGCTGTTGG
CCTGCATCAGTGTGGACCGTTACCTGGCCATTGTCCATGCCACACGCACACTGAC
CCAGAAGCGTCACTTGGTCAAGTTTGTTTGTCTTGGCTGCTGGGGACTGTCTATG
AATCTGTCCCTGCCCTTCTTCCTTTTCCGCCAGGCTTACCATCCAAACAATTCCAG
TCCAGTTTGCTATGAGGTCCTGGGAAATGACACAGCAAAATGGCGGATGGTGTT
GCGGATCCTGCCTCACACCTTTGGCTTCATCGTGCCGCTGTTTGTCATGCTGTTCT
GCTATGGATTCACCCTGCGTACACTGTTTAAGGCCCACATGGGGCAGAAGCACC
GAGCCATGAGGGTCATCTTTGCTGTCGTCCTCATCTTCCTGCTTTGCTGGCTGCCC
TACAACCTGGTCCTGCTGGCAGACACCCTCATGAGGACCCAGGTGATCCAGGAG
AGCTGTGAGCGCCGCAACAACATCGGCCGGGCCCTGGATGCCACTGAGATTCTG
GGATTTCTCCATAGCTGCCTCAACCCCATCATCTACGCCTTCATCGGCCAAAATTT
TCGCCATGGATTCCTCAAGATCCTGGCTATGCATGGCCTGGTCAGCAAGGAGTTC
TTGGCACGTCATCGTGTTACCTCCTACACTTCTTCGTCTGTCAATGTCTCTTCCAA
CCTCTGA-3’ (SEQ ID NO: 1) (NCBI Reference Sequence: NM 000634.3). In this specific example, the amino acid sequence of the CXCR1 is (from the N-terminal to the C-terminal):
MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGN
S LVMLVILY SR V GRS VTD V YLLNLALADLLF ALTLPIW A AS KVN GWIF GTFLCKV V S
LLKE VNFY S GILLLACIS VDRYLAIVH ATRTLT QKRHLVKFV CLGC W GLS MNLS LPFF
LFRQAYHPNNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTL
FKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGR
ALD ATEILGFLHSCLNPIIY AFIGQNFRHGFLKILAMHGLV S KEFLARHR VT S YT S S S V
NVSSNL (SEQ ID NO: 2).
[0025] The term "chimeric antigen receptor" or the short form “CAR” as used herein refers to artificial receptor proteins, or chimeric immunoreceptors, and encompass engineered receptors that graft an artificial specificity onto a particular immune effector cell. CARs may
be employed to impart the specificity of a monoclonal antibody onto a NK cell, thereby allowing a large number of specific NK cells to be generated, for example, for use in adoptive cell therapy. CARs typically comprise an intracellular activation domain, a transmembrane domain, and an extracellular domain comprising an antigen binding region. CARs can combine antibody-based specificity for a desired antigen with a NK cell receptor-activating intracellular domain to generate a chimeric protein that exhibits a specific cellular immune activity such as anti-tumor cellular immune activity. In some cases, molecules can be co expressed with the CAR, including co-stimulatory molecules, reporter genes for imaging, gene products that conditionally ablate the NK cells upon addition of a pro-drug, homing receptors, chemokines, chemokine receptors, cytokines, and cytokine receptors.
[0026] As used herein, the term "antigen" is a molecule capable of being bound by an antibody or cell surface receptor. An antigen may generally be used to induce a humoral immune response and/or a cellular immune response leading to the production of lymphocytes.
[0027] As used herein, the term "antibody" refers to a full-length (i.e., naturally occurring or formed by normal immunoglobulin gene fragment recombinatorial processes) immunoglobulin molecule (e.g., an IgG antibody) or an immunologically active (i.e., specifically binding) portion of an immunoglobulin molecule, like an antibody fragment. An "antibody" includes monoclonal, polyclonal, bispecific, multispecific, murine, chimeric, humanized and human antibodies.
[0028] As used herein, the term “antibody fragment" is a portion of an intact antibody such as F(ab') 2, F(ab) 2, Fab', Fab, Fv, scFv, or dAb. Regardless of structure, an antibody fragment as used herein binds with the same antigen that is recognized by the full-length antibody. For example, antibody fragments include isolated fragments consisting of the variable regions, such as the "Fv" fragments consisting of the variable regions of the heavy and light chains or recombinant single chain polypeptide molecules in which light and heavy variable regions are connected by a peptide linker ("scFv proteins"). "Single-chain antibodies", often abbreviated as "scFv" consist of a polypeptide chain that comprises both a VH and a VL domain which interact to form an antigen- binding site. The VH and VL domains are usually linked by a peptide of 1 to 25 amino acid residues. Antibody fragments also include diabodies, triabodies and single domain antibodies (dAb). In some examples, a “fragment” of an antibody comprises an amino acid sequence of at least 5 contiguous amino
acid residues, at least 10 contiguous amino acid residues, at least 15 contiguous amino acid residues, at least 20 contiguous amino acid residues, at least 25 contiguous amino acid residues, at least 40 contiguous amino acid residues, at least 50 contiguous amino acid residues, at least 60 contiguous amino residues, at least 70 contiguous amino acid residues, at least 80 contiguous amino acid residues, at least 90 contiguous amino acid residues, at least 100 contiguous amino acid residues, at least 125 contiguous amino acid residues, at least 150 contiguous amino acid residues, at least 175 contiguous amino acid residues, at least 200 contiguous amino acid residues, or at least 250 contiguous amino acid residues of the amino acid sequence of the antibody.
[0029] "Specifically" or "selectively" binds, when referring to a ligand/receptor, nucleic acid/complementary nucleic acid, antibody/antigen, or other binding pair (e.g., a cytokine to a cytokine receptor) indicates a binding reaction which is determinative of the presence of the protein in a heterogeneous population of proteins and other biologies. Thus, under designated conditions, a specified ligand binds to a particular receptor and does not bind in a significant amount to other proteins present in the sample. Specific binding can also mean, e.g., that the binding compound, nucleic acid ligand, antibody, or binding composition derived from the antigen -binding site of an antibody, binds to its target with an affinity that is at least 25% greater, at least 50% greater, at least 100% (2-fold) greater, at least five times greater, at least ten times greater, at least 20-times greater, or at least 100-times greater than the affinity with any other binding compound.
[0030] Natural-killer group 2, member D, also known as Klrkl (NKG2D), is a C-type lectin-like receptor, which was firstly identified in NK cells as an activating immune receptor. NKG2D is a type II transmembrane glycoprotein, which does not contain any known signaling elements in the intracellular domain. Resembling many activating receptors, NKG2D depends on an adaptor molecule to initiate signaling transduction and cellular activation. In human, NKG2D is not only expressed by all NK cells, but is also expressed by all CD8+ T cells, and subsets of gd+ T cells as a co-stimulatory receptor. NKG2D expression and signaling can be regulated by cytokines and tumor-derived factors. Cytokines, such as IL-2, IL-7, IL-12, IL-15, and type I interferons (IFNs) increase cell surface expression of NKG2D. Cytokines such as IL-21, IFN-g, and TGF-b have been shown to decrease NKG2D expression. IL-21 has been reported to reduce expressions of NKG2D in human CD8+ T cells
and NK cells. In mice, IL-21 stimulation of NK cells is dependent on regulating the NKG2D expression in mouse model of breast carcinoma.
[0031] Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell-cell adhesion in epithelia. EpCAM in normal epithelia is expressed mostly on the basolateral membrane, and is therefore expected to be much less accessible to antibodies than EpCAM in cancer tissue, where it is located on the surface of the cancer cells. The terms "polynucleotide", "nucleic acid" and "oligonucleotide" are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides or analogues thereof. Polynucleotides can have any three-dimensional structure and may perform any function, known or unknown. The following are non-limiting examples of polynucleotides: a gene or gene fragment (for example, a probe, primer, EST or SAGE tag), exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes and primers. A polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogues. If present, modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide. The sequence of nucleotides can be interrupted by non-nucleotide components. A polynucleotide can be further modified after polymerization, such as by conjugation with a labelling component. The term also refers to both double- and single- stranded molecules. Unless otherwise specified or required, a polynucleotide encompasses both the double-stranded form and each of two complementary single- stranded forms known or predicted to make up the double-stranded form.
[0032] The term “recombinant nucleic acid” as used herein refers to nucleic acid formed by laboratory methods of genetic recombination (such as molecular cloning) to bring together genetic material from multiple sources. The nucleic acid sequences used in the construction of recombinant nucleic acid molecules can originate from any species. For example, human nucleic acid may be joined with bacterial nucleic acid. In addition, nucleic acid sequences that do not occur anywhere in nature may be created by the chemical synthesis of nucleic acid, and incorporated into recombinant molecules. Proteins that can result from the expression of recombinant nucleic acid within living cells are termed recombinant proteins. When recombinant nucleic acid encoding a protein is introduced into a host organism, the
recombinant protein is not necessarily produced. Expression of foreign proteins requires the use of specialized expression vectors and often necessitates significant restructuring by foreign coding sequences.
[0033] As used herein, the term "vector" refers to a non-chromosomal nucleic acid comprising an intact replicon such that the vector may be replicated when placed within a permissive cell, for example by a process of transformation. A vector may replicate in one cell type, such as bacteria, but have limited ability to replicate in another cell, such as mammalian cells. Vectors may be viral or non-viral. Exemplary non- viral vectors for delivering nucleic acid include naked DNA; DNA complexed with cationic lipids, alone or in combination with cationic polymers; anionic and cationic liposomes; DNA-protein complexes and particles comprising DNA condensed with cationic polymers such as heterogeneous polylysine, defined-length oligopeptides, and polyethylene imine, in some cases contained in liposomes; and the use of ternary complexes comprising a virus and polylysine-DNA.
[0034] The term “operably linked" as used in the context of a promoter and a nucleic acid means that the promoter can be used to initiate transcription of that nucleic acid.
[0035] The terms “transfer” or “transfect” as used herein refer to the general process by which exogenous nucleic acid is introduced into the host cell, said process can be mechanical transfection (including electroporation), chemical transfection or viral transduction. A “transfected” cell is one which has been transfected with exogenous nucleic acid using any of the above mentioned methods. The cell includes the primary subject cell and its progeny. [0036] As used herein, the term “autologous” is meant to refer to any material derived from the same individual to which it is later to be re-introduced into the individual.
[0037] As used herein, the term “allogeneic” refers to any material derived from an individual other than the individual to which it is later to be introduced into.
[0038] As used herein, "percent identity" refers to sequence identity between two peptides or between two nucleic acid molecules. Percent identity can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are identical at that position.
[0039] As used herein, the terms “peptide”, “polypeptide”, and “protein” are used interchangeably, and refer to a compound having amino acid residues covalently linked by
peptide bonds. A protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can include a protein's or peptide's sequence. Polypeptides include any peptide or protein having two or more amino acids joined to each other by peptide bonds. As used herein, the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides, and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types. “Polypeptides” include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others. The polypeptides include natural peptides, recombinant peptides, synthetic peptides, or a combination thereof.
[0040] As used herein, the phrase "homologous" or "variant" nucleotide sequence, or "homologous" or "variant" amino acid sequence refers to sequences characterized by identity, at the nucleotide level or amino acid level, of at least a specified percentage. Homologous nucleotide sequences include those sequences coding for naturally occurring allelic variants and mutations of the nucleotide sequences set forth herein. Homologous nucleotide sequences include nucleotide sequences encoding for a protein of a mammalian species other than humans. Homologous amino acid sequences include those amino acid sequences which contain conservative amino acid substitutions and which polypeptides have the same binding and/or activity. In some examples, a homologous nucleotide or amino acid sequence has at least 60% or greater, for example at least 70%, or at least 75%, or at least 80%, or at least 85%, or at least 90%, or at least 95%, or at least 98%, or at least 99%, with a comparator sequence. In some examples, a homologous nucleotide or amino acid sequence has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity with a comparator sequence. In some examples, a homologous amino acid sequence has no more than 15, or no more than 10, or no more than 5 or no more than 3 conservative amino acid substitutions. Percent identity can be determined by, for example, the Gap program (Wisconsin Sequence Analysis Package, Version 8 for UNIX, Genetics Computer Group, University Research Park, Madison Wis.), using default settings, which uses the algorithm of Smith and Waterman. In some examples, the recombinant nucleic acid molecules used to modify the NK cells according to the present disclosure are homologous to the exemplary nucleotide sequences disclosed herein, such as the sequences provided in any of SEQ ID NO: 1, 3, 4, 5,
6, 7, 9, 12, 13, 14, 15 or 16. In some other examples, the CXCR1 and/or chimeric antigen receptor (CAR) expressed in the modified NK cells are homologous to the exemplary amino acid sequences disclosed herein, such as the sequences provided in any of SEQ ID NO: 2, 8, 10 or 11.
[0041] The term “express” or "expression" refers to the production of a gene product in a cell. The term “overexpress” or “overexpression” refers to the artificial expression of a gene in increased quantity, as compared to the level of expression in a control cell. In some examples, the control cell is a primary NK cell isolated from a subject. In some examples, the control cell is an NK cell obtained from the expansion of a primary NK cell isolated from a subject. In some examples, the control cell is one of the ex vivo expanded NK cells from a subject, said cells have been transfected with an empty vector or without any nucleic acids. [0042] The term "transient" when referred to expression means a polynucleotide is not incorporated into the genome of the cell. In contrast, the term “stable” when referred to expression means a polynucleotide is incorporated into the genome of the cell. Transient expression can occur from introduced constructs which contain expression signals functional in the host cell, but which constructs do not replicate and rarely integrate in the host cell, or where the host cell is not proliferating. Transient expression also can be accomplished by inducing the activity of a regulatable promoter operably linked to the gene of interest, although such inducible systems frequently exhibit a low basal level of expression. Stable expression can be achieved by introduction of a nucleic acid construct that can integrate into the host genome or that autonomously replicates in the host cell. Stable expression of the gene of interest can be selected for through the use of a selectable marker located on or transfected with the expression construct, followed by selection for cells expressing the marker. When stable expression results from integration, integration of constructs can occur randomly within the host genome or can be targeted through the use of constructs containing regions of homology with the host genome sufficient to target recombination with the host locus. Where constructs are targeted to an endogenous locus, all or some of the transcriptional and translational regulatory regions can be provided by the endogenous locus. To achieve expression in a host cell, the transformed nucleic acid is operably associated with transcriptional and translational initiation and termination regulatory regions that are functional in the host cell.
[0043] The term “tumor” as used herein refers to a swelling of a part of the body, generally without inflammation, caused by an abnormal growth of tissue. Tumors can be benign or malignant (i.e cancerous). A benign tumor does not invade nearby tissue or spread to other parts of the body. Common types of benign tumors include adenomas, fibromas (or fibroids), hemangiomas, lipomas, meningiomas, myomas, neuromas, and osteochondromas. Adenomas are benign tumors starting in the epithelial tissue of a gland or gland-like structure. A common type of adenoma is a polyp in the colon. Adenomas might also grow in the liver or the adrenal, pituitary, or thyroid gland. Fibromas (or fibroids) are tumors of fibrous or connective tissue that can grow in any organ. Hemangiomas are a buildup of blood vessel cells in the skin or internal organs. Lipomas grow from fat cells. They are the most common benign tumor in adults, often found in the neck, shoulders, back, or arms. Meningiomas are tumors that develop from the membrane surrounding the brain and spinal cord. Myomas are tumors that grow from muscle. Neuromas are tumors that develop from the nerves. Osteochondromas are tumors that develop from the bones.
[0044] The term “cancer” as used herein refers to an unregulated proliferation of cells due to loss or normal controls, resulting in unregulated growth, lack of differentiation, local tissue invasion, and, often, metastasis. There are several main types of cancer. Carcinoma is a cancer that begins in the skin or in tissues that line or cover internal organs. Sarcoma is a cancer that begins in bone, cartilage, fat, muscle, blood vessels, or other connective or supportive tissue. Leukemia is a cancer that starts in blood-forming tissue, such as the bone marrow, and causes large numbers of abnormal blood cells to be produced and enter the blood. Lymphoma and multiple myeloma are cancers that begin in the cells of the immune system. Central nervous system cancers are cancers that begin in the tissues of the brain and spinal cord.
DETAILED DESCRIPTION OF THE PRESENT INVENTION
[0045] The inventors of the present application have found that after genetically modifying natural killer (NK) cells with a gene encoding C-X-C Motif Chemokine Receptor 1 (CXCR1) to induce the expression of CXCR1, the genetically modified NK cells display increased migration capacity towards tumor cell-released cytokines, as well as enhanced infiltration into solid tumors. The increased migration and enhanced infiltration resulted in increased antitumor responses of NK cells.
[0046] Thus, in one example, the present invention refers to a natural killer (NK) cell genetically modified to comprise a recombinant nucleic acid encoding C-X-C Motif Chemokine Receptor 1 (CXCR1). The introduction of the recombinant nucleic acid encoding CXCR1 results in induced expression of CXCR1 in the NK cells.
[0047] The expression levels of CXCR1 vary among different types of NK cells. In some examples, the unmodified primary NK cells isolated from a subject do not express CXCR1. For such NK cells, genetic modification is carried out to express CXCR1. In some other examples, the unmodified primary NK cells isolated from a subject express CXCR1 upon isolation. However, after NK cell expansion, which is necessary for providing sufficient NK cells for clinical uses, the expression of CXCR1 is diminished. For such NK cells, genetic modification is carried out after NK cell expansion to restore the expression of CXCR1 to at least the same level as the level of expression of CXCR1 in the isolated NK cells before cell expansion, or to overexpress CXCR1 to a level higher than the level of expression of CXCR1 in the isolated NK cells before cell expansion. In some other examples, the unmodified primary NK cells isolated from a subject express CXCR1, and the level of expression of CXCR1 does not diminish after NK cell expansion. For such NK cells, genetic modification is carried out to overexpress CXCR1 to a level higher than the level of expression of CXCR1 in the isolated NK cells before or after cell expansion. In some examples, overexpression of CXCR1 results in at least about 10%, or at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90%, or at least about a 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100 fold increase in expression of CXCR1 in the genetically modified NK cells as compared to the control NK cells.
[0048] In some example, expression or overexpression of CXCR1 in the genetically modified NK cells can be transient or stable.
[0049] In some examples, NK cells are derived from human peripheral blood mononuclear cells (PBMC), unstimulated leukapheresis products (PBSC), human embryonic stem cells (hESCs), induced pluripotent stem cells (iPSCs), bone marrow, or umbilical cord blood by methods well known in the art. In one particular example, human peripheral blood mononuclear cells are used to derive NK cells. NK cells can be isolated and expanded by methods well known in the art. In one exemplary method, PBMCs are isolated by gradient centrifugation from huffy coats. After PBMC isolation, cells are co-cultured with g- irradiated
K562 cells in SCGM media (Cellgenix GmbH, Freiburg, Germany) supplemented with FBS and IL2 (Peprotech, Rocky Hills, NJ). Half media was refreshed every 2 - 3 days. After 7 days of cell expansion, NK cells are re-stimulated with K562 cells. After 2 rounds of stimulation in total, NK cells can be used for downstream experiments.
[0050] In another example, there is provided a method of preparing a natural killer (NK) cell genetically modified to comprise a recombinant nucleic acid encoding C-X-C Motif Chemokine Receptor 1 (CXCR1), the method comprises: (1) obtaining or providing NK cells; (2) providing a recombinant nucleic acid encoding CXCR1; and (3) transferring the recombinant nucleic acid encoding CXCR1 into the NK cell. In some example, some, or the majority, or all of the NK cells into which the recombinant nucleic acid is to be transferred in step (3) are not expressing CXCR1 or have lost the expression of CXCR1. In some other examples, the method further comprises, after step (1), culturing the NK cells to expand the number of NK cells. NK cell expansion methods are known in the art and exemplified in the Experimental Section of the present application.
[0051] A recombinant nucleic acid encoding CXCR1 can be created using methods known in the art. For example, the nucleotide sequence coding for CXCR1 can be inserted into an appropriate expression vector, i.e., a vector which contains the necessary elements for the transcription and translation of the inserted protein-coding sequence. The necessary transcriptional and translational signals can also be supplied by the native CXCR1 gene and/or its flanking regions. A variety of host-vector systems may be utilized to express the protein-coding sequence. These include but are not limited to mammalian cell systems infected with virus (e.g., vaccinia virus, adenovirus, etc.), insect cell systems infected with vims (e.g., baculovirus), microorganisms such as yeast containing yeast vectors, or bacteria transformed with bacteriophage, DNA, plasmid DNA, or cosmid DNA, transgenic plants or transgenic non-human animals. The expression elements of vectors vary in their strengths and specificities. Depending on the host-vector system utilized, any one of a number of suitable transcription and translation elements may be used.
[0052] Any of the known methods for the insertion of DNA fragments into a vector may be used to construct expression vectors containing a chimeric gene consisting of appropriate transcriptional/translational control signals and the protein coding sequences. Exemplary methods include in vitro recombinant DNA and synthetic techniques. Expression of a nucleic acid sequence encoding CXCR1 may be regulated by a second nucleic acid sequence so that
the CXCR1 peptide is expressed in a host transformed with the recombinant DNA molecule. For example, expression of CXCR1 may be controlled by any promoter/enhancer element known in the art. Promoters that are not native CXCR1 promoters which may be used to control CXCR1 expression include, but are not limited to, prokaryotic promoters such as T7 promoter, T71ac promoter, Sp6 promoter, araBAD promoter, trp promoter, lac promoter, Ptac promoter and pL promoter. In a specific example, the promoter used is T7 promoter having the sequence of 5’-TAATACGACTCACTATAGGG-3’ (SEQ ID NO: 3). The T7 promoter functions to initiate transcription of downstream DNA sequences, for example the CXCR1 encoding sequence.
[0053] The expression vector as described above can further include a 3' untranslated region (3’ UTR) following the DNA encoding CXCR1. The 3' UTR can contain regulatory regions that influence expression of CXCR1 post-transcriptionally, by influencing, for example, polyadenylation, translation efficiency, localization, and/or stability of the mRNA. 3'-UTR contains both binding sites for regulatory proteins as well as microRNAs (miRNAs). By binding to specific sites within the 3'-UTR, miRNAs can decrease gene expression of various mRNAs by either inhibiting translation or directly causing degradation of the transcript. 3 '-UTR can also have silencer regions which bind to repressor proteins and inhibit the expression of the mRNA. Many 3'-UTRs also contain AU-rich elements (AREs). Proteins bind AREs to affect the stability or decay rate of transcripts in a localized manner or affect translation initiation. Furthermore, 3'-UTRs can contain the sequence AAUAAA that directs addition of several hundred adenine residues called the poly(A) tail to the end of the mRNA transcript. Poly(A) binding protein (PABP) binds to this tail, contributing to regulation of mRNA translation, stability, and export. For example, poly(A) tail bound PABP interacts with proteins associated with the 5' end of the transcript, causing a circularization of the mRNA that promotes translation. The 3'-UTR can also contain sequences that attract proteins to associate the mRNA with the cytoskeleton, transport it to or from the cell nucleus, or perform other types of localization. In addition to sequences within the 3 '-UTR, the physical characteristics of the region, including its length and secondary structure, contribute to translation regulation. In one example, the 3’UTR used in the CXCR1 expression vector is the 3’UTR from an alpha globin, a beta globin gene, a growth hormone gene. In one specific example, the 3’UTR used is a mouse alpha globin 3’UTR having the sequence of 5’- GCTGCCTTCTGCGGGGCTTGCCTTCTGGCCATGCCCTTCTTCTCTCCCTTGCACCT
GTACCTCTTGGTCTTTGAATAAAGCCTGAGTAGGAAG-3’ (SEQ ID NO: 4) (NCBI Reference Sequence NM_008218.2), wherein the underlined sequence is a polyA signal enhancing the stability of mRNA.
[0054] In one specific example, the recombinant construct containing the T7 promoter, the nucleotide sequence encoding CXCR1, and the alpha globin 3’UTR, has the following nucleotide sequence: 5’-
TAATACGACTCACTATAGGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATA
TAAGAACCGGTGCCACCATGTCAAATATTACAGATCCACAGATGTGGGATTTTGA
TGATCTAAATTTCACTGGCATGCCACCTGCAGATGAAGATTACAGCCCCTGTATG
CTAGAAACTGAGACACTCAACAAGTATGTTGTGATCATCGCCTATGCCCTAGTGT
TCCTGCTGAGCCTGCTGGGAAACTCCCTGGTGATGCTGGTCATCTTATACAGCAG
GGTCGGCCGCTCCGTCACTGATGTCTACCTGCTGAACCTGGCCTTGGCCGACCTA
CTCTTTGCCCTGACCTTGCCCATCTGGGCCGCCTCCAAGGTGAATGGCTGGATTTT
TGGCACATTCCTGTGCAAGGTGGTCTCACTCCTGAAGGAAGTCAACTTCTACAGT
GGCATCCTGCTGTTGGCCTGCATCAGTGTGGACCGTTACCTGGCCATTGTCCATG
CCACACGCACACTGACCCAGAAGCGTCACTTGGTCAAGTTTGTTTGTCTTGGCTG
CTGGGGACTGTCTATGAATCTGTCCCTGCCCTTCTTCCTTTTCCGCCAGGCTTACC
ATCCAAACAATTCCAGTCCAGTTTGCTATGAGGTCCTGGGAAATGACACAGCAA
AATGGCGGATGGTGTTGCGGATCCTGCCTCACACCTTTGGCTTCATCGTGCCGCT
GTTTGTCATGCTGTTCTGCTATGGATTCACCCTGCGTACACTGTTTAAGGCCCACA
TGGGGCAGAAGCACCGAGCCATGAGGGTCATCTTTGCTGTCGTCCTCATCTTCCT
GCTTTGCTGGCTGCCCTACAACCTGGTCCTGCTGGCAGACACCCTCATGAGGACC
CAGGTGATCCAGGAGAGCTGTGAGCGCCGCAACAACATCGGCCGGGCCCTGGAT
GCCACTGAGATTCTGGGATTTCTCCATAGCTGCCTCAACCCCATCATCTACGCCTT
CATCGGCCAAAATTTTCGCCATGGATTCCTCAAGATCCTGGCTATGCATGGCCTG
GTCAGCAAGGAGTTCTTGGCACGTCATCGTGTTACCTCCTACACTTCTTCGTCTGT
CAATGTCTCTTCCAACCTCTGAGTCGACCCAAGCTTGCTGCCTTCTGCGGGGCTT
GCCTTCTGGCCATGCCCTTCTTCTCTCCCTTGCACCTGTACCTCTTGGTCTTTGAAT
AAAGCCTGAGTAGGAAG-3 ’ (SEQ ID NO: 5).
[0055] In some examples, the basic backbone of the recombinant expression vector is a commercially available vector into which each of the above elements is inserted. Exemplary expression vectors included but are not limited to pFastbacl, pALTER-Exl, pALTER-Ex2,
pCal-n, pCal-n-EK, pCal-c, pCal-Kc, pcDNA 2.1, pDUAL, pET-3a-c, pET-9a-d, pET-1 la-d, pET-12a-c, pET-14b, pET-15b, pET-16b, pET-17b, pET-19b, pET-20b(+), pET-2 la-d(+), pET-22b(+), pET-23a-d(+), pET-24a-d(+), pET-25b(+), pET-26b(+), pET-27b(+), pET-28a- c(+), pET-29a-c(+), pET-30a-c(+), pET-3 lb(+), pET-32a-c(+), pET-33b(+), pET-34b(+), pET-35b(+), pET-36b(+), pET-37b(+), pET-38b(+), pET-39b(+), pET-40b(+), pET-41a-c(+), pET-42a-c(+), pET-43a-c(+), pETBlue-1, pETBlue-2, pETBlue-3, pGEMEX-1, pGEMEX-2, pRSET, pTriEx-1, and pTriEx-2 expression vectors. In one specific example the expression vector is a pFastbacl expression vector.
[0056] The nucleic acid encoding CXCR1 can be cloned into the expression vector using molecular cloning techniques commonly known in the art. In some examples, the primers used for molecular cloning are as follows: forward primer 5’-
AATAACCGGTGCC ACC ATGTCAAATATTACAGATCC ACAGATG-3 ’ (containing Age- I site) (SEQ ID NO: 6) and reverse primer 5’-
TAAAGTCGACTCAGAGGTTGGAAGAGACATTGA-3 ’ (containing Sal-I site) (SEQ ID NO: 7).
[0057] Methods generally known in the field can be used for the transcription of mRNA from the recombinant expression vectors described above. For example, PCR can be performed using the recombinant expression vectors as the DNA template to generate the linear DNA template. In vitro transcription of the linear DNA template generated can then be used to generate the CXCR1 mRNA. Optionally, the linear DNA template is purified before in vitro transcription is carried out.
[0058] The recombinant nucleic acid encoding CXCR1 to be transferred into the NK cell can be a DNA encoding the CXCR1, or an mRNA obtained by transcription of the DNA. The transfer can be carried out by electroporation, non-viral chemical transfection, viral transduction using retroviral or lentiviral vectors, in a manner commonly used in the art. [0059] In another example, the natural killer (NK) cell modified as described above is further genetically modified to express a recombinant chimeric antigen receptor (CAR). In some examples, the CAR comprises an intracellular signaling domain, a transmembrane domain, and an extracellular domain comprising an antigen binding region. In some examples, the expression of such recombinant CAR allows the genetically modified NK cells to express the antibody binding domain of the CAR on the cell surface, conferring novel antigen specificity that is MHC independent.
[0060] The antigen recognition domain includes a polypeptide that is selective for or targets an antigen, receptor, peptide ligand, or protein ligand of the target; or a polypeptide of the target. The antigen recognition domain may be obtained from any of the wide variety of extracellular domains or secreted proteins associated with ligand binding and/or signal transduction. The antigen recognition domain may include a portion of Ig heavy chain linked with a portion of Ig light chain, constituting a single chain fragment variable (scFv) that binds specifically to a target antigen. The antibody may be monoclonal or polyclonal antibody or may be of any type that binds specifically to the target antigen. In another embodiment, the antigen recognition domain can be a receptor or ligand.
[0061] The choice of the antigen binding region depends upon the type and number of ligands that define the surface of a target cell. For example, the antigen binding region may be chosen to recognize a ligand that acts as a cell surface marker on target cells associated with a particular disease state. Examples of cell surface markers that can act as ligands for the antigen binding region in the CARs include those associated with or specific to cancer and/or tumor cells, autoimmune diseases, and viral, bacterial and parasitic infections.
[0062] In some examples of CARs, the antigen binding region of the extracellular domain binds to a tumor associated antigen, a tumor specific antigen, or a pathogen-specific antigen. The genetically modified NK cells comprising such CARs can then be redirected to the tumor associated antigen, tumor specific antigen or a pathogen- specific antigen based on the antigen binding specificity. A tumor specific antigen is unique to tumor cells and does not occur on other cells in the body. A tumor associated antigen is not unique to a tumor cell and instead is also expressed on a normal cell under conditions that fail to induce a state of immunologic tolerance to the antigen. The expression of the antigen on the tumor may occur under conditions that enable the immune system to respond to the antigen. Tumor associated antigens can be antigens that are expressed on normal cells during fetal development when the immune system is immature and unable to respond or they may be antigens that are normally present at extremely low levels on normal cells but which are expressed at much higher levels on tumor cells. Non-limiting examples of tumor associated or tumor specific antigens include the following: NKG2D, differentiation antigens such as MART-l/MelanA (MART-1), gplOO (Pmel 17), tyrosinase, TRP-1, TRP-2 and tumor- specific multilineage antigens such as MAGE-1, MAGE-3, BAGE, GAGE-1, GAGE-2, pl5; overexpressed embryonic antigens such as CEA; overexpressed oncogenes and mutated tumor-suppressor
genes such as p53, Ras, HER-2/neu; unique tumor antigens resulting from chromosomal translocations such as BCR-ABL, E2A-PRL, H4-RET, 1GH-IGK, MYL-RAR; and viral antigens such as the Epstein Barr virus antigens EBVA and the human papillomavirus (HPV) antigens E6 and E7. Other large, protein-based antigens include TSP-180, MAGE-4, MAGE- 5, MAGE- 6, RAGE, NY-ESO, pl85erbB2, pl80erbB-3, c-met, nm-23Hl, PSA, TAG-72, CA 19-9, CA 72-4, CAM 17.1, NuMa, K-ras, beta-Catenin, CDK4, Mum-1 , pl5, pl6, 43-9F, 5T4, 791Tgp72, alpha-fetoprotem, beta-HCG, BCA225, BTAA, CA 125, CA 15-3\CA 27.29VBCAA, CA 195, CA 242, CA-50, CAM43, CD68M, CO-029, FGF-5, G250, Ga733V, EpCAM, HTgp-175, M344, MA-50, MG7-Ag, MOV18, NB/70K, NY-CO-1, RCAS1, SDCCAG16, TA-90\Mac-2 binding protein, Acyclophilin C-associated protein, TAAL6, TAG72, TLP, and TPS.
[0063] In some examples, the CAR recognizes cell-surface tumor associated antigen or tumor specific antigen independent of human leukocyte antigen (HLA) and employs one or more signaling molecules to activate the genetically modified NK cells for killing, proliferation, and/or cytokine production.
[0064] In some examples, the antigen binding region of the extracellular domain of the CARs target an antigen that includes but is not limited to CD 19, CD20, CD22, ROR1 , Mesothelin, CD33/lL3Ra, c-Met, PSMA, Glycolipid F77, EGFRvIII, GD-2, MY-ESO-1 TCR, MAGE A3 TCR, EpCAM and the like.
[0065] In some specific examples, the tumor associated antigen is a ligand of NKG2D, and therefore the extracellular domain of the chimeric antigen receptor comprises NKG2D or an antigen binding fragment thereof. In one example, the antigen binding fragment of NKG2D is or comprises the extracellular domain of NKG2D having the following amino acid sequence (from the N-terminal to the C-terminal): FN QE V QIPLTES YCGPCPKNWIC YKNN C Y QFFDES KNW YES Q AS CMS QN AS LLKV Y SKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDC ALYAS S FKG YIENCS TPNT YICMQRT V (SEQ ID NO: 8)(UniProt P26718, amino acid residues 83-216), encoded by the following exemplary nucleotide sequence: 5’- TTCAACCAAGAAGTTCAAATTCCCTTGACCGAAAGTTACTGTGGCCCATGTCCTA A A A ACT GG AT ATGTT AC A A A A AT A ACT GCT ACC A ATTTTTTG AT G AG AGT A A A A A CTGGTATGAGAGCCAGGCTTCTTGTATGTCTCAAAATGCCAGCCTTCTGAAAGTA TACAGCAAAGAGGACCAGGATTTACTTAAACTGGTGAAGTCATATCATTGGATG
GGACTAGTACACATTCCAACAAATGGATCTTGGCAGTGGGAAGATGGCTCCATT CTCTCACCCAACCTACTAACAATAATTGAAATGCAGAAGGGAGACTGTGCACTCT ATGCCTCGAGCTTTAAAGGCTATATAGAAAACTGTTCAACTCCAAATACGTACAT CTGTATGCAAAGGACTGTG-3 ’ (SEQ ID NO: 9). NKG2D ligands are structural homologs of MHC class I molecules. NKG2D ligands are absent or rarely expressed in normal tissues, but are extensively expressed in various malignancies and viral-infected tissues. Examples of human NKG2D ligands include class-I-related chains-related molecules A and B (MICA and MICB) proteins and retinoic acid early transcripts-1 (RAET1), also known as UL-16 binding proteins. Examples of mouse NKG2D ligands include five different RAETl isoforms (RAETla, RAET1 b, RAETl g, RAETl d, and RAETl e), three different H60 isoforms (H60a, b, and c), and UL16 binding protein 1 (encoded by MULTI gene). Although NKG2D ligands are structural homologs of MHC class I molecules, they do not present antigen to T cells or bind b2 -microglobulin. In some examples, the NKG2D ligands for which the extracellular domain of the chimeric antigen receptor binds to are membrane- bound ligands.
[0066] In some specific examples, the tumor associated antigen is EpCAM, and therefore the extracellular domain of the chimeric antigen receptor comprises the single-chain variable fragment (scFv) of a monoclonal EpCAM antibody. In one specific example, the scFv of an monoclonal EpCAM antibody has the following amino acid sequence (from the N-terminal to the C-terminal) :
DIQMTQS PS S LS AS V GDRVTITCRSTKS LLHS N GIT YLYW Y QQKPGKAPKLLIY QMS N LAS G VPS RFS S S GS GTDFTLTIS S LQPEDF AT Y Y C AQNLEIPRTF GQGTKVELKRATPS HN S HQ VPS AGGPT AN S GTS GS E V QLV QS GPGLV QPGGS VRIS C A AS G YTFTN Y GMN W VKQ APGKGLEWMGWINT YT GES T Y ADS FKGRFTF S LDT S AS A A YLQIN S LR AEDT A VYY C ARFAIKGD YWGQGTLLT V S S (SEQ ID NO: 19), encoded by the following exemplary nucleotide sequence: 5’-
GATATCCAGATGACCCAGTCCCCGTCCTCCCTGAGTGCTTCTGTTGGTGACCGTG TTACCATCACCTGCCGTTCCACCAAATCCCTCCTGCACTCCAACGGTATCACCTA CCTTTATTGGTATCAACAGAAACCGGGTAAAGCTCCGAAACTTCTGATCTACCAG ATGTCCAACCTGGCTTCCGGTGTTCCGTCTCGTTTCTCCAGTTCTGGTTCTGGTAC CGACTTCACCCTGACCATCTCTTCTCTGCAGCCGGAAGACTTCGCTACCTACTACT GCGCTCAGAACCTGGAAATCCCGCGTACCTTCGGTCAGGGTACCAAAGTTGAAC
TTAAGCGCGCTACCCCGTCTCACAACTCCCACCAGGTTCCATCCGCAGGCGGTCC GACTGCTAACTCTGGAACTAGTGGATCCGAAGTACAGCTGGTTCAGTCCGGCCCG GGTCTTGTTCAACCGGGTGGTTCCGTTCGTATCTCTTGCGCTGCTTCTGGTTACAC GTTCACCAACTACGGCATGAACTGGGTCAAACAGGCTCCGGGTAAAGGCCTGGA ATGGATGGGCTGGATCAACACCTACACCGGTGAATCCACCTACGCTGACTCCTTC AAAGGTCGCTTCACTTTCTCCCTCGACACAAGTGCTAGTGCTGCATACCTCCAAA TCAACTCGCTGCGTGCAGAGGATACAGCAGTCTATTACTGCGCCCGTTTCGCTAT CAAAGGTGACTACTGGGGTCAAGGCACGCTGCTGACCGTTTCCTCG -3’ (SEQ ID NO: 18). EpCAM (CD326) is also referred to as EGP-2, 17-1 A, HEA125, MK-1, GA733-2, EGP34, KSA, TROP-1, ESA, TACSTD1 or KS1/4 and is one of the first identified tumor- associated antigens. EpCAM is a type I membrane protein of 314 amino acids (aa) of which only 26 aa are facing the cytoplasm. EpCAM has been postulated to function as a homophilic cell adhesion molecule that interferes with cadherin-mediated cell-cell contact.
[0067] In one specific example, the extracellular domain of the CAR has the following amino acid sequence (from the N-terminal to the C-terminal):
FN QE V QIPLTES YCGPCPKNWIC YKNN C Y QFFDES KNW YES Q AS CMS QN AS LLKV Y SKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDC ALYAS S FKG YIENCS TPNT YICMQRT V (SEQ ID NO: 8).
[0068] In another specific example, the extracellular domain of the CAR has the following amino acid sequence (from the N-terminal to the C-terminal):
DIQMTQS PS S LS AS V GDRVTITCRSTKS LLHS N GIT YLYW Y QQKPGKAPKLLIY QMS N LAS G VPS RFS S S GS GTDFTLTIS S LQPEDF AT Y Y C AQNLEIPRTF GQGTKVELKRATPS HN S HQ VPS AGGPT AN S GTS GS E V QLV QS GPGLV QPGGS VRIS C A AS G YTFTN Y GMN W VKQ APGKGLEWMGWINT YT GES T Y ADS FKGRFTF S LDT S AS A A YLQIN S LR AEDT A VYY C ARFAIKGD YW GQGTLLT V S S (SEQ ID NO: 19)
[0069] It is understood that the antigen binding region may include some variability within its sequence and still be selective for the targets disclosed herein. Therefore, it is contemplated that the polypeptide of the antigen binding region may be at least 95%, at least 90%, at least 80%, or at least 70% identical to the antigen binding region polypeptide sequences disclosed herein and still be selective for the targets described herein and be within the scope of the disclosure.
[0070] The extracellular domain of a chimeric antigen receptor generally also comprises a hinge region. The hinge region is a sequence positioned between for example, the antigen binding region, and the transmembrane domain. The sequence of the hinge region can be obtained from, for example, any suitable sequence from any genus, including human or a part thereof. In some examples, the hinge region includes the hinge region of a human protein including CD-8 alpha, CD28, 4-1BB, 0X40, T cell receptor a or b chain, a Oϋ3z chain, CD28, CD3e, CD45, CD4, CD5, CD8, CD8a, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, ICOS, CD154, functional derivatives thereof, and combinations thereof. In one specific example, the hinge region includes the CD8 hinge region. In some examples, the hinge region can be one selected from, but is not limited to, immunoglobulin (e.g. IgGl, IgG2, IgG3, IgG4, and IgD). In one specific example, the hinge region of the CAR has the following amino acid sequence (from the N-terminal to the C- terminal): F VP VFLP AKPTTTP APRPPTP APTIAS QPLS LRPE ACRP A AG (SEQ ID NO: 14), encoded by the following exemplary nucleotide sequence: 5’-
TTCGTGCCGGTCTTCCTGCCAGCGAAGCCCACCACGACGCCAGCGCCGCGACCAC CAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGT GCCGGCC AGCGGCGGGG-3 ’ (SEQ ID NO: 13)
[0071] The transmembrane domain of a CAR includes a hydrophobic polypeptide that spans the cellular membrane. In particular, the transmembrane domain spans from one side of a cell membrane (extracellular) through to the other side of the cell membrane (intracellular or cytoplasmic).
[0072] In some examples, the transmembrane domain is artificially designed so that more than 25%, more than 50% or more than 75% of the amino acid residues of the domain are hydrophobic residues such as leucine and valine.
[0073] The transmembrane domain may be in the form of an alpha helix or a beta barrel, or combinations thereof. The transmembrane domain may include a polytopic protein, which has many transmembrane segments, each alpha-helical, beta sheets, or combinations thereof. [0074] In one example, the transmembrane domain that is naturally associated with one of the domains in the CAR is used. In another example, the transmembrane domain is selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
[0075] For example, a transmembrane domain includes a transmembrane domain of a T- cell receptor a or b chain, a Oϋ3z chain, CD28, CD3e, CD45, CD4, CD5, CD7, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD68, CD134, CD137, ICOS, CD41, CD 154, functional derivatives thereof, and combinations thereof. In one specific example, the transmembrane domain is a CD8 transmembrane domain. In one specific example, the transmembrane domain of the CAR has the following amino acid sequence (from the N- terminal to the C -terminal):
GAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRN (SEQ ID NO: 10), encoded by the following exemplary nucleotide sequence: 5’-
GGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGATATCTACATCTGGGCG CCCTTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACCCTTTACTG CAACCACAGGAAC-3 ’ (SEQ ID NO: 15).
[0076] The intracellular signaling domain of a chimeric antigen receptor is responsible for activation of at least one of the normal effector functions of the immune cell in which the chimeric antigen receptor has been placed. The term "effector function" refers to a specialized function of a differentiated cell, such as a NK cell. The intracellular receptor signaling domain generally includes at least one immunoreceptor tyrosine based activation motif (ITAM)-containing domain. Each ITAM possesses two repeats of the consensus sequence Tyr-X-X-Leu/Ile (X being any amino acid) spaced by six to eight amino acids. The tyrosine residues within ITAM become phosphorylated following interaction of the receptor molecules with their ligands and form docking sites for other proteins involved in the signaling pathways of the cell. In some examples, intracellular receptor signaling domains in the CAR include part or all of CD3C, OX40/CD134, FceRIy, ICOS/CD278, ILRB/CD122, IL-2RG/CD132, DAP molecules, CD70, cytokine receptor, CD40, or a combination thereof. In one specific example, the intracellular receptor signaling domain used is O03z. In one specific example, the intracellular receptor signaling domain of the CAR has the following amino acid sequence (from the N-terminal to the C-terminal): RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQ EGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQAL PPR (SEQ ID NO: 11), encoded by the following exemplary nucleotide sequence: 5’- AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAA CCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGA
CAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACC CTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACA GTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTT TACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAG GCCCTGCCCCCTCGC-3’(SEQ ID NO: 16).
[0077] In some examples, the chimeric antigen receptors disclosed herein further includes one or more co- stimulatory domains. The inclusion of a co-stimulator can enhance the proliferation, survival and/or development of the NK cells. In some examples, the co stimulatory domain is a functional signaling domain from a protein including 0X40; CD27; CD28; CD30; CD40; PD-1; CD2; CD7; CD258; Natural killer Group 2 member C (NKG2C); Natural killer Group 2 member D (NKG2D), B7-H3; a ligand that binds to at least one of CD83, ICAM-1, LFA-1 (CD1 la/CD18), ICOS, and 4-1BB (CD137); CDS; ICAM-1; LFA-1 (CD 1 a/CD 18); CD40; CD27; CD7; B7-H3; NKG2C; PD-1; ICOS; active fragments thereof; functional derivatives thereof; and combinations thereof.
[0078] As used herein, the at least one co-stimulatory domain and intracellular signaling domain may be collectively referred to as the intracellular domain of the chimeric antigen receptor. As used herein, the hinge region and the antigen binding region may be collectively referred to as the extracellular domain of the chimeric antigen receptor.
[0079] In some examples, between the extracellular domain and the transmembrane domain of the CAR, or between the intracellular domain and the transmembrane domain of the CAR, there is incorporated a spacer domain. As used herein, the term "spacer domain" generally means any oligo- or polypeptide that functions to link the transmembrane domain to, either the extracellular domain or, the intracellular domain in the polypeptide chain, A spacer domain can comprise up to about 300 amino acids, or about 10 to about 100 amino acids, or about 25 to about 50 amino acids.
[0080] In one specific example, the desired CAR in the genetically modified NK cell comprises NKG2D, CD8 alpha hinge and transmembrane domain, and CD3z signaling domains. In one specific example, the recombinant construct containing a T7 promoter, the nucleotide sequence encoding such CAR, and the alpha globin 3’UTR, has the following codon optimized nucleotide sequence: 5’-
TAATACGACTCACTATAGGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATA
TAAGAGCCACCATGCTTCTCCTGGTGACAAGCCTTCTGCTCTGTGAGTTACCACA
CCCAGCATTCCTCCTGATCCCAGGCGCGCATGCCTTCAACCAAGAAGTTCAAATT
CCCTTGACCGAAAGTTACTGTGGCCCATGTCCTAAAAACTGGATATGTTACAAAA
ATAACTGCTACCAATTTTTTGATGAGAGTAAAAACTGGTATGAGAGCCAGGCTTC
TTGTATGTCTCAAAATGCCAGCCTTCTGAAAGTATACAGCAAAGAGGACCAGGA
TTT ACTT AAACTGGTG AAGTC AT ATC ATTGGATGGGACT AGT AC AC ATTCC AAC A
AATGGATCTTGGCAGTGGGAAGATGGCTCCATTCTCTCACCCAACCTACTAACAA
TAATTGAAATGCAGAAGGGAGACTGTGCACTCTATGCCTCGAGCTTTAAAGGCT
ATATAGAAAACTGTTCAACTCCAAATACGTACATCTGTATGCAAAGGACTGTGGC
TAGCTTCGTGCCGGTCTTCCTGCCAGCGAAGCCCACCACGACGCCAGCGCCGCGA
CCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAG
GCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCC
TGTGATATCTACATCTGGGCGCCCTTGGCCGGGACTTGTGGGGTCCTTCTCCTGTC
ACTGGTTATCACCCTTTACTGCAACCACAGGAACAGAGTGAAGTTCAGCAGGAG
CGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAA
TCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCC
TGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATG
AACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGC
GAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCC
ACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCTGAACCG
GTCGACCCAAGCTTGCTGCCTTCTGCGGGGCTTGCCTTCTGGCCATGCCCTTCTTC
TCTCCCTTGCACCTGTACCTCTTGGTCTTTGAATAAAGCCTGAGTAGGAAG-3’
(SEQ ID NO: 12).
[0081] In another specific example, the desired CAR in the genetically modified NK cell comprises a scFv fragment of an anti-EPCAM antibody, CD8 alpha hinge and transmembrane domain, and O03z signaling domains. In one specific example, the recombinant construct containing a T7 promoter, the nucleotide sequence encoding such CAR, and the alpha globin 3’UTR, has the following nucleotide sequence: 5’- TAAT ACGACTC ACT AT AGGGAA AT AAGAGAGAAAAGAAGAGT AAGAAGAAAT A TAAGAGCCACCATGCTTCTCCTGGTGACAAGCCTTCTGCTCTGTGAGTTACCACA CCCAGCATTCCTCCTGATCCCAGGCGCGCATGCCTTCAACCAAGAAGTTCAAATT CCCTTGACCGAAAGTTACTGTGGCCCATGTCCTAAAAACTGGATATGTTACAAAA ATAACTGCTACCAATTTTTTGATGAGAGTAAAAACTGGTATGAGAGCCAGGCTTC
TTGTATGTCTCAAAATGCCGATATCCAGATGACCCAGTCCCCGTCCTCCCTGAGT
GCTTCTGTTGGTGACCGTGTTACCATCACCTGCCGTTCCACCAAATCCCTCCTGCA
CTCCAACGGTATCACCTACCTTTATTGGTATCAACAGAAACCGGGTAAAGCTCCG
AAACTTCTGATCTACCAGATGTCCAACCTGGCTTCCGGTGTTCCGTCTCGTTTCTC
CAGTTCTGGTTCTGGTACCGACTTCACCCTGACCATCTCTTCTCTGCAGCCGGAA
GACTTCGCTACCTACTACTGCGCTCAGAACCTGGAAATCCCGCGTACCTTCGGTC
AGGGTACCAAAGTTGAACTTAAGCGCGCTACCCCGTCTCACAACTCCCACCAGGT
TCCATCCGCAGGCGGTCCGACTGCTAACTCTGGAACTAGTGGATCCGAAGTACA
GCTGGTTCAGTCCGGCCCGGGTCTTGTTCAACCGGGTGGTTCCGTTCGTATCTCTT
GCGCTGCTTCTGGTTACACGTTCACCAACTACGGCATGAACTGGGTCAAACAGGC
TCCGGGTAAAGGCCTGGAATGGATGGGCTGGATCAACACCTACACCGGTGAATC
CACCTACGCTGACTCCTTCAAAGGTCGCTTCACTTTCTCCCTCGACACAAGTGCT
AGTGCTGCATACCTCCAAATCAACTCGCTGCGTGCAGAGGATACAGCAGTCTATT
ACTGCGCCCGTTTCGCTATCAAAGGTGACTACTGGGGTCAAGGCACGCTGCTGAC
CGTTTCCTCGGCTAGCTTCGTGCCGGTCTTCCTGCCAGCGAAGCCCACCACGACG
CCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCC
CTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGG
GCTGGACTTCGCCTGTGATATCTACATCTGGGCGCCCTTGGCCGGGACTTGTGGG
GTCCTTCTCCTGTCACTGGTTATCACCCTTTACTGCAACCACAGGAACAGAGTGA
AGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCT
AT A AC G AGCT C A AT CT AGG ACG A AG AG AGG AGT AC GAT GTTTT GG AC A AG AG AC
GTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAA
GGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATT
GGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGG
TCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCC
CCTCGCTGAACCGGTCGACCCAAGCTTGCTGCCTTCTGCGGGGCTTGCCTTCTGG
CCATGCCCTTCTTCTCTCCCTTGCACCTGTACCTCTTGGTCTTTGAATAAAGCCTG
AGTAGGAAG -3’ (SEQ ID NO: 20)
[0082] The terms “Oϋ3z”, “CD3zeta”, “CD3z” are used interchangeably herein to refer to the same T-cell surface glycoprotein CD3 zeta chain.
[0083] Expression of CARs in the genetically modified NK cells can be transient or stable. In some examples, the constructs in each of Figs. 1A - IF are transiently or stably expressed in the genetically modified NK cells.
[0084] In another example, there is provided a method of preparing a natural killer (NK) cell genetically modified to comprise a recombinant nucleic acid encoding CXCR1, and also expressing a CAR. The method comprises: (1) obtaining or providing NK cells; (2) providing a recombinant nucleic acid encoding CXCR1 and a recombinant nucleic acid encoding the CAR; and (3) transferring the recombinant nucleic acid encoding CXCR1 and the recombinant nucleic acid encoding the CAR into the NK cell. In some examples, some, or the majority, or all of the NK cells into which the recombinant nucleic acids are to be transferred in step (3) are not expressing CXCR1 or have lost the expression of CXCR1. In some other examples, the method further comprises, after step (1), culturing the NK cells to expand the number of NK cells. NK cell expansion methods are known in the art and exemplified in the Experimental Section of the present application. In some examples, the recombinant nucleic acids encoding CXCR1 and the CAR are transferred into the NK cells simultaneously. In some examples wherein the recombinant nucleic acids encoding CXCR1 and the CAR are transferred into the NK cells simultaneously, the recombinant nucleic acids encoding CXCR1 and the CAR are cloned into the same vector. In some other examples, the recombinant nucleic acids encoding CXCR1 and the CAR are transferred into the NK cells sequentially.
[0085] The molecular cloning and techniques described above for preparing and transferring the recombinant nucleic acid encoding CXCR1 into the NK cell can also be used for preparing and transferring the recombinant nucleic acid encoding the CAR into the NK cell. In some examples, the recombinant nucleic acid encoding the CAR can be prepared from an amino acid sequence of the specified CAR by any conventional method. A base sequence encoding an amino acid sequence can be obtained from the NCBI RefSeq IDs or accession numbers of GenBenk for an amino acid sequence of each domain, and the nucleic acid as disclosed herein can be prepared using a standard molecular biological and/or chemical procedure. For example, based on the base sequence, a polynucleotide can be synthesized, and the polynucleotide of the present disclosure can be prepared by combining DNA fragments which are obtained from a cDNA library using a polymerase chain reaction (PCR). The following techniques can also be used for introducing the CAR into the NK cell:
(i) CARs that are designed to signal through endodomains, (ii) CARs with variable lengths of extracellular domains connecting the antigen-recognition domain to the cell surface, and (iii) artificial antigen presenting cells (aAPC) derived from K562 to expand CAR+ NK cells. In one particular example, the NK cells are genetically modified to express the CAR by electroporation.
[0086] In some examples, the modified NK cells are able to replicate in vivo resulting in long-term persistence that can lead to sustained tumor control.
[0087] The sequence of the open reading frame encoding the chimeric antigen receptor can be obtained from a genomic DNA source, a cDNA source, or can be synthesized (e.g. via PCR), or combinations thereof. Depending upon the size of the genomic DNA and the number of introns, it may be desirable to use cDNA or a combination thereof as it is found that introns stabilize the mRNA. Also, it may be further advantageous to use endogenous or exogenous non-coding regions to stabilize the mRNA.
[0088] In one example, the NK cells as described herein can be provided as a composition or a pharmaceutical composition. The compositions as described herein may be administered in a number of ways depending upon whether local or systemic treatment is desired. Administration may be topical, pulmonary (e.g., by inhalation or insufflation of powders or aerosols, including by nebulizer; intratracheal, intranasal, epidermal and transdermal) or systemic such as oral, and/or parenteral. Parenteral administration includes intravenous, intraarterial, subcutaneous, intraperitoneal or intramuscular injection or infusion; or intracranial, e.g., intrathecal or intraventricular, administration. In some examples, the route of administration may be selected from the group consisting of systemic administration, oral administration, intravenous administration and parenteral administration.
[0089] A composition or pharmaceutical composition as described herein can be provided in unit dosage form wherein each dosage unit, e.g., an injection, contains a predetermined amount of the NK cells as disclosed herein, alone or in appropriate combination with other active agents. The term “unit dosage form” as used herein refers to physically discrete units suitable as unitary dosages for human and animal subjects, each unit containing a predetermined quantity of the NK cells as disclosed herein, alone or in combination with other active agents, calculated in an amount sufficient to produce the desired effect, in association with a pharmaceutically acceptable diluent, carrier, or vehicle, where appropriate. The specifications for the unit dosage forms depend on the particular pharmacodynamics
associated with the pharmaceutical composition in the particular subject. Unit dosage forms can be prepared according to conventional techniques well known in the pharmaceutical industry. Such techniques include the step of bringing into association the active ingredients with the pharmaceutical carrier(s) or excipient(s). In general the formulations are prepared by uniformly and intimately bringing into association the active ingredients with liquid or semi liquid carriers.
[0090] The compositions as described herein may additionally contain other adjunct components conventionally found in pharmaceutical compositions. Thus, for example, the compositions may contain additional, compatible, pharmaceutically-active materials such as, for example, antipruritic, astringents, local anaesthetics or anti-inflammatory agents, or may contain additional materials useful in physically formulating various dosage forms of the compositions of the present invention, such as buffer, dyes, preservatives, antioxidants, opacifiers, thickening agents and stabilizers or combination thereof appropriate for use with the pharmacologically active agent that may be added to solution in any concentration suitable for use in eye drops. However, such materials, when added, should not unduly interfere with the biological activities of the components of the compositions of the present disclosure. The formulations can be sterilized and, if desired, mixed with auxiliary agents, e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, colourings, flavourings and/or aromatic substances and the like which do not deleteriously interact with the NK cells of the formulation.
[0091] In some examples, a medical disease or disorder can be treated by administering a population of the NK cell as disclosed herein. In some examples, the medical disease or disorder is cancer or tumor. Due to their release of pro -inflammatory cytokines, NK cells may reverse the anti-inflammatory tumor microenvironment and increase adaptive immune responses by promoting differentiation, activation, and/or recruitment of accessory immune cell to sites of malignancy.
[0092] Thus, in one example, there is provided a method of treating cancer or tumor in a subject in need thereof, comprising administering to the subject a pharmaceutically effective amount of the NK cells or the pharmaceutical composition as disclosed herein. In another example, there is provided use of a pharmaceutically effective amount of the NK cells or the pharmaceutical composition as disclosed herein in the manufacture of a medicament for treating cancer or tumor. In yet another example, there is provided the NK cells or the
pharmaceutical composition as disclosed herein for use in treating cancer or tumor. In some examples, the genetically modified NK cells used to treat cancer or tumor are prepared during the course of treatment. Thus, in one example, there is provided a method of treating cancer or tumor in a subject in need thereof, the method comprises: (i) obtaining NK cells from the subject, or from a donor which is different from the subject to be treated; (ii) providing a recombinant nucleic acid encoding CXCR1; (iii) transferring the recombinant nucleic acid encoding CXCR1 into the NK cell to obtain genetically modified NK cells; and (iv) administering to the subject a pharmaceutically effective amount of the NK cells obtained from (iii). In another example, there is provided a method of treating cancer or tumor in a subject in need thereof, the method comprises: (i) obtaining NK cells from the subject, or from a donor which is different from the subject to be treated; (ii) providing a recombinant nucleic acid encoding CXCR1 and a recombinant nucleic acid encoding the CAR; (iii) transferring the recombinant nucleic acid encoding CXCR1 and the recombinant nucleic acid encoding the CAR into the NK cell to obtain genetically modified NK cells; and (iv) administering to the subject a pharmaceutically effective amount of the NK cells obtained from (iii). In some example, some, or the majority, or all of the NK cells into which the recombinant nucleic acid is to be transferred in step (iii) are not expressing CXCR1 or have lost the expression of CXCR1. In some other examples, the method further comprises, after step (i), culturing the NK cells to expand the number of NK cells. NK cell expansion methods are known in the art and exemplified in the Experimental Section of the present application. [0093] The term “pharmaceutically effective amount” as used herein includes within its meaning a sufficient but non-toxic amount of the NK cells as described herein to provide the desired treatment effect. Desirably an effective amount or sufficient number of the NK cells as described herein is present in the composition and introduced into the subject such that long-term, specific, anti-tumor responses are established to reduce the size of a tumor or eliminate tumor growth or regrowth than would otherwise result in the absence of such treatment. Desirably, the amount of NK cells introduced into the subject causes at least a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, or 100% decrease in tumor size when compared to otherwise same conditions wherein the NK cells are not present. The exact amount of NK cells required will vary from subject to subject depending on factors such as the species being treated, the age and general condition of the subject, the severity of the condition being treated (e.g. the stage and /or size of the tumor), the mode of
administration, and so forth. In general, the concentration of NK cells desirably should be sufficient to provide in the subject being treated at least from about lxlO6 to about lxlO9 NK cells, even more desirably, from about lxlO7 to about 5xl08 NK cells, although any suitable amount can be utilized either above, e.g., 5xl08 cells, or below, e.g., lxlO7 cells. The dosing schedule can be based on well-established cell-based therapies, or an alternate continuous infusion strategy can be employed. These values provide general guidance of the range of NK cells to be utilized by the practitioner upon optimizing the method of treatment as disclosed herein. The recitation herein of such ranges by no means precludes the use of a higher or lower amount of a component, as might be warranted in a particular application. For example, the actual dose and schedule can vary depending on whether the compositions are administered in combination with other pharmaceutical compositions, or depending on inter individual differences in pharmacokinetics, drug disposition, and metabolism. In any given case, an appropriate “effective amount” may be determined by one of ordinary skill in the art using only routine experimentation.
[0094] Cancers or tumors for which the present treatment methods are useful include any malignant cell type, such as those found in a solid tumor or a hematological tumor. In some specific examples, the malignancy is a solid tumor. Exemplary solid tumors can include, but are not limited to, a tumor of an organ selected from the group consisting of pancreas, colon, cecum, stomach, brain, head, neck, ovary, kidney, larynx, sarcoma, lung, bladder, melanoma, prostate, and breast. In some specific examples, the malignancy is a hematological tumor. Exemplary hematological tumors include tumors of the bone marrow, T or B cell malignancies, leukemias, lymphomas, blastomas, myelomas, and the like. Further examples of cancers that may be treated using the methods provided herein include, but are not limited to, lung cancer (including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung), cancer of the peritoneum, gastric or stomach cancer (including gastrointestinal cancer and gastrointestinal stromal cancer), pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, various types of head and neck cancer, and melanoma. The cancer may specifically be of the following histological type, though it is not limited to these: neoplasm, malignant; carcinoma; carcinoma, undifferentiated; giant and spindle cell carcinoma; small cell carcinoma; papillary carcinoma;
squamous cell carcinoma; lymphoepithelial carcinoma; basal cell carcinoma; pilomatrix carcinoma; transitional cell carcinoma; papillary transitional cell carcinoma; adenocarcinoma; gastrinoma, malignant; cholangiocarcinoma; hepatocellular carcinoma; combined hepatocellular carcinoma and cholangiocarcinoma; trabecular adenocarcinoma; adenoid cystic carcinoma; adenocarcinoma in adenomatous polyp; adenocarcinoma, familial polyposis coli; solid carcinoma; carcinoid tumor, malignant; branchiolo-alveolar adenocarcinoma; papillary adenocarcinoma; chromophobe carcinoma; acidophil carcinoma; oxyphilic adenocarcinoma; basophil carcinoma; clear cell adenocarcinoma; granular cell carcinoma; follicular adenocarcinoma; papillary and follicular adenocarcinoma; nonencapsulating sclerosing carcinoma; adrenal cortical carcinoma; endometroid carcinoma; skin appendage carcinoma; apocrine adenocarcinoma; sebaceous adenocarcinoma; ceruminous adenocarcinoma; mucoepidermoid carcinoma; cystadenocarcinoma; papillary cystadenocarcinoma; papillary serous cystadenocarcinoma; mucinous cystadenocarcinoma; mucinous adenocarcinoma; signet ring cell carcinoma; infiltrating duct carcinoma; medullary carcinoma; lobular carcinoma; inflammatory carcinoma; paget's disease, mammary; acinar cell carcinoma; adenosquamous carcinoma; adenocarcinoma w/squamous metaplasia; thymoma, malignant; ovarian stromal tumor, malignant; thecoma, malignant; granulosa cell tumor, malignant; androblastoma, malignant; Sertoli cell carcinoma; leydig cell tumor, malignant; lipid cell tumor, malignant; paraganglioma, malignant; extra-mammary paraganglioma, malignant; pheochromocytoma; glomangiosarcoma; malignant melanoma; amelanotic melanoma; superficial spreading melanoma; lentigo malignant melanoma; acral lentiginous melanomas; nodular melanomas; malignant melanoma in giant pigmented nevus; epithelioid cell melanoma; blue nevus, malignant; sarcoma; fibrosarcoma; fibrous histiocytoma, malignant; myxosarcoma; liposarcoma; leiomyosarcoma; rhabdomyosarcoma; embryonal rhabdomyosarcoma; alveolar rhabdomyosarcoma; stromal sarcoma; mixed tumor, malignant; mullerian mixed tumor; nephroblastoma; hepatoblastoma; carcinosarcoma; mesenchymoma, malignant; brenner tumor, malignant; phyllodes tumor, malignant; synovial sarcoma; mesothelioma, malignant; dysgerminoma; embryonal carcinoma; teratoma, malignant; struma ovarii, malignant; choriocarcinoma; mesonephroma, malignant; hemangiosarcoma; hemangioendothelioma, malignant; kaposi's sarcoma; hemangiopericytoma, malignant; lymphangiosarcoma; osteosarcoma; juxtacortical osteosarcoma; chondrosarcoma; chondroblastoma, malignant; mesenchymal
chondrosarcoma; giant cell tumor of bone; ewing's sarcoma; odontogenic tumor, malignant; ameloblastic odontosarcoma; ameloblastoma, malignant; ameloblastic fibrosarcoma; pinealoma, malignant; chordoma; glioma, malignant; ependymoma; astrocytoma; protoplasmic astrocytoma; fibrillary astrocytoma; astroblastoma; glioblastoma; oligodendroglioma; oligodendroblastoma; primitive neuroectodermal; cerebellar sarcoma; ganglioneuroblastoma; neuroblastoma; retinoblastoma; olfactory neurogenic tumor; meningioma, malignant; neurofibrosarcoma; neurilemmoma, malignant; granular cell tumor, malignant; malignant lymphoma; hodgkin's disease; hodgkin's; paragranuloma; malignant lymphoma, small lymphocytic; malignant lymphoma, large cell, diffuse; malignant lymphoma, follicular; mycosis fungoides; other specified non-hodgkin's lymphomas; B-cell lymphoma; low grade/follicular non-Hodgkin's lymphoma (NHL); small lymphocytic (SL) NHL; intermediate grade/follicular NHL; intermediate grade diffuse NHL; high grade immunoblastic NHL; high grade lymphoblastic NHL; high grade small non-cleaved cell NHL; bulky disease NHL; mantle cell lymphoma; AIDS-related lymphoma; Waldenstrom's macroglobulinemia; malignant histiocytosis; multiple myeloma; mast cell sarcoma; immunoproliferative small intestinal disease; leukemia; lymphoid leukemia; plasma cell leukemia; erythroleukemia; lymphosarcoma cell leukemia; myeloid leukemia; basophilic leukemia; eosinophilic leukemia; monocytic leukemia; mast cell leukemia; megakaryoblastic leukemia; myeloid sarcoma; hairy cell leukemia; chronic lymphocytic leukemia (CLL); acute lymphoblastic leukemia (ALL); acute myeloid leukemia (AML); and chronic myeloblastic leukemia. In some examples, the cancer/tumor that can be treated using the genetically modified NK cells provided herein include colorectal cancer, ovarian cancer, head and neck cancer, liver cancer, breast cancer, cervical cancer, neuroblastoma, osteosarcoma, lymphoma and glioma. In one specific example, the cancer/tumor that can be treated is ovarian cancer. In another specific example, the cancer/tumor than can be treated is head and neck cancer. [0095] In some examples, the cancer/tumor expresses NKG2D ligand or EpCAM. In some other examples, the cancer/tumor expresses NKG2D ligand or EpCAM after treatment with another drug, radiation or biological agent.
[0096] The terms “treat,” “treatment,” and grammatical variants thereof, refer to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological condition, disorder or disease or obtain beneficial or desired clinical results. Such beneficial or desired clinical results include,
but are not limited to, alleviation of symptoms; diminishment of extent of condition, disorder or disease; stabilized (i.e. not worsening) state of condition, disorder or disease; delay or slowing of condition, disorder or disease progression; amelioration of the condition, disorder or disease state, remission (whether partial or total), whether detectable or undetectable; or enhancement or improvement of condition, disorder or disease. Treatment includes eliciting a cellular response that is clinically significant, without excessive levels of side effects. Treatment also includes prolonging survival as compared to expected survival if not receiving treatment.
[0097] The terms "decrease", "reduced", "reduction" , "decrease", “removal” or "inhibit" are all used herein generally to mean a decrease by a statistically significant amount. However, for avoidance of doubt, "reduced", "reduction" or "decrease", "removal", or "inhibit" means a decrease by at least 10% as compared to a reference level, for example a decrease by at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% or up to and including a 100% decrease (e.g. absent level as compared to a reference sample), or any decrease between 10-100% as compared to a reference level (e.g., in the absence of a treatment as described herein).
[0098] In some examples, the subject or patient to be treated is an animal, mammal, human, including, without limitation, animals classed as bovine, porcine, equine, canine, lupine, feline, murine, ovine, avian, piscine, caprine, corvine, acrine, or delphine. In one example, the patient is a human.
[0099] The source of NK cells that can be used for treating a medical disease or disorder may be of any kind, but in specific examples the cells are obtained from a bank of umbilical cord blood, peripheral blood, human embryonic stem cells, or induced pluripotent stem cells. [00100] In some examples, the NK cells that can be used for treating a medical disease or disorder are autologous, i.e. obtained from the same individual to which the treatment is to be administered. For example, autologous source of NK cells can be collected from a patient in need of treatment and NK cells are activated and modified using the methods described herein and known in the art and then infused back into the patient. Some autologous source of NK cells include PBMCs, umbilical cord blood obtained when the patient was born and subsequently preserved, and induced pluripotent stem cells derived from cells obtained from the patient.
[00101] In some other examples, the NK cells that can be used for treating a medical disease or disorder are allogeneic, i.e. derived from a different individual of the same species as the patient, such as an NK cell donor. In some other examples, the NK cells that can be used for treating a medical disease or disorder are xenogeneic, i.e. derived from an animal of a different species as the patient. Genetically modified NK cells derived from allogeneic xenogeneic sources can provide an off-the-shelf product.
[00102] Allogeneic or autologous NK cells induce a rapid immune response but disappear relatively rapidly from the circulation due to their limited lifespan. Thus, there is reduced concern of persisting side effects using the treatment methods as disclosed herein.
[00103] In certain examples, the NK cells as described herein are administered in combination with a second therapeutic agent. For example, the second therapeutic agent may comprise T cells, an immunomodulatory agent, a monoclonal antibody, or a chemotherapeutic agent. In non- limiting examples, the immunomodulatory agent is lenolidomide, the monoclonal antibody is alemtuzumab, rituxumab, trastuzumab, ibritumomab, gemtuzumab, brentuximab, adotranstuzumab, blinatunomab, daratumumab or elotuzumab, and the chemotherapeutic agent is fludarabine or cyclophosphamide.
[00104] Following administration of the genetically modified NK cells as disclosed herein for treating or preventing a cancer/tumor, the efficacy of the treatment can be assessed in various ways well known to the skilled practitioner. For instance, one of ordinary skill in the art will understand that a therapeutic genetically modified cell delivered in conjunction with the chemo-adjuvant is efficacious in treating or inhibiting a cancer in a patient by observing that the therapeutic genetically modified cell reduces the cancer cell load or prevents a further increase in cancer cell load. Cancer cell loads can be measured by methods that are known in the art, for example, using polymerase chain reaction assays to detect the presence of certain cancer cell nucleic acids or identification of certain cancer cell markers in the blood using, for example, an antibody assay to detect the presence of the markers in a sample (e.g., but not limited to, blood) from a subject or patient, or by measuring the level of circulating cancer cell antibody levels in the patient.
[00105] The invention illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Thus, for example, the terms "comprising", "including", "containing", etc. shall be read expansively and without limitation. Additionally, the terms and expressions employed
herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by preferred embodiments and optional features, modification and variation of the inventions embodied therein herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention.
[00106] As used herein, the term "about", in the context of amounts or concentrations of components of the formulations, typically means +/- 5% of the stated value, more typically +/- 4% of the stated value, more typically +/- 3% of the stated value, more typically, +/- 2% of the stated value, even more typically +/- 1% of the stated value, and even more typically +/- 0.5% of the stated value.
[00107] The invention has been described broadly and generically herein. Each of the narrower species and subgeneric groupings falling within the generic disclosure also form part of the invention. This includes the generic description of the invention with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein.
[00108] Other embodiments are within the following claims and non- limiting examples. In addition, where features or aspects of the invention are described in terms of Markush groups, those skilled in the art will recognize that the invention is also thereby described in terms of any individual member or subgroup of members of the Markush group.
EXPERIMENTAL SECTION
[00109] Methods [00110] Tumor Cell Lines
[00111] K562 feeder cells engineered to express different cytokines (not disclosed) were maintained in IMDM medium. Ovarian cancer cell lines: SKOV3-luc, SW626 and CaOV3 were maintained in McCoy’s 5 A medium. All types of medium were supplemented with 10% FBS (Gibco).
[00112] Ex vivo expansion of natural killer cells
[00113] Peripheral blood mononuclear cells (PBMCs) of healthy donors were isolated by gradient centrifugation from huffy coats obtained from Health Sciences Authority (HSA, Singapore) with approval by the university IRB. After PBMC isolation, cells were co cultured with g- irradiated K562 cells in SCGM media (Cellgenix GmbH, Freiburg, Germany) supplemented with 10% FBS and 50 IU IL2 (Peprotech, Rocky Hills, NJ) at a ratio of 1 PBMC: 2 K562 cells. Half media was refreshed every 2 - 3 days. After 7 days of cell expansion, NK cells were re-stimulated with K562 cells at a cell ratio of 1:1. After 2 rounds of stimulation in total, NK cells were used for downstream experiments.
[00114] Preparation of CXCR1 and NKG2DCAR DNA constructs
[00115] CXCR1 (SEQ ID NO: 1) was cloned into a pFastbacl expression vector (Thermo Fisher) modified with a T7 promoter (SEQ ID NO: 3) and an alpha-globin 3’ UTR sequence (SEQ ID NO: 4) using primers 5’-aataACCGGTgccaccatgtcaaatattacagatccacagatg- 3’ (containing Age-I site) (SEQ ID NO: 6) and 5’-taaaGTCGACtcagaggttggaagagacattga- 3’(containing Sal-I site) (SEQ ID NO: 7). Fig.lA provides a schematic representation of the CXCR1 expression cassette comprised in the final vector.
[00116] To generate the NKG2D CAR construct or EpCAM CAR construct, the sequences was designed by in silico assembly of fragments encoding the NKG2D extracellular domain (DNA sequence of SEQ ID NO: 9, corresponding to amino acid sequence of SEQ ID NO: 8 or UniProt P26718, residues 83-216) or the scFv of anti-EpCAM monoclonal antibody (DNA sequence of SEQ ID NO: 18, corresponding to amino acid sequence of SEQ ID NO: 19), the CD8 alpha hinge (DNA sequence of SEQ ID NO: 13, corresponding to amino acid sequence of SEQ ID: 14 or UniProt P01732, residues 128 - 169) and transmembrane domain (DNA sequence of SEQ ID NO: 15, corresponding to amino acid sequence of SEQ ID NO: 10 or UniProt P01732, residues 170-210) and the Oϋ3z intracellular ITAM domain (DNA sequence of SEQ ID NO: 16, corresponding to amino acid sequence of SEQ ID NO: 11 or UniProt P20963, residues 52-164), followed by synthesis of the fusion gene (AIT Biotech, Singapore). The above NKG2D CAR sequence (SEQ ID NO: 12) was subcloned into pFastbacl expression vector as described above using Eco-RI and Sal-I. Fig. IE provides a schematic representation of the NKG2D CAR expression cassette comprised in the final vector.
[00117] RNA preparation and electroporation
[00118] For in vitro transcription of mRNA, PCR was performed using the pFastbacl vectors as the DNA template, a forward primer CMV-F (5’- atccgctcgagtagttattaatagtaatcaattacggggtc-3’) (SEQ ID NO: 17), and reverse primer containing a synthesized 150-nt poly (A) tail to generate the linear DNA template. The PCR products were then purified with phenol-chloroform. Capped mRNA was generated through in vitro transcription of the PCR DNA templates using the mMESSAGE mMACHINE T7 ULTRA transcription kit (Thermo Fisher). Control RNA template provided in the kit was also generated. RNA pellets were re-suspended in RNase-free water and frozen at -80°C for storage. To overexpress CXCR1 in NK cells, expanded NK cells was mixed with CXCR1 mRNA and electroporated in a 2-mm cuvette (Bio-Rad, Hercules, CA) using an electroporator. For in vitro studies of overexpressing CXCR1 and NKG2D CAR in NK cells, expanded NK cells was mixed with NKG2D CAR mRNA and CXCR1 mRNA and electroporated. To generate NKG2D CAR cells without CXCR1 (NKG2D CAR+ CXCR1- NK cells), CXCR1 mRNA were replaced with control RNA with amount unchanged. NK cells were rested overnight prior to downstream experiments.
[00119] Pheno typing
[00120] To phenotype NK cells, the following monoclonal antibodies conjugated to PE or APC were used (Becton Dickinson Biosciences, San Diego, CA): CD3, CD56, CXCR1, CXCR2 and NKG2D. Cells were acquired using a FACSCalibur flow cytometers (BD Biosciences) or Acuri C6 (BD Biosciences) and analyzed.
[00121] NSG xenograft animal model
[00122] Animal experiments were performed according to protocols reviewed and approved by Institutional Animal Care and Use Committee (IACUC), the Biological Resource Centre (BRC), the Agency for Science, Technology and Research (A*STAR), Singapore. Non-obese diabetic/severe combined immuno- deficiency/IL-2RYcnull (NSG) mice (The Jackson Laboratory) were maintained and used in the current study. All luminescent signals and images were acquired and analyzed with the Xenogen living imaging software v3.2.
[00123] In vivo migration assay
[00124] To examine improved migration towards IL8-secreting ovarian cancer tumors, female NSG mice (8-10 weeks) were injected i.p with lxlO7 SKOV3-luc tumor cells. On day 10 post-tumor inoculation, tumor engraftment was confirmed by live bioluminescence
imaging. Two groups of mice were then injected via the tail vein with either 5xl06 CXCR1+ NK cells or Mock NK cells labelled with DiR (Perkin Elmer, Ohio, USA). Following NK cell infusion, mice received single dose of 20,000 IU/mouse recombinant human IL-2 intraperitoneally (i.p). Biodistribution of NK cells was examined by DIR imaging at time points of 24 and 48 hours. Peritoneal tumors were isolated after 48 hours and imaged. Photon emission was analyzed by constant region-of-interest (ROI) drawn over the tumor region and the signal measured as radiant efficiency.
[00125] In vivo therapeutic efficacy evaluation
[00126] To determine if the CXCR1 overexpression on NK cells can improve therapeutic efficacy towards ovarian peritoneal carcinomas in NSG mice, 8-10 weeks old female NSG mice were used. Mice were injected i.p. with lxlO7 SKOV3 luc cells and on day 7 post tumor inoculation, tumor engraftment was confirmed by live bioluminescence imaging (BLI) monitored using an IVIS100 Imaging platform. Mice with similar BLI signal intensity randomly divided into 3 different treatment groups containing 5 mice per group. On day 7, IOOmI of PBS or IOOmI cell suspension containing lx 107 NK cells of two different group: (1) Mock NK cells, (2) CXCR1+ NK cells was injected intravenously (i.v.). A total of four injections at the same dose were given in a 3 - 4 days interval. To prolong the longevity of NK cells in vivo, mice received dose of 20,000 IU/mouse recombinant human IL-2 intraperitoneally (i.p) every 2 - 3 days from the start of NK cell inoculation till 4 days after the last NK cell injection. Tumor progression was monitored by BLI every week up to 42 days post tumor inoculation, after which survival of mice was monitored.
[00127] To determine if the overexpression of CXCR1 in NK2GD CAR modified NK cells can improve therapeutic efficacy towards ovarian peritoneal carcinomas in NSG mice, the above described experiment was repeated with the following changes: On day 7, IOOmI of PBS or IOOmI cell suspension containing lxlO7 NK cells of two different group: (1) NKG2D CAR+ CXCR1- NK cells, (2) NKG2D CAR+ CXCR1+ NK cells was injected intravenously (i.v.). The frequency, dose and route of NK cell and IL-2 injection remain unchanged as the above described experiment. Tumor progression was monitored by BLI every week up to 42 days post tumor inoculation, after which survival of mice was monitored.
[00128] Mice were monitored closely and humanely euthanized after observing the development of moribund condition characterized by obvious abdominal bloating due to
ascites, palpable hypothermia, inability to walk, ruffled fur, hunched posture and/or lack of overt response to manipulation.
[00129] Head and neck subcutaneous animal model
[00130] To establish a head and neck subcutaneous model, 5xl06 Fadu tumour cells were subcutaneously injected in the left flank in male NSG mice (8-10 weeks). After tumours were established and palpable, NK cells (5xl06) were labelled with Xenolight DiR (Perkin Elmer, Ohio, USA) and injected via the tail vein (intravenous; i.v.) into tumor-bearing mice. Following NK cell infusion, mice received a single dose of 20,000 IU/mouse recombinant human IL-2 intraperitoneally (i.p). Bio-distribution of NK cells was examined by DIR imaging at time points indicated and using the IVIS imaging system (Xenogen). Photon emission was analyzed by constant region-of-interest (ROI) drawn over the tumour region. Subcutaneous tumours were isolated after 72 hours, respectively, and imaged again ex vivo using the IVIS imaging system. Photon emission was analyzed by constant region-of-interest (ROI) drawn over the tumour region and the signal measured as radiant efficiency.
[00131] Statistical analyses
[00132] Data are expressed as means ± standard deviation. Statistics were computed using GraphPad Prism 7.0 (GraphPad Software). For in vitro and in vivo experiments, unpaired Student’s t test was used to evaluate continuous variable of 2 groups, and 1-way ANOVA with post-test Bonferroni to evaluate continuous variables of more than 2 groups. Survival was analyzed by the Kaplan-Meier method and the log-rank (Mantel-Cox) test to compare pairs of groups. Differences were considered significant when the P value was less than 0.05. [00133] Results
[00134] Qverexpression of CXCR1 promotes NK cell tumor migration towards tumor cells in vitro
[00135] CXCR1 expression in NK cells was investigated. While the majority of freshly isolated NK cells express CXCR1, after NK cell expansion, which is necessary for clinical treatment, CXCR1 expression diminished in the ex vivo expanded primary NK cells (Fig. 2 A, B). Electroporation of NK cells with mRNA encoding CXCR1 successfully restored and elevated CXCR1 expression in the ex vivo expanded NK cells (Fig. 2C). The migration of the transfected NK cells towards three different human cancer cells was then tested. As shown in Fig. 3, the condition media generated by these cancer cells was effective to attract CXCR1 modified NK cells but not those without CXCR1 modification (mock controls),
demonstrating that CXCR1 overexpression increases the migration ability of ex vivo expanded NK cells towards cancer cells.
[00136] Qverexpression of CXCR1 promotes NK cell tumor migration towards tumor sites in vivo
[00137] It was then investigated whether the enhanced NK cell migration via overexpression of CXCR1 could be established in vivo. A human SKOV3 ovarian peritoneal carcinoma xenograft model was established in mice by intraperitoneal injection of SKOV3- luc cells, a tumor cell line genetically modified with firefly luciferase gene. Ten days after tumor inoculation, the mice were randomized based on ROI values obtained via BLI imaging and similar tumor burden was used as a criterion for randomization. The mice were then intravenously injected through tail vein with mock NK cells or CXCR1 overexpressing NK cells. The NK cells were pre-labelled with DIR dye, a lipophilic, NIR fluorescent cyanine dye ideal for staining cytoplasmic membrane. Fig. 4A shows bioluminescence imaging results: similar tumor burdens were observed in SKOV3 -inoculated NSG mice that received mock NK cells or CXCR1+ NK cells, before NK cell injection. Fig.4B addresses whether there was an increase in DIR signal at the peritoneal region of the mice inoculated with SKOV3 cancer cells. Increased DIR signals over the peritoneal region were observed in the mice receiving CXCR1+ NK cells, but not in those injected with mock NK cells. Furthermore, isolated tumors from the peritoneal cavity of sacrificed mice were studied using ex vivo imaging. Fig. 4C showed that the DIR signals of tumor tissues from the mice injected with CXCR1+ NK cells were significantly higher compared to those from the mice receiving mock NK cells. The flux value differences were statistically significant between two groups, P < 0.0001. Therefore, overexpression of CXCR1 on NK cells can improve the migration of intravenously (i.v.) injected NK cells towards peritoneal tumors.
[00138] A human head and neck cancer xenograft model was established to investigate whether overexpression of CXCR1 could enhance migration of NK cells toward subcutaneous tumor cells in vivo. The xenograft model was established by inoculating FaDu human hypopharyngeal cancer cells subcutaneously (s.c.) at the left flank of NSG mice. 10 days after tumor inoculation, NK cells were labeled with l,l’-dioctadecyl-3,3,3’,3’- tetramethylindotricarbocyanine iodide or DiOC18(7) (DiR), a lipophilic, near-infrared (NIR) fluorescent cyanine dye ideal for staining cytoplasmic membrane, and DiR-labeled NK cells were intravenously (i.v.) injected through the tail vein. Cell distribution in mice was imaged
every 24 h for 3 days. Whereas DiR fluorescence signals remained in the lung region by 24 h post-NK cell injection, enhanced DiR signals in the tumor sites were observed by 48 h in mice injected with CXCR1 expresssing NK cells, which became more pronounced by 72 h (Fig. 8A). Whole-body imaging was unable to detect DiR signals in the tumor sites in mice injected with mock NK cells during the 72-h period. The quantitative analysis of DiR fluorescence signal intensity at the tumor sites demonstrated an approximately 10-fold increase in signal intensity in mice injected with CXCR1 expresssing NK cells over those injected with mock NK cells by 48 and 72 h (Fig. 8A). Mice were euthanized after 72 h, and the subcutaneous tumors were collected for ex vivo imaging. The images of the tumors and the associated flux values are shown in Fig. 8B. Similarly, an approximately 10-fold increase in signal intensity was observed in mice injected with CXCR1 expresssing NK cells as compared to those injected with mock NK cells. Thus, overexpression of CXCR1 in NK cells can improve the migration/infiltration of i.v. -injected NK cells toward subcutaneous tumors. [00139] Qverexpression of CXCR1 increases the cancer killing capacity of NK cells in vivo
[00140] Another mouse experiment was performed to examine whether the improved migration could enhance the in vivo killing capacity of CXCR1 overexpressing NK cells against cancer cells. The same tumor model as described above was used, and the mice inoculated with SKOV3-luc cells were treated with three different ways: PBS, NK cells without CXCR1, and NK cells overexpressing CXCR1. The treatments via intravenous tail vein injection started 7 days after tumor inoculation. As shown in Fig.5A, tumor burdens were similar among the three groups of mice at day 7. However, tumor growth was slowed in mice treated with NK cells overexpressing CXCR1, as demonstrated by bioluminescence imaging. The flux value differences were analyzed statistically, and the values from mice treated with NK cells overexpressing CXCR1 were significantly lower than those from the two control groups, P < 0.05 (Fig. 5B).
[00141] Qverexpression of CXCR1 increases cancer killing capacity in NKG2D CAR-NK cells in vivo
[00142] To investigate the effect of combining a chemokine receptor and a CAR on expanded primary NK cells, mRNAs of CXCR1 and a CAR specific to NKG2D ligands was electroporated to the expanded primary NK cells. The SKOV3-luc tumor model was used again, and the mice inoculated with SKOV3-luc cells were treated via intravenous tail vein
injection with three different materials: PBS, NK cells expressing NKG2D CAR, and NK cells co-expressing NKG2D CAR and CXCR1. The treatments started 7 days after tumor inoculation. Bioluminescence imaging demonstrated that the tumor burdens in mice receiving NKG2D CAR+ CXCR1+ NK cells was obviously reduced relative to the initial tumor burdens during the course of treatment (Fig. 6A). There was a statistically significant difference in flux values over the peritoneal region (P value < 0.01) in the tumor burden between the group with NKG2D CAR+ CXCR1- NK cells and the group with NKG2D CAR+ CXCR1+ NK cells (Fig. 6B). Therefore, NKG2D CAR-modified, CXCR1 overexpressing NK cells display better anti-tumor efficacy than NKG2D CAR-modified NK cells without CXCR1 overexpression. Thus, introducing both CXCR1 and NKG2D CAR can effectively control tumor growth in an ovarian peritoneal carcinoma model.
[00143] Overexpression of CXCR1 increases cancer killing capacity in EpCAM CAR-NK cells in vitro
[00144] To demonstrate that CXCR1 modified NK cells can also be combined with a conventional CAR construct for enhancing cancer cell killing capacity, expanded primary NK cells were electroporated with mRNAs of CXCR1 and EpCAM CAR that contains a scFv for EpCAM recognition, and tested their in vitro cancer killing capacity against SKOV3, a human ovarian cancer cell line known to express EpCAM. As shown in Figure 7, the modified NK cells showed an improved in vitro killing capacity against SKOV3 cancer cells over mock-control NK cells, demonstrating that CXCR1 incorporation is compatible with EpCAM CAR, and the potential of CXCR1 modified CAR NK cells to eliminate tumors expressing targets other than NKG2D ligands. Therefore, a conventional CAR with a scFv fragment of a monoclonal antibody (in this case an anti-EpCAM monoclonal antibody) can also be used in CXCR1 overexpressed NK cells for NK cell-mediated anticancer immunotherapy.
Claims
1. A natural killer (NK) cell genetically modified to comprise a recombinant nucleic acid encoding C-X-C Motif Chemokine Receptor 1 (CXCR1).
2. The NK cell of claim 1, further genetically modified to express a recombinant chimeric antigen receptor (CAR) comprising an intracellular signaling domain, a transmembrane domain, and an extracellular domain comprising an antigen binding region.
3. The NK cell of claim 2, wherein the intracellular signaling domain comprises at least one immunoreceptor tyrosine based activation motif (IT AM) -containing domain.
4. The NK cell of claim 2 or 3, wherein the intracellular signaling domain is CD3z.
5. The NK cell of any one of claims 2 to 4, wherein the transmembrane domain is CD8 transmembrane domain.
6. The NK cell of any one of claims 2 to 5, wherein the antigen binding region binds a tumor associated antigen.
7. The NK cell of claim 6, wherein the tumor associated antigen is solid tumor associated antigen.
8. The NK cell of any one of claims 2 to 7, wherein the extracellular domain of the recombinant CAR comprises the extracellular domain of an NK cell activating receptor or a scFv fragment of a monoclonal antibody.
9. The NK cell of any one of claims 2 to 8, wherein the extracellular domain of the recombinant CAR comprises the extracellular domain of an NKG2D receptor or a scFv fragment of an anti-EPCAM monoclonal antibody.
10. The NK cell of any one of claims 2 to 9, wherein the recombinant CAR further comprises, between the antigen binding region and the transmembrane region, a hinge region.
11. The NK cell of claim 10, wherein the hinge region is a CD8 hinge region.
12. A pharmaceutical composition comprising a pharmaceutically effective amount of the NK cell of any one of claims 1 to 11 and a pharmaceutically acceptable excipient.
13. A method of treating cancer or tumor in a subject in need thereof, comprising administering to the subject a pharmaceutically effective amount of the NK cell of any one of claims 1 to 11, or the pharmaceutical composition of claim 12.
14. The method of claim 13, wherein the NK cells are derived from allogeneic or autologous cells.
15. The method of claim 13 or 14, wherein the NK cells are derived from peripheral blood, cord blood, bone marrow, or induced pluripotent stem cells.
16. A method of treating cancer or tumor in a subject in need thereof, the method comprises:
(i) obtaining NK cells from the subject, or from a donor which is different from the subject to be treated;
(ii) providing a recombinant nucleic acid encoding CXCR1;
(iii) transferring the recombinant nucleic acid encoding CXCR1 into the NK cell to obtain genetically modified NK cells; and
(iv) administering to the subject a pharmaceutically effective amount of the NK cells obtained from (iii).
17. A method of treating cancer or tumor in a subject in need thereof, the method comprises:
(i) obtaining NK cells from the subject, or from a donor which is different from the subject to be treated;
(ii) providing a recombinant nucleic acid encoding CXCR1 and a recombinant nucleic acid encoding a recombinant chimeric antigen receptor (CAR);
(iii) transferring the recombinant nucleic acid encoding CXCR1 and the recombinant nucleic acid encoding the recombinant CAR into the NK cell to obtain genetically modified NK cells; and
(iv) administering to the subject a pharmaceutically effective amount of the NK cells obtained from (iii).
18. The method of any one of claims 13 to 17, wherein cancer or tumor is a solid tumor.
19. A method of preparing the NK cell of claim 1, the method comprises: (i) obtaining or providing NK cells;
(ii) providing a recombinant nucleic acid encoding CXCR1; and
(iii) transferring the recombinant nucleic acid encoding CXCR1 into the NK cell.
20. A method of preparing the NK cell of claim 2, the method comprises: (i) obtaining or providing NK cells;
(ii) providing a recombinant nucleic acid encoding CXCR1 and a recombinant nucleic acid encoding the recombinant CAR; and
(iii) transferring the recombinant nucleic acid encoding CXCR1 and the recombinant nucleic acid encoding the recombinant CAR into the NK cell.
21. The method of claim 19 or 20, wherein transferring the recombinant nucleic acid(s) in step (iii) is carried out using electroporation.
Priority Applications (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP20851132.9A EP4010464A4 (en) | 2019-08-08 | 2020-08-11 | Genetically modified nk cells and uses thereof |
US17/632,877 US20220273719A1 (en) | 2019-08-08 | 2020-08-11 | Genetically modified nk cells and uses thereof |
CN202080069201.0A CN114502724B (en) | 2019-08-08 | 2020-08-11 | Genetically modified NK cells and uses thereof |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
SG10201907378Q | 2019-08-08 | ||
SG10201907378QA SG10201907378QA (en) | 2019-08-08 | 2019-08-08 | Genetically modified nk cells and uses thereof |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2021025626A1 true WO2021025626A1 (en) | 2021-02-11 |
Family
ID=74504310
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/SG2020/050463 WO2021025626A1 (en) | 2019-08-08 | 2020-08-11 | Genetically modified nk cells and uses thereof |
Country Status (5)
Country | Link |
---|---|
US (1) | US20220273719A1 (en) |
EP (1) | EP4010464A4 (en) |
CN (1) | CN114502724B (en) |
SG (1) | SG10201907378QA (en) |
WO (1) | WO2021025626A1 (en) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN117599213A (en) * | 2023-11-03 | 2024-02-27 | 广东莱恩医药研究院有限公司 | DiR-marked immune cell injection, preparation method thereof and application thereof in tracing biological distribution of cell therapy products |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2018056736A1 (en) * | 2016-09-23 | 2018-03-29 | 주식회사 에스엘바이젠 | Novel natural killer cell line and use thereof |
WO2019113132A1 (en) * | 2017-12-05 | 2019-06-13 | Caribou Biosciences, Inc. | Modified lymphocytes |
Family Cites Families (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN109328074A (en) * | 2016-04-01 | 2019-02-12 | 凯德药业股份有限公司 | Chimeric antigen and T cell receptor and the method used |
MX2019011514A (en) * | 2017-03-27 | 2020-01-27 | Nat Univ Singapore | Truncated nkg2d chimeric receptors and uses thereof in natural killer cell immunotherapy. |
WO2019051047A1 (en) * | 2017-09-07 | 2019-03-14 | University Of Florida Research Foundation, Inc. | Chimeric antigen receptor t-cells expressing interleukin-8 receptor |
WO2019090355A1 (en) * | 2017-11-06 | 2019-05-09 | Children's National Medical Center | Cells expressing antibodies and methods of treatment using the same |
-
2019
- 2019-08-08 SG SG10201907378QA patent/SG10201907378QA/en unknown
-
2020
- 2020-08-11 EP EP20851132.9A patent/EP4010464A4/en not_active Withdrawn
- 2020-08-11 CN CN202080069201.0A patent/CN114502724B/en active Active
- 2020-08-11 US US17/632,877 patent/US20220273719A1/en active Pending
- 2020-08-11 WO PCT/SG2020/050463 patent/WO2021025626A1/en unknown
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2018056736A1 (en) * | 2016-09-23 | 2018-03-29 | 주식회사 에스엘바이젠 | Novel natural killer cell line and use thereof |
WO2019113132A1 (en) * | 2017-12-05 | 2019-06-13 | Caribou Biosciences, Inc. | Modified lymphocytes |
Non-Patent Citations (1)
Title |
---|
See also references of EP4010464A4 * |
Also Published As
Publication number | Publication date |
---|---|
EP4010464A4 (en) | 2023-08-30 |
EP4010464A1 (en) | 2022-06-15 |
US20220273719A1 (en) | 2022-09-01 |
CN114502724A (en) | 2022-05-13 |
CN114502724B (en) | 2024-06-11 |
SG10201907378QA (en) | 2021-03-30 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11274298B2 (en) | RNA engineered T cells for the treatment of cancer | |
US20140120136A1 (en) | Mir-155 enhancement of cd8+ t cell immunity | |
US11673964B2 (en) | Use of CD2/5/7 knock-out anti-CD2/5/7 chimeric antigen receptor T cells against T cell lymphomas and leukemias | |
US20200254086A1 (en) | Efficacious mrna vaccines | |
AU2024200425A1 (en) | Cancer vaccines | |
CA3036713A1 (en) | Hla class i-deficient nk-92 cells with decreased immunogenicity | |
KR20200075000A (en) | CRISPR-CAS9 editing method, composition and components of TGFBR2 in T cells for immunotherapy | |
WO2006073625A2 (en) | Inhibition of li expression in mammalian cells | |
US20220242929A1 (en) | Immune cells expressing modified cell receptors and methods of making | |
US20220273719A1 (en) | Genetically modified nk cells and uses thereof | |
WO2021045693A1 (en) | T cell modified with a synthetic receptor containing a single itam signaling motif | |
KR20220017887A (en) | Generation of Chimeric Antigen Receptor (CAR)-Primary NK Cells for Cancer Immunotherapy Using Combination of CAS9/RNP and AAV Virus | |
WO2021071431A1 (en) | Genetically modified t cells and uses thereof | |
EP4279085A1 (en) | Compositions and methods for treating a refractory or relapsed cancer or a chronic infectious disease | |
US20090060889A1 (en) | Ii-RNAi involved Ii suppression in cancer immunotherapy | |
US20240228655A1 (en) | Use of CD2/5/7 Knock-Out Anti-CD2/5/7 Chimeric Antigen Receptor T cells Against T Cell Lymphomas and Leukemias | |
WO2023139269A1 (en) | Modulation of suv39h1 expression by rnas | |
WO2024015988A1 (en) | Il-9r signaling compositions and method | |
Pulakkat et al. | Immunogene Therapy in Cancer | |
CN118222533A (en) | System for inserting large fragment DNA into genome | |
Trojan et al. | Experimental and clinical anti–gene anti IGF-I therapy | |
WO2024124244A1 (en) | Cd38 as integration site for enhanced function of gene-modified immune cells | |
EP4384280A1 (en) | Engineered soluble decoy receptors to enhance cancer immunotherapy | |
WO2023081767A1 (en) | Methods for immunotherapy | |
WO2023178348A1 (en) | Genetically engineered t-cell co-receptors and methods of use thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20851132 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2020851132 Country of ref document: EP Effective date: 20220309 |